4HEA2

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 45
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hea201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hea202
2H66A 2H73A 4KDYA 1FW1A 2A4VA 4ECJA 5G5EA 3C1SA 4JR4A 2XBQA 4TR4A 2I1UA 1Z6MA 3FHKA 5JCWA 2IWTA 2MZCA 2F51A 1F6MC 4E8HA 1XVWA 5DALA 3WT1A 3KXOA 4K7NA 4GQFA 3FR3A 2H71A 5CREA 3H93A 5ECOB 1KTEA 3BJ5A 6GSWA 1ABAA 2KUCA 2H74A 3AY8A 1GUMA 4ECBA 1ML6A 4MZBA 2C4JA 4G9HA 2VL9A 1YEPA 5FT3A 5L71A 3P7XA 1PSQA 3SWLA 3M3MA 5DJLA 2VLVA 1R5AA 5J41A 4MK3A 4X1UA 1KEBA 4FIWA 4HZ2A 3FYGA 4OCEA 1XOBA 2HLSA 1ZMAA 3QR6A 4EF0A 3O3TA 5D9VA 4V1Ag 1DUGA 5IO2A 4IN0A 3TJFA 1XVQA 3G7YA 2HE3A 2F8FA 3RBTA 4MF7A 1PGTA 4POMA 3GUSA 2YPMA 2AHEA 4DVCA 2G2QA 5A5KA 2DBCA 4KH7A 3ZYWA 1PL1A 2M46A 1M0UA 5G31A 1TJDA 3MNGA 2O87A 2VCVA 2OBIA 5JWOB 3IXRA 1GLQA 5B7CA 1FB0A 3VI7A 2KP1A 4EE0A 4YQVA 3MDKA 4RUVA 2G0FA 3FZAA 3F63A 1M9BA 2WZ9A 2YP6A 3DYRA 3TKRA 2DJ3A 2ON7A 2GSTA 4HQZA 3A2VA 2IMEA 3GHAA 3VI5A 1BJXA 1ZGNA 2FUG2 1GSEA 1O7UA 2VAFA 1Y6EA 2V41A 4EL1A 3LXZA 3F8UA 1QMVA 2WRTA 1XXUA 4DEJA 2MBSA 1XPVA 2HSYA 4NWYA 4ZBAA 2MMZA 5DAKB 4JU5A 1TK5B 5CRDA 4PGTA 5CRWA 1HYUA 2LNTA 4E8EA 3IA1A 1I5GA 2CVBA 1PN9A 1PKWA 1QFNA 3Q18A 3D6IA 2H1AA 4MJCA 4IS0A 3U6VA 4OWYA 5CYYA 3M9JA 4ZB9A 2OE3A 3GURA 3DKSA 3IRAA 1K3OA 5J5NA 2XPEA 4PQHA 4O5RA 3VLNA 2VCQA 4F82A 3E0UA 2C8UA 2WS2A 3QCPA 3UMAA 1T3BA 5J3RA 1R5PA 1X5CA 3LEFA 5D9WA 5FWGA 1I9DA 4ZL9A 4DSQA 1ZYEA 5FHIA 2YV7A 1K0CA 2RLIA 1NM3A 1XIYA 4LL1B 2R6KA 2C0GA 2C3QA 2IN3A 2OBKA 5JWQB 1MEKA 1EV4A 3W8SA 5KN1A 2VLTA 3WGXA 4J2FA 4ECIA 1XWCA 2DIYA 2OADA 2YWNA 2VL3A 2N5BA 6GSYA 2VCTA 5B6NA 4F0CA 2K6VA 3F4RA 3H1NA 3TRQA 5D9XA 3V1WA 3BOAA 3KGKA 1WMJA 3C71A 1GULA 5DQYA 1PL2A 2IL3A 2ON5A 3ERFA 2YJ7A 1A23A 4KDXA 2CA8A 1PD21 4CHSA 3L9UA 4TXOA 4Z7XA 5ECPB 2BJXA 3VPTA 1GTUA 2JZRA 1O85A 3EVIA 4FO5A 2H76A 2OJLA 5H5QA 4QL7A 3GH9A 3IBHA 1G6WA 2VLUA 4L8EA 4OFNA 1OC3A 4I6XA 5HR2A 2XHFA 4WF4A 2TRCP 3RHBA 3GV1A 2HFDA 1M99A 1ACVA 1YQ1A 2LUSA 1K0DA 1K0AA 4K2DA 1BAYA 1PKZA 3EMXA 1ERUA 3FZ4A 4IP1A 3KJYA 1T7PB 5ECIB 2GVPA 6GSSA 4ZXGA 1N2AA 3KEBA 2YN1A 5CAXA 5KEJA 4KE3A 1EOHA 1XW6A 1PRXA 3EINA 3LG6A 4GF0A 1U3IA 2FHEA 2L57A 5HR1A 7GSSA 4EUYA 4CW9A 4XS1A 4WBRD 3IE3A 1OC9A 2J23A 5E59A 4WR4A 3TOTA 4KA0A 1SENA 2PUKC 3W6GA 4HOJA 5INYA 5D8IA 5DAKA 3KP9A 2L4CA 2LRNA 4JZQA 4XTSA 4NXIA 2X64A 5G1LA 4DSRA 2DMMA 3EU4A 1TU7A 3BD2A 2QSIA 3CTGA 2HI7A 4XS4B 3APSA 4TR3A 1GSSA 2C0EA 1KBNA 1NSWA 1B48A 2LNSA 5A4UA 4OFTA 1AQVA 5C00A 4HQSA 2IMKA 4HU9A 1YEXA 1JZWA 5ELAA 4WXTA 2A2RA 4BVXA 5GAND 1B9YC 3RPNA 1ZOFA 2V2GA 1PX7A 1Z7RA 5ECLB 1K3YA 1EWXA 3UVHA 3GA4A 5IQYA 1UA5A 4IELA 3N9JA 2VM1A 3S9FA 4IGJA 2E0QA 3FY7A 1QQ2A 5G5FA 1ERVA 1GRXA 2TIRA 2B1LA 1AW9A 1GP1A 3CSJA 3ZREA 2B7KA 2YWIA 3IPZA 1GWCA 2H75A 4IHUA 2JACA 2DMLA 1GTIA 4TVEA 2AUVA 3GKNA 1T4ZA 1QXHA 3CYNA 2LQOA 5CRHA 4GXZA 4ZBBA 5J4UA 3H4KA 2HNLA 3KD0A 5DBQA 1CQGA 4ZL8A 3EURA 5C04A 1EV9A 3UL3A 4NAXA 2O85A 1T1VA 4I5QA 3TKSC 2HYXA 4ULXA 3JCML 2GQLA 3GYKA 3DRNA 5F0GA 2PMTA 3HY2A 1DBYA 2C1YA 4MH2A 3F3RA 10GSA 1SK0A 5JCUA 1B9XC 4YQMA 3GH6A 3CSHA 2OE1A 2E2GA 1V40A 2H1DA 1PA3A 2YZHA 4RQXA 5H5SA 3VURA 1YF0A 2GZZA 4GSSA 4HEA2 1SKSB 2H0GA 1QGVA 5DJMA 1WPIA 4WR5A 4PURA 1ERWA 2DJ2A 4POKA 3IAM2 3WYWA 4K1FA 2VD1A 1F9MA 1YKAA 2X8HA 2XBIA 3CTFA 1V58A 1IYHA 4MDCA 3GNJA 2FY6A 5IPHA 1OKDA 3TCOA 4I2TA 2RM5A 3FEUA 2WGRA 1V9WA 1GLPA 1GL8A 2H70A 4ZB8A 3FR9A 3HJOA 1T4YA 1Q98A 2LV3A 2M80A 1G7OA 3ZITA 4X43A 3GTUA 5JCGA 4N0ZA 2MBTA 4BL7A 4TKYA 4JBBA 4OO5A 4K9ZA 3GRXA 4F9ZA 1TOFA 3O76A 4IBPA 4ID0A 2RUEA 3IK9A 5EL8A 3SBCA 5IMZA 1KNGA 3ZLPA 1RQMA 2DLXA 1TKDB 2HZEB 3L4NA 4XIHA 4GLTA 2BTOT 2FCHA 3GTUB 4AGSA 2A2SA 4TRXA 1UC7A 2BMXA 2O7KA 1NHYA 2O89A 2VO4A 5ECSA 4K7IA 4KW6A 2GSSA 1MDJA 2CZ3A 5E4WA 1XFLA 4HZ4A 2TRXA 5EY6A 4I97A 1NW2A 3US3A 5D93A 3ZL5A 1MD3A 2V6OA 3TKSA 5LD0A 3UBLA 1S3AA 5B6MA 1WE0A 2PU9C 3KCMA 4BWQA 3LJRA 1GTBA 1GSYA 3VWXA 2K8SA 3H79A 4G2EA 4LLRA 3HVVA 5ELGA 4NMUA 3KP8A 4MJEA 1HQOA 2PN8A 3IC4A 2C3NA 2HRFA 2WDUA 4HJ2A 1O81A 2WFCA 1AUCA 3P90A 1SK2A 1TP9A 1XBSA 2PBJA 3K8NA 3FRCA 3GN3A 3QFAC 1C72A 1UN2A 3ZVJD 3TOUA 4PX1A 3A2XA 1JZDA 5ID2B 5LCZA 2B1KA 4KAEA 4FYUA 4BWSA 1U87A 5KN0A 2H6YA 2FD3A 1BEDA 2E7PA 4TW5A 2L5OA 5F07A 1GSQA 2GT6A 4ML6A 4MA9A 6GSUA 3GKXA 2YJHA 2EIQA 4NHWA 2DIZA 5DCHA 3NOFA 5D9TA 3GIXA 3D5JA 2YANA 2X99A 3HDCA 5HR0A 3ERGA 1HD2A 3TJJA 3IV4A 1WP0A 1Q4JA 4XRAA 2JZTA 3PGTA 4ISDA 3F4SA 3TRPA 1E2YA 2O8VB 4BA7A 4D73A 4N0VA 3O6TA 4KSMA 3VWVA 1VRSD 2PWJA 3WGDA 1DE1A 2B3SA 3UARA 1ERTA 3D4MA 1TRUA 3GL5A 4G10A 2GLRA 3F9UA 1ZZYA 8GSSA 2B5EA 1SD8A 1SYXA 4ZBDA 1FVJA 1GTAA 4GCIA 3DGQA 5ABRA 2IMIA 4WEYA 3TKQA 4PQIA 3HKRA 2EIOA 3QAVA 3EYTA 2B6MA 3KMNA 1G7EA 3GL3A 5CNWA 4BPYA 4N30A 3PH9A 2FNOA 3LORA 2NDOA 12GSA 2WB9A 4FYCA 4DSSA 5B8AA 2VCXA 1AQWA 1M9AA 1FOVA 3QDNA 4Q5FA 2NPBA 1M2BA 1X9SB 2YWOA 3DVWA 3GX0A 2ALBA 2R5GA 2RUFA 5DALB 5DVBA 1B4PA 5ECHB 2FWGA 2HSHA 11GSA 4F2IA 3LYKA 3KMOA 6GSXA 2JZSA 1ZCPA 3QAGA 3WGEA 3GX8A 3KZQA 3WD6A 4MLYA 2H19A 5D73A 