4HEA2

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 45
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hea201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hea202
3GH9A 2L6CA 1AUCA 1AW9A 4XHMA 4GQCA 2FY6A 1SD9A 5IMAA 3VLNA 3IXRA 2KHPA 2K9FA 1G7EA 5AGYA 1JZDA 1GNWA 4BL7A 4NPBA 3G7JA 4MPFA 4EC0A 3GL3A 2V6KA 1ZMAA 3RHCA 1I5GA 3GH6A 4TR1B 1Y6EA 2C1YA 3E3EA 1OC8A 4HZ4A 9GSSA 5J9CA 5FWGA 5KN2A 5F0GA 2X99A 2PERA 1OE7A 1ZL9A 5DQYA 1T1VA 2L4QA 1GTBA 3UBLA 2YJHA 1MTCA 4KUNA 2GSQA 2H73A 4KGIA 4JEDA 1YY7A 3IOSA 5ECSA 2RUEA 3KZQA 1JFUA 1HD2A 1GTAA 3OR5A 4PUFC 2JADA 3KH7A 4AJ7A 3GMFA 2VLTA 4LLRA 2ZNMA 2TRCP 5GZZB 4GF0A 2B1LA 5HQPA 1T7PB 2XPEA 4IQAA 1TI1A 1PL2A 1XZOA 2HZFA 3ZMLA 4TR3A 1A0FA 1HNAA 1HNCA 2VIMA 4E8HA 5F06A 1A24A 2C0DA 1UVZA 4GSNA 1CQGA 4MZBA 1N8JA 3FY7A 3ERFA 2IN3A 2GSTA 1WP0A 5ELAA 1B9YC 3U6VA 2XC2A 3FK8A 3ZFBA 3F3QA 1SYXA 5CAXA 4K8MA 5H5SA 4KX4A 2VL3A 3QAGA 4K0GA 16GSA 2O85A 4ECCA 2OA7A 1NHYA 2FA8A 22GSA 1VF1A 3KXOA 5D9WA 4DSQA 1PKWA 2H1AA 4EO3A 1V98A 3O76A 4PXOA 4HU9A 1LBKA 3APSA 3CXGA 4MJCA 1E2YA 3GSTA 5F07A 2JZTA 4O5RA 3VURA 2PBJA 4ZB8A 4BA7A 1T3BA 2D2ZA 4OFTA 1Z3EA 2YJ7A 4WEYA 1DUGA 3BJ5A 4HI7A 1K0CA 5D96A 5G31A 5B6MA 2X8HA 5A4WA 1FB0A 3RPPA 3GX0A 1I9DA 2CZ3A 4ZILA 2AYTA 2H6XA 4E8EA 5HR2A 4HEA2 3SBCA 3F9UA 5D73A 1QQ2A 1SKSB 3EINA 5HR1A 1AC1A 5IMCA 1XPVA 2VCTA 4H86A 3A2WA 17GSA 2BMXA 5HR3A 1SK0A 3BD2A 1R4WA 5AIXA 1HYUA 1JZWA 3DVXA 3IK7A 2N5BA 2JSYA 4NWYA 1PX6A 4KDXA 4XRAA 4TXOB 1Q98A 4G9HA 1TK0B 4ISDA 4YQVA 4WF4A 2ON7A 2C0FA 1A2MA 3E9JB 3VPQA 3JCML 2CVKA 2QKEA 4GLTA 3LQ7A 1XOBA 3TKSA 3KH9A 3TOUA 3TDGA 2KUCA 1QUWA 4KE3A 4IS0A 1T4YA 2O87A 3VPTA 1WJKA 4V2NA 4I5QA 1NHOA 1Y25A 5J41A 4EE0A 3HJOA 3GN3A 4DEJA 1GTIA 5CYYA 1K3LA 1GNEA 4D73B 4KSMA 2DBCA 5LNKe 3FZ4A 4FYCA 3BCKA 4TXVA 3GKKA 5IM9A 1URMA 3FKFA 3CSJA 3BCIA 1FVKA 3NIVA 4POBA 1PX7A 3TJGA 2VLVA 4KSOA 3TKSC 1ZOFA 3F3RA 4MJBA 2F9SA 1Z6MA 1ZCPA 2N5FA 5KN3A 3FR3A 1E6BA 3CTFA 1RQMA 4L0WA 1NSWA 1XWBA 2L5LA 3DGQA 2DC5A 2DJKA 2MMZA 3WD6A 2VO4A 1AIUA 1A23A 4IQ1A 1EOGA 1R5PA 1Z7PA 2DIZA 4MPGA 4BWQA 1OC3A 3LWAA 1K0BA 2CAIA 4XIHA 1VRSD 4N10A 4IELA 2C3QA 4LMWA 4TKYA 3GURA 1PMTA 4TN8A 1XCCA 1XXUA 3IC4A 3P8WA 4POKA 14GSA 2AAWA 2H8LA 3BBYA 4I6XA 4O7HA 2MBTA 4HQSA 2V6OA 3L4NA 4PX1A 3KP9A 1YDKA 2VCXA 1BG5A 2GZZA 2DMMA 4GSTA 5EVOA 3HVSA 1EV9A 3G7YA 4XS4B 4YAPA 1PD21 1XWGA 1ILOA 1EWXA 3F0IA 2VOCA 3VFIA 3ZLPA 6GSTA 1V57A 1JHBA 2V2GA 1LJRA 2LRNA 4EVMA 4ZBBA 1S3DA 1XIYA 2DJ2A 5J4UA 2NPBA 5GSSA 4TR4A 5KN0A 2IMDA 1RW1A 3BOAA 1O73A 2OJLA 3HD5A 5B7CA 1ML6A 2CAQA 2CVDA 2FUG2 1IYHA 5HFKA 3UBKA 2IFQA 5ECKB 3QAVA 3M9JA 2L57A 2VL2C 4WETA 3ZVJA 1TRWA 4HZ2A 2ZUPA 1S3AA 2DJ3A 5JWQB 2HSHA 5H5RA 3QAWA 1UA5A 1PKZA 1PSQA 1SU9A 3LGCA 4YQUA 3UL3A 3V1WA 2CX3A 2YWMA 4ZB9A 2H01A 4MMMA 2F51A 3A2XA 3ZITA 1M7TA 3FEUA 3UJ1A 3TCOA 6GSVA 1XVQA 3D21A 3KM6A 3GSSA 3G9BA 2WJUA 1QXHA 2MZCA 2O8VB 3EMXA 3KMOA 1EGRA 4YH2A 2H6YA 1HQOA 3FZAA 2RM6A 5A4VA 3M1GA 4JU5A 3PINA 1DBYA 3MNGA 4KNDA 3Q74A 3IAM2 3LJRA 2IMKA 1X0RA 4MCUA 1XBSA 2I3YA 5G5FA 3RAZA 1IYIA 3UVTA 5D9TA 3QD9A 3DD3A 1SKWB 2P5QA 3FR6A 1DSBA 1T00A 1PRXA 2FLSA 1J08A 1PQNA 2HNLA 2H1DA 1YEXA 5D9VA 2DSAA 3GL5A 3MSZA 1K0AA 3QDNA 3KEBA 1WOUA 1MEKA 6GSYA 1ERWA 4ZIJA 1T4ZA 4JZQA 1F3AA 2LQQA 1ZYEA 2VD0A 1K0OA 3A3TA 5IIZA 1MDKA 2AV4A 5DJLA 4FIWA 1B48A 2Z9SA 2MYGA 2NVLA 1U6TA 4LL1B 4F0BA 3L0HA 1BJXA 1U3IA 3PR8A 4L0UA 5E4WA 2XHFA 2FGXA 3GA4A 2H74A 5FHIA 3U5RE 4AF2A 1WE0A 2OBKA 5HFIA 1QMVA 4V1Ag 4MF7A 1QFNA 5DVBA 4PNGA 3FW2A 1M2AA 4TVEA 4NHZA 4NV2A 4MZWA 2FCHA 5ECNB 2X64A 1TP9A 4X43A 2WRTA 3KGKA 5A5KA 3C8EA 3D4MA 1V2AA 3EURA 1AXDA 2YZUA 4FYUA 5G1LA 1XW9A 3TKRA 2H70A 5B8AA 5DBQA 3GTUB 4NMUA 1M0UA 2B5YA 2EC4A 3APQA 2PVQA 1TU8A 2YWIA 3CRUA 3DMLA 1KNGA 5HR0A 5CRHA 5EPFA 3IPZA 2AUVA 2OACA 4AJ6A 1TRVA 4O92A 4BVYA 2KOKA 5FT3A 1TDIA 3D6IA 5IO2A 3DEXA 3H8QA 4V2LA 2YOIA 1MDJA 3FZ5A 5F8BA 2H0GA 4F03A 2HE3A 3GV1A 2QGVA 2HRNA 4X1UA 3EYTA 2VM1A 3AY8A 2YWOA 3J7Yb 3M8NA 2J23A 5F05A 3GKMA 2B1KA 2V1MA 2MMAA 1VF3A 5DQSA 2KP2A 1FVJA 2FA4A 5IPHA 3KP8A 4LL4B 2GVPA 3N5OA 2EIQA 3ZMKA 1EEMA 1EZKA 5COHA 5DDLA 3GRXA 3GKXA 4I97A 2VL9A 3QFAC 5G30A 1X9SB 2WCIA 1H75A 2PWJA 2CVBA 3MAKA 4PNFA 2HT9A 2IJYA 3ED3A 3G7IA 4XS1A 4DSSB 5KEJA 3GTUA 1PL1A 3H79A 5JCWA 5AN1A 4F2IA 4V2MA 1BQ7A 1VF2A 2F8FA 4EDZA 2GSRA 1JLVA 1G7OA 3TGZA 5ECOB 1F3BA 2FHEA 1OC9A 4FO5A 1THXA 3LG6A 1ZZYA 2MBSA 2CX4A 1TU7A 3HVVA 3S9FA 2RM5A 1FHEA 2NDOA 3EMPA 3DXBA 2DLXA 4TR0A 2HLSA 1A0RP 2GQKA 2H0HA 3TJKA 1OE8A 4RQXA 3SWLA 4WR4A 3ERWA 4IHUA 5ECRB 2C0GA 2FD3A 4RI6A 4Q5RA 4OO5A 2H0IA 4JR6A 3QFBC 1QK8A 2X8CA 2H1BA 5IOXA 2RLIA 1BX9A 1BAYA 2OKAA 2L4CA 3VWWA 3LXTA 4PQ1A 1R7HA 4F0CA 4JR4A 5DJMA 1SJIA 6GSXA 2EIOA 1KBNA 3HXSA 3M9KA 4J56E 4ID0A 1ZYQB 2K8SA 3CTGA 4AJ8A 2L6DA 2QSIA 2C80A 2I4AA 1GSSA 3LFLA 2OBIA 4KDUA 5CNWA 1GLPA 4DSSA 2JACA 4G19A 3UAPA 4WR5A 3KD0A 4ZL9A 1TRSA 2LS5A 3TRPA 1YF0A 1SJ6A 3GHAA 4HU7A 3KMNA 3UOMA 3WGXA 1GSFA 2OE1A 2GZPA 1K3YA 2ES7A 2XBIA 1H4OA 8GSSA 2NBSA 5GAPD 2OE3A 2C4JA 3P90A 6GSWA 