4HEA2

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 45
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hea201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hea202
1MD3A 3QDNA 3TKPA 3BBYA 5B6MA 5D73A 5DALB 2AV4A 13GSA 1B9YC 1XVQA 2CVKA 3TRPA 2H30A 2GZZA 1ZYEA 3TOTA 3KIJA 4GTUA 1Z6MA 3CSIA 2GQKA 4K9ZA 2K8SA 4IP6A 3ZVJA 2AHEA 1FG4A 3LEFA 4BVXA 4K2DA 3V1WA 3ZL5A 2GTUA 3P2AA 2F8FA 3C71A 3A5WA 1X5EA 1S3AA 3G7YA 2FWHA 1R5PA 3N9JA 3HVSA 4I8BA 2DSAA 1ABAA 3ISOA 2O87A 2FHEA 3H8QA 1OYJA 2WZ9A 2CX4A 3Q18A 5EL8A 2R37A 1SD9A 4XRAA 2FGXA 3APOA 4MCUA 3RPPA 4CW9A 4ZBAA 2XPEA 1CQGA 3IBHA 4P3YB 3FK8A 1TRUA 3F0IA 3W6GA 3RHBA 2L4CA 1GUMA 2WULA 3FHKA 3FRCA 2IMEA 4JE1A 4ISDA 1XCCA 3I43A 2XC2A 3VLNA 2B7JA 3FY7A 1LBKA 2HZFA 2B5YA 9GSSA 3ERGA 4RQXA 4MF6A 3OR5A 2LRNA 1W4VA 1TW9A 1K0MA 5IPHA 16GSA 1T8EB 4GQFA 4K7NA 4OFNA 4WXTA 2YJHA 4BVYA 5IO0A 4NPBA 5ECMB 4MP4A 1ZL9A 2E2GA 1ZYQB 1SJZA 3O76A 4MH2A 1ZOFA 2HRNA 3WT2A 5A5KA 3APQA 4GF0A 1ST9A 4L5LA 4L0WA 5F07A 2VL9A 3VPTA 2V6KA 2JZSA 5CNWA 4RUVA 20GSA 1V2AA 4ZILA 2YN1A 4WBJA 2REMA 4EE0A 1QFNA 3US3A 4LL1B 1SL1B 4DVCA 3LWAA 5IMVA 1XBSA 3IK7A 4WF4A 4PQ1A 5E4WA 4J57E 4NV2A 2OJLA 3A2VA 3C7MA 3TKSC 3GKMA 3DIEA 1T4ZA 3IAM2 1FOVA 5IM9A 4EC0A 3GSTA 3TKSE 2OKAA 1VRSD 2KUCA 4G19A 2H01A 2B7KA 1AQVA 3CRUA 4AJ6A 2ON5A 1SL0B 3M9KA 4V1Ag 3GFKA 1DBYA 3PINA 2VUPA 5IOWA 2C0FA 3H1NA 1W89A 4KCAA 1WRYA 4MDCA 5ID2B 4K0GA 4JRRA 2LRCA 2HE3A 3HVVA 1XWGA 2JU5A 3FZAA 3GURA 2VCZA 4HI7A 3ZIVA 3QOUA 1EV9A 1G0TA 4V1Ap 2MZCA 2OACA 1EGOA 4KB3A 1DE1A 4J56E 4LA1A 1PL2A 3GHAA 3ZYWA 6GSVA 4AJ7A 3GTUB 5KN2A 4K0NA 3IR4A 3HDCA 1Z5YE 4HEA2 4JR4A 1ERVA 4KDUA 4ZBDA 2H0HA 4G9HA 2VO4A 3WT1A 3I69A 2CAQA 5H5QA 2R5GA 1V58A 3EMPA 1NSWA 2ON7A 3LXZA 4HS1A 1K0DA 