1FG4A 1E6BA 4J56E 2H0IA 4MP4A 3QPMA 3P2AA 1XCCA 1TRVA 1TK0B 3HA9A 3VWWA 1R7HA 1Z5YE 1A2MA 4HJMA 4RI7A 3I9V2 1BQ7A 3KIJA 4EC0A 1Z3EA 3NZNA 2H30A 4WF5A 5IMCA 1O73A 5HR3A 3TRXA 3HD5A 2H6ZA 4GQCA 4I8BA 4YH2A 3R2QA 2CAIA 1OKTA 4MCUA 2B5XA 3M1GA 4OMVA 2X8GA 2MMOA 3C73A 13GSA 3DD3A 1A8YA 1OE7A 5IM9A 1ILOA 4PQ1A 1EGRA 4KB3A 2OACA 1XWKA 3CSIA 3DIEA 3Q74A 1AAZA 1ZYQB 4ZIJA 2H6XA 2KP2A 4P3YB 1Z9HA 3FZ9A 2GSRA 2YV9A 4PNGA 4WBJA 3QAWA 1F37A 2KHPA 3APOA 1XWGA 4MZCA 1BX9A 4NV2A 1XW5A 2KOKA 4H86A 5F06A 2FWEA 2LRTA 3GKKA 3KTLA 2H8LA 1PQNA 2PERA 2VOCA 1MDKA 4TOPA 3IAS2 2GGTA 1M7TA 2LJAA 3I43A 3EE2A 4EDZA 2FWHA 5GZZB 2MMAA 1XZOA 1Z7PA 1TK8B 3LWAA 3D4TA 3LYPA 4JEDA 3E9JB 3APQA 2KLXA 4Q5NA 1XW9A 3RDWA 4ZL7A 1S3CA 3A2WA 2LS5A 6GSTA 2VUPA 3DVXA 1GSUA 1AXDA 4IW9A 2EIRA 4BVYA 2B5YA 3IR4A 4LMWA 2B7JA 1K0OA 2HT9A 5ECMB 2GDRA 1X9WB 4LA1A 1B4QA 2FA8A 1R26A 2AB6A 3Q19A 4POLA 4IQ1A 3QMXA 5B8BA 1FVKA 2GS3A 4O7HA 4GTUA 1U3AA 1HNAA 4OD7A 5DQSA 5AIXA 1EP8A 1JZOA 2H0HA 2DJJA 1M2AA 3L0HA 1WJKA 4TR0A 4X0XA 3ZTLA 4OCFA 4AJ6A 4O92A 1TI1A 3FR6A 4ILFA 3C7MA 4TR1B 2YZUA 3EMPA 3KH7A 3E3EA 2ES7A 3ZIJA 1ON4A 2NTOA 1V98A 2OKAA 4Q5RA 4OFMA 5J9CA 1VF3A 5COHA 1RW1A 4K7OA 1EOGA 1VF4A 1U6TA 2P31A 1X0RA 1OYJA 2VCWA 4HDEA 5A4WA 4KDUA 9GSSA 1OC8A 4EXJA 2R37A 5LNKe 5EVOA 4KCAA 4KCEA 1O8XA 2RIIA 2K8VA 2C80A 2F9SA 4GSTA 1UVZA 1SKRB 4IP6A 2GSQA 1A8LA 1A24A 4LMVA 2L6CA 2H72A 1FB6A 5CP1A 1TI3A 1F3BA 3F6DA 3D0ZA 2REMA 2D2ZA 1J9BA 2DJ0A 3FZ5A 4J57E 2V1MA 2AAWA 2CX3A 2VL2C 2QC7A 1S3DA 3RPPA 3TUEA 2N5FA 1GNEA 3HJPA 3UJ1A 4WKWA 4MF5A 1TXXA 1QK8A 1YKCA 4AJ8A 4FYBA 4MMMA 2NBSA 1WWJA 5ID2A 5DCGA 1JLVA 3G7IA 3VK9A 4MH3A 2QKEA 3NIVA 5HFIA 3UIWA 4EVMA 2P5QA 5ECKB 1TRSA 3IHQA 4YAPA 2IMDA 2YOIA 3CRTA 1SL1B 4HUAA 2WCIA 3LGCA 4YAVA 3BCKA 4MABA 1NHOA 1K0MA 3L9VA 3CBUA 3GSSA 1THOA 1U88A 2WULA 3GSTA 2IIYA 3ZVJA 3ME8A 4TN8A 4TXOB 1EZKA 1Z6NA 1LU4A 2K18A 5AN1A 1TDIA 3HZ8A 4MJBA 3L9SA 1O8WA 1DE2A 4ACSA 3TDGA 1JZRA 2FLSA 1YF1A 4JE1A 1AQXA 4EDYA 4HU7A 5G2ZA 5IMDA 4MPGA 5H5RA 1FAAA 1G6YA 3GKMA 3HXSA 2CV4A 1MTCA 4RI6A 4AJ7A 1BYEA 4L0UA 1A0FA 3TKSE 1AIUA 5IOWA 1O6JA 3QFBC 1YZXA 2GTUA 1EP7A 1H75A 2FGXA 3TB2A 2JADA 2VD0A 3HVXA 1SYRA 2GQKA 4F03A 3IK7A 4NPBA 1BG5A 2IPAA 1TTZA 1PX6A 5JWRB 2LJRA 1WRYA 1TW9A 3BBYA 3KM6A 3LXTA 1WOUA 1SU9A 5AISA 2IFQA 2IMFA 1R4WA 3GFKA 3U5RE 1TU8A 4GWRA 4IJ3A 1JLWA 1FO5A 2Z9SA 3N5OA 3HYPA 3IDVA 1CQHA 1IYIA 2GZPA 4IKHA 3MSZA 2YWMA 4Q5QA 4TR1A 3CXGA 4JRRA 2CVKA 4XCSA 2WJUA 2E2MA 3HCZA 2DJ1A 2P5RA 1YDKA 22GSA 2IFQB 5EPFA 1YY7A 3CRUA 5F8BA 2DC5A 3PR8A 1SJIA 1G0TA 2AYTA 20GSA 3TKPA 2K9FA 2CVDA 2P0GA 1N8JA 2R2JA 4I2UA 1LBKA 3MAKA 2DJKA 1DSBA 5KN2A 4QL9A 3VFIA 4ECCA 4MF6A 3F4TA 3ME7A 1SK1A 3KTBA 2M72A 1B8XA 5GSTA 3ZFLA 2LSTA 5ECQB 3M0FA 1XOAA 4RQRA 1EGOA 3ED3A 1XWAA 1X5EA 4NV5A 3L78A 3J7Yb 2L59A 1OVNA 4N10A 1URMA 2AV4A 2LQQA 2L6DA 2VL2A 5ENUA 2FWFA 3TJGA 4XHMA 3A5WA 1A2JA 1SJ6A 2CQ9A 2XC2A 4KGIA 2LRCA 5ECRB 2HXKA 4KUNA 3F0IA 2LKUA 2OA7A 4NHZA 4PNFA 1V2AA 1VGLA 1JFUA 1SL2B 2QGVA 1SD9A 1VF1A 2ZCTA 3A3TA 4D73B 4PUAA 1F3AA 3M9KA 4MPFA 3UVTA 5CO3A 1W4VA 3ZIVA 3OR5A 19GSA 4IQAA 4KX4A 3J7Yk 4G19A 5AIVA 4ML1A 3DMLA 4F0BA 4EO3A 18GSA 1GSDA 2JSYA 4V1Ap 3FK8A 2YCDA 5IMVA 4ZB6A 3D22A 4JR6A 4OO4A 5AGYA 1PMTA 1RK4A 1TRWA 1J08A 5IPGA 2DSAA 2F3MA 1V57A 5IMFA 3I6AA 1X5DA 3EU3A 2VM2A 2HZEA 3HVSA 4GRFA 1MD4A 4GSNA 2V32A 4FH8A 2I81A 5HFKA 4K0NA 3C1RA 3VWUA 4K8MA 3UAPA 5CRGA 2J9HA 3DEXA 3RHCA 16GSA 2MMNA 1WIKA 3UOMA 2V6KA 2VCZA 3F3QA 3G7JA 2JL4A 3ZRDA 3IOSA 2I3YA 2HRNA 4XRDA 2XPDA 2PVOC 2FA4A 3HJMA 3ISOA 3RAZA 4XS6A 2RM6A 1USBA 1GUKA 5J9BA 2C3TA 2C0FA 4QQ7A 2IJYA 1GSFA 1YJ6A 5G30A 1H4OA 1SJZA 1J0FA 1MDIA 5GSSA 3UBKA 3Q6OA 2F8AA 2H01A 5F05A 4KNDA 5IMAA 2ZNMA 1T00A 3WT2A 3G9BA 2H1GA 4HS1A 2PPTA 4K6XA 5ECNB 1GUHA 3CMIA 3EC3A 2CAQA 3ZZXA 1W89A 4V2NA 2L4QA 2EC4A 4N11A 3MWHA 2JSZA 3D21A 3P8WA 5GAPD 2CX4A 2HZFA 2CZ2A 4K0GA 4MJAA 1HNBA 1K0NA 1EEJA 1OE8A 1QUWA 2YNXA 4AF2A 1SL0B 2GZYA 4EKZA 3DXBA 3UEMA 3M8NA 3FW2A 1F2EA 4WETA 1XWBA 4HI7A 1X9MB 2MYGA 1GH2A 4POBA 2H1BA 5HFGA 1ZL9A 2PGTA 3ERWA 1HNCA 2PVQA 1SKWB 3HHVA 6GSVA 3BCIA 1AC1A 14GSA 3LFLA 3VPQA 4V2MA 1K0BA 4IVFA 3QOUA 2VIMA 3QD9A 1FHEA 1GNWA 4KSOA 4IJIA 2R4VA 1VF2A 4L0WA 5KN3A 1EEMA 2LJKA 1JHBA 4O32A 2ZUPA 2CT6A 2LEGA 17GSA 5IO0A 2LTKA 3PINA 1ST9A 3LSZA 3EWLA 2I4AA 3GMFA 3ZFBA 3ZMLA 2X8CA 1OC9B 5A4VA 5IIZA 4L5LA 2R3XA 3TJKA 4ZILA 2NVLA 3HZ4A 1OAZA 3ZMKA 3H8QA 4LL4B 5IOXA 2JU5A 5HQPA 3TJBA 3W8JA 1LJRA 3C8EA 5D96A 1THXA 2GQMA 4L5OA 4PUFC 3KH9A 1A2LA 4YQUA 3FKFA 4MZWA 2AJQB 4CDOA 4XS4A 1T8EB 3I69A 2N5AA 2OE0A 4TXVA 3F6FA 1M2DA 2C0DA 1A0RP 5G1KA 2I9HA 4DSSB 2GT5A 3TGZA 1Y25A 1K3LA 3LQ7A 2L5LA 4V2LA 5DDLA 3DWVA 4PXOA
chains in the Genus database with same CATH superfamily