2QC7A 1M9AA 2CT6A 2LJRA 3C73A 2HXKA 4ECBA 2AJQB 1NM3A 5C00A 5EL8A 2IFQB 1FG4A 3UVHA 2F8AA 2OE0A 1B8XA 3EWLA 3LSZA 5IPGA 2DMLA 1AAZA 4HUAA 5L71A 3I69A 1GUMA 3EE2A 1B4QA 10GSA 3UEMA 1VF4A 4ML1A 2PMTA 4FH8A 5IO0A 4K0NA 3ZYWA 3IK9A 3TKQA 4Q5QA 3F8UA 1YQ1A 5B8BA 2V41A 5LD0A 3ZIVA 3DVWA 2LTKA 2JSZA 5ID2A 3GIXA 4MK3A 3RDWA 2VAFA 3D0ZA 1O85A 1R26A 2GT5A 2MMOA 1OKDA 1GSUA 1LU4A 2GQLA 3KCMA 2LKUA 3PH9A 3VWUA 2HYXA 3ME8A 4HJMA 2LV3A 3FRCA 2GT6A 2J9HA 3TRXA 4EF0A 5IOWA 1F6MC 2HZEA 3W8SA 4N30A 1A2JA 2REMA 4GQFA 1GSYA 3W8JA 5CO3A 3DRNA 1XVWA 2JU5A 4V1Ap 1AQWA 2O89A 1KTEA 4OFMA 4MA9A 2E2MA 3DYRA 2FWGA 1TTZA 1GSQA 4HS1A 2EIRA 3ME7A 12GSA 5LCZA 2CV4A 1Z5YE 4XRDA 1S3CA 3TOTA 4CDOA 1FO5A 1YZXA 2H19A 4OD7A 4XS6A 5IMZA 2C0EA 2XPDA 5D9XA 1Z7RA 2RUFA 2B6MA 2VLUA 3M0FA 5INYA 4BVXA 3IBHA 1V58A 4KCAA 4PGTA 1J9BA 3FZ9A 1F9MA 1ERVA 1ERUA 2M72A 1XWAA 3A5WA 3IV4A 1A8LA 2P31A 4N11A 4MP4A 2NTOA 3UMAA 3HJPA 3Q6OA 4QL9A 1MDIA 4CHSA 3CSIA 4IW9A 7GSSA 1U88A 3HY2A 5ENUA 11GSA 4MLYA 4POLA 1UN2A 3C1RA 2LSTA 2JZSA 3NOFA 5CREA 1WRYA 1F2EA 1W4VA 5DAKA 2CZ2A 3TUEA 2B3SA 3UARA 5ABRA 1SL1B 4EL1A 3R2QA 1M99A 2WDUA 3CYNA 4MABA 2GSSA 2H76A 1TJDA 1TI3A 4Q5FA 1RK4A 1BEDA 2GS3A 4LMVA 4RI7A 1MD3A 2WS2A 2H1GA 5G2ZA 3IAS2 1X9WB 3IA1A 4L5OA 3F4SA 1NW2A 1YF1A 3VI5A 4PQHA 1JLWA 3TKSE 1AQVA 2HI7A 1X5EA 2WULA 3VWVA 2G0FA 4GXZA 1JZOA 2C8UA 13GSA 4MZCA 5GAND 2DIYA 3MDKA 2C3NA 3IE3A 1TOFA 1GUKA 4KW6A 2FNOA 2ON5A 3A2VA 20GSA 2VM2A 1K0DA 3KTLA 4X0XA 4RUVA 4K7NA 1EOHA 3QR6A 2I81A 2A4VA 5A4UA 4EXJA 3TB2A 2HRFA 3HYPA 2R2JA 2AHEA 4GWRA 4HDEA 2LNTA 5EY6A 3ZVJD 4HQZA 4TOPA 1WIKA 3IHQA 1X5CA 5JCGA 2FWFA 2H30A 2LJAA 2R3XA 2YV9A 1X9MB 1QGVA 1SENA 2PGTA 3D22A 1XOAA 1XW5A 5DALA 2PUKC 3CSHA 4EUYA 5J3RA 4K9ZA 3C7MA 1W89A 1M9BA 4J2FA 1F37A 1ABAA 1FW1A 4KAEA 3TJFA 1EEJA 3TKPA 2P5RA 4WXTA 3TRQA 4NV5A 4KB3A 1R5AA 2CQ9A 2PVOC 4PUAA 3GKNA 1XW6A 2YN1A 1GSDA 2IMIA 1TKDB 5JCUA 5AISA 3HCZA 3LORA 4MF5A 3EU3A 1OC9B 2VCWA 3GX8A 3WGEA 1SD8A 2LRCA 5GSTA 4XCSA 1YKAA 2KP1A 4JBBA 4KA0A 2CA8A 4WBRD 4XTSA 5HFGA 2HFDA 2ALBA 3HZ4A 3N9JA 3HHVA 4J57E 3E0UA 4ECJA 3P2AA 5CRDA 5AIVA 1G0TA 1HNBA 2JZRA 2JL4A 3DIEA 3Q19A 4NHWA 2TRXA 2OADA 3WYWA 5IQYA 3GFKA 3FYGA 1O7UA 4WF5A 3US3A 1V9WA 3Q18A 3L9UA 4ZBAA 3CBUA 4MDCA 4L5LA 2M46A 4GTUA 3KIJA 3CRTA 4N0VA 3IRAA 4ZL8A 1SL0B 4OCEA 4LA1A 4PURA 2DJ1A 2BTOT 2I9HA 4QQ7A 4ZL7A 4JRRA 3L9SA 1TRUA 3F63A 1Z9HA 5ECPB 2AB6A 1BYEA 2B7JA 2FWEA 4TR1A 2B5EA 5B6NA 4KDYA 2ZCTA 1U3AA 4KH7A 5ELGA 1SYRA 2B7KA 2YZHA 4G2EA 4ZXGA 2H66A 1EP8A 4IP6A 1OAZA 4IJ3A 4DVCA 1KEBA 5IMFA 3I43A 3ZREA 3O6TA 2M80A 1PA3A 3IDVA 2I1UA 4I8BA 2IIYA 1VGLA 2LQOA 2A2RA 2HSYA 2LEGA 1YJ6A 5JWRB 1GULA 2G2QA 1YEPA 1FB6A 1GRXA 4GRFA 4YQMA 4MJAA 3HVXA 2VD1A 1TW9A 1ST9A 1B4PA 3QMXA 2GZYA 1Q4JA 4BPYA 1AQXA 3FHKA 5ECMB 2DJ0A 3LXZA 2IL3A 1SL2B 2LNSA 3UIWA 3LYPA 3TJBA 2IPAA 1TXXA 3C71A 3F6FA 5DCGA 4OMVA 3ZRDA 4NXIA 3D4TA 2DJJA 1GH2A 2XBQA 1B9XC 3VI7A 3DWVA 2VCQA 3L9VA 2WB9A 3LEFA 2YPMA 1M2DA 1XFLA 4MH3A 2H72A 4IKHA 3I6AA 1G6YA 1GWCA 3APOA 1GTUA 1ON4A 2R6KA 2IWTA 2LUSA 2K6VA 2YANA 2R4VA 5D8IA 2WZ9A 1GSEA 3ERGA 4ZBDA 2O7KA 5ID2B 1SJZA 1SK1A 5J9BA 4ACSA 4NAXA 5J5NA 3F6DA 3EU4A 4ULXA 5H5QA 2LJKA 1PGTA 1J0FA 4GSSA 1DE1A 3F4TA 4QL7A 5CRWA 2HZEB 4L8EA 4K7OA 3CMIA 4HJ2A 5ECHB 3H4KA 4K7IA 4ML6A 1SKRB 2A2SA 1WPIA 4ZB6A 5IMVA 3ZIJA 1EP7A 3P7XA 4DSRA 5ECIB 4OWYA 2PU9C 1PN9A 1A2LA 1JZRA 2KLXA 4EKZA 1WMJA 2H75A 3EVIA 4MJEA 3HA9A 1O6JA 2PN8A 1K0NA 2L59A 2YP6A 3QPMA 5G1KA 3M3MA 4BWSA 3H1NA 1OYJA 3D5JA 3LYKA 2WGRA 4WKWA 4I2UA 3K8NA 2TIRA 2GGTA 1FOVA 3PGTA 1N2AA 2F3MA 3C1SA 1OVNA 2VCZA 2GLRA 1G6WA 2PPTA 5CP1A 2X8GA 4TXOA 3ZZXA 1XWCA 3HZ8A 4TW5A 4Q5NA 5E59A 1O81A 3FR9A 2E7PA 6GSUA 1TK8B 3GNJA 1EGOA 4IP1A 4OCFA 4F82A 1EV4A 4G10A 3QCPA 2VUPA 3WT2A 3KJYA 4IVFA 1K0MA 2YNXA 1ERTA 1U87A 5DAKB 1K3OA 5ECQB 2MMNA 2LRTA 4IGJA 3IR4A 3MWHA 1GUHA 3EC3A 5ECLB 4I2TA 2GQMA 2VL2A 4JE1A 1OKTA 4D73A 3VK9A 3KTBA 4KCEA 1MD4A 1UC7A 1XWKA 1GL8A 4ECIA 1CQHA 1ACVA 1O8WA 2K18A 3RPNA 4CW9A 1Z6NA 4ILFA 1M2BA 4FYBA 1YKCA 2E0QA 2L5OA 3HKRA 3HJMA 3TJJA 4GCIA 6GSSA 4HOJA 3DKSA 2IMEA 3ZTLA 1GLQA 3QOUA 1C72A 4K1FA 4MH2A 3RBTA 3O3TA 1O8XA 3L78A 4IJIA 1USBA 5IMDA 4POMA 5C04A 2YV7A 3ISOA 2H71A 3W6GA 3GUSA 4N0ZA 4K2DA 2GDRA 3WT1A 1T8EB 3WGDA 2WFCA 5DALB 2B5XA 1GP1A 4P3YB 1X5DA 1WWJA 1DE2A 1ZGNA 4XS4A 3HDCA 3ZL5A 3H93A 5CRGA 4IN0A 2E2GA 2IMFA 2VCVA 2N5AA 3NZNA 3GYKA 4YAVA 3RHBA 3J7Yk 2C3TA 2H6ZA 2P0GA 2BJXA 1SK2A 2V32A 2R5GA 5JWOB 5G5EA 2YCDA 4IBPA 1V40A 4EDYA 2FWHA 5D93A 4AGSA 2K8VA 4O32A 4PQIA 3VWXA 4K6XA 3ZFLA 3I9V2 4F9ZA 1TK5B 4OO4A 4MF6A 4RQRA 4OFNA 2RIIA 2YWNA 3F4RA 5KN1A 4Z7XA 19GSA 2R37A 1THOA 4TRXA 2GTUA 1A8YA 1FAAA 4WBJA 5DCHA 18GSA
chains in the Genus database with same CATH superfamily
