4HEA2

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 45
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hea201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hea202
2H0IA 1R5AA 2HRFA 1BJXA 4EF0A 1EV4A 1G0TA 1M7TA 2VCXA 1OYJA 2HZEA 1Z5YE 4X43A 3HVVA 2HRNA 2FA4A 2WDUA 20GSA 1GULA 2H66A 2NTOA 2O87A 2R6KA 5HFIA 1THXA 1GTAA 1AIUA 3H8QA 2LV3A 2BMXA 5AGYA 1X9MB 3IC4A 2RLIA 3CTGA 3TRXA 1J0FA 2OADA 12GSA 3ME8A 2L6DA 1ZYQB 4EDYA 2C80A 10GSA 3RPNA 1RQMA 2VAFA 1VF2A 2PU9C 2JZSA 4IP1A 1FVJA 4EKZA 2ALBA 4KAEA 3RPPA 2VCZA 3TKQA 3ZFLA 3MAKA 2H74A 4ISDA 1PD21 2I4AA 2FA8A 3GUSA 3VWUA 2H6ZA 3C71A 2YN1A 1SL2B 3KH7A 2OE1A 3GTUA 1WIKA 4WETA 1WPIA 3QD9A 2VM2A 5J41A 5J9CA 1ZGNA 5CNWA 4IVFA 2C0EA 4GSTA 5D8IA 4JU5A 1M2BA 4IBPA 3EC3A 3Q19A 4IW9A 2GTUA 2L5LA 2H0GA 3U5RE 2CAIA 3JCML 2DJKA 5G5EA 4KUNA 17GSA 3HXSA 1XOAA 3D22A 4JEDA 1X9WB 1AQVA 4L5LA 2V2GA 3ZMLA 4MJEA 1JZWA 3DWVA 5IPHA 3UL3A 1R4WA 1Z6MA 3NOFA 1YQ1A 4F0CA 4XTSA 3DMLA 3F4RA 1B4PA 5HQPA 3V1WA 2JSYA 3LFLA 4JR4A 3UMAA 4IKHA 3QFAC 1GSFA 2YOIA 1GSEA 1T00A 2ON7A 3HVSA 4GTUA 2HYXA 2FWGA 3MNGA 3TGZA 3L78A 2F3MA 2XBQA 2VL2A 1PL2A 1F2EA 3GIXA 3GKNA 1K0BA 5JCWA 5CREA 1VF4A 2XBIA 1SYRA 2H76A 4XS6A 5EVOA 5D93A 5ID2B 4MK3A 3LQ7A 4TR1B 4ULXA 1LU4A 4I5QA 1R5PA 4N11A 4Z7XA 3ZMKA 5DCGA 3VI7A 1HYUA 2E0QA 4IQ1A 5C04A 3DXBA 2DJ1A 1OKTA 2HT9A 3F4TA 3C8EA 4JRRA 1ERUA 3IDVA 5D96A 3UARA 3GNJA 2HE3A 3CSHA 3IK7A 1SKSB 1VF3A 3TCOA 1V98A 2C4JA 3CMIA 3CRUA 2KP1A 4RQRA 2H72A 2WS2A 4AGSA 1G7OA 5JCUA 2FCHA 3HD5A 3ERWA 1OAZA 4ZIJA 3VWWA 4GWRA 3CYNA 1XVQA 4WF4A 2GQMA 2TRXA 4PNGA 2OKAA 3W8JA 3TOTA 4IGJA 2E2GA 4YAVA 3ZVJA 3TJGA 5HR2A 5H5SA 2IJYA 3ZRDA 4ECJA 3VPTA 2O85A 4NV5A 1USBA 4KW6A 1FB0A 1XBSA 5F05A 3N9JA 1ABAA 3H93A 3ZZXA 1O7UA 4JE1A 4KSOA 4V1Ap 5IMVA 4HU7A 3HDCA 5J4UA 1DUGA 2PN8A 4I8BA 3TDGA 2PUKC 5IMZA 4MZWA 3A2XA 3KIJA 1AUCA 2C3TA 2F9SA 3EMPA 2I1UA 3DD3A 5L71A 5J3RA 1K0DA 4ZL8A 4POBA 4PX1A 4MH2A 4G19A 4PUFC 1SJIA 2IN3A 2IL3A 3IR4A 2NDOA 1SYXA 3CRTA 1M2DA 1XW5A 2RUFA 1PRXA 1O8WA 3CBUA 1ON4A 3PR8A 4POMA 5INYA 4K6XA 3C1SA 3ZREA 1WWJA 4ZB9A 4XIHA 18GSA 4GQFA 2IWTA 2LTKA 1W89A 3EURA 2LQOA 4AF2A 1M99A 5HR3A 5KN3A 4L8EA 4IHUA 3KEBA 4Q5RA 1TI3A 1LBKA 1XPVA 2AAWA 1XWBA 3IOSA 3U6VA 3D4TA 1JHBA 4KCAA 2VLTA 2DBCA 3ED3A 3ZYWA 1OKDA 5B6NA 1TRUA 5DALA 2H70A 4FH8A 1XWKA 3UVHA 1XCCA 4ML6A 2GT6A 4PUAA 3WD6A 3HYPA 2Z9SA 4OO4A 2V32A 1TK8B 2YJHA 3WYWA 1GP1A 4EC0A 4DSSB 3QMXA 1A2JA 3TB2A 1GTUA 2CV4A 3O3TA 1T8EB 1SU9A 2F8FA 2F8AA 5EL8A 2P5RA 2H1GA 5ECLB 5DAKB 4MCUA 3IE3A 2L59A 2QSIA 4ID0A 1PX6A 2GSQA 6GSYA 2YV9A 5C00A 1TW9A 3HCZA 2LSTA 3EVIA 5CRGA 2REMA 1F6MC 1JZDA 5LD0A 3UBLA 1EWXA 3F6DA 1I9DA 4IQAA 2N5AA 4K0GA 1EP7A 4FO5A 1V9WA 3LWAA 4TXOA 3HZ8A 1GL8A 1OC9B 4H86A 3DEXA 2MMOA 1Z7RA 1YKCA 4KDUA 4NHZA 3QAVA 1X9SB 1KTEA 2FLSA 2IMEA 4WR4A 3HVXA 13GSA 3L9SA 3WGEA 4J2FA 2A2SA 3LSZA 4Q5QA 4XS4A 1GH2A 1T4ZA 3R2QA 4QQ7A 1F3BA 4BA7A 1TXXA 1YF1A 4JZQA 4KH7A 2WRTA 4HU9A 4XRAA 5B8AA 3FZ5A 5CRWA 4TRXA 5AN1A 4ACSA 1FOVA 3APSA 1F37A 4YAPA 1QQ2A 3DYRA 5HFGA 2YP6A 5F0GA 1ERVA 1JLWA 3I43A 2IIYA 1PMTA 1XFLA 1H4OA 2MYGA 1PA3A 2IFQA 4TR3A 3AY8A 4L5OA 3W8SA 3KMOA 4ZB6A 2M46A 1U87A 3BD2A 4FIWA 2YWMA 5JWOB 3FZ4A 5IOXA 4KE3A 1UA5A 2BJXA 1GSUA 1H75A 1S3DA 2C0DA 1K3OA 4J57E 3GH6A 7GSSA 4MJAA 4KGIA 3KD0A 3VK9A 3PINA 2CVDA 2JZRA 4HDEA 1ERWA 1FO5A 4ZL7A 1NM3A 2ON5A 2EIRA 5AISA 4NV2A 2LJRA 2PWJA 3IPZA 2DMMA 1GLPA 3FZAA 1VRSD 5F06A 1G6YA 3VWVA 1CQGA 4MLYA 5KN1A 2H6YA 3KJYA 4MJCA 3RAZA 5IMFA 1YDKA 3VURA 2B1LA 2NPBA 3QAWA 4F9ZA 1MEKA 4NHWA 1HNAA 1AQXA 2V1MA 2VIMA 2ZUPA 2O8VB 2P5QA 3GKXA 1CQHA 2YWOA 3ZL5A 3ZFBA 5B7CA 2JL4A 2RM5A 1WE0A 2B5EA 5G2ZA 1WJKA 2GVPA 1ACVA 2GSTA 3GL3A 4O92A 4PQ1A 1FAAA 2VD1A 3HKRA 1N8JA 4QL9A 1XWAA 2OE3A 1U3IA 3K8NA 3UBKA 1S3CA 1GLQA 1R26A 2C1YA 4HZ4A 2WGRA 4GF0A 5CRDA 2VCTA 5LCZA 4BWQA 4PQHA 2OACA 2PPTA 2CVBA 5D9TA 3P2AA 3QCPA 6GSXA 3ME7A 1ZZYA 3QPMA 2PVQA 3RHCA 3GURA 1ZOFA 4IELA 3GTUB 5H5RA 3O6TA 4CDOA 2GS3A 3BBYA 3CXGA 5ECQB 5ECOB 1X0RA 4XS1A 1GUKA 4K1FA 5G30A 4V2MA 4MF5A 5IO2A 2OE0A 1JZRA 5G5FA 1ST9A 1SKRB 2H75A 2IMFA 3KH9A 4BWSA 1XOBA 6GSVA 2LJAA 3FHKA 5ECHB 4I97A 1EEMA 1AW9A 5G31A 5D73A 5DBQA 4OCFA 4KB3A 3FW2A 5GSTA 2R5GA 4OFNA 3KGKA 1F9MA 1SENA 3C73A 3QR6A 3QFBC 2DC5A 4ECIA 1EZKA 2R37A 5KN0A 11GSA 4O32A 2OA7A 5E4WA 4G2EA 4L0UA 1TKDB 1PSQA 4IJ3A 1MTCA 1EGRA 1QXHA 2L57A 4KDYA 4ZILA 1M9BA 1GNWA 1C72A 2HXKA 2DSAA 5ID2A 5A5KA 2B5YA 3J7Yk 2FD3A 4OCEA 3IHQA 2YZUA 4J56E 14GSA 2CT6A 2VLVA 3ZTLA 3TKSC 3D5JA 2CVKA 4GLTA 2RM6A 1K0AA 2YPMA 3TKSE 1X5DA 3HA9A 4CHSA 1HQOA 3P7XA 3A5WA 3ZIJA 1PX7A 3GN3A 3FK8A 4KSMA 4L0WA 1SJZA 3A2VA 1F3AA 2DJ0A 4IP6A 1GSYA 2L4CA 5CO3A 2VL3A 3BJ5A 3EU3A 2FUG2 3HJMA 1MDIA 4BL7A 1S3AA 1XZOA 2ZNMA 4N0ZA 2VM1A 4D73A 3RBTA 3GRXA 2YNXA 1TP9A 5EY6A 2AYTA 4NWYA 1PKZA 4ZB8A 22GSA 3F3QA 5A4UA 1Z9HA 4KA0A 1GSDA 4ECBA 3IBHA 5IPGA 2N5BA 5FHIA 4E8EA 1KNGA 2IPAA 3D4MA 3CTFA 1ZL9A 5JCGA 4EO3A 2DJ3A 4PURA 2K8VA 1YJ6A 5IMAA 1G7EA 4NXIA 3TRQA 3TRPA 1SL1B 1FHEA 3LJRA 2C3NA 4Q5FA 5JWRB 1A2MA 1BX9A 