2H66A 4KYWA 2H73A 1LE8A 3HGGA 1WZ2A 1FW1A 2A4VA 2RNJA 2IVMA 4KDYA 4ECJA 3BWGA 5G5EA 3C1SA 4HLXA 2ID6A 2ME6A 4JR4A 2DPDA 2XBQA 5E1ZB 2V7FA 2P6TA 4TR4A 3FMRA 2I1UA 2A61A 1Z6MA 1VNDA 3E5XA 1PJRA 5LFAA 3FHKA 4KFCA 2K5CA 5JCWA 3HB9A 2IWTA 4Q47A 1JKPC 2MZCA 2F51A 1F6MC 1U2WA 4E8HA 4UUSB 1FOWA 2AQFA 2QEXI 3GCMA 3LNQA 4MQVA 1XVWA 4RGXA 5DALA 4HYEA 2MW8A 5HVQC 3WT1A 2LVSA 5GAHJ 3KXOA 4GQFA 2HPIA 4AD9A 2H71A 3FR3A 4K7NA 2BYVE 2KKOA 1OLTA 3F23A 4C30A 3IC7A 2ZJ2A 3RKWA 4MIMA 5CREA 3BG9A 1D0ZA 4CXFA 4HA8A 4AIDA 2O6GE 5ILUA 4GDFA 3WTXC 2PG4A 4BQQA 1E17A 1KTEA 3BJ5A 6GSWA 4A12A 1ABAA 2KUCA 2H74A 3AY8A 4A6DA 1GUMA 4ECBA 1UCRA 5DYMA 2XPVA 1JTYA 4XKWA 5F1JA 2EWNA 3J81K 3R4KA 2DBBA 4PDKA 5J1YA 1ML6A 2C4JA 3I4PA 3ABMH 3ZMZA 4G9HA 4F3QA 4MZBA 2O8KA 2VL9A 4XLFA 2V6CA 4HRIA 2DFFA 1W7PD 1HF0A 4CCMA 1YEPA 5FT3A 4DOZA 3U9GA 5L71A 4M9ZA 4IVNA 3P7XA 4OMZA 5FROA 1R1UA 3OSGA 4WF2A 1PSQA 3SWLA 1G3WA 4KIGA 3M3MA 5DJLA 1MDKA 1YS6A 3BJOA 2E7WA 1K7AA 1IXSB 3GLXA 2VLVA 3CCEI 3OYMA 3I71A 1R5AA 5J41A 2M0MA 4MK3A 3KEYA 4Q4ZF 4X1UA 2A07F 4HX8A 2L01A 4FE4A 4O6JA 1KEBA 2XAGA 4BBRJ 5DCMA 4D0PA 3SZGA 5LLQA 3FYGA 4FIWA 4HZ2A 2XAFA 1XOBA 1ZMAA 2HLSA 5AIQA 4OCEA 2BXYA 2KT0A 3QR6A 2ECBA 4EF0A 2V1DA 3O3TA 1JKOC 5D9VA 4O5VA 3GTMJ 1DUGA 4V1Ag 5IO2A 3CUQA 3CDLA 2FBIA 3ELKA 4ASNA 4IN0A 3K69A 3OYEA 3TJFA 5HS8A 1XVQA 5ICCA 2A6HF 3G7YA 2HE3A 2F8FA 1SD6A 3RBTA 3Q5FA 1FZPB 4MF7A 2E2HJ 3FXOA 3SDBA 4E7SA 1J0RA 3H1CA 3H0GJ 3E3VA 1PGTA 4POMA 3GUSA 2V26A 4KT6A 1LPQA 1ZAOA 1RC9A 3C3WA 4ICYA 2BXZA 2YPMA 2AHEA 1QU3A 3FHNA 2VB6A 1DPRA 1HXDA 4HX7A 1HKSA 4DVCA 2G2QA 1I1GA 2K27A 5A5KA 4L9VA 2NXNB 3OMYA 2R5ZB 1I39A 2DBCA 3GUDA 4M9XA 2NNYA 2DFEA 4KH7A 3ZYWA 5K7HA 3B02A 4BA7A 5GAEJ 3SDGA 3RQ4A 2D5VA 2ZXWH 3P9IA 2Z16A 3KLOA 3K7AJ 5J40A 4Y7NJ 1PL1A 2M46A 1M0UA 2HTJA 3CUQB 3SFZA 1LFBA 5G31A 1OR7C 3OIPA 1TJDA 5F0HA 4NHJA 3MNGA 4HOBA 3GBGA 2ZJQF 2R3SA 1DGRM 1LFUP 1T0FC 2VN2A 3F3XA 1BC8C 2O87A 2OBIA 5J8FA 2VCVA 2Z1DA 3CCUI 3RZDJ 2MSYA 3UNGC 5F0FA 1W5TA 3CQFA 5JWOB 4DYRA 1YE9A 3IXRA 2K9LA 5JVTA 3OR1C 1K6OA 2TCTA 1GLQA 2DW4A 4OMYA 1ETYA 2H8WA 4IL6C 1FP1D 5B7CA 2K9MA 1GVJA 1NK3P 2R92J 1MH3A 4A3GJ 2E1MC 5EGOA 4FE7A 2HDDA 1FB0A 4JK1X 3VI7A 3M1EA 2VBXA 3LA7A 5HLIA 2KP1A 3MDKA 5F0CA 3CMEI 4RUVA 4EE0A 4YQVA 2G0FA 3FZAA 1JUSA 1M9BA 2P5LC 3F63A 3E97A 2WZ9A 2YP6A 3GZ6A 3DYRA 3TKRA 1IN4A 2NOGA 3VEPA 1CF7B 2DJ3A 2ON7A 1JUPA 2GSTA 1B6AA 4HQZA 1FYKA 5EF6A 1QZYA 2P81A 3A4CA 4PCQA 3A2VA 3LSGA 3DLLF 2IMEA 3F8BA 3GHAA 1VI0A 3VI5A 5ECOB 1BJXA 1UG0A 4XN0A 4HF0A 4U88A 1ZGNA 2Y0SA 5ICFA 2FUG2 2RV8A 5LGUA 2QLZA 3QRFF 1GSEA 1VZ0A 3G1OA 4NQWA 4CCNA 2R7RA 1O7UA 1P7JA 4M3BA 2VAFA 1Y6EA 2V41A 4EL1A 4M9SA 3LXZA 5GPAA 4CY6A 3F8UA 1RUNA 2KPMA 3WHCA 2LK2A 1K78B 1QMVA 5F6FA 2WRTA 1PFOA 1XXUA 2KDOA 2GXBA 4DEJA 2MBSA 1L3LA 4HW0A 1XPVA 2HSYA 4NWYA 1XSXA 4ZBAA 2MA3A 2MMZA 3GFJA 5E8IA 5DAKB 4JU5A 1IDZA 2H09A 1TK5B 3LW9A 2MYSA 3GEZA 4A0YA 2HI3A 2QSFX 5CRDA 4PGTA 2RN7A 3ZN0A 5CRWA 2GBYA 1HYUA 2LNTA 3WTZA 3TO7A 2WAFA 3CESA 4E8EA 3HPHA 4N4OB 3CCRI 2PI0A 1IW7F 2K86A 1OCOH 1MSEC 1OYYA 3S1NJ 3IA1A 2RKHA 1I5GA 3IWFA 2ZXHA 3T8RA 2FSWA 2CVBA 4ON0A 1PN9A 1PKWA 1QFNA 4BAYA 3Q18A 3D6IA 2H1AA 5CYVA 4IS0A 2HFHA 4MJCA 4OWYA 3U6VA 1Z3YA 5CYYA 2L9VA 2WA0A 4IHSA 3RPUD 3M9JA 4KITB 2AS5F 4ZB9A 2OE3A 3GURA 3VB2A 1RETA 1ETKA 2EK5A 2DTRA 3DKSA 2E2MA 2BW3B 3IRAA 3AG2H 3ZQHA 3RTRA 1K3OA 5J5NA 2XASA 2OTLI 2XPEA 4PQHA 4O5RA 3VLNA 3JSPA 1LDJA 3IV5A 2VCQA 3LAPA 4F82A 3KE2A 4JOMA 3E0UA 2KMUA 2C8UA 2WS2A 1PDNC 3BTLA 2XAHA 3QCPA 1T3BA 3UMAA 5J3RA 2QZ8A 1YTYA 4BH9A 3W2WA 1QQIA 2XDVA 1SAXA 1R5PA 2L9NA 3ROUA 2KIUA 5FLMJ 1KYWA 5L3DA 1X5CA 1KGSA 2FD5A 4E6KG 3DU6A 3LEFA 1ZYRF 5D9WA 3P5JA 5FWGA 3ONQA 3AKZA 1I9DA 2BZTA 4ZL9A 4DSQA 4LJZF 1D1AA 4GRIA 1ZYEA 1WJBA 4XRSG 4IOAF 5FHIA 3RYPA 1SAUA 4ZYGA 4WXDA 5GTIC 2YV7A 1K0CA 2RLIA 1NM3A 3HTUA 5K5OA 2ZMEB 2LDUA 1XIYA 1VQMI 1Z6RA 3HC7A 3LFUA 4YELA 4HSCX 3QYFA 4LL1B 1BOBA 1XD7A 2LNBA 3V7RA 3U1KA 3TKYA 2X6OA 2X1CA 2R6KA 2R0PA 2C0GA 2C3QA 2IN3A 3CF2A 4LB6B 2OBKA 3KP3A 1ETVA 4BHPA 5IP7J 3TOBA 5JWQB 1MEKA 1EV4A 4DJAA 2QCOA 4UVCA 2NAZA 4ZZLA 4XKVA 3W8SA 1WJDA 2BY3A 4C3HJ 2DKIA 2VLTA 5KN1A 4J2FA 3WGXA 1V5FA 4ECIA 2E1OA 2WV1A 4UUVA 3PL8A 1XWCA 2DIYA 4JX5A 2JRMA 2OADA 2YWNA 1POGA 2EIJH 2V9KA 2VL3A 2N5BA 3COAC 4AYBA 4KN4X 3PO3J 2QQAA 2W1OA 2XGDA 3NQOA 4OIOF 3IL2A 1T0FA 6GSYA 2DMPA 2FRHA 1R5ID 1JJ6C 2VCTA 3BY6A 1I6HJ 4M71A 5BS6A 5B6NA 4F0CA 3CCYA 1J75A 2K6VA 1R4NB 4GYIA 4B3XA 2CQXA 4KISA 3F4RA 3H1NA 3TRQA 5D9XA 5LHIA 4I0BA 3V1WA 3BOAA 2B7EA 3KGKA 5K7ZA 1HDDC 1X3WB 4EVIA 4NUBA 1WMJA 1N77A 2HZDA 3C71A 4OU0A 1XX5A 3TO6A 1GULA 5CJ9A 2EQRA 5DQYA 1Z1DA 3BQYA 1PL2A 2IL3A 2ON5A 3ERFA 3N97A 1Z3XA 3RIRA 4CH7A 4YIIA 3K4KA 2YJ7A 2VXDA 3M7GA 1A23A 4L5JA 3J7AO 4KDXA 1TL8A 2CA8A 1PD21 1MNMC 2K85A 4CHSA 3L9UA 4TXOA 2XKOA 4Z7XA 5ECPB 2BJXA 3VPTA 3SXYA 1GTUA 2JZRA 1O85A 4MEXF 4YKGA 3EVIA 1K6YA 4FO5A 3HYIA 1F4KA 2H76A 5EEGA 2OJLA 4L18B 2OTJI 5H5QA 3DPUA 4QL7A 2NOJB 4XLEA 1K4TA 3GH9A 2ZNZA 2WBMA 2P8TA 3IKVA 4OAZA 1G6WA 1ZELA 3IBHA 2VLUA 4L8EA 3MKYB 1CGPA 4OFNA 2A6EF 1GHCA 5HS9A 1OC3A 3HOVJ 2ZKZA 2UXXA 4I6XA 5HR2A 2HDWA 4G6QA 3FM5A 2TRCP 2XHFA 1K79A 4USSA 4WF4A 3RHBA 3HKZN 4M3FA 2LREA 3GV1A 4A3MJ 2GM4A 5FB2A 2DA1A 2HFDA 1M99A 2Z5UA 4G7OF 5HODA 1ACVA 2AO9A 4EGZA 1YQ1A 2LUSA 4K2XA 5LBQA 3OYDA 