2P8TA 2DTZA 3T5XA 2L6CA 1AUCA 3GH9A 4HYEA 1AW9A 3BTJA 4XKWA 5IP7J 3LQQA 4GQCA 4XHMA 3CJNA 2FY6A 1SD9A 3KP2A 4DYQA 5IMAA 2FBHA 2AO9A 3CCJI 3IXRA 3VLNA 1G3WA 2KHPA 3BQYA 3KP3A 3ZXSA 1U2WA 2K9FA 3DEUA 1G7EA 5AGYA 2VASA 2IGMA 1SAXA 1JZDA 2BZTA 1GNWA 3EUHA 4BAYA 2W00A 1TTYA 2DKHA 3ABUA 4BL7A 2W48A 2GM4A 4NPBA 2LG4A 4B8XA 4FISA 4LD5A 1IN6A 4XLPF 3G7JA 2XHKA 1W5CC 2EA2A 2YU9J 4MPFA 4EC0A 3GL3A 1K4TA 5BPIA 3I4NJ 2V6KA 9ANTA 3EYIA 2BXZA 1EKEA 1ZMAA 2WV1A 3RHCA 1I5GA 1ZYPA 4BHCA 4A3KJ 2H1LA 1ZGAA 3WU2C 1JKOC 4PGGA 1R4NB 4G6DA 3GH6A 4D7MA 4PFOA 4TR1B 3NEUA 5TRDA 2CYYA 1T98A 5IT9Z 1Y6EA 1OC8A 2C1YA 3E3EA 4D73A 3BP8A 1IRXA 4HZ4A 3IV5A 9GSSA 5J9CA 1P2FA 2ZXJA 5FWGA 3F6VA 4BBRJ 4EM1A 5CQGA 3S1NJ 5KN2A 5FGMA 5F0GA 2X99A 2PERA 4BE2A 1MBEA 4HV5A 4Y17A 2DYSH 2MW8A 1OE7A 5IT3A 1ZL9A 5DQYA 1T1VA 2L4QA 3TP3A 3IWFA 1GTBA 1ON2A 3NQOA 2NVXJ 3UBLA 5FLMJ 2IP2A 4KIFA 3DF8A 3JW4A 2YJHA 4B3XA 1MTCA 2L5QA 2A07F 2O8XA 2GSQA 3QPSA 4KUNA 5IPAA 2DA4A 2H73A 4KGIA 3HPGA 4JEDA 1G3YA 5LEKA 3WHCA 3JRGA 4O3MA 1YY7A 3IOSA 3M7GA 4AWXB 2I8DA 3EUHC 2M1BA 4OWRB 5ECSA 2E1MC 2VJ4A 4UVCA 1U5TC 2KIMA 3HHHA 4BYYA 2RUEA 3KZQA 1ZLKA 1BBYA 2ZSHB 3E97A 1JFUA 1HD2A 3QYEA 4KN7X 1GTAA 3OR5A 2XAUA 4G0IA 3D5RC 2NAZA 3ZMTA 1UELB 4H0EA 2XV4S 4AD9A 4PUFC 5KNLA 3HGYA 3MN2A 2VOPA 2JADA 3KH7A 4AJ7A 1HSTA 4YKGA 1T0FC 3BPVA 4BHPA 5GPAA 2EH3A 3PIOF 3GMFA 2DMTA 5CQEA 3WTSC 5K7HA 4RB1A 2VLTA 3LA3A 4B09A 1AU7A 2W4SA 3K10A 1IV6A 2ZNMA 1X3UA 4LLRA 3UMAA 4Z6YA 2TRCP 3PIPF 5GZZB 5KAFC 4L9TA 5CKTA 1Z9CA 5KOWA 4GF0A 3NRVA 2R7DA 2B1LA 5HQPA 1D1AA 1T7PB 2XPEA 2QCOA 2CJJA 3GWZA 3ZCOA 4E7SA 4IQAA 1TI1A 3DLAA 1PL2A 2RVCA 5L3EA 1P7IA 1XZOA 2HZFA 3HRMA 3ZMLA 4YELA 4TR3A 3K2ZA 4G7HF 2P6SA 2XUBA 3H5NA 3K1PA 2H1KA 1I5ZA 4ESFA 1A0FA 3TKYA 3CCQI 1D0ZA 1TQPA 5FKNA 1HNAA 1TWAJ 1HNCA 4HX4A 2BW3B 4NUBA 3NAUA 2VIMA 1L0OC 4E8HA 5F06A 1SFEA 3OS1A 2E2HJ 1A24A 2Y9ZA 2IGKA 4ZYHA 1KU9A 2CQNA 2C0DA 1LJ9A 4Z2YA 2M4KA 4FE4A 1MNMC 1UVZA 3G1LA 4GSNA 3ECOA 2XSJC 4MZBA 1CQGA 3KYCB 5JHFA 1A36A 3OWTA 2Z3YA 3C2GA 1SFOJ 1VI0A 1N8JA 1ZKGA 4BS9A 3FY7A 3ERFA 2IN3A 2GA1A 2HZDA 3CP2A 2LYCA 4JYKA 1MSFC 2GSTA 3Q9SA 1WP0A 1WI9A 4WCGA 5ELAA 1OYWA 2IPQX 1B9YC 3U6VA 2GLOA 3CJRB 2XC2A 3FK8A 2PMUA 3ZFBA 3F3QA 4IHTA 1SYXA 1RRJA 1X2MA 2P6TA 1QGPA 3GBGA 3CLOA 5B1BH 2NS7A 3ASNH 5CAXA 3V4GA 4K8MA 3CCYA 1EV7A 5H5SA 4KX4A 2MGQA 4HBLA 1VQPI 2VL3A 3QAGA 4K0GA 2X4HA 4MTEA 5JVGF 3TO6A 5LRSA 16GSA 2O85A 4ECCA 3A01A 3VPRA 4BE0A 3CJQB 3WG9A 2OA7A 5FKOA 2JPBA 1NG6A 3FXQA 2CUFA 4BXUA 3H0GJ 3AL0B 2L01A 2DOFA 4HQMA 1NHYA 22GSA 3OIPA 2FA8A 1R36A 1U8RA 1VF1A 3KXOA 3KPHA 3QPTA 5D9WA 1EJ9A 3IRQA 4DSQA 2FNPA 3DPUA 1PKWA 2H1AA 3HSRA 2YSRA 4EO3A 2QQAA 3M4OJ 1V98A 2JMWA 1XC5A 4U7DA 2EPFA 1Y0NA 3O76A 4HU9A 4PXOA 1FP1D 4HG2A 1LUJB 1LBKA 3TO9A 2JVHA 5C3EJ 3APSA 3CXGA 4MJCA 3DPTA 3FHZA 1UB9A 1VZ0A 1B1BA 2BY1A 1E2YA 5BMUA 2JA6J 2UXNA 3S14J 2IS1A 4BY1J 4E70A 1P4WA 2ADUA 1DGWY 1JUSA 3RIRA 5EZHA 3GSTA 5D6EA 5F07A 1APLC 4R79A 3F8MA 2JZTA 2P5VA 1J5YA 4O5RA 2HPMA 3VURA 5CJ9A 2H94A 3K4JA 4L9NA 3DTIA 3VWBA 2ELKA 3E1SA 2M7BA 1T3BA 3VYSB 2D2ZA 4OFTA 2XPUA 5EYRA 4BA7A 2XB0X 1Z3EA 2QM3A 4II3A 4E6KG 2YJ7A 2NVTJ 4WEYA 4XR6A 3FM5A 1DUGA 3BJ5A 4HI7A 3BROA 1N25A 5HOOA 4EJVA 4BQQA 1K0CA 5D96A 2QWWA 3LWFA 5M3MJ 4RAYA 5G31A 5B6MA 2X8HA 3SJMA 1F5TA 1FB0A 5A4WA 1VQNI 5K7ZA 4XOTA 2M2EA 3RPPA 1X1DA 1XSXA 2VE9A 2B0LA 2DN0A 2FMLA 3GX0A 4A3IJ 1ENHA 1W36C 4GDFA 1I9DA 2CZ3A 2FMYA 2VB6A 3MD2A 1ETYA 4HNVA 5ICEA 2AS5F 3ESWB 2AYTA 2VBWA 2H6XA 1ZH5A 1O3TA 5EEHA 4E8EA 5HR2A 3L09A 1B6AA 4I2OA 3DTEA 4HEA2 4RS8A 4N4NB 1ZG5A 3SBCA 3F9UA 1HKQA 5D73A 2QKMB 4NQWB 1QQ2A 1JJ6C 2KDOA 4EMSA 3KX2A 4HZFA 1SKSB 1YRNA 3EINA 5DUKA 1AC1A 5HR1A 2NXNB 3P7NA 5IMCA 5BMZA 4HLYA 1XPVA 5JLWA 2BW3A 4IF4A 3OYFA 3M9AA 1FNNA 2K4BA 2VCTA 4H86A 3A2WA 4I98B 17GSA 2BMXA 3S17J 2X48A 1KYWA 5HR3A 2H09A 3FM3A 3T0YA 3PUFA 1SK0A 1I50J 2XGXA 1V3FA 3BD2A 2PMZN 1R4WA 1HYUA 5AIXA 1R5ID 1D5VA 2ZFWA 4B4CA 3K6GA 1WJBA 1JHHA 2MA3A 1JZWA 3CQZJ 5ICGA 3DVXA 2N5BA 3IK7A 1G3SA 2DT6A 2FF4A 5JLXA 1W7PA 2JSYA 3N4MA 4NWYA 4MQ9F 3E6MA 3K4CA 1SD5A 1PX6A 4ETSA 2NNYA 4JQFA 3SDBA 4KDXA 4XRAA 1I27A 2R3SA 4IRGA 4BDZA 1NHAA 1MDMA 4G7OF 1Q98A 4G9HA 2XAGA 3HRSA 3KCCA 4UUSA 4E7JA 1TK0B 4ISDA 2HQRA 1U3EM 3LFKA 2FJ1A 4QIWN 4YQVA 5JI6A 4YIFA 3DLLF 4I7HA 3L2UA 4GCVA 5GAEJ 4WF4A 2ON7A 2C0FA 3H0DA 1QA6A 1A2MA 3GTLJ 1USTA 3E9JB 5ERIA 3VPQA 3JCML 3OYKA 1UG0A 2CVKA 2HKOA 3SYTA 2XVCA 2QKEA 5DCMA 4GLTA 4J01A 3LQ7A 1T8EB 1TZLA 4P9UA 1Y1VJ 5L3GA 2STTA 1HKTA 1XOBA 1H9GA 4PSWA 3TKSA 2CQ7A 3KH9A 3ONQA 4UB8C 5KHDA 3WGHA 2Z99A 3ZR8X 4WWCA 3TOUA 3TDGA 3BT9A 2KUCA 1QUWA 4KE3A 1REPC 2CS3A 1HOMA 4IS0A 1T4YA 2O87A 3CP8A 3WTZA 3ISPA 3VPTA 2KIUA 3DBHB 1WJKA 4F55A 1VNDA 1SVMA 2BY0A 5AIQA 4B47A 4EV0A 3F21A 1NHOA 1Y25A 2CWEA 4I5QA 4V2NA 2K5CA 5J41A 4EE0A 3HJOA 1T39A 3GN3A 5FRNA 2KRFA 2JT1A 5F04A 4DEJA 4Y15A 2I5UA 1GTIA 3L00A 3OYAA 4BXFA 1RETA 5CYYA 1QHGA 1KA8A 5LRRA 1S6LA 1K3LA 2ZC2A 1GNEA 2Y48A 4D73B 3H9JA 5M3FJ 4KSMA 4ENJA 2DBCA 3WTTC 1HA8A 2NOJB 2Y0SA 3OIQA 4ESBA 2R7XA 3FXMA 4G0LA 5LNKe 4OMYA 2IS2A 3BR2A 5DDGA 2WTEA 1R7JA 3FZ4A 4FYCA 3BCKA 4EQQA 2LLKA 3KYDB 5FJ8J 4BEHB 2RNGA 4L0ZB 2JWTA 3ABKH 4TXVA 2CH0A 3GKKA 3JTGA 1ETWA 3AL0C 5IM9A 5F64A 5FLXZ 1URMA 3ZQCA 2ID3A 3FKFA 3O8GA 2A5YB 4LB5A 3BR5A 1FOKA 2QQ8A 3CSJA 4OU0A 3BCIA 