2QKEA 3TOUA 3LXZA 2E2MA 3QAGA 3UJ1A 3MWHA 3DRNA 3BOAA 1RW1A 2P0GA 4TR4A 1URMA 1OE7A 4HJMA 2TIRA 3WGXA 4MABA 2XC2A 1DE1A 4ECCA 1AC1A 1E6BA 1JZOA 4F0BA 1FG4A 3GX8A 2A4VA 1SK0A 5CP1A 3VFIA 3NIVA 5DVBA 1SKWB 3IXRA 2LNTA 4K8MA 3L9VA 2OBKA 3TJFA 4CW9A 3GMFA 2DLXA 2JSZA 4GRFA 5J9BA 2H1AA 2VCWA 5HR0A 2D2ZA 3FYGA 2YWNA 1AXDA 3M9JA 1XWGA 1K0MA 4KCEA 1BQ7A 2CQ9A 2R2JA 1T4YA 3GV1A 2AHEA 1QGVA 1Z6NA 1Z3EA 1NSWA 1Q4JA 3I6AA 3LG6A 4HJ2A 5A4VA 2I9HA 2WB9A 3IV4A 5JWQB 5ECRB 3E3EA 5DALB 3HHVA 2KP2A 4HZ2A 4BVYA 2NBSA 5CAXA 3I9V2 2H1DA 3DKSA 2AB6A 2MMNA 3ZIVA 1K0CA 3LYPA 1GSSA 2FWFA 3L4NA 2YJ7A 2L4QA 3E9JB 3DIEA 4K7NA 2MZCA 2DJ2A 4ZL9A 3F6FA 2C0GA 2WJUA 2G0FA 2F51A 5DAKA 4MPFA 2AV4A 1AQWA 4MF6A 2A2RA 4IJIA 4EL1A 1ZYEA 1MDJA 3M8NA 3FR6A 3F4SA 2CAQA 3M0FA 4ZBAA 4K9ZA 3VLNA 2ES7A 3EU4A 1TRVA 4WBRD 5EPFA 1WP0A 3F0IA 3GX0A 2K9FA 2HZFA 2LJKA 4G9HA 3IAS2 2CZ3A 4PQIA 3HJPA 1TI1A 5IOWA 3ERGA 1OC9A 4PGTA 3IRAA 4KNDA 4ZBBA 4BVXA 4EDZA 1BEDA 1Y25A 4JBBA 2H6XA 2H0HA 1SD9A 4PNFA 3UOMA 4GXZA 4YQVA 5DCHA 2ZCTA 4OD7A 1M9AA 2YANA 2X99A 3BCKA 4XS4B 3C7MA 3HZ4A 3A3TA 1EV9A 1ERTA 5KN2A 3VWXA 2VUPA 4K7OA 4HQSA 1A0RP 1XW9A 2PBJA 1TJDA 4GSNA 1A23A 2LRCA 1KEBA 2WFCA 1X5CA 4OFTA 3RDWA 5D9VA 3LGCA 4POLA 1NW2A 5CYYA 2IFQB 3KM6A 4ILFA 4V1Ag 3M1GA 4MDCA 1TU7A 3TKPA 1SK1A 4EUYA 3GKKA 1XW6A 5E59A 2KOKA 4O5RA 1J9BA 2M80A 2GT5A 4XHMA 4OO5A 1JLVA 3KP8A 2FGXA 1XWCA 2FWHA 2TRCP 1HNBA 2O89A 2FNOA 2IMDA 3D0ZA 1B9YC 1OVNA 3F9UA 3GSTA 4I2UA 3IA1A 5AIVA 4DSRA 2GSRA 2H71A 2I81A 1FVKA 2K18A 3G7IA 2G2QA 4RI6A 1JFUA 5ECNB 2B1KA 1BAYA 1SK2A 1GTIA 3LXTA 1SL0B 2JADA 4V2LA 4TKYA 3FR9A 3WGDA 2GDRA 4HOJA 3G9BA 3KCMA 5IMDA 1DSBA 2HZEB 5ECSA 3F63A 1N2AA 2RUEA 5ABRA 4MZBA 5DQYA 1EP8A 5ECKB 3GKMA 4HUAA 2AUVA 3SBCA 1DE2A 5LNKe 2H1BA 3TUEA 3ZITA 2PERA 4FYCA 4TOPA 3UVTA 1YEPA 4DSQA 2H19A 1WRYA 3GH9A 3MSZA 4F03A 1WOUA 4WKWA 2RIIA 2DIZA 3G7JA 3GSSA 1O81A 2VL9A 4ML1A 3CSJA 2FHEA 4N0VA 3FZ9A 3DVWA 1QK8A 2OBIA 2WULA 4OMVA 4YQMA 3W6GA 1A8YA 1GWCA 2HSHA 3CSIA 4HI7A 2LRTA 1ML6A 4AJ8A 2XPDA 2YCDA 1Z7PA 3US3A 4LL1B 4I2TA 1NHOA 1AAZA 2X8CA 1TK0B 3VPQA 1M2AA 3EYTA 3SWLA 2FWEA 3BCIA 4HEA2 1XIYA 4MPGA 3D6IA 2CZ2A 2HNLA 5G1LA 2MBSA 3EWLA 2LUSA 2L6CA 3TKRA 4G10A 2LRNA 2HSYA 2CA8A 5B6MA 2X64A 1UVZA 1EGOA 2PVOC 2V41A 1Y6EA 6GSWA 2E7PA 3APOA 4X1UA 5ECMB 1I5GA 3KP9A 2R4VA 8GSSA 4JR6A 4IN0A 1KBNA 2H73A 1TU8A 1K3YA 1YEXA 5D9WA 4EE0A 2KHPA 3L9UA 4TVEA 3DGQA 5IMCA 1PGTA 5DJLA 4LMVA 2DMLA 1ZMAA 3KTBA 1GNEA 2GZZA 3VI5A 1WMJA 3ZVJD 3NZNA 3KTLA 2VCQA 4KDXA 3F8UA 4MZCA 4DEJA 1A0FA 4EVMA 2JZTA 2QC7A 2VL2C 5B8BA 4KX4A 3UIWA 2H8LA 4MA9A 3IAM2 1X5EA 2KUCA 5J5NA 1DBYA 4XRDA 2NVLA 2FY6A 4P3YB 1QMVA 1EOHA 1TOFA 4NPBA 1YKAA 3M9KA 2JU5A 2EC4A 4TR1A 2KLXA 1YF0A 3FKFA 3HJOA 4IS0A 4TXVA 4V2NA 4MMMA 3L0HA 1XVWA 3PGTA 4FYUA 3F3RA 1OC3A 1J08A 3ERFA 2B3SA 1GTBA 3LORA 1NHYA 1V2AA 1V57A 1O85A 4XCSA 2H01A 4POKA 1U3AA 2JACA 2GLRA 4F2IA 4I6XA 2X8HA 3UEMA 2GGTA 2GSSA 3TKSA 3WT2A 4E8HA 1A24A 3EE2A 1TRWA 1U88A 2PMTA 3OR5A 3E0UA 2QGVA 4RUVA 4D73B 3MDKA 3P8WA 1XXUA 3ZLPA 5A4WA 4BPYA 2WZ9A 2GQLA 2M72A 3O76A 5ECPB 5ELGA 5IIZA 4DVCA 4MJBA 4RQXA 3A2WA 4AJ6A 4QL7A 1BYEA 4MP4A 3I69A 16GSA 19GSA 4LL4B 1ILOA 2XPEA 2WCIA 5H5QA 3TJBA 1HNCA 3QDNA 2MMZA 4WXTA 4HQZA 3D21A 3KMNA 2K6VA 1B48A 3EMXA 5FT3A 3Q6OA 2P31A 3M3MA 2VOCA 5ECIB 1HD2A 1B8XA 1G6WA 2VO4A 3FRCA 2CX3A 4YQUA 1K0OA 4GQCA 1A8LA 1MD3A 1FW1A 4TR0A 3GA4A 3LEFA 1V40A 5ELAA 2J23A 1PL1A 4HS1A 2GZYA 2LNSA 2C3QA 1V58A 1MD4A 1QFNA 1A2LA 2C8UA 2YZHA 4Q5NA 1SJ6A 1TTZA 1T7PB 2CX4A 5D9XA 2HI7A 1K3LA 2YWIA 2LQQA 4K2DA 3HY2A 4NAXA 1B4QA 4O7HA 3J7Yb 3H4KA 1TRSA 3G7YA 2MBTA 1RK4A 5AIXA 4OFMA 4N10A 2B7KA 3KXOA 3TJJA 2LEGA 5GAND 2VLUA 2VCVA 4WR5A 2BTOT 3N5OA 1O8XA 4WEYA 1TK5B 1T3BA 1VGLA 3Q18A 5COHA 1T1VA 3QOUA 1IYIA 4DSSA 4WF5A 3LYKA 2L5OA 5HR1A 1PKWA 1GSQA 3DVXA 2V6OA 4ZBDA 2HLSA 2EIQA 1OE8A 2C0FA 1UC7A 4MH3A 2DJJA 3UAPA 3TJKA 2XHFA 1TDIA 3P90A 5CRHA 2B5XA 4FYBA 1UN2A 3IK9A 3APQA 5DDLA 1M0UA 2AJQB 4WBJA 1ZCPA 2O7KA 1GUMA 3FY7A 2OJLA 1PN9A 1K0NA 4TXOB 4F82A 3GL5A 4X0XA 5GAPD 3ISOA 2IMIA 1O73A 5GSSA 4GSSA 5HFKA 2B7JA 2PGTA 5ENUA 1QUWA 5IO0A 5GZZB 1MDKA 1BG5A 1LJRA 3RHBA 2DIYA 5F8BA 3Q74A 6GSUA 3GFKA 3PH9A 4YH2A 2H30A 3S9FA 4LMWA 1W4VA 3GYKA 5G1KA 2LKUA 5FWGA 3FEUA 3GHAA 4TW5A 5DJMA 2K8SA 3EINA 5IM9A 4OWYA 3KZQA 5F07A 2R3XA 2X8GA 1U6TA 2MMAA 1PQNA 4K7IA 4MF7A 4N30A 2IMKA 1EEJA 2VD0A 4ZXGA 2HFDA 1E2YA 2B6MA 2J9HA 1IYHA 1FB6A 4K0NA 4AJ7A 2V6KA 2LS5A 4GCIA 5DQSA 3FR3A 6GSTA 5IQYA 5KEJA 3H79A 2GQKA 9GSSA 1VF1A 1OC8A 1GUHA 1O6JA 4PXOA 2EIOA 3WT1A 4LLRA 2GZPA 4EXJA 1B9XC 1YY7A 1SD8A 1Q98A 4LA1A 4TN8A 2N5FA 2I3YA 1R7HA 1THOA 3C1RA 4RI7A 2YV7A 6GSSA 1YZXA 3H1NA 1GRXA 1EOGA 4NMUA
chains in the Genus database with same CATH superfamily