3HRMA 3W2AA 2KRCA 1A35A 1K0DA 4OAYA 1FYLA 4OWRB 1QBJA 1K0AA 4K2DA 3OIOA 2A5YB 2M7AA 1BAYA 1PKZA 3EMXA 5DV5A 3KP2A 3HSFA 1ERUA 3FZ4A 4IP1A 3D1NI 3FBIB 4PSWA 3KJYA 2LMDA 1Y56A 1T7PB 5HOOA 1V3FA 2XUBA 4MFEA 5ECIB 4DNCA 4HAMA 1TLHB 1IV8A 4HBLA 4NB5A 3DKWA 3QYBA 3L1PA 3EYYA 2BGCA 2GVPA 1QHHD 6GSSA 2R7WA 1R1VA 2VJIA 4ZXGA 1V54H 5E20A 1N2AA 3KEBA 3JCUC 2R7OA 1LJ9A 4BEHA 4F91B 3MZYA 2YN1A 3VYTB 4HF2A 2PMZN 5CAXA 5KEJA 1ZLJA 4D7NA 3HOXJ 2P4WA 3BG6A 4AWXB 4KE3A 4F9ZA 1L0OC 3A0BC 1OR7A 1WJAA 4JX4A 5D8LB 3WTTC 4YKFA 5D4SA 3F6OA 2GXAA 2HQNA 2LD5A 1JGSA 3TEDA 4HSRA 2A05A 2CU7A 3PO2J 1EOHA 1XW6A 1PRXA 2VIXA 3EINA 3LG6A 1U3IA 2FHEA 4GF0A 1B72A 1KU9A 3S15J 2L57A 5HLTA 5LRRA 2V79A 3ABUA 4OIPF 3VYUB 5HR1A 3KCCA 4B3AA 4CW9A 3K0LA 2MH2A 1STZA 4EUYA 1U8BA 7GSSA 4XS1A 4W97A 1UJ8A 2STWA 3DEWA 4WBRD 1X1BA 3CC4I 3IE3A 1SEUA 1XG1A 3VWBA 2UWMA 1OC9A 3ME7A 2J23A 1UFMA 3KYLA 4Y15A 2QA1A 5E59A 4WR4A 2OV7A 3TOTA 2GWRA 3W3CA 4KA0A 5D5UB 1SENA 4RMNA 3HSRA 2PUKC 1BBYA 3W6GA 2CV2A 1R1TA 4BXUA 4HOJA 2Y0SN 1D3YA 4CA0A 4ESBA 4HNVA 4CYDA 3I3LA 5INYA 1VQ9I 5D8IA 5DAKA 3OS2A 3OV8A 1T38A 1RRJA 2H8RA 1USSA 3KP9A 3H92A 1YIOA 3FX3A 2QA4I 2V1UA 2L4CA 2LRNA 4JZQA 4XTSA 3OYHA 4NXIA 2X64A 1ZKGA 5G1LA 1OCRH 4XK4A 4DSRA 3L00A 4PUSA 2DMMA 1MW7A 1CQTA 5CVIA 1TU7A 3BD2A 3EU4A 2QSIA 2G7UA 4EIQA 2VXZA 3FXRA 3CTGA 2HI7A 2L5QA 4XL9A 1ZK8A 4ABZA 4EJTA 4XS4B 3APSA 4TR3A 2JUGA 5CQGA 1GSSA 2D2WA 2ZC2A 2C0EA 1KBNA 3S16J 1NSWA 1BI2A 1P7IA 4A3LJ 2WB1N 3O6BB 1B48A 3I4NJ 2LNSA 5A4UA 4OFTA 4F92B 1AQVA 4I01A 2Z33A 4CYCA 2B63J 4HQSA 5C00A 1BI1A 2IMKA 2NS0A 4HU9A 2IPQX 2OZ6A 3CCQI 1YEXA 4EM1A 1JZWA 5ELAA 2K4JA 4WXTA 2M87A 2EV5A 4KMUX 5D5VB 2A2RA 4BVXA 5GAND 1BIBA 3DTKA 1MGTA 4C2MJ 1T39A 1DE2A 3HGYA 3IC8A 1JTXA 3R3EA 4H4KC 4CCLA 2XAQA 4WXHA 4HLYA 5CVUA 2EZKA 1B9YC 3RPNA 1ZOFA 4IHXA 3ASOH 4LIUA 1PX7A 1Z7RA 2V2GA 5ECLB 2Z3YA 4EJWA 5JFRA 4HZFA 4XKBA 1K3YA 2RDPA 1VFCA 3BOQA 1EWXA 3UVHA 2O7OA 3G3ZA 3GA4A 5IQYA 1UA5A 3IHUA 3N9JA 4IELA 4BHBA 5DUIA 5ICGA 3GXOA 4A3EJ 4RGSA 4A5MA 2VM1A 3S9FA 3KEQA 4IGJA 2ZJRF 3WU0A 4CYCB 2IS1A 2OF7A 3GVAA 3I64A 3FMWA 4N0BA 2K02A 2E0QA 3FY7A 1ETWA 3KPHA 1X2NA 4FASD 1FIAA 2LC2A 3S2WA 1QQ2A 5G5FA 3NEUA 4JYKA 5DD8A 1ERVA 1GRXA 4XSZF 2VL8A 4Z6YA 3HCZA 3TP3A 2R0QC 3G4SI 2TIRA 2B1LA 2XF7A 2DO7A 1Z0XA 1YOVB 2F5EA 3H5RA 2DCEA 2VKDA 1P92A 4GGGA 2R7TA 5C4XJ 1AW9A 1GP1A 3CSJA 1PP8F 2X4AA 4AVPA 2M1BA 4NDLA 2B7KA 3ZREA 1O7LA 2YWIA 3IPZA 1GWCA 4E70A 4EMSA 5M5XJ 3A01A 1MJ9A 1YW7A 2ZJPF 1HKTA 2H75A 1YQAA 1E3OC 2JACA 4IHUA 3HJEA 2KJBA 2DMLA 4XR6A 1GTIA 2MABA 1BW5A 2K40A 4TVEA 2AUVA 4B44A 3GKNA 1B1BA 1J09A 3JRHA 5JLXA 1QZEA 1U9NA 3HOUJ 1N78A 1IRXA 1T4ZA 1QXHA 3JAMK 3RI4A 3CCLI 2LQOA 3CYNA 4CHUA 5CRHA 3CO7C 1TQIA 2JA2A 4GXZA 4ZBBA 5J4UA 3H4KA 1PYVA 3U2RA 2HNLA 3KD0A 4CSWA 1RUOA 5DBQA 1CQGA 3N4MA 1Z21A 5F04A 3OYIA 2VUMJ 4Y33A 6PAXA 4ZL8A 3EURA 3TQNA 5C04A 1X1AA 1LVKA 3K1PA 4F55A 3F72A 1EV9A 2UV1A 3BDDA 5BNGA 2HOSA 3M3YJ 2O85A 4NAXA 2R7QA 4BIKA 3K9TA 1T1VA 4I5QA 3TKSC 2HYXA 2M8EA 2ZXJA 2X49A 4ESJA 4MNNA 3BR5A 2BV6A 3WG9A 4ULXA 3JCML 2QQ9A 2GQLA 3GYKA 3DRNA 5F0GA 3OS0A 3LFKA 5K5QA 4ZYDA 1HOMA 2PMTA 3HY2A 1DBYA 2C1YA 1GV5A 3Q3SA 4O5QA 3J7Yk 4XN3A 2BY2A 4MH2A 3F3RA 1D1BA 2X6WA 1SK0A 10GSA 1H88C 1ZGAA 1MNEA 2VQHA 4KIBA 1YJNI 5JCUA 2QA2A 1B9XC 1SFOJ 3D5SC 3LQQA 1IZ1A 2HQ5A 5JHFA 4YQMA 3GH6A 3CSHA 2OE1A 3IRRA 4J19A 4FQUA 5LGNA 2E2GA 2DFHA 1V40A 2H1DA 1PA3A 1M3IA 4BL0B 3JSOA 2XPUA 2YZHA 4RQXA 5H5SA 5IYBJ 4FCYA 3VURA 2MC4A 5LHGA 2Y9ZA 2R7ZJ 1YF0A 3LSKA 1H0MA 4HEA2 2GZZA 4GSSA 1SKSB 1FTTA 4RB0A 1E2XA 2ICWG 4YIFA 2H0GA 3NWSA 3C7JA 4I98B 3CUOA 5DD4A 1QGVA 5HNFA 4RGRA 2UXNA 5DJMA 1W5CC 4BS9A 4OINF 2XB0X 3KYCB 4Q48A 4EGYA 1WPIA 2XROA 4XSXF 4WR5A 4XIDA 4PURA 1JJ8C 1ERWA 4L9TA 2DJ2A 2E36A 2LG4A 4POKA 3IAM2 4RB1A 3WYWA 2CYYA 3F8FA 3MD2A 2HKOA 4K1FA 1SFKA 2FOKA 4EATA 3OR2C 3LSPA 2VD1A 4A3BJ 2HXIA 1IUYA 4AU7A 1F9MA 1YKAA 1R23A 2X8HA 2MFZA 4BJTA 2XBIA 2QGUA 1YJ9I 3CTFA 4NBQA 1V58A 4FQGA 3MWMA 1IYHA 4MDCA 4YRVA 1MBGA 4P9FA 4A2UA 3GNJA 2FY6A 5IPHA 2WWYA 3OYKA 1OKDA 3BCBA 2VKVA 3CLQA 3DTIA 4ENNA 2AXTC 3JRAA 1DPUA 1DU6A 2RM5A 4I2TA 3FEUA 5EG0A 3ZN1A 1U78A 1Z7UA 1AOYA 1GLPA 1V9WA 2PFBA 2WGRA 3CLOA 2GA1A 3VYRB 2HQAA 1GL8A 3FMQA 1A04A 4BEHB 2CQQA 5DS9A 3FMSA 2H70A 4ZB8A 4UB8C 3FR9A 5M5YJ 3HJOA 3QOEA 1T4YA 1Q98A 2LV3A 2M80A 3ML6A 1G7OA 1TNTA 4DQ2A 3ZITA 3FZVA 1JE8A 4X43A 2GQQA 3GTUA 2X6YA 1X1CA 2J5PA 2Q0OA 1O3TA 4WXCA 4BVXB 3K4MA 1S7OA 1ZLKA 2HVSA 5JCGA 3ABLH 3BJAA 2CUZA 4N0ZA 4S0HB 1XCVA 2MBTA 4BL7A 3I0TA 4TKYA 4JBBA 3TCOA 1XCBA 4ZC3A 1D0XA 3OOPA 4MGRA 3WE2A 4K9ZA 3GRXA 4OO5A 1TW2A 2FNAA 1OCCH 1TOFA 3JTHA 3O76A 3FXKA 3LSIA 1YG2A 4D1QA 1OCPA 4IBPA 3ZMUA 4ID0A 2QKLB 1LQ1A 3MFKA 2RUEA 3IK9A 5EL8A 3SBCA 1WH5A 2DT7B 3OOUA 5IMZA 1K83J 4EJOA 2PJPA 1KNGA 4BYYA 3ZLPA 1FMWA 2MBFA 4M72A 1RQMA 2DLXA 4B43A 1TKDB 3JAMZ 1MKMA 2HZEB 3H3UA 3ZQ7A 4MLOA 3RKYA 4PK4A 4LK1F 3L4NA 2FNPA 2QQ8A 4XIHA 2QUFA 4MHGA 2EIKH 1Z05A 1QO0D 3BTJA 4GLTA 2BW3A 2BTOT 2LOOA 4CZZA 2FCHA 3GTUB 4AGSA 2A2SA 4TRXA 2YX4A 1UC7A 