1FVKA 3JRAA 3NIVA 4POBA 3QQAA 1ONVA 1PX7A 2K9SA 3TJGA 4EATA 2IA0A 2VLVA 3R4KA 4KSOA 3RKQA 4XRSA 4E7LA 3TKSC 3TL4X 1ZOFA 3F3RA 5HDGA 1WGXA 4MJBA 2F9SA 3GX4X 1Y0UA 2R0PA 2Y2ZA 3TDUC 1Z6MA 2V1NA 4JX6A 2A6EF 1V54H 2ZO4A 2X6OA 4CYCB 4KFCA 2EFPA 1ZCPA 2N5FA 4PDKA 5KN3A 5D5VB 2DTRA 3FR3A 2GAUA 1E6BA 3CTFA 4QWQA 1RQMA 1E3PA 4L0WA 2X49A 1IUFA 1NSWA 1XWBA 3H36A 5BS6A 5IY5H 4IHYA 2ME6A 3I71A 1O57A 2VOOA 3DBRB 3J80K 2L5LA 2CUZA 2L9NA 3DGQA 2M4GA 2DC5A 3OYGA 2DJKA 4DZJA 1ZYNA 2MMZA 3QU6A 5BNGA 5HDNA 3G3ZA 1VQMI 3WD6A 5J6XA 2VO4A 3IL2A 1XDSA 1IDZA 1AIUA 2P7VB 2L9RA 1A23A 5CLSA 4M71A 5FLVA 2VT3A 3E3VA 3LSJA 1P9QC 1AKHB 4IQ1A 1WKMA 1EOGA 4A12A 2HOSA 1R5PA 1Z7PA 5CVIA 3AFHA 2DIZA 2F5EA 1K79A 1WZ2A 5F0FA 4MPGA 5DD8A 2LY9A 1XDUA 4BWQA 4IXAA 4NC6A 1OC3A 3LWAA 1K0BA 1HW1A 2CAIA 2E34A 2KL4A 1I39A 4G12A 3ZQ7A 3MWMA 1WJFA 5F27A 3JAMK 2ZJPF 4XIHA 3KZYA 5D5XB 2OUMA 3S1QJ 3FMQA 5FRMA 1VRSD 4N10A 2NS8A 3T8RA 4IELA 3LFUA 1GVDA 2C3QA 4LMWA 1D1CA 4TKYA 3GURA 3FZVA 1RESA 2K4JA 3H9QA 4GYIA 1PMTA 4TN8A 1XCCA 2HDCA 4A2UA 2IRFG 1Y1WJ 4M9ZA 1XXUA 3IC4A 5CVVA 2EV5A 2W82A 4ENKA 3P8WA 5EEAA 4ICYA 2HZTA 1XSDA 1TWFJ 2AQEA 4POKA 14GSA 1D0YA 1MBKA 3RCOA 2AAWA 1X4OA 2K85A 2H8LA 3S1RJ 3BBYA 1OQYA 2MD5A 5DS9A 3KP5A 3J80Z 4I6XA 2BVMA 4DZPA 4BU2A 4XORA 2M8EA 3C2HA 1SMYF 1Z3XA 2DYRH 2CV1A 4B3AA 3OOUA 1S3RA 2MBTA 3GTPJ 2V6OA 4HQSA 3L4NA 4O7HA 2DMPA 2JRTA 2LOOA 4XQFA 3KP9A 4D5FA 4PX1A 2QBYA 1YDKA 2VCXA 3PPUA 2OD5A 1Z3YA 1BG5A 4CZCA 2LKPA 1IRFA 4BH9A 2GZZA 2DMMA 4GSTA 5EVOA 2QQBA 3UKGA 1ON1A 2DAOA 3LSRA 1EV9A 3G7YA 3HVSA 4IPAA 2GZWA 4XS4B 4ZTJA 5J1UA 4XRMA 5LBQA 2ZKZA 1R9TJ 1F1ZA 3VDXA 4YAPA 1J0RA 4XRFA 1PVEA 2DPDA 2HVRA 1PD21 4BJ5C 3A2KA 1XWGA 4KYWA 4GTUA 2ZJRF 1ILOA 5LEJA 1EWXA 4KISA 1GV2A 2FQ4A 4L0YB 4OIQF 2DMQA 3JAMZ 3F0IA 2NYXA 5FFXA 3GZ6A 2VOCA 3ZP5A 3VFIA 3ZLPA 2XAQA 1A5JA 4XLNF 1V57A 6GSTA 1JHBA 4B48A 2V2GA 1LJRA 4I01A 5D5UB 3CMAI 1IXSB 1F4KA 4I0BA 2LRNA 4BEHA 3LAJA 4ZBBA 4EVMA 1S3DA 1XIYA 4CH7A 3K1NA 2DJ2A 5J4UA 4RGXA 2LVSA 4U0VA 4BBSJ 2LKXA 2NPBA 3V7SA 5GSSA 4TR4A 2OQRA 1MGTA 4KT5C 1YFHA 2R5ZB 3ZGKA 1YI2I 5KN0A 2HQAA 2KZGA 3HKZA 4MH3A 3CDIA 3JRFA 2IMDA 4Y4RA 4RB0A 3BZCA 4Y13A 3ROUA 1RW1A 3BOAA 1K7AA 5AIPA 2DK5A 3GMEA 1O73A 4M73A 1ULYA 2OJLA 3HD5A 3DPLC 5B7CA 2EFWA 2A6HF 1ML6A 2CAQA 5LHHA 3FF5A 3MZ8A 1XB4A 2FUG2 2DBBA 3OR2C 1ZHFA 5ICFA 2JA7J 1IYHA 4OIOF 5HFKA 3UBKA 2IFQA 5ECKB 3BY6A 3R0AA 3Q0WA 2XKOA 3QAVA 2HRKA 2IW5A 1N77A 2L57A 2VL2C 3M9JA 1ETXA 1Y8RB 4WETA 2VT2A 3ZMDA 5F1JA 3ZVJA 1TRWA 1H8AC 4EDYA 4HZ2A 2ZUPA 1IW7F 2XKPA 2O61A 3FMWA 3G2BA 4AU7A 3GLLA 2GQQA 2AQFA 3CUQB 3C18A 3N05A 5B66C 1POGA 1MW7A 1XSVA 1S3AA 2DJ3A 5JWQB 1DQUA 5D4SA 2HSHA 5H5RA 2FU4A 3DV8A 3ZQLA 1UAAA 4MHGA 5J8FA 4K2XA 3KIOA 5GP9A 3QAWA 1UA5A 1BW6A 1YJNI 2EZLA 1J9IA 2IGOA 2JTVA 3SEZA 1RKTA 3PSIA 3F72A 3MZHA 4L18B 1GUUA 2LNBA 2E71A 2DMNA 3FX3A 4LB6B 3GVAA 1PKZA 1I6XA 2LF8A 4NNJA 2F4IA 1PSQA 2WAQA 3DEEA 1BC7C 3RPUA 2VQLA 5LFAA 5KVRA 4BL7B 1XPXA 2KT0A 1SU9A 3LGCA 3BOQA 4YQUA 3ELKA 4KT6A 3UL3A 3V1WA 3BR0A 1Y8QB 2CX3A 2JZYA 2YWMA 2AHQA 2P4WA 3ASOH 1FYKA 3BG5A 4Z7XA 4ZB9A 1J59A 1VQ8I 2H01A 4MMMA 2F51A 3A2XA 3ZITA 1M7TA 3FEUA 2OV7A 5TISC 3LSIA 3KYLA 3UJ1A 3TCOA 3H1CA 2M9HA 2DA6A 1QO0D 6GSVA 1XVQA 1T38A 1IC8A 4BUPA 3D21A 4R1HA 3M8FA 2LSOA 3QOEA 3HOVJ 3M8JA 1M3IA 2QKLB 3I5UA 2K86A 1TT0A 1W5TA 3KM6A 2DJIA 3S2WA 3WODF 3GSSA 3P9IA 4A69C 3G9BA 2WJUA 5FB2A 1A6QA 1OCCH 4BY7J 1QXHA 1W0UA 1MBHA 2HEOA 1JGSA 2MZCA 5EDNA 2O8VB 2VBZA 3ABMH 3EMXA 2EJRA 3KMOA 1EGRA 1LDJA 4YH2A 2H6YA 1HQOA 2OA4A 3FZAA 2XPVA 3HOXJ 3FHNA 2RM6A 1B59A 5A4VA 1YOVB 1QRYA 4L5IA 3M1GA 2LR8A 1FLIA 4FE7A 4JU5A 3PINA 2NVYJ 1I6HJ 1DBYA 3MNGA 4A6DA 1FC3A 4KNDA 4JP0A 3Q74A 2X1DA 3IAM2 3EQLF 3LJRA 2IMKA 5E20A 1X0RA 4IQJA 2QZ8A 2TDXA 1FOYA 4LLLA 4MCUA 2K40A 4GO1A 1XBSA 3KZZA 2I3YA 5CYVA 5E17F 5G5FA 1DPRA 1YW9A 1KZHA 1E3OC 2DLLA 1WJ5A 2G9WA 3ZPLA 3RAZA 1IYIA 3UVTA 5D9TA 4OAZA 5FROA 3QD9A 1Z91A 2VIXA 4BACA 3OIOA 2P5QA 3DD3A 3FR6A 1SKWB 1DSBA 1T00A 2WB1A 1QZEA 5F0HA 1PRXA 1X3WB 1IUYA 3TDZC 4HNUA 4MTDA 3RSNA 5J4VA 1LE8A 2Z9OA 2ETHA 1J08A 1PQNA 3LSGA 2FLSA 2HNLA 4HOBA 2VN2A 1E2XA 4PJ0C 4F3QA 1R4MB 4UUVA 4V19K 2EZKA 2H1DA 1LFUP 2JN6A 3KZIC 3CCSI 4KIBA 1YEXA 1O3QA 2YS9A 3H3VK 5D9VA 2R7FA 4EJUA 2BOLA 2DSAA 3GL5A 1ETKA 4ZYEA 1XGSA 4HX8A 5BQTA 3MSZA 3K70C 1BA5A 3M07A 2YU3A 1H0MA 1K0AA 2M3AA 2V9PA 3QDNA 1ZLJA 2JUGA 3KEBA 1WOUA 2E2JJ 1MEKA 6GSYA 4IHWA 1ERWA 4ZIJA 5H2FC 4D1QA 4M6VA 3CUQA 1T4ZA 4JZQA 3J81Z 1F3AA 2COBA 4XLAA 2LQQA 1ZYEA 2VD0A 1OYIA 3O8HA 1OISA 4D5CA 1K0OA 3A3TA 5IIZA 1X2NA 4NDLA 1MDKA 2VKDA 4BJTA 2AV4A 4AYBA 5DJLA 4FIWA 3TGNA 2LY2A 1KU3A 1B48A 3CC4I 2Z9SA 1B4AA 2YX7A 1DU0A 3K9TA 2MYGA 2NVLA 1P6RA 1U6TA 4DW6A 1MBFA 1V5GA 3I55I 4LL1B 4F0BA 3L0HA 3BZKA 1BJXA 1ORKA 3DCFA 2OBPA 1U3IA 4JBAA 5IYBJ 5D8KB 1BL0A 3PR8A 2VPRA 4L0UA 4D0PA 2XHFA 5E4WA 3BQZA 1XTAA 5TGTA 2FGXA 4XKBA 2KDZA 3VSLA 5DM7F 5LD2C 3GA4A 1ZTRA 1OLTA 2ECCA 2H74A 4O5QA 2JSPA 5FHIA 4CCOA 3U5RE 4AF2A 1WE0A 3GLXA 2OBKA 4H4KC 2HWVA 3A01B 4LK1F 1TQMA 3E6CC 5HFIA 