2H0IA 1RUNA 1R5AA 2HRFA 1WJDA 1BOBA 1IRGA 3HUGB 4G7HF 1BJXA 4EF0A 1EV4A 3DVXA 1G0TA 1M7TA 2XAFA 3X2QH 5DM6F 2VCXA 3U1DA 3KYCB 2PBIA 3K4MA 2OCEA 2HVRA 3HTSB 5J8FA 1OYJA 1ZELA 2WAFA 3D5SC 1ZG1A 3ULQB 2HZEA 1Z5YE 4X43A 3HVVA 2HRNA 2FA4A 3BQYA 1IAWA 1NHAA 2WDUA 1YJNI 3RSNA 4PJNA 1W5SA 1GULA 20GSA 2H66A 4N4NB 2VOOA 2NTOA 2IBDA 2CQNA 2DT6A 3KYLA 1I50J 5DEQA 4KMFA 3V42A 3A01B 2DYSH 2X6YA 2A6TA 3BTJA 5F64A 3TOAA 2A6HF 3NRVA 4CXFA 1X4OA 1GTAA 2JJ7A 1THXA 1M3IA 2R6KA 1S3RA 2PMHA 4JBBA 3R3EA 3FHZA 2GOMA 4KISA 1AIUA 1X3ZB 3H8QA 3NARA 5E17F 2LV3A 3WGIA 2HGCA 2GIZA 3QP6A 5GTHC 1I1GA 5DM7F 4HLYA 3O6BB 3BZKA 2BMXA 5AGYA 1X9MB 4LK0F 2NS0A 3IC4A 2RLIA 3BOQA 3CTGA 3TRXA 5FO5A 3KZZA 1CF7A 2OADA 1J0FA 12GSA 3ME8A 1WH5A 3BR2A 1JTXA 2ELKA 2R7RA 2FU4A 2L6DA 1ZYQB 4EDYA 1XSXA 5J1UA 4XBFA 5KOWA 4K5SA 5E20A 1U9OA 3DEWA 2C80A 1UAAA 4UHTA 3RPNA 10GSA 1RQMA 2VAFA 5ICGA 2FA5A 3J7AO 4B4CA 3HOXJ 1VF2A 1IRFA 4IO9F 3J7AY 2PU9C 2KDOA 2LF7A 4O5UA 5CKTA 2JZSA 1YJ9I 5DCMB 3QP5A 3JR9A 4IOCF 4E70A 4IZZA 4IP1A 3SDBA 1EV7A 4EJWA 4G8XA 2XC7A 2IT0A 1FVJA 3FISA 3R0AA 4EKZA 5GTIC 3J80Z 2ALBA 3F8FA 2N8GA 2YX7A 1J75A 4KAEA 3RPPA 3FKJA 4I09A 1Y0NA 1TWHJ 2DBBA 2XGEA 3GZ5A 4J19A 2VCZA 2KRFA 2O6GE 2OTJI 3TKQA 3ZFLA 3MAKA 2H74A 4ISDA 4YELA 4A6DA 1PD21 3VPRA 4CYDA 1TP4A 4FE7A 1UG2A 4UVCA 4Y33A 4EATA 5LEKA 2CW8A 5LBQA 3ZQFA 1YFHA 4HNVA 2FA8A 4N9IA 3GUSA 4FHTA 3VWUA 2H6ZA 2Y9YA 3LA2A 2EB7A 3DV8A 1G2HA 1F9NA 5CVJA 3WHCA 2YN1A 3C71A 2DA6A 4DBQA 1SL2B 1MJAA 1Z7LA 3KH7A 1MZBA 4MFEA 2OE1A 1FOKA 4A3IJ 4V2FA 4A0YA 5HNHA 3GTUA 4BKXA 2XAQA 2ZXWH 4PFOA 2CW7A 3DU5A 1WIKA 3TP3A 4WETA 1IF1A 1WPIA 2DT5A 3OYIA 1FBQA 3QD9A 1O7FA 1SMYF 2VM2A 5J41A 5FRMA 3ZMDA 1XGOA 5J9CA 5LFAA 1ZGNA 3R61A 1LFPA 5CNWA 2CQ7A 3A0HC 3GCMA 1BR1A 4UXNA 2VN2A 1FTTA 1VQNI 2C0EA 5D4RA 4GSTA 4IVFA 4JU5A 5D8IA 1I6HJ 4F52A 2P6SA 4BXUA 1M2BA 4KNYA 1R5GA 5LGTA 3EC3A 3Q19A 4IBPA 4IW9A 3LOCA 5KAFC 1FYMA 2GTUA 2WV1A 2LKSA 2NAZA 5AONA 1YRNB 2L5LA 5HNFA 1FP2A 2O5RA 2VKEA 1AOYA 1J59A 1SMTA 2H0GA 3U5RE 2QVOA 5FKOA 1BN5A 3HJEA 2CAIA 3JCML 1X3UA 3BPXA 3J7ZI 5IY5H 2G9WA 2X9DA 2DJKA 5G5EA 4KUNA 3HBLA 1B6AA 4UUSB 4JQFA 4N4OB 3JRHA 1GXPA 1VQ6I 17GSA 1XOAA 3D22A 5D5UB 3PIPF 5EYRA 2GM4A 3ABUA 1X9WB 3CP8A 1AQVA 4L5LA 2V2GA 4LD5A 1DPRA 3KLNA 4MJEA 3ZMLA 1ZG5A 1JZWA 3DWVA 5IPHA 2H6CA 1H9TA 1MMGA 4GYIA 3UL3A 2FBKA 1R4WA 4P1WA 2R3SA 2GXAA 1Z6MA 3TQNA 1ETYA 2LOOA 3NOFA 3F21A 3E6BA 2R5ZA 2HEOA 1YQ1A 4F0CA 3G71I 5ILVA 4XTSA 3PNTA 4F7ZA 3TP0A 3DMLA 3F4RA 1RKTA 1TNSA 1U5TC 1B4PA 4BHBA 3QODA 4CO8A 1PUFB 5HQPA 1WJEA 2XVCA 3ZQ7A 3V1WA 3RDIA 2LY1A 2OJED 2JSYA 3LFLA 2HOEA 4JR4A 3UMAA 2XKPA 4FISA 4IKHA 3QFAC 3H3ZA 4CY8A 1GSFA 1MH4A 2YOIA 1V3FA 2ICWG 2PMZN 2BZTA 1GSEA 1T00A 2ON7A 2HKXA 4DYQA 3HVSA 2CQKA 1JJ8C 1O3SA 1BA5A 2HYXA 4GTUA 1S7OA 2FWGA 3MNGA 4RBOA 3TGZA 1FWZA 3L78A 4QPOA 2F3MA 3G1LA 3VOEA 4Y4RA 5IYDJ 2XBQA 2IA1A 1J09A 2RKHA 2VL2A 1PL2A 4NHJA 2FBHA 2YU3A 3ZQHA 4KITB 2CV2A 2VQGA 1AA7A 4G7OF 1F2EA 3GEZA 3GIXA 2DA7A 3GKNA 1K0BA 1R49A 5J6XA 4FT8A 5JCWA 4RLQA 5CREA 1VF4A 4GDFA 2XBIA 1U8RA 1B1BA 2KQRA 2R0QC 1SYRA 2H76A 2Y69H 2F2EA 1XG8A 4XS6A 5EVOA 4PZJA 3WTWC 1I3QJ 5D93A 1ZYNA 2JT1A 5ID2B 3WGHA 3LQ7A 4MK3A 4TR1B 3I53A 1UZCA 2ZFUA 4G12A 2ACJA 3HRTA 3LAPA 4QWQA 5J47A 4PK4A 1ORKA 3RPQA 2VL8A 2KMUA 4RB1A 3BP8A 1SVOA 3HHHA 4ULXA 1LU4A 4B44A 4I5QA 3CF2A 4V2GA 3JRGA 1R5PA 3IH4A 4N11A 4J00A 1PDNC 4Z7XA 1R5HA 4XSZF 3ZMKA 3CQZJ 5DCGA 2F5FA 1LNWA 2P5KA 2QGUA 2A6EF 3VI7A 1X58A 3RIRA 1HYUA 2L3DA 2E0QA 4IQ1A 3IWZA 4M72A 5C04A 3DXBA 1MMDA 4AD9A 2DJ1A 4K2XA 1OKTA 2HT9A 3F4TA 3C8EA 4JRRA 1ERUA 1UB9A 3IDVA 5D96A 3UARA 4LJZF 3WU1B 3GNJA 2HE3A 2O3FA 2JSCA 2M0CA 3OWTA 2DJIA 3CSHA 3IK7A 1SKSB 1VF3A 3TCOA 2DA2A 3RKXA 1P2FA 1V98A 1R6RA 4E4HA 2C4JA 2I8DA 4ASNA 2XPVA 1IRZA 2QSFX 3CMIA 2KP1A 3CRUA 4RQRA 4M9SA 3H5AA 3MN2A 2H72A 2ZXHA 2QQ8A 2E1OA 3ZOBA 2WS2A 2MSYA 4AGSA 3MVPA 4FQUA 1G7OA 4IEJA 5JCUA 3M4OJ 3G1MA 1P92A 3CDHA 3MWMA 2FCHA 3HXLA 3HD5A 2YUSA 2IXSA 3ERWA 1OAZA 4ZIJA 4XMYA 3VWWA 2XRLA 4BL7B 2LTPA 5E1ZB 3I54A 4GWRA 3CYNA 3QOPA 1XVQA 1H8AC 4WF4A 2GQMA 2TRXA 4PNGA 2OKAA 3W8JA 3TOTA 1YITI 4IGJA 3WTXC 3RYPA 3WTSC 4RGUA 2ISYA 3HRSA 2HNHA 2DPUA 1RRJA 2E2GA 4YAVA 2JVHA 3ZVJA 4XRSA 3TJGA 5HR2A 2AQEA 2M9HA 3A0BC 4MLOA 5H5SA 1E17A 2ZB9A 2IJYA 4CCOA 3DPTA 4CCKA 3ZRDA 4ECJA 3EETA 3VPTA 2O85A 1VQ8I 1WRJA 1X3WB 4NV5A 3ASOH 4RGXA 1T38A 4XLFA 4UUVA 3BG5A 5HS7A 1USBA 2V9KA 3DWLE 4KW6A 1FB0A 1XBSA 2NNYA 1MMAA 2NVXJ 5F05A 5AIPA 1ZH5A 3N9JA 5HLGA 4HF2A 1Y39A 1ABAA 2JPBA 1VNDA 4BYYA 5BMUA 1XSVA 2PJRA 3H93A 2P5VA 3ZZXA 4CY6A 3E5XA 1O7UA 4JE1A 4KSOA 4CSWA 4V1Ap 1FY7A 5IMVA 4S0HB 3FXRA 2DTRA 4HU7A 3HDCA 3BWGA 4CICA 1L0OC 1FX7A 2EV0A 5J4UA 3ZXSA 5LHHA 3L2QA 1DUGA 2EA4A 2PN8A 2F48A 4I8BA 3TDGA 3F6VA 2PUKC 4KUMA 3O3KA 4XQFA 5IMZA 4G6TB 3JAMZ 1HKTA 2R0CA 3A2XA 3KIJA 4MZWA 1AUCA 4Z2TA 2C3TA 3L2RA 4EVIA 3KP6A 4BUPA 5L3EA 2F9SA 2P8TA 4ZZDA 1FJLA 1IXSB 4RAZA 3EMPA 1XMAA 2IGMA 2I1UA 4IVNA 3DD3A 5L71A 5J3RA 3BR3A 1OR7C 5GP9A 1K0DA 4ZL8A 4POBA 2IAIA 4PX1A 4MH2A 1ZGJA 2G0EA 3I55I 2BGCA 3FMSA 4G19A 4PUFC 2LSOA 3MIXA 3ZMSA 2HTJA 1QVTA 1SJIA 1D1BA 1V54H 2IN3A 5EZHA 2IL3A 4AWXB 2DU9A 3EUHC 3COAC 3IR4A 3RQ4A 3T0YA 3A2KA 2NDOA 1SYXA 5DD8A 3CRTA 1M2DA 1XW5A 3NAUA 2RUFA 3FK7A 1PRXA 1O8WA 2QBYB 3JRBA 3BZCA 2KL4A 3QYEA 3E6DA 3CBUA 1ON4A 3ONQA 