4N9HA 1REPC 2BMXA 2O7KA 4WWCA 4U7DA 4G0KA 1EH6A 1NHYA 2NVTJ 4TV7A 4XQFA 3H93A 2OCCH 3VPRA 4A6EA 3LMMA 2O89A 2VO4A 3HBLA 2HYFA 2XKPA 5ECSA 2FEZA 4K7IA 4CGZA 4KW6A 2GSSA 1MDJA 3DLAA 2CZ3A 4KT5C 5E4WA 1XFLA 2NS7A 5ICEA 4HZ4A 1WCMJ 1BIAA 2K3FA 3KZIC 2TRXA 5EY6A 2Y0MA 3T0YA 4XNFA 4I97A 2EZIA 2E5NA 2NNNA 3FXMA 4RM3A 5IY5H 4OIQF 1NW2A 1MSFC 1XDUA 3US3A 3HSEA 5D93A 3ZL5A 3PIPF 4XBFA 2YSRA 1XMXA 1W0UA 3HOYJ 4J00A 2M45A 1MD3A 2V6OA 1KQ9A 2HOEA 1D1CA 4LITA 4ZDLA 4XLAA 3TKSA 4G6DA 2IP2A 2PN6A 4P1WA 5FKKA 1VQ4I 3BG3A 3VSLA 4UUSA 5LD0A 3UBLA 4JX6A 1HCRA 1S3AA 2VE8A 3BPVA 5B6MA 1WE0A 1P9QC 2PU9C 3KCMA 3MIXA 3HUGA 2HYGD 4CCKA 1VQ7I 4BWQA 4DZPA 3LJRA 1GTBA 2V1NA 1TW3A 3GF2A 1JHFA 2MD0A 5D4RA 1GSYA 1WJCA 3VWXA 2K8SA 4MQ9F 4ANJA 3H79A 4G2EA 4LLRA 2DA6A 1R5GA 1X1PA 3DCFA 3MCZA 1Y39A 2VKEA 4ZZDA 2CV0A 1RKWA 2Q2EB 3HVVA 4B1RA 3UR3C 1GDTA 5ELGA 3QWLA 3TW7A 4IKFA 4NMUA 4G9YA 1P4WA 3KP8A 4MJEA 1HQOA 2PN8A 1NG6A 3IC4A 1M1EB 2AXLA 2C3NA 2LLKA 3LSMA 4E7ZA 1WSUA 2HRFA 2WDUA 3X2QH 4HJ2A 1O81A 3H36A 4M3GA 1G6NA 2LH9A 1V4RA 2WFCA 3JW4A 3BT9A 4XRSA 2E34A 5HDNA 1NH3A 1AUCA 3BLYA 3P90A 1SK2A 1JHHA 1J9IA 1YJWI 1TP9A 1XBSA 2PBJA 4HPQA 2F2EA 3B73A 3IH2A 3K8NA 3TGNA 4U0VA 4RS8A 3FRCA 3GN3A 2M4GA 2OUMA 3ULQB 2XSDC 1B59A 3R0JA 4A0ZA 2K9QA 2DMQA 3QFAC 1U5TB 2BOLA 3I59A 2CFXA 1PUEE 1C72A 1UN2A 3ZVJD 3HVNA 3C2GA 3TOUA 2FU4A 1R49A 3EPZA 4KMFA 4PX1A 3A2XA 4PJNA 1JZDA 1ZGJA 2KQRA 2Q2EA 2ETHA 3FBNB 4R1HA 5ID2B 4LOCA 2STTA 5LCZA 1LDDA 1WH7A 3K6GA 3F8MA 3PIOF 3JRCA 2B1KA 2CW0F 1RPWA 4FYUA 4XMYA 2TRTA 2KRHA 3CJRB 4KAEA 1ZG1A 3ZQGA 2VOPA 3ESWB 1PN0A 4OOIA 2FMYA 2XF5A 2ZB9A 3FKJA 3SEZA 2LR8A 4BE2A 4LFUA 1U87A 4XM3A 5KN0A 2OQRA 2H6YA 1OJLA 1IN8A 2A6TA 2FD3A 3GWZA 1FBSA 2IGOA 3ZQFA 1BEDA 3ERMA 2E7PA 4TW5A 3DF8A 1HDPA 4BJ5C 2L5OA 2RAEA 4PTSA 5F07A 1GSQA 2GT6A 4ML6A 3K1MA 2X1EA 1XGMA 3CJNA 4HF1A 3I4MJ 3F0CA 4MA9A 4DYQA 2FOWA 3W6KB 4AVZA 4IO9F 1MDMA 6GSUA 1R36A 4W1UA 1DQUA 3GX4X 4EJVA 2EFWA 1B8IB 1TWCJ 3SJMA 1BJZA 3GKXA 3D5LA 2CSOA 2YJHA 2EIQA 4NHWA 2KP6A 2DIZA 1OMIA 4K2EA 2DDBA 1ZYNA 5DCHA 5E8GA 3NOFA 4Z2TA 3QYEA 2HTSA 3W6VA 4DBQA 3GIXA 2MLKA 5D9TA 2EFOA 3D5JA 3E6MA 4V19K 2Q8KA 2YANA 5E79C 2VJJA 1XC5A 2X99A 3H5AA 3HDCA 3BPXA 5HR0A 4Z2RA 2DT5A 3ERGA 3JREA 2EIMH 5E17F 1HD2A 3TJJA 1QHGA 2WC2A 1R6RA 3V8KA 4PJJA 3IV4A 4WCGA 2HRAA 5M3FJ 1WP0A 2XB5A 4ZYEA 2XGXA 5FFZA 3DPTA 1Q4JA 5KVRA 3GZ5A 2RVCA 2JZTA 4XRAA 1MD0A 3PGTA 1VF9A 2KHMA 3F4SA 4ISDA 3TRPA 1FBUA 4UY8I 1E2YA 2O8VB 2VJ5A 5EJCA 1ZG5A 4N0VA 2EV0A 3KFWX 5CVRA 4F52A 5LEJA 2FE3A 2HS5A 3TP0A 4BY1J 3ABTA 2P5KA 2O03A 1ERDA 4KSMA 3VWVA 1I6XA 3CMAI 1VRSD 2XAJA 2F4IA 4BQNA 2HQRA 2PWJA 3E0JB 3WGDA 1DE1A 3MKWB 3CDHA 4A0XA 3AAFA 1KQ8A 2B3SA 3HHGA 2W7NA 3UARA 3HDDA 1BJAA 4M74A 2EINH 1ERTA 3UKGA 1ZG3A 4BY7J 1FWZA 1IDYA 3D4MA 4OIRF 1TRUA 3LWFA 3GL5A 3BR6A 4G10A 2GLRA 3HRUA 3F9UA 3DBHB 1ZZYA 2ISZA 2I8DA 2Y69H 1C0WA 2X1DA 3G2BA 1WHUA 2E19A 8GSSA 2DK5A 3HG9A 2EFQA 2HOAA 3V4GA 4RAZA 3WGIA 2I5UA 5FKLA 4IQ4A 3H3VK 1JLVA 1SD8A 1SD7A 2H94A 3HOZJ 5IYDJ 1SYXA 5C4JJ 4ZBDA 1FVJA 4IXAA 1GTAA 4GCIA 3DGQA 4RM2A 4ITVA 2LKSA 5ABRA 4RAFA 1FSEA 4EEFG 2IMIA 4WEYA 4C2TA 3PNVA 1PP7U 2E7XA 3TKQA 1SVLA 4PQIA 1KU2A 3PFYA 3HKRA 3WHBA 5TISC 2EIOA 3QAVA 1OFCX 4ZH4F 3EYTA 4L5IA 1WPKA 2B6MA 2JVHA 2FMLA 3KMNA 1Y8QB 3M8FA 5FKOA 4KA4A 4KF9A 2QSGX 1G7EA 1T6SA 2VE9A 2KZVA 3S3NA 5KNLA 3GL3A 2ZBKA 4HNTA 2VI6A 3BG5A 4F93B 2Z99A 4LB5A 5CNWA 4BPYA 1B4AA 2EBIA 4N30A 1KQ0A 4Y13A 3PH9A 2JPBA 3HZJA 4XRFA 3ZPLA 2VODA 1ZYPA 2FNOA 3LORA 5GAGJ 2NDOA 4E7HA 12GSA 2Y75A 2WB9A 2KIMA 4FYCA 4DSSA 5B8AA 2VCXA 2ELKA 1AQWA 1X3ZB 1M9AA 3SFIA 3ZQCA 1FOVA 3QDNA 4LGWA 1LVAA 4Q5FA 4K5SA 1FBQA 2NPBA 5B1AH 2NVXJ 2HZTA 4GO1A 1UHSA 4P9UA 1F9NA 3NWTA 4LIVA 3HOTA 1BW6A 3PUBA 5K1YA 3J7YJ 4IOCF 1M2BA 1X9SB 1CF7A 4RBOA 2IW5A 1ZR4A 2YWOA 2DU9A 1GVDA 3DVWA 3CMMA 4L5EA 3GX0A 1H9GA 2ALBA 1HQCA 4B47A 2DOEA 5LHHA 2R5GA 2L4MA 2RUFA 2JUCA 4I76A 2LF8A 1SL0B 5DALB 5DVBA 4A3JJ 1B4PA 1Y0UA 1YS7A 1QZZA 2MD5A 5CLSA 2FWGA 3EUAA 5ECHB 2HSHA 1XB4A 2Y2ZA 11GSA 5ILVA 1K78A 4F2IA 3LYKA 4FETA 3KMOA 6GSXA 4A69C 2W82A 3Q0WA 1DU0A 2JZSA 4F7ZA 4V2GA 1ZCPA 2FQ4A 1S6LA 5HDKA 2YX7A 3ZQQA 3QAGA 2CUJA 1ZQ3P 5ILSA 4BDZA 3H3ZA 3WGEA 4UV9A 2FF4A 3REOA 3GX8A 4G8XA 1IN5A 5AIPA 2KLOA 3KZQA 2X4HA 4MLYA 2JVGA 2H19A 5D73A 1FG4A 3GO5A 3QPHA 2O9LA 9ANTA 1E6BA 4J56E 3GTQJ 2H0IA 1U5TC 3PUFA 4BXFA 3C18A 4MP4A 1Y8RB 4MCUA 3ZCOA 2DA5A 3QPMA 3EDPA 1BR2A 1G3SA 3DXJF 3OL3A 2GLOA 3P2AA 1EA3A 2V9VA 1XCCA 4O3MA 1TRVA 1QPIA 3HOWJ 4M73A 4BDYA 4IHTA 3QU3A 3HA9A 1TK0B 3VWWA 1R7HA 1Z5YE 1A2MA 2UUZA 3K1NA 2NVUB 5D5WB 1YITI 1FT9A 3CCJI 3PQKA 4HJMA 2IA2A 2OD5A 1WVRA 2ZNYA 2VBYA 3I9V2 3PFIA 2DI3A 2O61A 1ZRFA 1BQ7A 4RI7A 3KIJA 2R7FA 4EC0A 3CC7I 1Z3EA 3EUKL 2HVQA 3ZMDA 3NZNA 1W5SA 2DQRA 4Y3OA 3IP4B 1AU7A 2H30A 4WF5A 1RR8C 2YU3A 5IMCA 1O73A 5HR3A 3TRXA 1APLC 3HD5A 5EEAA 5DCFA 3WG7H 3GLLA 1JT6A 4XLCA 3FDYA 4XOTA 3MZHA 3AL0B 2OBPA 1U6GA 2DYSH 2H6ZA 3IH3A 1MMGA 4GQCA 4IX7A 4I8BA 4YH2A 3R2QA 2WAEA 2RQQA 2C6YA 1Z6TA 2CAIA 1X1DA 1OKTA 1FYMA 1VQ8I 