1P7JA 4YG2F 2P5KA 4PUSA 1QMVA 4V1Ag 2RQQA 4MF7A 1TWCJ 1QFNA 4AVZA 1IJWC 2BV6A 3EPZA 3PFYA 4OIRF 1IV8A 5DVBA 3CUQC 2DA7A 4HSRA 4PNGA 3FW2A 1M2AA 2G0EA 4L9VA 4TVEA 4NHZA 3DU6A 3UNGC 4NV2A 1IAWA 2FCHA 4MZWA 5ECNB 2X64A 2OJED 1TP9A 3IH3A 3KEOA 5M5WJ 4AIKA 2L54A 1AA7A 2LF7A 4RM2A 1ZRDA 1YQAA 1N75A 4X43A 3F23A 4JX4A 2XROA 4MNUA 4OMZA 2WRTA 3KGKA 5A5KA 3C8EA 1SVOA 3D4MA 2PMHA 3CC2I 1V2AA 2F5DA 3EURA 3TOAA 4I6ZA 2Y0MA 1T8IA 1AXDA 2YZUA 1MMDA 1W1WE 4FYUA 1YW7A 5G1LA 2CO5A 3GTOJ 1XW9A 1F43A 2H70A 2E36A 1HF0A 3TKRA 2QA4I 5B8AA 1RR8C 4OIPF 2EINH 5IYDJ 5DBQA 5ECLB 4M72A 3GTUB 2ZSIB 1R71A 2CW8A 2MH9A 3C1DA 2D5VA 2X6XA 4NMUA 4K5RA 3IC7A 1FEXA 1M0UA 2B5YA 1VQ6I 1E0EA 2EC4A 3APQA 4LGWA 3W2VA 1TU8A 2PVQA 2YWIA 3SDGA 2XF6A 1AHDP 2L7FP 3CRUA 2XB5A 5JFRA 2L0KA 3DMLA 4XN3A 4P55A 1KNGA 5HR0A 5E8IA 1MBGA 2BYVE 5CRHA 1X1BA 4I99C 4LIUA 4WK8F 2MFZA 5EPFA 2XIGA 2DT7B 2PN6A 3IPZA 2WA0A 1QVUA 2EV6A 4PCQA 1EH7A 2MC3A 4EM2A 4HNTA 3G71I 1XS9A 2O8KA 2AUVA 3ABTA 4CUGA 1OKRA 6PAXA 2OACA 2XAFA 3HGGA 4BQOA 2Z33A 4AJ6A 3VYUB 3H3ZA 3JRDA 1TRVA 4BHBA 2HFHA 4O92A 3UR3C 2P7CB 3K1MA 4BVYA 2KOKA 1G6NA 2G7UA 3TW6A 4C3JJ 1HQCA 1YRNB 1MMNA 5FT3A 1TDIA 1JKQC 2DA1A 1ZELA 1DP7P 3D6IA 1UFMA 5IO2A 1TP4A 3DEXA 3S2HJ 3H8QA 3PSFA 4V2LA 2A5WA 2YOIA 1MDJA 3BG7A 3FZ5A 5F8BA 3U21A 2H0GA 4F03A 2QA2A 1TT5B 4HAMA 2HE3A 1LDDA 3GV1A 1BR1A 1VFCA 5EJCA 2LMDA 2QGVA 4XLFA 1UHSA 5LGNA 2HRNA 3D1NI 1C0WA 4X1UA 3EYTA 2CU7A 2VM1A 3AY8A 3R6SA 2YWOA 3J7Yb 3M8NA 4JX5A 1D8JA 2W24A 2QA1A 1W7PB 2J23A 5C4JJ 2LTPA 3OS0A 3GKMA 5F05A 4M9XA 2B1KA 2O0YA 4LOCA 2HI3A 5K7FA 4BIKA 2V1MA 1BM9A 4UNOA 2MMAA 4XOPA 5GTHC 2QLZA 1VF3A 5DQSA 2ISYA 2KP2A 1FVJA 1R23A 1MDMB 2CQKA 2FA4A 3A5IA 4FASD 4UUSB 5J47A 1MMSA 5IPHA 4N0BA 1IXRC 3KP8A 2LREA 4RLQA 2RN7A 4LL4B 3PUBA 3GYHX 3KETA 3MFKA 2GVPA 1WJCA 3N5OA 4RAFA 2EIQA 1ZRFA 3ZMKA 1K78A 1EEMA 1B9NA 3G1MA 3IH2A 1DPUA 2DODA 1EZKA 1Z6TA 5CPRB 5COHA 5DDLA 5DCMB 4JOMA 3RQ4A 3GKXA 1S7AA 3GRXA 4I97A 4UUTA 3HRTA 5F0CA 2VL9A 3HKRA 2GOMA 2CQQA 2KMUA 3QFAC 1TNSA 2L7MP 2NOGA 2LKSA 4RDUA 4UB6C 1G59A 4XRSG 4ZDPA 4HF0A 5G30A 2A05A 2DA3A 2RAEA 3PQKA 1X9SB 4HF1A 2WCIA 2E60A 1UCRA 3A03A 3HC7A 2QSFX 4DYCA 3HBLA 4BQNA 2IVMA 3K4KA 1H75A 4XONA 2CVBA 2PWJA 1LFBA 3MAKA 4A5PA 1ZREA 2CVDA 4PNFA 5D5WB 2HT9A 2IJYA 5L3BA 1GV5A 3MKLA 3ED3A 1WJDA 4CCKA 2STWA 4WXDA 1RPWA 1N78A 1QNTA 4HSCX 3G7IA 4XS1A 3Q0VA 1HCRA 4DSSB 5KEJA 1IN4A 2A3SA 4BDYA 4CO8A 1QHHD 2HVSA 3PO2J 2IJLA 1PL1A 3GTUA 3H79A 3R61A 2E35A 2P0WA 4M3BA 4ZDLA 5JCWA 3LA2A 3L2RA 1E17A 3K69A 1O4XA 5AN1A 1XGNA 4PJNA 1T6SA 4S04A 4Y3OA 4F2IA 3WHBA 5GAGJ 2B63J 2DOEA 2HDWA 2MBFA 2RDPA 4B44A 2QVOA 3CMYA 4V2MA 4RBOA 2FEZA 2JQ7A 1WPKA 1BQ7A 2F5CA 1VF2A 2F8FA 4EDZA 3ZQIA 5IYCJ 2GSRA 4X4JA 3LSKA 1X1AA 3BR1A 3A0BC 3L2CA 1JLVA 1G7OA 4M6YA 3E6DA 3TGZA 5ECOB 1F3BA 4F52A 1IGNA 2FHEA 1OC9A 4FO5A 1THXA 3LG6A 1CQTA 1ZZYA 1RR7A 2MBSA 4DBQA 2CX4A 1TU7A 3HVVA 3S9FA 1P92A 1CF7A 2RM5A 2CUJA 1FHEA 2NDOA 1A35A 4DJAA 2FOKA 5CVUA 5HLTA 1BW5A 3EMPA 3OYBA 5ILVA 3DXBA 3BJ6A 4TV7A 1FIPA 2DLXA 4TR0A 2HLSA 1OCOH 1A0RP 1K61A 2GQKA 1MH3A 3GTGJ 2H0HA 1JT0A 3HZJA 2NVUB 3KLNA 2Y31A 1AWCA 2UUZA 1OE8A 3TJKA 5HS9A 2W7NA 1OFCX 3FK7A 4RQXA 3SWLA 1ZR2A 4KF9A 4WR4A 1MKMA 1V5FA 2Y75A 3ERWA 4FX4A 4IHUA 2EZIA 5ECRB 2IEKA 1FT9A 2QENA 1SD4A 3BPXA 2C0GA 2FD3A 4KMUX 3RKYA 3OSGA 4KMFA 4RI6A 4Q5RA 2Z1DA 4PJLA 1RUOA 3REOA 1D3YA 2M34A 2KISA 2HSMA 4WXCA 5J8CA 1NK3P 4OO5A 4M3FA 2H0IA 4JR6A 2F5VA 3QFBC 2HU9A 5BRTA 1QK8A 2AXTC 4AIDA 1T56A 2EILH 5E79C 3AKZA 1QPIA 3PJRA 2H1BA 2X8CA 5IOXA 3ZOBA 2OZUA 1S9HA 2YX4A 4AVPA 1UJ8A 2RLIA 1BX9A 1BAYA 1Q1HA 2OKAA 2L4CA 3VWWA 1NK2P 1Z7LA 3LXTA 4PQ1A 5HODA 2JA2A 4E7KA 1GXPA 1R7HA 4F0CA 1DDNA 2EQRA 4JR4A 1SC7A 1XMXA 5DJMA 1KU2A 2R7VA 1VQ4I 1SJIA 3DWLE 6GSXA 2DT5A 2EIOA 2VKEA 2PX9A 4RGSA 3TW7A 1KBNA 3HXSA 2KZVA 4K5SA 2JK3A 2PFBA 1T2KA 3M9KA 4J56E 3TOBA 2Q1ZB 4ID0A 1WSUA 2N8GA 1ZYQB 3LSPA 2K8SA 2Y9YA 3CTGA 1FBQA 3K2AA 4F7ZA 2DFHA 2LY1A 4AJ8A 2L6DA 4A5NA 2QBYB 1U9OA 2QSIA 1BOAA 1Z77A 3K7AJ 2C80A 2KJCA 2I4AA 4RA2A 3T1BA 2PEXA 1JE8A 1JTYA 3U9GA 3D0SA 4FCYA 1GSSA 3LFLA 4AIJA 2OBIA 4KDUA 5CNWA 2KRHA 3OR1C 1PP8F 3I0TA 1XD7A 3MAJA 1YTYA 3B6CA 2X1EA 1GLPA 2VI6A 4DSSA 3RDIA 1MBJA 2JACA 4G19A 4Q5SF 3D5LA 3KD0A 4WR5A 4XNFA 3UAPA 4G6QA 2ESNA 4ZL9A 4G94A 4A3FJ 2Q0OA 1NTCA 5HLIA 2HR3A 4A3MJ 1TRSA 3CO6C 2LS5A 3TRPA 4XLCA 3RPQA 3MMYB 1YF0A 1SJ6A 1W36D 3GHAA 4HU7A 3KMNA 4G8XA 4IRHA 1HSJA 4CSWA 3UOMA 3WGXA 3AAFA 1GSFA 2OE1A 2TCTA 1PFOA 2GXGA 2GZPA 3FXUA 1K3YA 3FXJA 2ES7A 2DI3A 2XBIA 2VJJA 4IL6C 1H4OA 8GSSA 2FBKA 2NBSA 1P4AA 5GAPD 2OE3A 1BI1A 3MEXA 3W2AA 2C4JA 4BE1A 3P90A 4Z2UA 6GSWA 2QC7A 4HQEA 2X6WA 2RQPA 1M9AA 5LHIA 3B6AA 2CT6A 2LJRA 2ISZA 3C73A 2HXKA 4YIIA 4FX0A 2AXLA 4ECBA 2AJQB 1NM3A 5C00A 2FNAA 2R0QC 2ZJQF 1FG4A 2IFQB 3AG4H 5EL8A 3UVHA 2XPWA 5B3SH 2K9MA 4G7ZF 3CJTB 2HYFA 2IGNA 2F8AA 1LNWA 2BGCA 3FMSA 2OE0A 3L9FA 4N9IA 1MMGA 1S5LC 4QLCU 3RYPA 5KAIC 4DOZA 4XSZF 2RKHA 1B8XA 3G73A 3EWLA 3LSZA 5IPGA 1ACIA 2DMLA 1YX5A 1AAZA 1FJLA 1X58A 4Q4ZF 4HUAA 4KITB 4CYDA 