1YS6A 3PR8A 4MTDA 2EIJH 1K78A 5HDKA 4POMA 3KYDB 1B9MA 3ZQQA 5INYA 4K6XA 3PNYA 3C1SA 1FIAA 3ZREA 1WWJA 5JVTA 3BR0A 1O3RA 4QPQA 4AYBA 1WJBA 2JA6J 3ZGKA 2EFWA 2HDCA 4WXHA 4ZB9A 3LQRA 3TO7A 1BJAA 4XIHA 4NC8A 2QUFA 2L4MA 2ZXIA 4YKFA 4RA2A 5J1RA 18GSA 4GQFA 3I3LA 2IWTA 2LTKA 1P9QC 1YYVA 2RREA 3OMYA 1W89A 5CLSA 3EURA 2NXNB 5AIQA 4DZPA 1LE8B 2LQOA 4AF2A 3I4PA 4D7MA 1M99A 2V1XA 5LGNA 5HR3A 3P5JA 3JAMK 5KN3A 4L8EA 4IHUA 4M71A 3KEBA 4Q5RA 1JHFA 5IPAA 1B9NA 3FXKA 3SXYA 2EIKH 2IRFG 3ABKH 1XDSA 1F36A 5HDNA 3Q9SA 4AIJA 1LBKA 3CP2A 1TI3A 2NS7A 2JA8J 1XPVA 2AAWA 1XWBA 4HSCX 4Z6YA 2AXLA 2BY1A 3M1EA 1FPQA 2BEOA 3L1PA 5D5VB 1HOMA 3HG9A 1PYVA 1YHQI 3IOSA 3D4TA 3U6VA 1MBHA 1JHBA 1OCZH 2QQ9A 4KCAA 3SYTA 2VLTA 5HLIA 1WJFA 3LFKA 2DBCA 2VBZA 1D8JA 1KA8A 1V5FA 4YEJA 3ED3A 4CZZA 3BTLA 4PJ0C 1OKDA 1TRUA 3ZYWA 5B6NA 2GA1A 2HXIA 2VJ4A 5DALA 2O7OA 2OQRA 4YIRX 2H70A 2P6TA 5BQTA 4FH8A 2XSDC 1XWKA 3UVHA 1XCCA 2L9NA 3EDPA 5K1YA 4ML6A 3CJRB 2ID6A 1W4MA 2CUZA 3K4BA 4IL6C 2E1CA 2GT6A 4PUAA 3WD6A 3HYPA 3HIFA 4IF4A 1W0TA 1O3TA 2Z9SA 4E7IA 4OO4A 2V32A 1JJ6C 1TK8B 5BPIA 2KHMA 2YJHA 2XPUA 3WYWA 2CYYA 2GZWA 3ESWB 2F5CA 3IRRA 1TBXA 3J7YJ 4X0GA 1GP1A 4EC0A 1IN7A 1BJZA 3MEXA 4DSSB 4BBRJ 3QMXA 2XAJA 4RMNA 1A2JA 2JQ7A 4XORA 3CQFA 3TB2A 1W7PA 1JGSA 5LHIA 1GTUA 2CV4A 3O3TA 4KICA 1T8EB 2B63J 3GLXA 5HOOA 4G9YA 4AYBN 1SU9A 2F8FA 4L5IA 4M9ZA 5LRRA 2R7SA 4ENKA 3TW7A 2F8AA 5EL8A 2P5RA 2H1GA 1G3YA 5DAKB 5ECLB 3K69A 4MCUA 3IE3A 2L59A 2QSIA 5GADJ 4ID0A 1GUUA 3DKWA 4AIHA 2L2OA 3SHFA 5IT3A 1SEUA 1PX6A 2GSQA 6GSYA 5HS8A 4M3FA 3OL4A 2YV9A 4G0KA 1AWCA 5C00A 3Q9VA 3IC7A 5IP6A 1TW9A 3HCZA 2STWA 5M5WJ 2LSTA 2FQ3A 4OINF 3WTVC 1IG7A 1EKEA 4ZYGA 2LRDA 3EVIA 2DI3A 5CRGA 3ABLH 1BR4A 4OIRF 2L9RA 4XLCA 5DUIA 2REMA 1A31A 3OIQA 1F6MC 3V7SA 1JZDA 3CUOA 2IP2A 1LKXA 4BXXJ 3W2VA 3VB2A 3CJQB 3GTJJ 5LD0A 2B0LA 3S14J 3UBLA 2WY8Q 2YX4A 4UB8C 1EWXA 1UG0A 4PCQA 2JK3A 1R00A 2STTA 1A36A 3F6DA 1I9DA 4IQAA 2N5AA 4K0GA 2COBA 3RJPA 1EP7A 4FO5A 1BOAA 2CUEA 1V9WA 3LWAA 2LP0A 2CWEA 4XOTA 1O4XA 4IX7A 3AKZA 3HZ8A 1B8IB 4MGRA 4TXOA 1OC9B 1GL8A 4NUBA 4H86A 2VIXA 2EFQA 3DEXA 3OS2A 1OYYA 1Z7RA 3E5QA 2Y48A 5B1AH 2ZFWA 2CGPA 4HF1A 4HLXA 2MMOA 1YKCA 3ML6A 2V1UA 4KDUA 2DFFA 3C18A 4NHZA 4RS8A 4MEXF 1D5VA 1R58A 2A2PA 3QAVA 2F4IA 1X9SB 2E36A 4BBSJ 4CCMA 3OYKA 2UZ8A 3V7CA 3BTIA 1PP7U 4U7DA 1T56A 1KTEA 3TGNA 2FLSA 1FZPB 2IMEA 3BDDA 4WR4A 3HVXA 4JOMA 1GT0C 1VQ5I 13GSA 3L9SA 2M4GA 1ZRFA 4J2FA 1KQ8A 3WGEA 2ZNYA 1FSEA 3MZYA 3Q3SA 2NOJB 4UUTA 1VQPI 3GTLJ 2A2SA 1HQCA 2VC0A 5L3DA 3LSZA 1FLIA 4Q5QA 4XS4A 1GH2A 1T4ZA 2L01A 3R2QA 4QQ7A 1F3BA 3GW2A 3QPSA 4BA7A 4KMUX 1TXXA 1YF1A 2QCOA 1AHDP 3FF5A 2R0PA 4JZQA 2WRTA 4KH7A 1MDMA 4C3HJ 4HU9A 1FMWA 4XRAA 5B8AA 1V5EA 5DTDA 3KP7A 3H1CA 1JUMA 2JN6A 3FZ5A 5CRWA 4BNCA 1TTYA 3JRCA 4A0XA 1ZARA 1XMKA 5CQGA 1TK5B 3TO9A 3ZMUA 4TRXA 1ON2A 4ENJA 1ZHFA 1G3TA 2X48A 3DKXA 5AN1A 2QSGX 4ACSA 1FOVA 2YU9J 3APSA 1ZG3A 4O3MA 2K86A 2Y9ZA 1XGMA 3FXLA 5J1YA 1F37A 1OCTC 3KPHA 4MHGA 4YAPA 1QQ2A 4BHPA 3DYRA 4BQQA 3DCFA 5HFGA 2YP6A 2KPMA 3CC2I 5F0GA 4U0YA 3BJ6A 1ERVA 1JLWA 3I43A 5HFIA 3KE2A 2IIYA 2BW3B 2LF8A 1PMTA 1XFLA 1H4OA 2MYGA 2IA2A 1ULYA 1PA3A 2IFQA 3AY8A 1B72B 4L5OA 1BR2A 3Q0UA 3MKZA 4TR3A 3KMOA 4HBLA 3TW6A 5J3LA 2M46A 4ZB6A 1U87A 1T6SA 2DT7B 3BD2A 4FIWA 2IVMA 4FE4A 4PGHA 2YWMA 5JWOB 1K4TA 3FZ4A 1REPC 3ZR8X 3OYDA 5IOXA 1G3SA 4KE3A 2K9MA 1UA5A 3ZQCA 2BJXA 3JRDA 3LSJA 4OMYA 2ECBA 2H1LA 4IRGA 5IYBJ 1GSUA 2X51A 5ED4A 1H75A 1S3DA 3DLLF 2C0DA 2CH0A 2QF7A 2Z1DA 4JK1X 2GWRA 5K5RA 1E0EA 1LDJA 2QM3A 1K3OA 4J57E 1EH6A 3GH6A 4LG0B 7GSSA 1WI3A 1ZK8A 1W1WE 3FWEA 4MJAA 4A6EA 4KGIA 3HEFA 2K02A 3KD0A 1QQIA 1VFCA 3VK9A 3PINA 1RPWA 2F6CA 2BXZA 5E3OA 1Z67A 2CVDA 1NG7A 1V4RA 2JSPA 1ERWA 2JZRA 4HDEA 4ZL7A 2Z99A 1NM3A 2X85A 2CUJA 5CQEA 2ON5A 1YW7A 1ZLKA 2EIRA 5AISA 3SDGA 2ZMEC 1O7LA 4IPAA 4YIIA 4PTSA 4NV2A 4I0BA 1QGPA 2LJRA 3OV8A 4BY7J 4Y15A 2PWJA 3IPZA 2DMMA 1LJ9A 2CFXA 2P81A 3ERMA 3DP7A 3I5UA 5BS6A 1GLPA 3FZAA 1VRSD 3W2AA 4E7KA 1G6YA 5F06A 3VWVA 2DFHA 1CQGA 5F6FA 4MLYA 2L4AA 1RR7A 3LSHA 4HG2A 4BL0B 2H6YA 3KJYA 5KN1A 4HX4A 3FMRA 4LK1F 2A5WA 3FXUA 2DN0A 2ESHA 3E97A 5F0HA 2WA0A 4YRVA 2J5OA 3RKQA 1KZHA 1Y1WJ 2YS9A 5GAHJ 4MJCA 1N75A 2E1MB 3U2RA 1IDZA 1TWGJ 2LH9A 1QPMA 4X6AJ 2VE9A 3RAZA 5IMFA 1YDKA 3VURA 1RESA 2EINH 3QYBA 3QQAA 2B1LA 2NPBA 3QAWA 4F9ZA 1MEKA 4NHWA 2CO5A 2HZTA 3LFUA 1P7JA 1HNAA 1YQAA 2X6WA 1AQXA 4BU2A 4A3MJ 2V1MA 3HUGA 2VIMA 1MW7A 4C2UA 2ZUPA 2O8VB 3OS1A 2P5QA 3GKXA 4B47A 1CQHA 2ZSIB 3FDYA 2HFHA 3A02A 2YWOA 1Z7UA 2K40A 2V9PA 4V19K 3ZL5A 1WQ2A 4I01A 2FEZA 1X19A 1XCVA 3PQKA 4IOAF 3ZFBA 2X1DA 5DV5A 1G8XA 3TOBA 2JL4A 5B7CA 3M9AA 3R0JA 3G73A 2RM5A 2CW0F 3KZYA 1WE0A 2DOAA 3JTGA 4A3LJ 2B5EA 1WH7A 3GO5A 3WU2C 2R5YA 5G2ZA 1WJKA 2GVPA 1ACVA 1TWFJ 5KNLA 2GSTA 3GL3A 4O92A 2VOPA 2EH3A 1XX5A 4BEHA 1ZR2A 4PQ1A 1I5ZA 1P4XA 1TLHB 3QPTA 4OAZA 4BJ5C 1FAAA 1D1CA 2KIQA 2OAZA 2VD1A 3HKRA 4RGSA 4MTEA 5B66C 3OIPA 1N8JA 3HTUA 5F0FA 4C30A 4QL9A 1MNEA 5K5QA 2RNJA 2JRTA 2DMNA 2E1NA 2VT3A 1XWAA 5J4VA 2HQ5A 2W57A 4PDKA 4NNJA 