2NVQJ 3LSJA 2B5XA 3M1GA 1Q1HA 1XMAA 4OMVA 2R5ZA 1T98A 2X8GA 2F4MB 1RR7A 3MAJA 2M7BA 2F6CA 3KEOA 3K4NA 1TT0A 1R7JA 1MJAA 1ENHA 3FXLA 2MMOA 2ZMEA 3C73A 1W7PA 1GLNA 1T95A 2NS8A 13GSA 3DD3A 4YG2F 3L2QA 3L2VA 1A8YA 1R71A 1OE7A 4DZJA 2B9SA 5IM9A 3J80Z 2KRFA 3BR3A 3B6CA 5L3FA 1ILOA 1T08B 1SD4A 4PQ1A 1B9MA 3I5UA 1G4DA 1EGRA 1D8JA 2IAIA 2R7DA 5KK1A 2DQLA 4ETSA 4KB3A 3DBRB 2OACA 2DOAA 4A3IJ 1XWKA 3CSIA 3DIEA 5F08A 1AAZA 3Q74A 1ZYQB 1J59A 4ZIJA 3CJQB 5JR3A 5J4YA 2H6XA 2KP2A 4P3YB 1Z9HA 2AHQA 3FZ9A 2GSRA 2YV9A 4PNGA 1S7EA 1IGNA 4WBJA 1AWCA 2K3PA 3QAWA 2K7LA 1F37A 4DGWB 2KHPA 5E3NA 4HDUA 4NNJA 3APOA 3KZZA 2L02A 1WI3A 1XWGA 4MZCA 2QQBA 3CD6I 1HA8A 1Y1WJ 1A31A 1BX9A 4NV2A 1YFHA 1XW5A 1W0TA 2KOKA 4H86A 5F06A 1YYVA 3OYGA 2FWEA 2LRTA 3GKKA 4YFXF 3KTLA 2H8LA 3P9CA 1PQNA 4G6TB 3KZYA 3W6JB 2PERA 2HWVA 2B0LA 2IXSA 3IAS2 5DUKA 4CICA 2LRDA 2IS2A 5TGTA 1E0EA 1M7TA 2GGTA 2LJAA 3I43A 1F1ZA 4HX4A 5GPCA 2HXOA 3DPLC 2KIFA 3EE2A 4EDZA 2B5EA 4FISA 3FK7A 3S2DJ 2FWHA 4G0LA 4HG2A 2MG4A 5GZZB 1FP2A 3FM3A 4BACA 2MMAA 2D1HA 2M2EA 5ERIA 1DUXC 1XZOA 3T8TA 1Z7PA 1TK8B 3LWAA 3D4TA 5J6XA 5FGMA 3V42A 3A0HC 3HRSA 3F22A 1W36D 3LYPA 2VQLA 1VQPI 2CUFA 2WY7Q 4JEDA 1XSDA 3L2CA 4U0WA 5FLVA 3APQA 1ONVA 3E9JB 3JRIA 3I53A 4XLPF 1NHAA 1PUFA 2KLXA 1XW9A 4O5UA 4Q5NA 1USTA 4RAYA 2EA2A 3RDWA 1JKRC 1T8IA 3V7SA 2IEKA 4ZL7A 5GTHC 2A68F 2L9RA 1S3CA 2LS5A 2EZLA 3A2WA 5FD6A 4KJZA 6GSTA 3LA2A 4X1EA 1IRZA 5EG0B 2MC3A 3OYFA 2VUPA 4M6VA 3DVXA 5D6EA 3GTKJ 1GSUA 2PMZA 1AXDA 4IW9A 4FTHA 1PVEA 1R4MB 5JVGF 5B5EC 1ZHFA 3SQNA 2EIRA 1ITYA 2E1MB 1H9TA 5D8KB 2IS4A 4BVYA 2B5YA 3IR4A 4LMWA 1OKRA 4G12A 2CGPA 3PSIA 2B7JA 2PJRA 4PGHA 2VQCA 4IHVA 1MBKA 1K0OA 2HT9A 5ECMB 2GDRA 1X9WB 2OCEA 4LA1A 1G8XA 1B4QA 1DGWY 2FA8A 2EILH 1BM9A 1R26A 2CV1A 4I09A 2AB6A 3IH4A 5IT3A 3Q19A 4IQ1A 3QMXA 4POLA 4BU2A 4CO8A 5B8BA 1WJEA 1XMKA 1FVKA 4PJLA 2JJ7A 4C9YA 2GS3A 1T33A 4O7HA 2DXIA 3ZRGA 2EFPA 1UAAA 4GTUA 1U3AA 2JA7J 1MH4A 1OPCA 1YX3A 3OYNA 2BE5F 4CDGA 2JQ7A 1HNAA 4OD7A 3S93A 5DQSA 3SHFA 5AIXA 4BE0A 2GXGA 3KP4A 1EP8A 3RQIA 1JKQC 4P5OA 2DFIA 2F5FA 1JZOA 2H0HA 3VDXA 1BI0A 5EZGA 2DJJA 1M2AA 3WTYC 3L0HA 1BR4A 2G9WA 1FPQA 3L9FA 1ZRDA 1WJKA 4TR0A 4X0XA 4S05A 3ZTLA 3IUOA 4Z2YA 1Y6IA 3SZTA 3WD6A 1ETOA 3TO9A 4OCFA 4AJ6A 4O92A 3HEFA 1X4OA 1TI1A 2GIVA 1RZ4A 2FBHA 3BZ6A 3FR6A 3BTIA 4ILFA 2VBWA 3C7MA 1HKQA 1X3UA 4TR1B 4ENMA 3TDZC 5H2FC 2YZUA 3AG4H 3EMPA 1EKEA 1F5TA 4KDPA 2QVOA 3E3EA 3KH7A 3R60A 4XONA 1FSHA 2ES7A 2WB1A 3ZIJA 4FHTA 1ON4A 3OL4A 3S3OA 1V98A 2NTOA 2OKAA 4Q5RA 2K9NA 5KAIC 4OFMA 1MMDA 3MQ0A 1S8NA 5J9CA 2ZMEC 1VF3A 3ECOA 5COHA 1RW1A 2CW8A 4K7OA 1WWXA 1EOGA 1X58A 1VF4A 1U6TA 2OU2A 2P31A 1X0RA 1OYJA 4A93J 2VCWA 4HDEA 1WKMA 2HU9A 3T5XA 3ZMVA 1OYIA 3P9KA 4QPOA 2VPLA 1RESA 5A4WA 1E3PA 3LA3A 3GZNB 4KDUA 1IXRC 5EDNA 1OC8A 2R7XA 1D5VA 4EXJA 9GSSA 2F5VA 4PSXA 2R37A 5LNKe 1FIPA 2Y48A 3CP2A 3MEXA 4KCAA 5EVOA 2RC4A 4AIJA 4KCEA 2YPRA 1G2HA 3F8NA 3GFLA 1O8XA 3MYDA 3ASNH 4LG0A 2RIIA 2N8GA 1VQNI 2VT2A 2K8VA 4YEJA 2C80A 5K5RA 2F9SA 4GSTA 4XICA 1IAWA 1UVZA 1SKRB 4IP6A 3CTAA 4KIFA 2GSQA 5DEQA 3HXLA 3A2KA 1A8LA 4PFPA 1A24A 2VC0A 1AKHA 2V1XA 4LMVA 2DDAA 2LFBA 2L6CA 2HEOA 1TWFJ 2H72A 1SKWB 4XRMA 1FB6A 5CP1A 1TI3A 1F3BA 3F6DA 1XTAA 2XRLA 3D0ZA 3ZOBA 1EH7A 2EJRA 5E1WA 2REMA 2D2ZA 1J9BA 1RNLA 2DJ0A 5BOXA 3FZ5A 1V5GA 2V1MA 2AAWA 3PM1A 4J57E 5DDGA 2CX3A 4A5NA 1F43A 1J7KA 4IKHA 2X48A 1IXCA 2VL2C 3CP8A 3RPQA 2QC7A 3F21A 1S3DA 3BR1A 2L3DA 2O5RA 4Q5SF 3RPPA 3SZPA 3TUEA 1I3AA 4CY8A 3K70D 4MFDA 1GNEA 2N5FA 4KUMA 3OYLA 3HJPA 1UB9A 1U5TA 1T56A 5F27A 3UJ1A 1ORKA 3G6EI 1BC7C 1ETXA 3VYSB 4WKWA 4MF5A 1TXXA 1YIJI 1QK8A 2WAQN 3Q0UA 2A3SA 1YKCA 4AJ8A 3ZMSA 3JRFA 4FYBA 1TNSA 2W85A 2V6EA 2O8XA 4MMMA 1N75A 1FOXA 2MH9A 5KOXA 4HNUA 3I59B 2NBSA 4EM0B 4YIRX 3L2WA 2JTVA 3BR2A 2MGQA 3FXJA 1WWJA 1BN5A 1NK2P 1YO5C 2GOMA 4IQJA 3EUHA 3H35A 5ID2A 4ENJA 1VQ6I 3DP7A 3FXUA 4IRHA 5DCGA 3PJRA 2DA7A 1UZCA 2DMNA 2ZFWA 2JSCA 2RNGA 3GTJJ 3R61A 1PUFB 1A36A 3G7IA 4MH3A 2W24A 2QKEA 3Q0VA 3UL3A 2DJIA 3TW6A 2GAUA 5B1BH 4BBSJ 3NIVA 1LB2A 5HFIA 3UIWA 4EVMA 1GXQA 2P5QA 4YAPA 1TRSA 3IHQA 4A3KJ 5ECKB 2IMDA 2YOIA 2DA3A 3QP6A 3QOPA 1V55H 1S72I 1YW9A 4XORA 1B8IA 2H1KA 3CRTA 1SL1B 4BQOA 1QGPA 1ZN2A 1WJFA 3L2RA 4HUAA 2YR2A 2JZYA 4HQEA 2WCIA 3LGCA 4YAVA 2F48A 3T1BA 4L9JA 1FC3A 5TJJA 2XF6A 3BCKA 1JUMA 2ECCA 3MMYB 4PZJA 1W36C 2X6XA 4MABA 2E1NA 1TTYA 1NHOA 4S04A 1K0MA 3L9VA 4NQWB 3S1RJ 3CBUA 1HSJA 1RKTA 5E3MA 3KP7A 1SFEA 3GSSA 1THOA 5C44J 3HPGA 3GTOJ 1U88A 2WULA 3GSTA 2JRTA 3G73A 2L7FP 2VKHA 2IIYA 5BMZA 3ZVJA 2DTZA 3C2HA 3ME8A 2TDXA 2V9PA 3SEQA 3KETA 5BPIA 1I1SA 2CH0A 4TN8A 3WGGA 4U7BA 3JTGA 4TXOB 1EZKA 2PX9A 3O8GA 2LY2A 3BR0A 4BKXA 3E5UA 1Z6NA 5CVVA 1BL0A 1KU7A 3P7NA 2HYJA 5BQTA 1LU4A 2K18A 5E18F 5AN1A 2COBA 1TDIA 2A5WA 3HZ8A 4MJBA 4Y17A 3L9SA 2OQGA 2IS6A 4C3JJ 1RI7A 4A3DJ 1O8WA 2XIGA 3MKLA 1S5LC 3K10A 4CCOA 4RB3C 2OAZA 3TDGA 3DTEA 4ACSA 1Z9CA 5EZHA 1JZRA 3J7AY 2FLSA 3GTLJ 2QF7A 2WADA 1YF1A 2DODA 3WE3A 3R0AA 1E3HA 3S1QJ 4IRIA 2FQ3A 2HOTA 3S32A 4JE1A 3CQZJ 1AQXA 1OQYA 3BQZA 2L7ZA 