1V55H 5L71A 2FD5A 3I64A 1TWGJ 2QF7A 4M3EA 3O6BB 3DEWA 3KFWX 3I69A 2Y30A 1GUMA 3EE2A 3IP4B 1O7FA 1B4QA 10GSA 3UEMA 2VQGA 1FIAA 2HKXA 1VF4A 3W2WA 4Y7NJ 4E7IA 1JJ8C 1FYLA 4ML1A 2RREA 1OJLA 4ZYAA 4MQVA 3FXLA 5EG0A 2W57A 2PMTA 4FH8A 4CICA 3GTJJ 3HRUA 2BBYA 3PO3J 5IO0A 3HEFA 4CCNA 1LVAA 3QYBA 5DD4A 4K0NA 1FSEA 2R92J 3ZYWA 1IRGA 1IDYA 3ZQFA 3IK9A 3TKQA 5D8LB 2XGDA 4Q5QA 1YIOA 3F8UA 1IRZA 1YQ1A 5B8BA 4EEFG 2V41A 3HG9A 5LD0A 1RZ4A 4DIQA 3ZIVA 1ZAOA 5EEGA 4HPQA 3BR3A 3TO7A 3DVWA 2LTKA 4K2EA 3RKWA 2JSZA 4MFDA 2IT0A 2HS5A 4GFBA 5ID2A 3GIXA 3S3OA 5M5XJ 4ENNA 4MK3A 3RDWA 1BOBA 2VAFA 2HDDA 3ZN0A 1M1EB 1S72I 1O85A 3D0ZA 1R26A 3FMRA 2MD0A 2CG4A 1MJAA 1D1BA 2GT5A 3IC8A 3CDHA 2MMOA 1OKDA 4YRVA 2X6YA 1GSUA 5LGUA 3H5RA 1LU4A 2WC2A 2GQLA 3KCMA 2R5YA 4AC0A 2R7QA 2LKUA 3WG7H 3PH9A 2PJRB 1BI0A 3VWUA 1WH5A 1XX5A 5H6QA 3J7YJ 2HYXA 2F6CA 4UY8I 3ME8A 3OYJA 4HJMA 2L2OA 4IOCF 2LV3A 3FRCA 2GT6A 2J9HA 3OS2A 2K9LA 3U1KA 3EUKL 1U78A 2VPLA 1KONA 1JI8A 3TRXA 4EF0A 1AOYA 1LVKA 1U0JA 4C9YA 1F6MC 2HZEA 5IOWA 3W8SA 4YIRX 2PLYA 3CCLI 1A2JA 2REMA 4GQFA 4N30A 2VL8A 1MH4A 2ZJ2A 2XDVA 1GSYA 1FOWA 2HTSA 4A3GJ 2X9DA 2JA5J 2WY8Q 3W8JA 5CO3A 3HPHA 3DU5A 4XLHA 5HS8A 2DQLA 1XVWA 3NWSA 4I09A 3DRNA 2JU5A 4V1Ap 3I4PA 1I1GA 2UWMA 4ZYGA 2DXIA 1AQWA 4ZH4F 2GXBA 1KTEA 2V4JC 2O89A 2DA5A 4O5UA 4OFMA 1X4PA 2G7HA 1LE8B 1DGRM 2E2MA 4MA9A 1G3TA 2JRMA 3DYRA 2FWGA 1TTZA 1GSQA 4HS1A 4LITA 2EIRA 3ME7A 1R5HA 3VSKA 3AG1H 4ON0A 12GSA 3ML6A 3OYHA 2Q8KA 3EDPA 5LCZA 2EA4A 2ZCWA 3OV8A 2FA5A 2XGEA 4PSXA 1ZGJA 2CV4A 1A6IA 4RB2C 1Z5YE 3IH4A 1R1TA 2HYJA 4XRDA 1U6GA 1HW5A 2KRCA 1S3CA 1H88C 3TOTA 4CDOA 3VYTB 3WE2A 4XIDA 1FO5A 4A3CJ 2Y69H 1YZXA 4M3GA 2DKIA 3FDYA 2H19A 4OD7A 4XS6A 5IMZA 2LBFA 2C0EA 2XPDA 5D9XA 3MQ0A 4U0YA 2WWYA 1Z7RA 3I58A 2R0CA 2RUFA 1FTTA 2B6MA 1YE9A 3GEZA 2H6CA 2VLUA 3M0FA 3HOUJ 1GXQA 2KFDA 5INYA 4AM3A 3DQVC 3FIWA 3FK6A 3OL4A 3HL2A 5B5EC 4BVXA 3IBHA 4RGRA 2DO7A 2L9VA 3ULQB 1YS7A 1V58A 4XBFA 1Z1DA 2CFXA 4XICA 2WBMA 4KCAA 4PGTA 3TMOA 4IEJA 1FMWA 1V5EA 2A68F 1FBSA 1J9BA 5F6FA 3FZ9A 1F9MA 2ELJA 3NWTA 2CUEA 1ERVA 4A0YA 1G8XA 4MEYF 3A0HC 3HTUA 4O6JA 4EGZA 1ERUA 2ZXHA 2M72A 2HOAA 2VC0A 1XWAA 3A5WA 3IV4A 2CGPA 2DK8A 2MC4A 4M3DA 1RIOH 1A8LA 1BI3A 2P31A 3A1YA 3EPTA 5C44J 2OTJI 3JRHA 3G1OA 4N11A 1OCPA 1ZK8A 1KGSA 2XAHA 2LC2A 4OAYA 5EGOA 1P4XA 4MP4A 2XGCA 2K3PA 2Z16A 3OYLA 3JTHA 5KCMA 3ZQGA 4QPQA 1TC3C 2NTOA 3HJPA 1UG2A 3Q6OA 2OAZA 4QL9A 1FOHA 2GXAA 2XRNA 1MDIA 1SVLA 1YW8A 3LA7A 5HLGA 3CSIA 3MYDA 4IW9A 4WF2A 1X1PA 3CD6I 1U88A 7GSSA 3HY2A 1BJAA 4HW0A 3SZTA 3W6JB 4W1UA 2J5PA 3MCZA 1ZG1A 5ENUA 11GSA 5FKMA 1Z67A 4MLYA 4POLA 2X0LA 1FYMA 3CMEI 2W84A 1UN2A 5C4XJ 5L3CA 1QU3A 3C1RA 5TJJA 3L2QA 2LSTA 1F9NA 3CDLA 2BHZA 1T95A 2PJRA 2JZSA 1YS6A 3IUOA 4U87A 4ZC3A 4M6XA 2ID6A 3NOFA 5CREA 2BEOA 2OPTA 3I53A 1WRYA 4QPOA 1F2EA 2L7KA 1W4VA 2W85A 3QP5A 1Y6IA 5DAKA 2CZ2A 3TUEA 3F6OA 3DKWA 2B3SA 4O5VA 3UARA 3LW9A 3GFJA 5ABRA 3Q5FA 1SL1B 4EL1A 3R2QA 2VJ5A 3WTUC 1M99A 3HDDA 2WDUA 3CYNA 4MABA 2GSSA 2R7WA 1YJ9I 3OY9A 2W1OA 3F8NA 4EIQA 2H76A 4BKXA 3OL3A 3U1DA 1TJDA 1TI3A 2DMUA 2QGUA 4Q5FA 1RK4A 3KE2A 2PG4A 1BEDA 5J1RA 2HPIA 1H9TA 3PQJA 2GS3A 1FSHA 2CSOA 4LMVA 3V42A 1B72A 3VFZA 4RI7A 1Z21A 5HNHA 3K0LA 1MD3A 2WS2A 2CV2A 2RNJA 4MO7A 4E7ZA 2QSHX 2H1GA 3IAS2 5G2ZA 3OMYA 1X9WB 2L02A 2EWNA 1HLVA 1VQ9I 3IA1A 4L5OA 1OPCA 3F4SA 1NW2A 4IJAA 1YF1A 3VI5A 2RGVA 3GUDA 5HS7A 4PQHA 4C2TA 3HVNA 4M74A 3Q9VA 2O5RA 4NC8A 1K83J 3RZDJ 4Z2TA 1JLWA 3TKSE 2DFIA 2EFOA 4EGYA 1IO2A 3CO7C 1AQVA 2CFOA 4XKVA 1X5EA 3E5XA 3GXOA 4ZZLA 2HI7A 1YG2A 4KUMA 4LG0A 2WULA 3VWVA 4P96A 2UV1A 2Y0SN 1D0XA 5HNFA 2O3FA 2G0FA 4GXZA 2PMZA 1JZOA 2C8UA 3WU1B 4BVYB 1VQOI 2GOXB 3CMMA 1FMVA 4KJZA 13GSA 1IN8A 3BR6A 4MZCA 3V8KA 3ZQHA 3CTAA 5GAND 1G4DA 2WY7Q 5CVRA 2DIYA 3MDKA 2C3NA 3IE3A 1Z6RA 2VBXA 4A0ZA 3CCVI 1SEUA 1TOFA 2WAEA 4A6EA 1GUKA 2HXOA 4CCLA 5IT9K 4KW6A 2ESHA 2OTLI 3G4SI 2FNOA 2D45A 2ON5A 3A2VA 20GSA 4II2A 2V26A 3QYFA 2VM2A 1K0DA 1QZYA 3FKIJ 3KTLA 1XGOA 4BXXJ 4X0XA 2I10A 4RUVA 5KK1A 5DUIA 1JKPC 1J75A 1EOHA 5DM6F 4K7NA 3QR6A 2I81A 3HSEA 2A4VA 5A4UA 4CY8A 1V4RA 2PI0A 4EXJA 2J5OA 4LG3A 3TB2A 2HRFA 3FBIB 1RC9A 2DJNA 3HYPA 1KQ8A 4UHTA 2AHEA 1L3LA 2R2JA 4UXNA 2E5ZA 4GWRA 4XLEA 3WE3A 4YFKF 4HDEA 5E1XA 4CDGA 2HQ5A 4Y33A 2V6EA 2LNTA 3LSHA 2VUMJ 5EY6A 3BG3A 3S3MA 1OMIA 2M0MA 3GFIA 3ZVJD 3EUAA 4HQZA 1K78B 4TOPA 1WIKA 3IHQA 3LAPA 1HDPA 1ZRCA 1U5TA 1XN7A 3V8JA 2FX0A 1X5CA 2FWFA 5JCGA 2H30A 2HVQA 2LJAA 2R3XA 2YV9A 1Z05A 2F4MB 3GTKJ 3F9KA 4LLNA 1X9MB 2LRDA 5JHUA 2Z5UA 2UZ8A 2M7AA 2VKHA 1QGVA 3HOSA 3RJPA 1SENA 5FO5A 3E0JB 1ZG3A 1W4MA 1VQ5I 2PGTA 4PTSA 3D22A 2V9KA 3ZN1A 1XOAA 1T0FA 1TW3A 1XW5A 2DFEA 1QPMA 1VF9A 5DALA 2OQGA 3C7JA 2NNNA 3RPUD 3DFGA 4P5OA 4XK4A 1QQIA 2PUKC 4USSA 4YEJA 2XF5A 2FRHA 4IOAF 3CSHA 5HLHA 4YFNF 3CZ6A 2UXXA 5HVQC 4EUYA 1PYVA 3NARA 1SD6A 3I59A 4K9ZA 5J3RA 3F0CA 3C7MA 1W89A 1M9BA 4J2FA 3BTLA 4V2GA 2V1UA 3M1EA 3GZNB 3SEQA 1ABAA 1F37A 1FW1A 4KAEA 3TJFA 1R49A 4ANJA 1YITI 2R7OA 3FXRA 4NBQA 4WXHA 1EEJA 2EBIA 2M30A 5DYMA 2P5RA 3TKPA 3BTCA 4WXTA 