2ZJ2A 2OE3A 1U3IA 2W25A 3K8NA 3UBKA 3BR5A 1FYLA 1GLQA 2CFOA 1R26A 1S3CA 2C1YA 1ETWA 3K4JA 4HZ4A 3TL4X 2V6CA 3LA3A 2BV6A 2WGRA 2Y2ZA 4GF0A 3HPGA 3L2UA 2VCTA 5CRDA 4A5PA 5LCZA 4BWQA 3HOTA 4GXOA 4PQHA 3GFJA 4JP0A 3A1YA 3VWBA 1S6LA 4KT5C 2Y30A 5H6RA 2Y0SA 2OACA 4EGZA 4XLHA 4AVZA 3MKLA 3W6VA 2PPTA 2FOWA 1RUOA 2OPTA 1ACIA 4F92B 4FQGA 3VDXA 3WE2A 1EH8A 2CVBA 2R7DA 4RM2A 5GAEJ 2HSMA 3P2AA 3QCPA 1D1AA 5D9TA 2DMTA 3PSFA 6GSXA 1I1SA 3DPLC 1ZYPA 2IEKA 2DK5A 3ME7A 2HPMA 4Y17A 2FSWA 1ZZYA 1EA3A 3MKYB 1U78A 3GZNB 3WODF 3QPMA 2E7XA 3VYTB 1HC8A 2VBWA 2PVQA 2PMZA 3NEUA 2XB0X 1IV6A 3RHCA 3GURA 5KOXA 4L0YB 4H0EA 1WJ5A 1ZOFA 4IELA 3BROA 4R1HA 2LBFA 3GTUB 1XGNA 2X1CA 2X4AA 3O6TA 5H5RA 4CDOA 5F08A 3LSRA 5F0CA 2GS3A 4Z2YA 3S1RJ 3F22A 1Y6IA 2VT2A 1RKWA 4NC7A 3B6AA 4HA8A 3GVAA 3PIOF 1IN4A 1WKMA 3BBYA 3K1MA 3CXGA 4DJAA 5ECQB 5J8CA 3ZQLA 1LFBA 3BJAA 5ECOB 1X0RA 2XRNA 5TRDA 3HSRA 1ZLJA 3E7LA 4XS1A 1VQ7I 1GUKA 3CC4I 2V6EA 3F3XA 3K4LA 3E6CC 2MYSA 3F9KA 2XGXA 4HYEA 4DNCA 3D5LA 2ZC2A 3L2WA 4K1FA 5G30A 4V2MA 3GTKJ 4BJ6C 5H2FC 4MF5A 4ZDLA 2PJPA 3S93A 5IP9J 3FZVA 1JKPC 4ZZLA 4KFCA 5IO2A 3MZ8A 3OYJA 2OE0A 2BY3A 4OIOF 2JTVA 4OU0A 1K79A 1JZRA 2VBYA 4JX6A 5IT9Z 1ST9A 5G5FA 1SKRB 2H75A 1QHHD 4EIQA 4LG3A 3LMMA 1CGPA 2IMFA 2MC4A 3KH9A 4BWSA 3CZ6A 1GDTA 4M6XA 5EZGA 3W6KB 1XOBA 2DMQA 4FX0A 2BE5F 2E60A 2LJAA 3FHKA 6GSVA 5ECHB 3LSKA 1D0YA 4I97A 2TDXA 2QEXI 1BI2A 5D8KB 1EEMA 4DOZA 2K9NA 1AW9A 3S3OA 2XIGA 5G31A 5D73A 3AL0C 2XROA 2Y0SN 3EQLF 3F0CA 5EF6A 3H9QA 3WU0A 3I59A 5DBQA 1VI0A 2MLGA 5CPRB 2DODA 2M45A 3PSIA 2KZGA 4I02A 2IS1A 4HZFA 4XLNF 3OY9A 1YLFA 2R5ZB 1OCCH 1R1TA 5B3SH 1E2XA 5E3MA 2YPRA 3FW2A 4KB3A 3SZGA 4OCFA 1P6RA 3EYYA 5GSTA 3AL0B 3CF5F 3QPHA 2R5GA 2ZKZA 1QRYA 3LSMA 3CCSI 1QZYA 2A05A 3J81Z 1HLVA 4A3JJ 5KHDA 4OFNA 4ZDPA 3LNQA 1LB2A 2BY0A 3KGKA 1LUJB 1F9MA 1RNLA 1SENA 3C73A 2YSRA 2VI6A 6PAXA 2BVMA 5JR3A 3CO7C 1PUFA 3QR6A 2XKOA 2DC5A 3QFBC 1Y1VJ 2EZLA 3HM5A 4DW6A 2JZYA 5FFZA 4ECIA 3K4NA 1EZKA 3ECHA 2R37A 3WTYC 5KN0A 11GSA 3NQOA 1U5TA 1MMNA 2Q8KA 2XB5A 4CCNA 4USSA 3IWFA 3PO2J 4O32A 2OA7A 5E4WA 2Y75A 2AXTC 3DBLB 3IKVA 3MKWB 2X6XA 4G2EA 3CCMI 3PPUA 2JA5J 2DYRH 4LLNA 4L0UA 1PSQA 1TKDB 4IJ3A 3DBHB 5IT9K 1SVMA 1MTCA 2XAGA 3PFYA 3DPUA 3PJRA 4R8HA 4XKBA 3V8KA 3V4GA 1QXHA 2L57A 3TEDA 1EGRA 4KDYA 4ZILA 1M9BA 1ZRDA 1MJ9A 1R4NB 2XHKA 1D5YA 1HW5A 3KP2A 3MFKA 3DTEA 1GNWA 1STZA 2MH2A 1BI3A 4PJJA 1C72A 4AVPA 2HXKA 5FRNA 1FBSA 1ERDA 1T98A 4M74A 4QSHA 1KU3A 3N97A 3CCRI 5FKNA 3E3VA 1HXDA 2DSAA 5ID2A 5A5KA 2B5YA 3J7Yk 2FD3A 2LR8A 4D1QA 4OCEA 5E8GA 3IHQA 5EEHA 2YZUA 1Y0UA 4J56E 3JTHA 1WI9A 14GSA 4XKCA 3CDLA 2D1VA 4L9VA 2CT6A 3V8LA 2VLVA 1HDPA 3ZTLA 2VXZA 3IC8A 3TKSC 3OOPA 3J81K 2IGNA 5CVIA 3D5JA 2CVKA 3JW4A 4GLTA 2RM6A 1K0AA 2YPMA 5BPDA 3TKSE 1R4MB 1X5DA 3T5XA 3VYUB 1IN6A 1IV8A 2D2WA 1S72I 3HA9A 1HQOA 3P7XA 4CHSA 3A5WA 1JKRC 3ZIJA 1PX7A 1MIJA 2VKDA 1WFXA 5EGOA 1VQKI 3GN3A 1GLNA 2NVUB 3FK8A 1NK2P 4Y3OA 4KSMA 5KVRA 4L0WA 2LC2A 4EJUA 1SJZA 1HKSA 3A2VA 4M3EA 1F3AA 3HXSA 2DJ0A 4IP6A 1DDNA 1Z6TA 2XV4S 3IHGA 3H5RA 1GSYA 2DPDA 2ZCWA 1C0WA 2GXBA 2L4CA 2VL3A 5CO3A 4U88A 1BW5A 3I71A 3PUFA 4CYCA 1M3JA 3BJ5A 2FUG2 4II3A 3EU3A 2DA3A 3HJMA 3E1SA 2MG4A 3GUDA 1O3QA 2RNGA 3QAHA 5FD5A 1FOWA 3OYFA 4OOIA 1MDIA 1S3AA 1X1BA 1XZOA 4BL7A 4P55A 3AG4H 2ZNMA 4N0ZA 2VM1A 4D73A 4NDLA 1QZEA 1XC5A 4QIWN 1JT6A 3K0LA 4EJTA 1YG2A 2MABA 1XSDA 3GRXA 3RBTA 3HPHA 2YNXA 1TP9A 5EY6A 2AYTA 3W6JB 3IKTA 4NWYA 3B02A 4MIMA 3JCUC 5CVUA 3HL2A 4YFKF 1IUYA 1PKZA 4ZB8A 22GSA 1QU3A 3CCVI 3F3QA 1QVUA 5LLQA 1Z9HA 4KA0A 5A4UA 2W4SA 2CV1A 2O03A 1GSDA 4ECBA 4DQ2A 4HNTA 3IBHA 2PJRB 4XOPA 5IPGA 2EV6A 4E7LA 2N5BA 2TCTA 3BLYA 5FHIA 4E8EA 2JUGA 2P7CB 3BJOA 1KNGA 2IPAA 3D4MA 1SD5A 1Z9CA 1W0UA 3VYSB 3CTFA 1ZL9A 5JCGA 3OR2C 2DJ3A 4EO3A 1KYWA 4CDGA 4PURA 2K8VA 5LGUA 1YJ6A 5IMAA 1G7EA 4HX8A 4NXIA 3CLQA 3TRQA 4G7ZF 4FCYA 3FXQA 1OFCX 3R60A 2BYVE 3LSGA 4G6QA 3TRPA 1SL1B 3RPUD 4L0ZB 1FHEA 3FX3A 3SEZA 4A3KJ 3UR3C 4C2MJ 5L3BA 4IHSA 2DMUA 2C3NA 3R6SA 3LJRA 4Q5FA 3OYEA 2YR2A 1Z91A 5FLVA 2K5CA 3GFLA 3K6GA 3K9TA 3QYFA 4HF0A 1DP7P 3S1MJ 5JWRB 1A2MA 1BX9A 2QKEA 5L3FA 3TOUA 1BI0A 3LXZA 2E2MA 3QAGA 3UJ1A 3MWHA 3FXMA 3OYLA 1KU7A 3DRNA 2UUZA 3BOAA 1TT5B 2M5WA 2RN7A 1RW1A 4FETA 1YI2I 2P0GA 4TR4A 3G2BA 1URMA 2Q2EA 2ISZA 1OE7A 4HJMA 2TIRA 3WGXA 4MABA 2PLYA 3M3YJ 2F5DA 2XC2A 1DE1A 1SC7A 1HSJA 1I39A 2DDBA 2NVQJ 2O87A 2M8EA 4ECCA 4X1EA 1AC1A 2KZVA 3FKIJ 1E6BA 2WC2A 1Z6RA 5CYVA 1JZOA 1WSUA 4F0BA 1OR7A 4DZJA 1FG4A 1XN7A 4RAYA 4W1UA 4ZYDA 2L7KA 1U8BA 3GX8A 1U6GA 3HC7A 3LAJA 3HKZA 2GA2A 3C3WA 1WCMJ 3HSFA 2DCEA 1QA6A 3OYBA 1K78B 3FXOA 3T8TA 2A4VA 1SK0A 1WPKA 3QWLA 5CP1A 1S7EA 3I64A 3T8RA 4IHTA 2IS4A 3VFIA 2EZKA 3NIVA 1F4KA 5DVBA 3IXRA 2LNTA 1SKWB 3S2DJ 4P5OA 5LEJA 1WWXA 4K8MA 3L9VA 4KF9A 1D8KA 3GFMA 2OBKA 3ZMVA 3WTZA 3TJFA 1T0FC 3GMFA 4E7JA 4CW9A 2DLXA 2JSZA 4GRFA 2D5VA 1JTYA 3HVNA 2HDWA 5J9BA 2OZ6A 4GRIA 2FBIA 2QYOA 4N9HA 3MQ0A 4A93J 5ERIA 4O5VA 1G4DA 2H1AA 2VCWA 5HR0A 2A61A 4NQWA 4XM3A 2D2ZA 1OCRH 1ETQA 3DTKA 1Y56A 2OA4A 3CLOA 2O9LA 2R7TA 