2QSHX 4EDYA 4HU7A 2XC7A 5G2ZA 4WK8F 1TQPA 5IMDA 4IZZA 1IC8A 1FOHA 1VQ5I 4D5CA 2LSOA 1X19A 4QPQA 5C3EJ 4MPGA 2LBFB 1MZBA 3M4OJ 1U0JA 1FAAA 1G6YA 3GKMA 4U0YA 5H5RA 1BR1A 2W25A 4AYBN 4GFBA 3HXSA 3VK9A 2A69F 4YFNF 2LP0A 5LGTA 2CV4A 5LD2C 1MTCA 4RI6A 3V8JA 1WGXA 2CO5A 4AJ7A 1ZGWA 5EYRA 2NRAC 1BYEA 5L3EA 1H89C 4L0UA 1A0FA 3TKSE 1AIUA 1G3TA 1LKXA 4UHTA 3MN2A 1O6JA 5IOWA 1VTNC 1YRNA 3WTUC 3QFBC 2KISA 1YZXA 2GTUA 3K4JA 2H27A 1EP7A 1IF1A 1H75A 2L0KA 2FGXA 2R0GA 1VQKI 4TOPA 3TB2A 3WU1B 2JADA 2PJRB 5KOWA 2VD0A 3HVXA 3F8CA 3HIFA 1SYRA 2GQKA 3IK7A 4F03A 4NPBA 2ELHA 2M3AA 1BG5A 1WRJA 5B3SH 2P7VB 4QSHA 2IPAA 3TDUC 5ED4A 5BPDA 1XGOA 5M3MJ 1KYZA 2HR3A 4BXXJ 2R4GA 4I6ZA 2CS3A 1SC7A 1TTZA 1MBFA 2EV6A 1PX6A 2F4OB 3WTWC 3H0DA 1B72B 4GXOA 5JWRB 2LJRA 5FRMA 4E7IA 1TW9A 1WRYA 3BBYA 1O3RA 4R79A 4MTEA 1AKHB 4IHYA 3KM6A 1BA5A 3LXTA 1WOUA 3DKXA 2DA4A 4JBAA 4X6AJ 1SU9A 3HL2A 5AISA 5HDGA 5L3CA 2IFQA 3QP5A 4U87A 5JI6A 2IMFA 2KDZA 5GP9A 1KZHA 4AC0A 2W00A 1R4WA 4NC6A 3GFKA 3U5RE 2VONA 1TU8A 4GWRA 5FRNA 4IJ3A 1SANA 2LY9A 1JLWA 1SMTA 4KICA 1T2KA 1FJLA 1FO5A 2ZSIB 4V2FA 1MNDA 2Z9SA 1U9OA 1HC8A 5CPRB 3OS1A 3N5OA 3HYPA 1MMNA 2H1LA 1YHQI 1AHDP 2Y30A 5IP6A 3IDVA 4PJMA 1U8RA 5LRSA 1CQHA 2LKPA 4C2UA 1IYIA 1WJ5A 2DT6A 2GZPA 2RGVA 3EUHC 3QODA 3QQAA 4RLFA 1DP7P 3MSZA 2ELJA 1D5YA 1R9TJ 2YWMA 2CQ7A 3CXGA 2MLGA 4Q5QA 4TR1A 2XGEA 3MVPA 4JRRA 1W1WE 4FX0A 3O6TA 4LG3A 3SYTA 2CVKA 4M3EA 1S3RA 2VOCA 4XCSA 1UMQA 2WJUA 2CRGA 5F64A 4XOPA 1UHMA 1P2FA 2H6BA 2KFDA 3DEEA 1N25A 4XLHA 5J47A 4PJ0C 2DJ1A 2P5RA 1YDKA 2DAOA 22GSA 2IFQB 3TMOA 1ON1A 5EPFA 2EPFA 1YY7A 2IA0A 3CRUA 2IJLA 2OC6A 5E3LA 2DC5A 3PR8A 1A5JA 5F1RA 1SJIA 5F8BA 2CFOA 1G0TA 3DFGA 4UVAA 1HW1A 1MJBA 1LE8B 2AYTA 4UXNA 20GSA 5CVJA 2WV0A 1FTZA 3TKPA 3PQJA 3ZP5A 1XDSA 4Y52J 2HPMA 2CMPA 5J1UA 2K9FA 2CVDA 3GYHX 2M9HA 2IBDA 1N8JA 2P0GA 3E6CC 2R2JA 3Q9VA 4G0IA 4I2UA 2E5ZA 2O3FA 2QM3A 2ZFUA 1QA6A 4A3CJ 2BVMA 1LBKA 3MAKA 2DJKA 1Z91A 3ZR8X 5L3GA 1DSBA 5KN2A 4D7MA 2GA2A 4L0YB 5BMUA 3FKIJ 3OY9A 4KN7X 5IOZA 4QL9A 4FX4A 3VFIA 4ECCA 4MF6A 3DU5A 1FOKA 3F4TA 1OCZH 1KONA 3LL7A 2IGMA 3Q9SA 3V8LA 3LSRA 3FHZA 1MBEA 3QAHA 3RKQA 1SK1A 2M72A 3KTBA 4I99C 2HVRA 3A5IA 1FX7A 3RDIA 1S9HA 2X85A 3NARA 3ISPA 4A3FJ 2IT0A 1LEBA 1B8XA 1TT5B 2IGNA 4GYGA 1NTCA 5GSTA 2F5DA 2IGKA 3ZFLA 3H9GA 4I2OA 4ENKA 2LSTA 5ECQB 5IPAA 1TBXA 4EIPA 3AG1H 5FJ8J 3A02A 3M0FA 1XOAA 5FFXA 4RQRA 3CCVI 2W84A 1EGOA 4N9IA 3ED3A 2BVLA 4M3DA 1W7PB 1XWAA 2XPWA 1X5EA 3KP6A 4NV5A 5H20A 3ABKH 3L78A 3AFHA 3NRVA 2BY1A 2L59A 4UUTA 3J7Yb 1OVNA 1EV7A 2KJCA 2VBZA 3E6DA 4N10A 1URMA 2XRNA 2W4SA 2AV4A 2LQQA 3HUGB 2L6DA 5J3LA 3D5RC 1IUFA 2VL2A 5ENUA 2FWFA 3TJGA 5H6QA 2A4HA 4XHMA 3A5WA 2LYCA 1A2JA 1SJ6A 2PQ8A 2CQ9A 2XC2A 3HTSB 4KGIA 2LRCA 3NAUA 3BZCA 1O57A 2R7VA 2HXKA 4KUNA 5ECRB 1ODDA 3D0SA 1IO2A 3F0IA 4L9NA 2LKUA 3FWEA 4LLNA 2JA6J 4HDVA 2UZ8A 5E1XA 2OA7A 3ZQLA 4NHZA 4PNFA 4LMYA 3M1CA 2R5YA 1V2AA 1VGLA 4MNUA 2JPCA 2NYXA 2CQNA 1IRGA 2WY8Q 3LSHA 4BGDA 3DQVC 3E5QA 1ZREA 1ETQA 1JFUA 1F36A 1SL2B 1O3QA 4BE1A 4H0EA 2QGVA 1SD9A 2PLYA 3RKXA 4D73A 3QPLA 1VF1A 2ISYA 2J5OA 3I58A 3H5NA 2ZCTA 4X4JA 1IN6A 3A3TA 4D73B 4PUAA 1F3AA 1ZARA 2L2OA 1VQLI 3ZMTA 3M9KA 5JLWA 1JXSA 2R0CA 4MPFA 3UVTA 5CO3A 1W4VA 3ZIVA 3OR5A 2F5CA 2DJNA 3RCOA 4BNCA 19GSA 3DWLE 4G19A 4CCJA 4IQAA 4KX4A 4ML1A 4RA2A 4ZTFA 3DMLA 5AIVA 4F0BA 1TWGJ 2JK3A 3K4CA 4EO3A 4ESFA 18GSA 1GSDA 2JSYA 4LK0F 4V1Ap 3FK8A 2YCDA 4NC8A 5IMVA 1GUUA 2HRKA 4ZB6A 1ZRCA 3D22A 3CF5F 4QWQA 4JR6A 3JR9A 4ZYHA 1B9NA 5D5XB 5JHUA 4OO4A 4P96A 5LEKA 1A6QA 1PMTA 1I27A 2COMA 3BP8A 1RK4A 5AGYA 1TRWA 1SD5A 3GMEA 1IJWC 1J08A 2HDCA 3K2AA 5EGOB 4QTRA 5IPGA 2XVCA 1M3JA 2DPUA 2DSAA 2F3MA 1IRFA 3OYJA 1V57A 3BC8A 4YFKF 3JRDA 4D9JA 2ID3A 1JI8A 1MDMB 5IMFA 3EQLF 5KHDA 2ZCWA 1QPMA 3RPUA 3RJPA 1Z77A 2W57A 2VJ4A 3I6AA 4IF4A 2EB7A 2FA5A 4M6XA 3DEUA 1X5DA 4XKCA 3EU3A 2CUEA 5IYCJ 4CUGA 2AQEA 1HW2A 2VM2A 2VQGA 4RB2C 4ZDOA 2HZEA 3M07A 4G94A 3IKTA 2E2JJ 5IT9Z 3C1DA 3HVSA 4GRFA 4EV0A 1MD4A 4BWSA 3CDIA 1SVOA 2GIZA 4GSNA 1LFPA 1P4AA 4UB6C 1RIOH 1GT0C 2V32A 4BVYB 2DN0A 4FH8A 2M0CA 2I81A 4ZYAA 2PEXA 5HFKA 2QBYA 3ZXSA 2VOOA 4K0NA 3G1LA 1I50J 1QRYA 3C1RA 3VWUA 4K8MA 3UAPA 1EJ9A 1G59A 5CRGA 1D8KA 3OIQA 2J9HA 5M5WJ 3DEXA 3IHGA 3R6SA 1ON2A 3RHCA 5H6RA 1QNTA 1KU3A 16GSA 1TZLA 2M5WA 2MMNA 1WIKA 3MKZA 3UOMA 4Y4RA 2V6KA 2GZWA 2VCZA 3F3QA 4EQQA 3G7JA 3KLNA 2CJJA 4Z2UA 3DV8A 2JL4A 3QPTA 3LAJA 3VFZA 5FLXZ 2XSJC 2ESHA 5J1RA 1SFXA 1W4MA 3ZRDA 3CO6C 1KA8A 3CCSI 2UZKA 2XGCA 3WODF 3FK6A 3IOSA 2I3YA 1R5HA 2HRNA 3J80K 5D6FA 3GFMA 4XRDA 2XPDA 2PVOC 4C3IJ 2JN6A 5HLGA 2FA4A 1I5ZA 3HJMA 4CZCA 5AONA 1I3QJ 3PSFA 2P6SA 1K4SA 1OISA 2FXAA 3ISOA 4K5RA 3RAZA 2K4BA 2R7UA 5IP9J 4XS6A 1IN7A 2DYRH 2GOXB 5A2QZ 3A01B 2RM6A 2PMUA 2H6CA 1USBA 4QLCU 1GUKA 4HV5A 4G7ZF 2CWEA 2Y9YA 5J9BA 1VQOI 4ZTJA 1MBJA 4M6YA 3WTSC 1DDNA 2E2IJ 2C3TA 2FBKA 2ESNA 2JSPA 1GV2A 3IRQA 1ZH5A 4DYCA 5IT9K 2QKMB 3L09A 2KL4A 2HGCA 2C0FA 5BRTA 4QQ7A 4ZJZA 2IJYA 1FY7A 3BG7A 1GSFA 5CQEA 3LSTA 3M8JA 3CCMI 2P5VA 4JP0A 3L2UA 2QENA 1YJ6A 2OZUA 4QIWN 