4CA0A 3TRQA 3Q0UA 4XKCA 5DV5A 4C3IJ 3JRIA 4NV5A 3BDDA 4KIGA 2QUFA 4KB3A 3GCMA 5F1RA 4ZILA 3QU3A 5EF6A 1R5AA 2CQ9A 1QZZA 2PVOC 1JHFA 5ED4A 4A3JJ 3CESA 4XL9A 4PUAA 3GKNA 1XW6A 3M3YJ 2YN1A 1DUXC 2BE5F 3E7LA 1GSDA 1XMAA 3WTYC 2IMIA 1TKDB 5JCUA 2H6BA 3LNQA 4HV6A 5AISA 5KOXA 3JREA 3K70D 2CV0A 3HCZA 3LORA 4MF5A 3EU3A 4Q47A 2B9SA 1OC9B 4HSTA 2VCWA 3GX8A 3IHGA 3WGEA 4NB5A 1SD8A 2LRCA 2GIVA 4RGUA 5GSTA 2DW4A 4XN0A 1JTXA 2OCCH 4EJWA 1CF7B 5FKKA 1GDTA 2VONA 1R1VA 1YKAA 1BC8C 4XCSA 3R0JA 2KP1A 4JBBA 4KA0A 3OYMA 2CA8A 5L3FA 1PJRA 4WBRD 4XTSA 5HFGA 4LIVA 4A5MA 3VOEA 1PDNC 2HFDA 2ALBA 3HZ4A 3N9JA 3HHVA 4J57E 3E0UA 4ECJA 1YO5C 1S7OA 2KJBA 3E5QA 4RMNA 2IS4A 3TQNA 2IA2A 3P2AA 1I1SA 2R7ZJ 2KQRA 2O03A 2DU9A 5CRDA 5AIVA 1G0TA 3HKZN 1HNBA 1SD7A 3GFLA 2JZRA 3V7RA 2P5LC 3FXKA 2JL4A 4G9YA 5IP9J 3DIEA 4DBRA 3Q19A 3WGIA 2O6GE 2F48A 1HDDC 1JUMA 4NHWA 4D9JA 3VYRB 5J1YA 1TWHJ 4U88A 2VE8A 4C2MJ 3WGGA 3L1PA 2TRXA 4EM0B 1UHWA 2OADA 3WYWA 5IQYA 3GFKA 4MLOA 4P9FA 1FWZA 3FYGA 1O7UA 1HBXG 4WF5A 3US3A 1USSA 1V9WA 3Q18A 1EH6A 3MKWB 3L9UA 3I3LA 2TRTA 4ZBAA 2OC6A 2VXZA 3ECHA 3CBUA 4MDCA 4L5LA 2HNHA 3F8FA 1IZ1A 2B7EA 4PJMA 4FT8A 5E3NA 4G6TB 4RB3C 1PUEE 1FY7A 2M46A 2O9LA 3CRTA 3WTWC 2M5WA 3KIJA 3G6EI 2ME0A 3W6KB 3PL8A 4N0VA 2D2WA 3IRAA 4ZL8A 1GLNA 3VEPA 1SL0B 3ZQQA 4OCEA 1IG7A 4ASNA 4LA1A 4PURA 2DJ1A 4IQ4A 1PN0A 2BTOT 2RC4A 2I9HA 4QQ7A 1S3JA 1BI2A 2WAFA 4ZL7A 4JRRA 2V6CA 1T33A 3H9GA 3P5JA 3L9SA 4RLFA 1TRUA 3F63A 4CCMA 1GT0C 1Z9HA 5ECPB 2AB6A 5K1YA 1BYEA 2B7JA 2FWEA 2WAQN 5J4YA 4TR1A 1LEAA 4HDVA 3VODA 2B5EA 5B6NA 2K3FA 4KDYA 1M3JA 3RKXA 2ZCTA 1U3AA 4ZYDA 4KH7A 5ELGA 1SYRA 4KN4X 2B7KA 2YZHA 3L2VA 3EYYA 3SXYA 4G2EA 4ZXGA 3C3WA 2H66A 5LHGA 1EP8A 4U7BA 4JK1X 2DDBA 3GZ5A 4OOIA 1TLHB 2W25A 3O2PE 2L3DA 3PNYA 4IP6A 1MJBA 2XAJA 2R7UA 1OAZA 4IJ3A 4DVCA 1KEBA 5IMFA 4U0WA 2DQRA 3I43A 1YX3A 3K4NA 2KIQA 2BVLA 3O6TA 3ZREA 2XF7A 2M80A 1PA3A 4BJ6C 5E3OA 3IDVA 2I1UA 4I8BA 5DCFA 5K5OA 2IIYA 4FETA 4EJTA 4X6AJ 4XM3A 1VGLA 2LQOA 3I56I 2A2RA 2GIZA 2V9VA 2DDAA 3A02A 1YJ6A 2VQCA 2HSYA 2LEGA 1B9MA 1SANA 5JWRB 1GULA 1K4SA 1K6OA 1ZN2A 3CCEI 2G2QA 2X4AA 1NG7A 1YEPA 3H35A 2L7ZA 1WI3A 5BOXA 1FB6A 1A31A 3TP0A 2PBJA 1GRXA 2Q2EB 2EZHA 1IN7A 1FTZA 1LPQA 1XCBA 3DBLB 3F22A 4GRFA 4YQMA 1ITYA 4CHSA 2ICWG 4D7NA 4IZZA 4MJAA 1WWXA 4PFPA 5IOZA 4MEXF 2VD1A 1Y39A 1RKWA 2HRAA 3HVXA 2DFFA 1TW9A 1ST9A 3OOPA 3H3UA 5F08A 4F92B 4IHXA 1S29A 3H5AA 1B4PA 2A4HA 2GZYA 2KKOA 3O3KA 3QMXA 1Q4JA 4FQUA 3D5SC 1SFXA 4BPYA 2BY2A 3CF2A 3DKYA 3IHUA 1AQXA 2LP0A 3WTXC 3FHKA 2FQ3A 5ECMB 1S8NA 2BHYA 2R4GA 2DJ0A 2E1NA 3F3XA 1H89C 3BCAA 3LXZA 2L4AA 2IL3A 3E6BA 2WB1N 4KDPA 2LNSA 1SL2B 2M45A 5ICCA 4IVNA 4XSXF 3UIWA 5BPDA 3LYPA 3TJBA 2IPAA 1TXXA 2ACJA 2JJ7A 1GHCA 3C71A 3F6FA 4UVBA 2P81A 2EK5A 3FISA 2YPRA 3WTVC 3H92A 5DCGA 2HXIA 1BIAA 4OMVA 5A2QK 5GPCA 2KPMA 2MH2A 3KEQA 3ZRDA 4NXIA 5E18F 2K27A 3D4TA 3B73A 3S8PA 4BQAA 1GH2A 2DJJA 2IBDA 2QEXI 2XBQA 3B02A 2FE3A 2HOEA 3PNVA 5EG0B 1B9XC 5GADJ 1KYZA 3VI7A 5J3LA 3DWVA 2VCQA 3L9VA 2WB9A 1WQ2A 3LEFA 3FBNB 1I3QJ 3HYIA 2M8GX 3RI4A 2JA8J 1M2DA 1XFLA 3I54A 2NS0A 4HA8A 2YPMA 2X1CA 3S32A 2H72A 3IWZA 4AUXA 4IKHA 4L9JA 3I6AA 1G6YA 4FQGA 1QBJA 2CMPA 3CUOA 1GWCA 3APOA 1ZYRF 1JGGA 1GTUA 1PP7U 4EJOA 2BY3A 1ON4A 1WHUA 2NVQJ 2R6KA 1KQ0A 2IWTA 2LUSA 4IO9F 2K6VA 2O7OA 2KLOA 4MIMA 3QODA 4AYBN 2R4VA 2YANA 4CZZA 2WZ9A 5D8IA 1GSEA 5FKLA 3ERGA 4ZBDA 2E19A 2O7KA 5ID2B 2BXYA 3SZPA 4DQ2A 1TBXA 1SJZA 1SK1A 5J9BA 1XGMA 3T8TA 3ABLH 3I4MJ 4ACSA 1RUNA 2VKVA 5FLXK 4YKFA 5E1ZB 4NAXA 3BLYA 5J5NA 1YJWI 3QAHA 3F6DA 1Y56A 1ZR4A 3EU4A 1WFXA 4ULXA 2R5YB 1O3SA 5H5QA 3QOPA 1OCZH 5A2QZ 2WV0A 1PGTA 2LJKA 1J0FA 3R3EA 1EA3A 2HOTA 4GSSA 1DE1A 3GF2A 2F4OB 2E7WA 3RZOJ 2VJIA 2XRLA 4QTRA 3F4TA 3C2BA 2JVGA 3S3NA 4QL7A 5CRWA 4RAGA 4X0GA 3QWLA 4AIHA 2E1CA 2HZEB 3DXJF 2PJPA 2ZMEB 1KQ9A 4ESJA 4L8EA 3GFMA 2EB7A 4K7OA 3CMIA 2LFBA 1UMQA 3CC7I 1HC8A 3SFZA 4NHJA 4IKFA 3J7AY 4HJ2A 1F36A 4A3DJ 5ECHB 3H4KA 1ETVA 1X19A 4I02A 4R8HA 5K5QA 1ETOA 4W97A 1R1UA 4HDUA 2R7TA 1ZGWA 1STZA 4K7IA 4ZJZA 4YFXF 3MKZA 4ML6A 1SKRB 1WH7A 1FOXA 4L5JA 2A2SA 1MD0A 1WPIA 4E7HA 4ZB6A 5IMVA 4FTHA 3ZIJA 2Q2EA 2F2EA 1EP7A 3ERMA 1LEBA 3R60A 4CGZA 3P7XA 4DSRA 5ECIB 3KP4A 4OWYA 2PU9C 4UV8A 4L5EA 5D6FA 3E5UA 2LD5A 1PN9A 3LMMA 1A2LA 1WRJA 1JZRA 1ERDA 4LJZF 5E3MA 3KEYA 4S05A 3TEDA 2KLXA 4EIPA 2EIJH 4RAZA 1B8IB 5E3LA 1WMJA 4EKZA 5D4RA 2FOWA 4RM3A 5DTDA 5JVTA 2H75A 1XG1A 2FSWA 2EIKH 1Z7UA 1IF1A 3HSFA 3EVIA 4MJEA 2HQNA 3S2DJ 2MLGA 1TNTA 2D1VA 2LBFB 1XMKA 2R7SA 2YUSA 2QSGX 1O6JA 3HA9A 1IXCA 4NQWA 2PN8A 2DPUA 1K0NA 2L59A 1TL8A 2YP6A 3QPMA 2R93J 2KP6A 3AG3H 2QYOA 3S16J 1ODDA 2CW0F 1VQLI 1DU6A 4BVXB 5G1KA 1HKSA 2HGCA 2V1XA 3M3MA 4BWSA 3H1NA 3BTIA 5E8GA 2OU2A 1R5GA 4C2UA 1OYJA 2LH9A 3HIFA 3GO5A 3WU0A 5LGTA 3D5JA 3W3CA 3LYKA 3PNTA 1PUFB 5ILSA 2WGRA 3CQFA 4WKWA 4IHSA 4I2UA 2K7LA 2E5NA 1OR7A 1MJ9A 4B43A 3K8NA 4GGGA 2JUCA 1XCVA 3FXOA 2XSDC 2IXSA 2TIRA 5DEQA 3ZRGA 2GGTA 2A2PA 3JRBA 2GBYA 3KLOA 1YLFA 5FFZA 4KICA 2LDUA 4ZB8A 1O3RA 3PGTA 1FOVA 5ILUA 4ZDOA 1N2AA 1RI7A 2F3MA 