3FYGA 1ZR4A 2YWNA 1J7KA 1ETVA 1AXDA 3M9JA 3PQJA 3S8PA 3F72A 2DOFA 1XWGA 1K0MA 3D1NI 4KCEA 3VSKA 4ZTFA 3C7JA 1BQ7A 4RB0A 2CQ9A 3W2WA 2R2JA 1T4YA 3ABMH 3GV1A 2AHEA 1APLC 1QGVA 3GXOA 5M5YJ 1Z6NA 3WTTC 1J5YA 2JPCA 3HZJA 5KCMA 1Z3EA 1K61A 1NSWA 1Q4JA 2X1EA 5DD4A 4LLLA 4WCGA 3I6AA 3DKYA 4CA0A 3RI4A 3BG9A 3LG6A 4HJ2A 1Z3XA 5A4VA 4BQNA 2VKVA 2I9HA 2CJJA 1ONVA 2LFBA 3ZMZA 3FK6A 3AAFA 2WB9A 2W24A 3ISPA 3EPTA 3IV4A 5JWQB 5ECRB 3E3EA 5DALB 4BQAA 3GYHX 5FKMA 3HHVA 2KP2A 1B59A 4OIQF 4HZ2A 1UHMA 4UVBA 4BVYA 2KP6A 3P9KA 2NBSA 5CAXA 1XDUA 5CVVA 3I9V2 5FFXA 2H1DA 3DKSA 3RZOJ 2AB6A 2MMNA 1LPQA 4NB5A 4HQMA 3ZIVA 4I6ZA 1K0CA 4KYWA 4YKGA 4BDZA 1VQMI 3LYPA 2LY2A 2BY2A 2UXXA 3ZN1A 1GSSA 1D0ZA 1X2NA 4I2OA 2FWFA 4UVAA 3L4NA 2EFOA 1TQPA 3A03A 1HF0A 1A5JA 2PX9A 2FX0A 3KZIC 3T1BA 1OKRA 2L9VA 3HKZN 3M8JA 4CH7A 3BY6A 2YJ7A 1J2XA 1W7PB 2FJ1A 1OCOH 1WJAA 2AO9A 4HOBA 2L4QA 4HAMA 1MBGA 2G7UA 5EG0A 1NH3A 3E9JB 5GAGJ 2KIUA 1AKHB 2HDDA 3DIEA 3F8BA 4K7NA 4JX4A 2MZCA 5DUKA 2HOSA 2ZNZA 1SVLA 2DJ2A 4ZL9A 3M1CA 3F6FA 4DGWB 2LDUA 2C0GA 2WJUA 4GFBA 2ETHA 2M1BA 3S3MA 1T08B 2G0FA 1SANA 2MD0A 1VQ4I 2HU9A 2IPQX 4IHYA 2F51A 4A3EJ 2P0WA 5C44J 5DAKA 2OQGA 1KU2A 3OL3A 1X1PA 2QENA 3TKYA 4ABZA 4F93B 1ETOA 2VLAA 3HSEA 2CRGA 4L9TA 1R71A 4WK8F 2AV4A 2EV5A 1AQWA 2A2RA 4IJIA 2EFPA 3EUKL 4ZYAA 4MF6A 3BG3A 4U0WA 1ZYEA 4EL1A 2ZXJA 1ZAOA 2M3AA 4KA4A 1MDJA 3M8NA 2KT0A 4IHWA 3OYMA 2KJCA 3FR6A 1U2WA 2R7VA 2E5NA 3RYRA 3BR1A 2CAQA 2JRMA 1P4AA 1VF9A 3F4SA 3M0FA 5EDNA 5GPAA 4XL9A 1TQMA 2X0LA 4ZBAA 4K9ZA 1UHWA 1TW3A 3VLNA 2ES7A 2OUMA 4PJLA 3EU4A 2M4KA 1IXRC 2I10A 2VE8A 5LD2C 2ADUA 3R4KA 5B1BH 3S2HJ 4CHUA 1R5ID 2RAEA 1TRVA 4WBRD 5EPFA 2HYGD 2AQFA 3UKGA 2C6YA 1WP0A 3F0IA 3SZTA 3K4KA 2EZIA 3KCCA 3GX0A 2E34A 4OMZA 4ESFA 2HZFA 4IQJA 2K9FA 4HNUA 2KFDA 2LJKA 1FOYA 3H0DA 1K4SA 3IAS2 4G9HA 4RDUA 1YIOA 2CZ3A 3ZRGA 2QQBA 2FE3A 4PQIA 2M30A 2PN6A 4A3CJ 3HJPA 1S29A 2K85A 1ZQ3P 1TI1A 1OMIA 2KDZA 1U3EM 1FIPA 3EPZA 2WAEA 5IOWA 3ERGA 5DDGA 2EBIA 3RCOA 1OC9A 4PGTA 4ZC3A 5K5OA 4O5QA 4M9XA 3IRAA 1DGRM 4KNDA 4ZBBA 2DKIA 2W1OA 4BVXA 1ODDA 3UNGC 3CCYA 4EDZA 4M6YA 1BEDA 3IP4B 4FTHA 1Y25A 3S1QJ 2H0HA 1TWCJ 2E5ZA 1FSHA 4AC0A 1SD9A 2H6XA 4LIUA 4PNFA 3ERED 4X4JA 1E3PA 2O61A 3K2ZA 3L7WA 4GXZA 3UOMA 5DCHA 4YQVA 2ZCTA 4OD7A 4GGGA 1RC9A 1M9AA 3K2AA 2YANA 2X99A 1A6IA 3BCKA 1EH7A 3BG6A 1IW7F 4XS4B 3P9CA 3C7MA 1TQIA 4ICYA 4IXAA 3RZDJ 3HZ4A 4ENMA 4BAYA 1MDMB 3MCZA 3A3TA 5JVGF 1EV9A 1XPXA 1ERTA 2VONA 5KN2A 3VWXA 4ENNA 2VUPA 4K7OA 4MEYF 4HQSA 4MNUA 1HCRA 3GTQJ 1A0RP 4L5JA 4IHXA 1XG1A 1XW9A 1D0XA 2PBJA 1BI1A 1N78A 3KEQA 2F5EA 4JBAA 1HW2A 4G0LA 4UV8A 2M7BA 4YIFA 1TJDA 4GSNA 1A23A 1DU6A 1KU9A 4BIKA 2LRCA 2KIFA 4ZDOA 1KEBA 2AHQA 2Z2SB 2WFCA 3M7GA 1X5CA 3HGYA 2CUFA 1YJWI 4OFTA 2GXGA 1MMSA 4LITA 4J01A 5ICEA 3RDWA 1IDYA 1S3JA 3KEOA 5D9VA 2MLKA 3LGCA 4POLA 3Q0VA 1NW2A 3CUQC 5CYYA 3BTCA 1LFUP 2W85A 2IFQB 3KM6A 3VFZA 3GF2A 4ILFA 4ZYEA 4EIPA 4V1Ag 2OCCH 2KJBA 3M1GA 4MDCA 1EJ9A 4BE2A 1QO0D 3CUQB 3DBRB 1B72A 3A4CA 1SK1A 1TU7A 3GKKA 3TKPA 4EUYA 2QKMB 2OU2A 1XW6A 1JI8A 1T2KA 5E59A 2KOKA 2A69F 5FLMJ 2PG4A 4O5RA 1JKQC 4DBRA 1J9BA 2Z9OA 2M80A 2GT5A 1KQ0A 4IQ4A 3KEYA 4YFNF 2R7XA 4XHMA 1M1EB 5F27A 1G59A 4OO5A 2HWVA 1YX5A 3QU6A 1DGWY 1JLVA 3KP8A 2FGXA 4E7ZA 1K7AA 1XWCA 2FWHA 4P9UA 3Q5FA 2VODA 1JXSA 1HNBA 2FNOA 2O89A 2TRCP 2IMDA 3D0ZA 4P9FA 2EJRA 2H8RA 1R9TJ 4PSXA 3F8MA 3HOVJ 1B9YC 1OVNA 3F9UA 3GSTA 2A07F 3PL8A 1VQ9I 1JUPA 2RQPA 2F5VA 3K1PA 3K7AJ 1BC7C 1ZRCA 3IA1A 3CD6I 4YFXF 2GSRA 2H71A 5AIVA 4DSRA 2L9SA 2I81A 2E7WA 4NBQA 4UB6C 5IP7J 2L7ZA 1MSEC 2HVQA 4EM2A 1FVKA 4UNOA 2K18A 3G7IA 3QRFF 1IUFA 2G2QA 4I76A 1NG6A 2E1MC 4RI6A 2E2HJ 1JFUA 5ECNB 1LVAA 3RKWA 2B1KA 1BAYA 1SK2A 1GTIA 2FMLA 1OCPA 2VPRA 3LXTA 3I0TA 1SL0B 2ME6A 2JADA 1LEAA 3U9GA 4V2LA 3BZ6A 2L7MP 3KIOA 4M3BA 4PFPA 3GZ6A 3I56I 2HOAA 2ZMEA 3KP4A 3M07A 4IJAA 3FR9A 4TKYA 1POGA 3WGDA 2GDRA 4HOJA 3L2CA 5FLXZ 5B5EC 3G9BA 3KCMA 4XN3A 1YO5C 5IMDA 2HOTA 3ROUA 3LW9A 4M3GA 5LRSA 2HQAA 3BQZA 4GO1A 1DSBA 2HZEB 5ECSA 3F63A 4G6DA 1N2AA 2VKHA 1HKQA 3DU6A 4A3GJ 1KONA 2HYFA 1GVDA 2K9LA 2V9VA 2VASA 3H36A 2XF5A 4MZBA 5ABRA 5DQYA 3REOA 1EP8A 5ECKB 2LMDA 2A3SA 3GKMA 1R23A 4HUAA 3PNVA 5A2QZ 2AUVA 4KIFA 1VQOI 3SBCA 1DE2A 1D3YA 2XPWA 3ELKA 2NOGA 3GLLA 3CMEI 5LNKe 3LA7A 3OYNA 2H1BA 3TUEA 1FYKA 3ZITA 2PERA 4FYCA 4TOPA 3UVTA 2ZBKA 3A01A 1GVJA 5ICCA 1SD6A 1Y8QB 4RAFA 2Z16A 4KDPA 1YEPA 3CMYA 3MZHA 4DSQA 3H9JA 2H19A 1MBFA 1WRYA 2V79A 2P5LC 3GH9A 1ETXA 3MSZA 2R5YB 4F03A 1WOUA 4WKWA 2RIIA 1W5TA 3L09A 2DIZA 4BEHB 3G7JA 2RUEA 5F1RA 3GSSA 2HQRA 4O6JA 1O81A 2XUBA 2VL9A 2L0KA 1ZN2A 3G4SI 4ML1A 3IHUA 2F4OB 2X6OA 1CF7B 5CVRA 3CSJA 4B3XA 5L3CA 2FHEA 4EQQA 1F1ZA 1R1VA 1TNTA 3DVWA 1QK8A 3FZ9A 4N0VA 2OBIA 1LDDA 2WULA 4I99C 1K83J 5FB2A 4A0ZA 4OMVA 4YQMA 4NC6A 3C2HA 4MNNA 3W6GA 1A8YA 1WJCA 4K2EA 2HXOA 2XGCA 4C9YA 2MA3A 4TV7A 1K6YA 2Y31A 4Q5SF 2Z5UA 2DFEA 2LY9A 3FXJA 2ZJRF 1GWCA 1T8IA 2HSHA 3CSIA 4U87A 3B73A 2LRTA 4HI7A 5FLXK 3ZCOA 2CMPA 1RETA 4MPFA 1UMQA 2ELHA 5E18F 4RGRA 2RV8A 1ML6A 5DCMA 3E0JB 2QA2A 2XPDA 4E7SA 