2BY0A 5HS7A 5G30A 1H4OA 2X0LA 3K2ZA 1SJZA 5FD5A 1J2XA 1J0FA 2ME0A 4AIHA 1MDIA 4WX9A 2VC1A 3CC2I 3BJ6A 2EH3A 4R8HA 4BUPA 1ULYA 5TRDA 1YW8A 1XSVA 1UHWA 3UBKA 1Z7LA 5GSSA 4RAGA 3BROA 1O7FA 3OSFA 4LG0B 4FT8A 5DTDA 4DW6A 2DOFA 3Q6OA 2F8AA 2H01A 2XHKA 5F05A 1XGNA 4KNDA 5IMAA 4BQAA 3ZGKA 1BI3A 2ZNMA 3PNYA 1T00A 3WT2A 2WAQA 3J7ZI 1WQ2A 5HLHA 3WGHA 3G9BA 4E7JA 4E7KA 2H1GA 4HS1A 2PPTA 4K6XA 3K70C 1WFXA 3S1MJ 1YX5A 5ECNB 1GUHA 3B6AA 2ACJA 2JMWA 3CMIA 3EC3A 2JWTA 2M8GX 3KX2A 2CAQA 3I56I 1FEXA 5KAFC 3ZZXA 2D45A 1W89A 2IRFG 3M8EA 1SVMA 2DMUA 3ECHA 4V2NA 2L4QA 2EC4A 3OWTA 4N11A 2QYOA 3MWHA 3S3MA 2CQKA 4GCVA 1J5YA 2JSZA 3F9KA 3D21A 2I10A 2EA4A 4N4NB 3W2VA 4L0ZB 2HSMA 3TBIA 1HLVA 4MO7A 1FLIA 3PPUA 2JA5J 1FMVA 3P8WA 2LY1A 5GAPD 2CX4A 4PFOA 3V7CA 5L3BA 4J01A 2HZFA 4B09A 3OYAA 1MIJA 2CZ2A 4K0GA 4MJAA 2CW7A 1Z67A 3FXQA 3GW2A 1HNBA 1R58A 3O8HA 1K0NA 2X9DA 4II2A 4AUXA 3S17J 1HW5A 3IWZA 4LD5A 1D0YA 1X4PA 4MTDA 3VODA 2JT1A 4HQMA 1HBXG 1UELB 4RGUA 1EEJA 2K9SA 1XPXA 1OE8A 1QUWA 2W48A 4HSTA 3A03A 4E4HA 2VLAA 2YNXA 2DA2A 4AF2A 1TC3C 1O3SA 2RREA 1FNNA 1YI2I 2IA1A 3H9JA 1IG7A 3J81Z 2GZYA 4A5PA 4EKZA 3WU2C 3DXBA 2Y31A 5FKMA 2L4AA 5A2QK 2R93J 3UEMA 2BHYA 3RZOJ 3M8NA 1TP4A 3FW2A 1F2EA 1ACIA 3AL0C 4WETA 2M30A 3WTVC 4DBRA 1XWBA 4HI7A 2FJ1A 1X9MB 1S3JA 5CKTA 2MYGA 4EM2A 4KNYA 1HSTA 1GH2A 4POBA 4UV8A 2H1BA 3FF5A 1ZL9A 2PGTA 5HFGA 3ERWA 2JA8J 3N05A 1HNCA 3LOCA 2E71A 1Q1VA 2PVQA 2NVYJ 2DK8A 3G1MA 4I7HA 3HHVA 3U21A 3GTGJ 4B4CA 3DBLB 3HOSA 3BCIA 6GSVA 1AC1A 3MZ8A 5FLXK 14GSA 4ZDPA 3LFLA 4PGGA 4IHWA 3VPQA 1UG2A 2R5YB 1Y0NA 4IRGA 5HNHA 2LTPA 3KIOA 4UVBA 1S29A 3G71I 2QBYB 1K0BA 4V2MA 4IVFA 1AA7A 3GFIA 3QOUA 2VIMA 3LQRA 3JRGA 3TL4X 3QD9A 4E7LA 1FHEA 2G0EA 3E6BA 3HHHA 4P55A 1GNWA 2O0YA 2OA4A 2BEOA 2X51A 2Z9OA 4KSOA 2E60A 2D1VA 3H9QA 2LKXA 5DCMB 1ZTRA 4IJIA 3I55I 3VSKA 1R00A 4AM3A 2R4VA 2OJED 4B48A 2VT3A 4IJAA 1VF2A 4L0WA 5KN3A 3HKZA 1LUJB 2OPTA 2YS9A 1EEMA 2LJKA 2KIQA 4UNOA 3EYIA 1JHBA 2ADUA 2FX0A 2DLLA 2VPRA 3AG3H 1P6RA 4B8XA 3E7LA 2LF7A 1TWAJ 4G7HF 1S7AA 4O32A 1DP3A 2ZUPA 4IPAA 5DM7F 5FO5A 2R7SA 2G7HA 1ZR2A 2CT6A 4JQFA 2LEGA 4X0GA 3ZQIA 3EETA 4MEYF 17GSA 2ZXIA 1G3YA 5IO0A 3QPSA 2A2PA 2LTKA 3PINA 1FOYA 1ST9A 3EWLA 3LSZA 1OCTC 3PNTA 3CUQC 3DKYA 1SMYF 2QWWA 3TOAA 2I4AA 3GMFA 5IOYA 2ZO4A 3BTCA 2WTEA 1MMSA 4NC7A 4IEJA 2L7MP 1TQMA 3K4BA 3ZFBA 2LBFA 3ZMLA 5DM6F 2X8CA 5E3OA 1A6IA 1OC9B 5A4VA 2M34A 2Q1ZB 1WI9A 4XLNF 1YRNB 2P7CB 5IIZA 3K4LA 4L5LA 4EJUA 1QVUA 2R3XA 3TJKA 5GADJ 4ZILA 1Y1VJ 1JGGA 2YUSA 3HM5A 3O2PE 3S8PA 1GXPA 2NVLA 5J4VA 3HZ4A 1OAZA 2BBYA 1SFUA 2L54A 2PBIA 1NG7A 2RQPA 3JRBA 2ZSHB 2M4KA 3GTPJ 1QVTA 3H8QA 4LL4B 3RYRA 3ZMKA 3VOEA 5IOXA 1LNWA 3U1DA 3CZ6A 3I54A 2JU5A 1MMAA 3M9AA 3CMYA 5HQPA 1EF4A 4HV6A 3TJBA 3W8JA 2Z2SB 2L7KA 2XV4S 1LDKB 4BL7B 2KZGA 3KP5A 2CG4A 3S14J 1XS9A 3FISA 4BHCA 5EEHA 5K7FA 3QU6A 2E35A 1LJRA 3C8EA 5D96A 3KYDB 3ERED 1THXA 4RDUA 2GQMA 4BJ6C 4L5OA 3HRTA 2PMHA 2YU9J 4RLQA 3O3KA 4PUFC 3BZKA 4II3A 3F6VA 3KH9A 2V4JC 1R22A 1EH8A 2XAUA 5J8CA 1H8AC 1MBHA 1A2LA 3FKFA 3FIWA 3OYBA 4MZWA 4YQUA 2AJQB 2DKHA 2L9SA 2P0WA 1XG8A 4CDOA 2BHZA 4XS4A 1T8EB 3A1YA 4I0AA 4LLGF 3I69A 1X2MA 4I02A 4AIKA 3OYCA 2DMTA 2N5AA 1OYWA 2HNHA 2OE0A 3S2HJ 4TXVA 3F6FA 2HKXA 1U3EM 1JT0A 2EZHA 3RSNA 1M2DA 1IV6A 5FKNA 1A0RP 2C0DA 5G1KA 4DIQA 2I9HA 4DSSB 3CJTB 2GT5A 5B66C 3L7WA 2EFNA 1YLFA 3TGZA 3C2BA 4D5FA 1Y25A 4LLLA 1BOAA 1XN7A 1K3LA 2E1CA 5KCMA 1V5EA 3LQ7A 1XGSA 3EPTA 1LEAA 2L5LA 4V2LA 3BCAA 3E1SA 1O4XA 1P4XA 1TWHJ 2VASA 3DWVA 5DDLA 4PXOA 1K61A
chains in the Genus database with same CATH topology
2H66A 2H73A 4KDYA 1FW1A 2A4VA 4ECJA 5G5EA 3C1SA 4JR4A 2XBQA 2V7FA 4TR4A 2I1UA 4X4JA 1Z6MA 3FHKA 1PJRA 5LFAA 5JCWA 2K5CA 2IWTA 2MZCA 2F51A 1F6MC 4E8HA 2AQFA 1XVWA 5DALA 5HVQC 3WT1A 3KXOA 4K7NA 4GQFA 2HPIA 3FR3A 2H71A 1OLTA 4C30A 5CREA 1D0ZA 3H93A 5ECOB 1KTEA 4BQQA 3BJ5A 6GSWA 1ABAA 2KUCA 2H74A 3AY8A 1GUMA 4ECBA 4XKWA 1ML6A 4MZBA 2C4JA 4G9HA 4F3QA 2VL9A 4XLFA 4HRIA 1YEPA 4CCMA 5FT3A 4DOZA 5L71A 3P7XA 5FROA 1PSQA 3SWLA 3M3MA 5DJLA 2VLVA 3OYMA 1R5AA 5J41A 2M0MA 4MK3A 3KEYA 4X1UA 1KEBA 4FIWA 4HZ2A 3SZGA 3FYGA 4OCEA 1XOBA 2HLSA 1ZMAA 3QR6A 4EF0A 3O3TA 5D9VA 4V1Ag 1DUGA 5IO2A 4IN0A 3TJFA 3OYEA 1XVQA 3G7YA 2HE3A 2F8FA 3RBTA 4MF7A 3SDBA 4E7SA 1PGTA 4POMA 3GUSA 2V26A 4KT6A 4ICYA 2YPMA 2AHEA 1QU3A 3FHNA 2VB6A 4DVCA 2G2QA 5A5KA 3OMYA 2DBCA 4KH7A 3ZYWA 3RQ4A 2Z16A 1PL1A 2M46A 1M0UA 5G31A 1OR7C 3OIPA 1TJDA 3MNGA 3GBGA 2R0CA 1DGRM 1T0FC 2O87A 2VCVA 2OBIA 2Z1DA 3UNGC 5JWOB 1YE9A 3IXRA 2K9LA 3OR1C 1GLQA 5B7CA 2K9MA 2E1MC 1FB0A 3VI7A 2KP1A 4EE0A 4YQVA 3MDKA 4RUVA 2G0FA 3FZAA 3F63A 1M9BA 2WZ9A 2YP6A 3DYRA 3TKRA 2DJ3A 2ON7A 2GSTA 4HQZA 3A4CA 3A2VA 3LSGA 2IMEA 3GHAA 3VI5A 1BJXA 1UG0A 4XN0A 1ZGNA 2Y0SA 2FUG2 1GSEA 1VZ0A 4CCNA 2R7RA 1O7UA 2VAFA 1Y6EA 2V41A 4EL1A 3LXZA 4CY6A 3F8UA 2KPMA 1QMVA 2WRTA 1XXUA 2KDOA 4DEJA 2MBSA 1XPVA 2HSYA 4NWYA 4ZBAA 2MMZA 5DAKB 4JU5A 1TK5B 3LW9A 2MYSA 5CRDA 4PGTA 5CRWA 1HYUA 2LNTA 2WAFA 3CESA 4E8EA 3HPHA 4N4OB 3IA1A 1I5GA 2ZXHA 2CVBA 1PN9A 1PKWA 1QFNA