3HB9A 3C1SA 1OVNA 2VCZA 2VLAA 2A69F 1OCTC 2GLRA 1G6WA 5EGOB 2PPTA 2NRAC 5CP1A 2X8GA 3KP6A 2XASA 4TXOA 4BL0B 3ZZXA 4C3HJ 4HRIA 1R58A 1XWCA 4V2FA 3HZ8A 4TW5A 4Q5NA 3SHFA 1DP3A 5E59A 1O81A 3FR9A 2E7PA 4Q48A 6GSUA 3GNJA 1TK8B 2EV0A 2MABA 1EF4A 2FBIA 1EGOA 1X1CA 4IP1A 4OCFA 4KA4A 4F82A 1EV4A 4G10A 3QCPA 3X2QH 1W7PD 2X51A 3HHGA 2VUPA 3WT2A 3KJYA 2LK2A 3L2WA 4E4HA 3JCUC 4G0KA 2K9NA 2OZ6A 1U8BA 2HTJA 1MSEC 2ZNZA 4IVFA 3KP7A 3ZMSA 1K0MA 2YNXA 4M9SA 3BC8A 1Q1VA 1KU7A 4X1EA 1ERTA 1U87A 5DAKB 1O7LA 4A93J 2ELHA 3HM5A 1K3OA 5ECQB 4ITVA 5E1WA 4I76A 4WX9A 3HOYJ 1W5SA 4ZZDA 1ETQA 3HJEA 4BGDA 1OR7C 1RNLA 2MMNA 2ZMEA 3AG2H 3RQIA 3VB2A 1R00A 2LRTA 4IGJA 4Z2RA 3IR4A 3MWHA 1GUHA 4IX7A 2VC1A 3EC3A 5IOYA 4J00A 2GQMA 4I2TA 2VL2A 3DTKA 4LLGF 3OYDA 3QP6A 3PFIA 5CVJA 3CF5F 1BR2A 1T08B 4JE1A 4ABZA 3GTQJ 2MLKA 1BR4A 1LKXA 1JKRC 1OKTA 3BWGA 5IP6A 2H8RA 2GWRA 1XG8A 3V7CA 1B72B 4ENMA 5B1AH 3COAC 3VK9A 1WCMJ 2H8WA 3KTBA 4J19A 1FP2A 4KCEA 4KNYA 2FXAA 5EZGA 3MVPA 2ZB9A 4MGRA 2K02A 2MG4A 4QSHA 3RTRA 4TXOB 1MZBA 1MD4A 4B1RA 1UC7A 4MNNA 1E3HA 1XWKA 2IA1A 1GL8A 3HXLA 4ECIA 1OCRH 4HX7A 4PJJA 3QPLA 1WJEA 3N97A 2PQ8A 2MSYA 1B8IA 1CQHA 4CY6A 2M0CA 3IKTA 1ACVA 1O8WA 2K18A 2COMA 3RPNA 5J40A 4CW9A 1Z6NA 5HDKA 2JPCA 4ILFA 3ZMUA 1M2BA 4FYBA 1UZCA 3FWEA 4LK0F 3HUGB 5L3DA 3OYCA 4LG0B 2E1OA 2Z2SB 1R6RA 5M5YJ 3CCRI 1YKCA 2IAIA 3A4CA 2RV8A 2F5FA 2E0QA 1R22A 1LDKB 2L5OA 1BJZA 4UV9A 4CYCA 3HOTA 3QPHA 3SZGA 1VQ7I 5GAHJ 2OF7A 3HTSB 3W6VA 1MMAA 2VODA 2DCEA 3ZMZA 3MIXA 1GVJA 4PK4A 2ZMEC 3HJMA 4P1WA 3CLQA 1HXDA 5AONA 1YYVA 4GCIA 3TJJA 6GSSA 4XMYA 2IS6A 4HOJA 3DKSA 3CCMI 2IMEA 2UZKA 2L9SA 1PUFA 3ZTLA 1WJAA 3MKYB 1WVRA 3DP7A 3M8EA 1FPQA 3V8LA 2WADA 1J2XA 3F8CA 2D1HA 2EIMH 1AKHA 2EFQA 3U2RA 3BJAA 2A6TA 2ZNYA 1MIJA 3LSMA 4C30A 2EFNA 3JRCA 1SMTA 2DOAA 1C72A 1GLQA 3QOUA 4K1FA 4MH2A 3RBTA 4A3LJ 3O3TA 1O8XA 2VBYA 1OYYA 3L78A 4IJIA 4CHUA 1J09A 1EH8A 2ZFUA 1USBA 1A04A 2ZXWH 5IMDA 3K4MA 2VXDA 2V7FA 4POMA 5C04A 2YV7A 2ZXIA 4Y52J 2V1DA 3ISOA 4IHVA 1YIJI 3FKJA 2E1MB 4FHTA 1U5TB 4GRIA 2H71A 3LSTA 3W6GA 4F93B 4UVAA 2DA2A 3IKVA 3LQRA 1BIBA 5H6RA 3HOWJ 1HW2A 3GTMJ 4PZJA 3GUSA 4N0ZA 4K2DA 3OYEA 2R0GA 4A0XA 4GXOA 1VTNC 4HF2A 3OYIA 2JSCA 4CCJA 5K5RA 1CGPA 2A61A 3MZYA 2M87A 5FD5A 2GDRA 1NH3A 1MNEA 3WT1A 1TW2A 1SAUA 1X3ZB 2OCEA 3TBIA 2E2IJ 3WGDA 2WFCA 1JT6A 5DALB 2KIFA 5H20A 2B5XA 1MNDA 1GP1A 1W0TA 4P3YB 3L7WA 1X5DA 1VQKI 1J7KA 3DKXA 1SFKA 1U9NA 4PGHA 3RYRA 1WWJA 1DE2A 4OINF 2L4MA 3JSOA 4ZTFA 3I59B 2H27A 1JUPA 4HLXA 1JXSA 1ZGNA 1TQIA 4XS4A 3K4BA 2GA2A 3HDCA 3LL7A 5LLQA 4MFEA 4A3BJ 4LMYA 3ZL5A 3ERED 2HYGD 1LB2A 3H93A 1G2HA 5CRGA 2MYSA 2X85A 4BNCA 4IN0A 2PBIA 2E2GA 3S1MJ 1S7EA 2CW7A 2IMFA 2VCVA 1FBUA 1LFPA 4S0HB 3J81K 2N5AA 3NZNA 2R7RA 3HOZJ 3GYKA 4YAVA 3RHBA 3LOCA 3JR9A 1IN5A 3J7ZI 4NC7A 3J7Yk 2KHMA 1LQ1A 2C3TA 1D5YA 4IRIA 2E7XA 1Z0XA 3BZ6A 3F8BA 3OYNA 2H6ZA 2P0GA 2VQHA 1SK2A 2BJXA 3S93A 3GW2A 4F91B 2V32A 2R5ZA 5FD6A 3P9KA 1FZPB 2R5GA 3HUGA 5JWOB 5G5EA 3CCUI 3K4LA 3SFIA 4GYGA 3BG9A 2YCDA 2ZBKA 1YHQI 4IBPA 3PM1A 3BG6A 1V40A 1SFUA 2FWHA 3P9CA 5D93A 4AGSA 3EETA 2K8VA 4O32A 4PQIA 1UHMA 2YR2A 4I0AA 3VWXA 1QVTA 2V79A 4K6XA 3ZFLA 4EVIA 5GTIC 3OSFA 2CQXA 3I9V2 1ZARA 3JSPA 3IRRA 1K6YA 2C6YA 2CRGA 4F9ZA 1TK5B 4OO4A 3SQNA 4MF6A 4RQRA 4OFNA 3ZMVA 2RIIA 2YWNA 3F4RA 5KN1A 1BN5A 4N4OB 4N9HA 3Q3SA 4A3EJ 4DNCA 1FX7A 2XC7A 2K9QA 4DYRA 4DGWB 19GSA 1D8KA 1THOA 2ECBA 2R37A 4TRXA 3M1CA 5JR3A 3S15J 2GTUA 3BCBA 1A8YA 4LFUA 1FAAA 1I3AA 4CXFA 1ZQ3P 3J7AO 4WBJA 5DCHA 18GSA 2QQ9A 3QRFF 3BJOA
chains in the Genus database with same CATH topology
3GH9A 2L6CA 1AUCA 1AW9A 4XKWA 4XHMA 4GQCA 2FY6A 1SD9A 5IMAA 3VLNA 3IXRA 2KHPA 3ZXSA 2K9FA 1G7EA 5AGYA 2VASA 2IGMA 1JZDA 1GNWA 2W00A 2DKHA 4BL7A 4NPBA 2LG4A 3G7JA 4MPFA 4EC0A 3GL3A 2V6KA 1ZMAA 3RHCA 1I5GA 1ZYPA 3GH6A 4TR1B 4PFOA 1Y6EA 2C1YA 3E3EA 1OC8A 1IRXA 4HZ4A 9GSSA 5J9CA 5FWGA 5CQGA 5KN2A 5F0GA 2X99A 2PERA 4BE2A 1OE7A 1ZL9A 5DQYA 1T1VA 2L4QA 1GTBA 3UBLA 2YJHA 4B3XA 1MTCA 2L5QA 4KUNA 2GSQA 2H73A 4KGIA 3HPGA 4JEDA 1YY7A 3IOSA 2I8DA 3EUHC 4OWRB 5ECSA 2E1MC 2VJ4A 2RUEA 3KZQA 2ZSHB 1JFUA 1HD2A 3QYEA 1GTAA 3OR5A 2XAUA 4G0IA 3D5RC 1UELB 4PUFC 5KNLA 2JADA 3KH7A 4AJ7A 4YKGA 1T0FC 3GMFA 5CQEA 2VLTA 4LLRA 2W4SA 3K10A 2ZNMA 2TRCP 5GZZB 5CKTA 5KOWA 4GF0A 2B1LA 5HQPA 1D1AA 1T7PB 2XPEA 3ZCOA 4E7SA 4IQAA 1TI1A 3DLAA 1PL2A 1XZOA 2HZFA 3ZMLA 4YELA 4TR3A 3H5NA 1A0FA 1D0ZA 1HNAA 1HNCA 2BW3B 4NUBA 2VIMA 4E8HA 5F06A 3OS1A 1A24A 2IGKA 2C0DA 2M4KA 1UVZA 4GSNA 1CQGA 4MZBA 2XSJC 5JHFA 3OWTA 3C2GA 1N8JA 4BS9A 3FY7A 3ERFA 2IN3A 2HZDA 3CP2A 2LYCA 2GSTA 1WP0A 5ELAA 1B9YC 3U6VA 3CJRB 2XC2A 3FK8A 3ZFBA 3F3QA 1SYXA 3GBGA 5CAXA 4K8MA 5H5SA 4KX4A 2VL3A 3QAGA 4K0GA 16GSA 2O85A 4ECCA 4BE0A 3CJQB 2OA7A 1NG6A 1NHYA 3AL0B 2FA8A 22GSA 3OIPA 1VF1A 3KXOA 5D9WA 4DSQA 3DPUA 1PKWA 2H1AA 4EO3A 1V98A 3O76A 4PXOA 4HU9A 4HG2A 1LBKA 2JVHA 3APSA 3CXGA 4MJCA 3DPTA 1VZ0A 5BMUA 1E2YA 2IS1A 1DGWY 3GSTA 5F07A 4R79A 2JZTA 4O5RA 2HPMA 3VURA 3K4JA 3VWBA 2PBJA 3DTIA 4ZB8A 4BA7A 3E1SA 2D2ZA 2M7BA 3VYSB 1T3BA 4OFTA