2NRAC 4AJ8A 3HOUJ 2MFZA 1KYZA 3S32A 3S2WA 4KIGA 2YCDA 1Z7PA 3US3A 1MBKA 2OC6A 4LL1B 5FGMA 1YW8A 3AG1H 3H9GA 2QZ8A 5IOZA 5A2QK 2ID3A 1K6OA 1NHOA 4I2TA 1AAZA 2MGQA 2X8CA 3P9IA 1TK0B 3TDZC 3WG9A 2M7AA 2HRAA 5L3GA 3VPQA 1M2AA 3EYTA 3SWLA 2NNNA 2IS2A 4CUGA 1OYWA 1MKMA 2FWEA 4EM1A 1UELB 2VJIA 3HGGA 3BCIA 4HEA2 1XIYA 4DYRA 4MPGA 3CCJI 3BG7A 1ZGWA 3D6IA 3K1NA 2CZ2A 2HZDA 4ZJZA 1NTCA 2LBFB 3NWSA 4B8XA 2HNLA 2DLLA 5G1LA 3LL7A 1UJ8A 5HDGA 2XAUA 2XF6A 3SZPA 2WV0A 2MBSA 3EWLA 1FT9A 2H6BA 2LUSA 5F1JA 3ABTA 3OOUA 4XRSG 5ILSA 2GLOA 2M34A 2ZO4A 2HQNA 2XASA 1YIJI 2L6CA 2GBYA 3TKRA 4GYGA 4G10A 2R92J 4RB2C 2HSYA 2LRNA 3HRMA 3DXJF 2CA8A 5B6MA 4MQVA 4F3QA 2X64A 1XB4A 1Z3YA 5JHUA 1UVZA 1EGOA 2PVOC 3MD2A 2UWMA 2V41A 3OSGA 3C2GA 1WVRA 1Y6EA 2CS3A 2VQLA 3QPLA 2O8XA 3JRAA 3KLOA 1MBJA 4XLEA 4XKVA 1YRNA 1GV2A 2LKXA 4ESBA 1QBJA 2I4AA 2QLZA 3Q0WA 4C2TA 6GSWA 1S5LC 2E7PA 3LSPA 3APOA 3ASNH 3IUOA 2EFNA 1R22A 3MAJA 4HV5A 4KN4X 4AU7A 4X1UA 1I5GA 2RVCA 5ECMB 4D9JA 3IV5A 5ILUA 3KFWX 1TT0A 3KP9A 4L9NA 4F91B 4L9JA 1T95A 2R4VA 5D5WB 4I2UA 4JR6A 8GSSA 4IN0A 2VJ5A 1KBNA 4UUSA 3WG7H 2H73A 4Q4ZF 3ZQIA 2ELJA 1TU8A 1MNDA 1K3YA 1YEXA 2HI3A 4XR6A 5D9WA 4EE0A 1E3OC 2KHPA 3L9UA 3F8CA 3J80K 4TVEA 3DGQA 3BC8A 1DQUA 2K4JA 4EJVA 5IMCA 1O57A 3KP5A 1PGTA 5DJLA 4LMVA 2D1HA 3CJNA 2DMLA 1ZMAA 3I59B 3P7NA 2OBPA 3KTBA 1FOHA 4Z2RA 2R7WA 1GNEA 2GZZA 2ESNA 2LK2A 2M2EA 2PEXA 1WMJA 4L5EA 4II2A 3VI5A 3ZVJD 3NZNA 3KTLA 4L18B 4RLFA 1T39A 2VCQA 4KDXA 3B6CA 3F8UA 3LSIA 3W3CA 4MZCA 4DEJA 1SFOJ 2WB1A 3WGGA 1A0FA 5D5XB 2DA5A 2HRKA 1Z0XA 5HLTA 4EVMA 4XKWA 3H92A 2JZTA 2KKOA 1DUXC 1MBEA 2QC7A 3CMAI 5F04A 4LGWA 2VL2C 3SFIA 1Z21A 1I27A 1SD4A 4Y7NJ 5B8BA 1N77A 5FJ8J 4KX4A 4KT6A 3SEQA 1OJLA 2H8LA 3UIWA 5C4XJ 1DPUA 1U5TB 2K4BA 2R7OA 1FBUA 4MA9A 3IAM2 1X5EA 2KUCA 2AS5F 5J5NA 4LB6B 1DU0A 1F5TA 4BY1J 1DBYA 4XRDA 2NVLA 2W00A 4BE1A 2FY6A 4P3YB 5DYMA 1QMVA 5JLXA 3L2VA 1EOHA 1TOFA 2Q1ZB 1R36A 2PI0A 4A3BJ 1VZ0A 1DP3A 3JRIA 1JKOC 4NPBA 1LVKA 2L02A 1YKAA 4IRIA 2QWWA 5EEAA 2Z33A 3M9KA 3JSPA 2HPIA 3LSTA 2JU5A 1KGSA 3DEUA 4BACA 2JA7J 2EC4A 1N25A 2JVGA 4TR1A 2KLXA 1YF0A 3FKFA 3HJOA 4WXDA 4XLPF 4IS0A 4TXVA 4V2NA 4MMMA 3TMOA 1E3HA 3HYIA 1IRXA 2WBMA 4FX4A 1H89C 3L0HA 1XVWA 2FMYA 3PGTA 3F3RA 4FYUA 1ETKA 2LNBA 1I6XA 3PFIA 3FMWA 1OPCA 3D0SA 1OC3A 1BBYA 4I0AA 2B9SA 1J08A 1ITYA 3JRFA 3FBIB 1JGGA 1PP8F 1A35A 2B3SA 3ERFA 1GTBA 3LORA 1NHYA 3G6EI 3O8HA 1V2AA 1V55H 2JUCA 4CCJA 1O85A 1V57A 2EA2A 2MH9A 3PO3J 4XCSA 4AIKA 2FNAA 2H01A 1IN8A 4I98B 2HS5A 4POKA 3D5RC 1U3AA 1BC8C 2JACA 4XRMA 4OWRB 4B09A 2GLRA 4AUXA 2X8HA 4LLGF 5EGOB 1H88C 4I6XA 4F2IA 4D7NA 3UEMA 3SQNA 2LG4A 4BE0A 1LQ1A 3S17J 3IL2A 3NWTA 2GGTA 2GSSA 3TKSA 2WB1N 3V7RA 4PGGA 3WT2A 1PVEA 3OR1C 4E8HA 4M3DA 1A24A 5D4SA 3EE2A 1EF4A 1MSFC 2LKPA 4B1RA 1TRWA 2EK5A 3HB9A 1U88A 4RM3A 3H5NA 1RR8C 2PMTA 1SD7A 4CYCB 2ZJQF 3OR5A 4YG2F 3FHNA 3F6OA 3E0UA 4BQOA 1Q1HA 1J0RA 3GWZA 1SFKA 4A3DJ 2OF7A 2QGVA 5EJCA 5K7FA 1XMXA 4RUVA 4D73B 1WHUA 3CCQI 3MDKA 3P8WA 4BXFA 3K70D 2UZKA 2CQQA 3H0GJ 1XXUA 3ZLPA 5A4WA 4N0BA 3FIWA 1JHHA 4E6KG 2E71A 2V1DA 5FKLA 2RQQA 3F23A 3DEEA 1IC8A 4BPYA 2IJLA 5FKKA 2RC4A 2WZ9A 3BCAA 2JA2A 2ZSHB 1HBXG 2GQLA 2M72A 3GX4X 2EZHA 4WF2A 2E19A 3HDDA 4LOCA 1TC3C 4UY8I 3O76A 1SAUA 2IA0A 3JREA 2E2JJ 2BHZA 2VXDA 3DTIA 4P96A 4IKFA 3MYDA 5ECPB 5ELGA 4HSTA 2FNPA 5IIZA 1YTYA 4MJBA 4DVCA 2L7FP 4RQXA 1SFXA 3GFIA 1FC3A 2KRCA 4XIDA 3A2WA 1UFMA 1UHSA 1XGSA 2DJNA 4A12A 4QL7A 1IXCA 1BYEA 3AG2H 4ETSA 4AJ6A 4G94A 4BGDA 4MP4A 2JWTA 1QZZA 3BT9A 1A6QA 4OAYA 2H27A 3I69A 16GSA 19GSA 3HOSA 4LL4B 3KETA 2QKLB 1ILOA 1GXQA 4ESJA 3DLAA 1BIBA 2XPEA 4UV9A 4LB5A 2COMA 2W84A 3I58A 1HA8A 2EIMH 2WCIA 5H5QA 3TJBA 1T33A 1HNCA 2K27A 3QDNA 3IH3A 3OS0A 2MMZA 4U0VA 4WXTA 1W7PD 2E2IJ 2VPLA 2DOEA 4HQZA 2R7QA 2OTLI 1ZREA 1RZ4A 4HX7A 2DDAA 2UXNA 4I7HA 3V8JA 3WHBA 3D21A 3KMNA 1X4PA 2JMWA 1BIAA 2K6VA 1Z77A 2BXYA 3U21A 2Q2EB 1XD7A 1B48A 1RIOH 2DKHA 3HRUA 2XF7A 5E1XA 3W8SA 3ZP5A 2ME0A 5JI6A 3GTPJ 3EMXA 5FD6A 5FT3A 4M73A 4LFUA 4HDVA 3S16J 4ZYHA 3Q6OA 4B43A 1VQLI 5C4JJ 2P31A 3M3MA 3WE3A 2VOCA 5ECIB 4Q47A 1HD2A 1B8XA 3DF8A 2LVSA 2QBYA 1G6WA 2M8GX 5H20A 2VO4A 3FMQA 3EUHA 3F8NA 2CX3A 3FRCA 4YQUA 1K0OA 2OD5A 1FP1D 4GQCA 4W97A 2P4WA 1A8LA 1MD3A 2UV1A 5D8LB 1FW1A 3ZMTA 4TR0A 3GA4A 3LEFA 2X4HA 4BDYA 2CU7A 3S3NA 3IRQA 4MO7A 4XK4A 3OSFA 4JX5A 1V40A 1Z1DA 5ELAA 2J23A 1ZYRF 3BPVA 2QA4I 2FXAA 2NVTJ 1PL1A 1RI7A 2GIVA 4HS1A 4EM0B 2DQRA 4KIBA 2GZYA 3L00A 2LNSA 2C3QA 1V58A 3K70C 2O8KA 4EMSA 1MD4A 1QFNA 1H9GA 2VQHA 3M8FA 5E79C 1A2LA 2C8UA 4IRHA 4NQWB 1LE8A 2YZHA 1X1DA 2M0MA 4KN7X 1HDDC 1LDKB 1Q1VA 2H1KA 4XN0A 2KISA 4B3AA 1SJ6A 3PUBA 2ZJPF 4Q5NA 2BHYA 1HSTA 5CJ9A 1TTZA 1S9HA 1USTA 1T7PB 2CX4A 4WXCA 2HYJA 4BJTA 2LLKA 1IGNA 2HI7A 5D9XA 3HOYJ 1FNNA 1T0FA 4MFDA 1QNTA 2L54A 1K3LA 2YWIA 5EEGA 3N4MA 5JHFA 2LQQA 4K2DA 2DK8A 3G3ZA 2A68F 4BS9A 3N05A 4WX9A 3HY2A 4NAXA 1B4QA 3CC7I 4O7HA 4Y13A 1Y8RB 4HDUA 3J7Yb 3G1OA 3H4KA 1TRSA 2CV0A 3S15J 2HKOA 4JEDA 3RQIA 3G7YA 4WWCA 2KIMA 2VB6A 2MBTA 1JE8A 1RK4A 2A5YB 5AIXA 4OFMA 4N10A 2BBYA 3H3VK 2WTEA 1FTZA 2FF4A 2B7KA 3KXOA 4PJMA 2R7FA 4GCVA 4D0PA 3CMMA 2IGOA 1P4WA 3TJJA 2WY7Q 3OYGA 2LEGA 4BVYB 5GAND 2FQ4A 3CCLI 3LWFA 2HR3A 2VLUA 3E5UA 3OYHA 3GTGJ 3LQQA 2BTOT 3WTUC 2GAUA 1W36D 2VCVA 3N5OA 4WR5A 1G6NA 4EV0A 1O8XA 3OIOA 5HLHA 1T3BA 4CCLA 4WEYA 2VJJA 1HW1A 3U1KA 1VGLA 3Q18A 4LMYA 1USSA 2EILH 2VUMJ 2GOXB 3EYIA 4OIPF 1AU7A 3RPUA 5COHA 5BMZA 2Q0OA 3BCBA 1T1VA 1OISA 3TBIA 3QOUA 3K4CA 5JLWA 2R4GA 1IYIA 1OYIA 2KRHA 5HS9A 4DSSA 1XCBA 4WF5A 2FD5A 3CJTB 5ICFA 5IOYA 3LYKA 1L3LA 5K7ZA 1W5CC 2HVSA 2R93J 2M87A 2L5OA 1G3WA 1MGTA 5HR1A 4XNFA 2O0YA 5EG0B 3TDUC 1PKWA 2NYXA 3CDIA 1GSQA 2W48A 3CO6C 2PFBA 1FOXA 2MD5A 4XLAA 2V6OA 5H6QA 5HODA 2EIQA 2HLSA 3MMYB 4A69C 4ZBDA 1X1AA 4ZH4F 1OE8A 2C0FA 3VODA 1UC7A 3AG3H 4A5NA 4MH3A 3L9FA 2DJJA 5TISC 1AKHA 3UAPA 3TJKA 1TWAJ 2ECCA 4HV6A 1GHCA 2K3FA 2XHFA 2K3PA 1TDIA 1TW2A 3P90A 5M5XJ 1PUEE 5BNGA 5CRHA 1CQTA 2B5XA 2R7UA 3SFZA 3SJMA 4FYBA 1UN2A 3C1DA 3DFGA 3IK9A 2EQRA 4EJOA 2KLOA 2DAOA 1TL8A 3APQA 2QQAA 1SFUA 2V1NA 1PFOA 4LIVA 1MNMC 5DDLA 2BVLA 1M0UA 2DFIA 4H4KC 4JYKA 3ZN0A 2P7VB 4WBJA 2AJQB 3QU3A 5JFRA 4A5MA 3GTOJ 4EGYA 4CZCA 2RDPA 4A3FJ 1ZCPA 2OZUA 4DIQA 2EWNA 2VQCA 2XSJC 1V5GA 1OQYA 1GUMA 2O7KA 3FY7A 2OJLA 2V4JC 1ZKGA 2J5PA 1R1UA 2WAQA 2Y0MA 3I4MJ 1PN9A 1K0NA 1PN0A 4TXOB 2LD5A 4KJZA 3QOEA 3GL5A 4F82A 2LREA 4X0XA 1JUSA 3GBGA 5GAPD 1IO2A 4DYCA 5K7HA 3ISOA 2IMIA 4Y52J 4RAGA 1O73A 2MBFA 2B7EA 3EUAA 1B8IA 5GSSA 3TO6A 1X2MA 2V26A 4GSSA 1JT0A 4F55A 5HFKA 1XTAA 2EPFA 2DA1A 4HSRA 4XONA 5J40A 3VYRB 5J4YA 1IJWC 3I4NJ 5TJJA 2B7JA 2PGTA 1U0JA 3DQVC 4QLCU 4Q48A 3E6MA 2V7FA 3O2PE 5ENUA 1QUWA 5D6FA 5IO0A 1S7AA 5GZZB 1R7JA 1W36C 1WGXA 1MDKA 4BVXB 1U9NA 2QSHX 3CCUI 1BG5A 1LJRA 4PSWA 4S04A 2L5QA 5DCFA 2DIYA 3RHBA 3KP3A 5F8BA 3GMEA 3VSLA 5C3EJ 2XAHA 3CTAA 5GPCA 3HOWJ 3Q74A 5BRTA 6GSUA 1YX3A 2WADA 3FBNB 2BOLA 3GFKA 2GQQA 5D6EA 3PH9A 4YH2A 1NK3P 2H30A 5HVQC 2FOKA 3S9FA 1MJBA 2DTZA 2XDVA 1W4VA 4LMWA 3GYKA 4RB3C 1VTNC 3PM1A 2TRTA 2OV7A 3CESA 4HRIA 4ITVA 2NVYJ 1IN5A 2H09A 2XGDA 3KX2A 4A2UA 2WWYA 3A5IA 2A4HA 4G0IA 2VBXA 5G1KA 2IGKA 4BHCA 2LKUA 3VEPA 5FWGA 1SFEA 3FEUA 1P7IA 2NS8A 2FRHA 3GHAA 4TW5A 3OYAA 3ZPLA 4K5RA 4M6VA 3C2BA 4PUSA 4AM3A 4C3IJ 2K8SA 5DJMA 4E7HA 4B48A 3EINA 5IM9A 4OWYA 3O8GA 1YOVB 2QA1A 5BOXA 3KZQA 5F07A 3H3UA 2R3XA 1ZGAA 1BW6A 2DW4A 2X8GA 4XRFA 2H94A 2HTSA 2PMUA 5KK1A 4ZTJA 2LYCA 2W7NA 5KAIC 1U6TA 4C3JJ 2VC1A 2MMAA 1PQNA 1WZ2A 4K7IA 3JSOA 2BW3A 4MF7A 2PQ8A 3FM5A 2D45A 1IZ1A 4CGZA 4N30A 1YE9A 2R0GA 2CSOA 3HOZJ 2IMKA 2DMPA 5TGTA 2WAQN 1EEJA 4Z2UA 2VD0A 4ZXGA 3ECOA 2HFDA 1Z05A 2DA4A 4HPQA 4MQ9F 4IHVA 2CQXA 1E2YA 2X49A 2W82A 2IW5A 2CG4A 1ENHA 2K7LA 4ON0A 2B6MA 2J9HA 5E3LA 1IYHA 1FB6A 1UCRA 5E8IA 4D5CA 3CUQA 1LEBA 1F43A 4K0NA 2Z3YA 9ANTA 5E3NA 4AIDA 5IYCJ 4AJ7A 1YS7A 2V6KA 1FO5A 3RKYA 1BL0A 4LG0A 1H0MA 2LS5A 1PJRA 4HW0A 4GCIA 5DQSA 3FR3A 4XSXF 3GTMJ 1ON1A 1FEXA 6GSTA 4U7BA 5IQYA 5KEJA 3H79A 2GQKA 2G7HA 4EEFG 2DO7A 3CCEI 1J9IA 1MH3A 5M3MJ 9GSSA 1VF1A 1FMVA 2K9SA 1OC8A 1GUHA 1O6JA 2RGVA 5E1WA 4PXOA 1BM9A 2EIOA 3RTRA 4LLRA 2GZPA 3WT1A 4EXJA 4HQEA 3IH2A 2F4MB 5FROA 2IS6A 1B9XC 2K9QA 3BR6A 1KQ9A 3HHGA 1YY7A 3K10A 2DXIA 1GV5A 1TZLA 2DQLA 1I3AA 1B4AA 1OLTA 3M8EA 5DS9A 1Q98A 1SD8A 4LA1A 4BH9A 3FM3A 1YW9A 4TN8A 1QHGA 5LHGA 4S05A 2N5FA 3S1NJ 2I3YA 1X1CA 1A04A 3AFHA 1R7HA 1THOA 3C1RA 4RI7A 4QTRA 2R7ZJ 2H8WA 2I5UA 2ZMEB 1MD0A 2YV7A 4D5FA 1QPIA 6GSSA 3ZQGA 4ANJA 1YZXA 3H1NA 1GRXA 4FASD 2MC3A 2MW8A 1EOGA 4R79A 4XICA 1ZTRA 3OYCA 5M3FJ 2E35A 3H35A 1SAXA 4NMUA 1XS9A 1S8NA
chains in the Genus database with same CATH topology
2H0IA 1R5AA 2HRFA 1WJDA 1BOBA 3HUGB 1BJXA 4EF0A 1EV4A 1G0TA 1M7TA 2VCXA 2HVRA 3K4MA 1OYJA 1ZELA 2WAFA 3D5SC 2HZEA 1Z5YE 4X43A 3HVVA 2HRNA 2FA4A 2WDUA 3RSNA 4PJNA 1GULA 20GSA 2H66A 4N4NB 2NTOA 2DT6A 3KYLA 3V42A 2X6YA 2A6TA 2O87A 2R6KA 5HFIA 1THXA 1X4OA 1GTAA 3R3EA 2GOMA 4KISA 1AIUA 3H8QA 2LV3A 2BMXA 5AGYA 1X9MB 3IC4A 2RLIA 3CTGA 3TRXA 1J0FA 2OADA 12GSA 3ME8A 2R7RA 2L6DA 1ZYQB 4EDYA 5KOWA 4K5SA 2C80A 1UAAA 10GSA 3RPNA 1RQMA 2VAFA 1VF2A 3J7AY 2PU9C 2KDOA 4O5UA 5CKTA 2JZSA 4IZZA 4IP1A 3SDBA 1FVJA 2XC7A 4EKZA 2ALBA 4KAEA 3RPPA 3FKJA 2VCZA 3TKQA 3ZFLA 3MAKA 2H74A 4ISDA 4YELA 1PD21 4EATA 4Y33A 2I4AA 2CW8A 2FA8A 3GUSA 3VWUA 2H6ZA 3C71A 2YN1A 1SL2B 4DBQA 1Z7LA 3KH7A 2OE1A 5HNHA 3GTUA 4PFOA 2CW7A 3DU5A 1WIKA 4WETA 1WPIA 3OYIA 3QD9A 2VM2A 5J41A 5FRMA 5J9CA 5LFAA 1ZGNA 1LFPA 5CNWA 1BR1A 4IVFA 2C0EA 4GSTA 5D8IA 4JU5A 4F52A 1M2BA 4IBPA 3EC3A 3Q19A 4IW9A 2GTUA 2L5LA 5HNFA 2O5RA 2H0GA 3U5RE 2CAIA 3JCML 2DJKA 5G5EA 4KUNA 17GSA 4JQFA 4N4OB 1XOAA 3D22A 3HXSA 4JEDA 1X9WB 3CP8A 1AQVA 4L5LA 2V2GA 3ZMLA 4MJEA 1JZWA 3DWVA 5IPHA 1MMGA 3UL3A 1R4WA 4P1WA 1Z6MA 2LOOA 3NOFA 1YQ1A 4F0CA 4XTSA 3PNTA 3DMLA 3F4RA 1B4PA 3QODA 5HQPA 1WJEA 3V1WA 2LY1A 2JSYA 3LFLA 4JR4A 3UMAA 4IKHA 4CY8A 3QFAC 1GSFA 2YOIA 1GSEA 1T00A 2ON7A 3HVSA 4GTUA 2HYXA 2FWGA 3MNGA 3TGZA 3L78A 4QPOA 2F3MA 2XBQA 4Y4RA 1J09A 2VL2A 1PL2A 4KITB 2CV2A 2VQGA 1AA7A 1F2EA 3GIXA 3GKNA 1K0BA 5JCWA 4RLQA 5CREA 1VF4A 2XBIA 1SYRA 2H76A