3TJBA 2PERA 2P0GA 2E0QA 4TKYA 1VF1A 1GLQA 2JADA 4EF0A 4ZB9A 1GSFA 1I9DA 2L5OA 3PR8A 3HJOA 5AIVA 3I6AA 4WKWA 5ENUA 1TK8B 3VFIA 4GRFA 2C3TA 2H76A 1Y25A 5IMDA 3IA1A 4GSTA 3GMFA 4DSRA 1WP0A 3GX0A 4Q5NA 2CZ2A 2H19A 4XS1A 3CSHA 4ZB6A 5GZZB 4I2UA 3F4SA 2H8LA 5ECIB 2C8UA 2X8GA 5GSSA 3F63A 3FZ5A 3Q74A 3TCOA 4MPGA 1KBNA 3EE2A 3FYGA 2YCDA 4IQ1A 1B9XC 3L9SA 1YZXA 4KUNA 3D4TA 2N5AA 4ECCA 3GL3A 1F9MA 3GH9A 4K6XA 4KSMA 1O8WA 5JWRB 1LU4A 3QCPA 2EC4A 1JFUA 1K0OA 1MTCA 2LSTA 4GLTA 1M0UA 1EP8A 3BD2A 4O7HA 1X0RA 3UAPA 3IC4A 3FZ4A 2GS3A 2L5LA 1PKZA 1A2JA 2HYXA 4ML1A 5D8IA 1JZRA 1TRVA 5LCZA 4MLYA 1VGLA 4N11A 4TXOB 2B6MA 1TK5B 5DDLA 1T7PB 3AY8A 3ERFA 4FYBA 5HFGA 2PU9C 1GNEA 2GQMA 2H74A 3LQ7A 2QC7A 2JL4A 1OE8A 3ME7A 5COHA 3KCMA 1IYIA 4ZBBA 1M2AA 1BJXA 2GT5A 2I3YA 1EV4A 1M2DA 2H1GA 2H6XA 3KD0A 2KP1A 2AJQB 2WGRA 1OVNA 3E3EA 2YZUA 4N30A 4JR6A 4TW5A 2YV7A 1C72A 4TXOA 2NVLA 5ECOB 3BOAA 5DQSA 1YF0A 1V40A 1Z6NA 6GSUA 3CBUA 2CQ9A 4XRDA 2V2GA 1FO5A 2HSHA 2EIRA 4BL7A 1O81A 1GTAA 4TOPA 2H72A 1A2LA 1EOHA 5B8AA 1WPIA 1HQOA 3MNGA 1THOA 4K7IA 4EDZA 1A0FA 4KCEA 2O85A 3DVXA 5HR1A 1UVZA 4IQAA 1TU8A 4O92A 1OKTA 1ZZYA 1EZKA 1GUHA 2D2ZA 3H93A 4E8EA 1ZGNA 2RUFA 1BG5A 1Q4JA 3WGDA 4JEDA 4ZL8A 3KMNA 1K3OA 1X9MB 2RM5A 2ZUPA 4YQUA 1O8XA 2PN8A 5F06A 1NHYA 2JSYA 1Y6EA 2LRTA 3KGKA 3M1GA 1XWAA 2VLVA 5KN1A 3NOFA 1B4QA 4OFMA 1FB6A 4RQRA 3G7IA 2IMIA 3GKKA 4TN8A 4G2EA 3EMXA 1R26A 1F3BA 2DJ2A 2LTKA 3KEBA 5LNKe 4WEYA 2J23A 1BQ7A 2B5EA 3IPZA 5IO2A 3UARA 3I9V2 4KNDA 2GT6A 2H66A 2OE0A 1A0RP 3DMLA 2O89A 2KHPA 3C1SA 1PMTA 5ECSA 1A8LA 1Z3EA 2ZCTA 4TR1B 3TRXA 5D9VA 2Z9SA 4POBA 3FR9A 5INYA 2IN3A 1UC7A 1AIUA 2YPMA 2P5RA 1MDKA 1U87A 3MDKA 4NAXA 3UMAA 2EIOA 2E7PA 5A4UA 1XW9A 1OC9A 4OCEA 3P8WA 5J9CA 5G5FA 2VM1A 2YV9A 2ES7A 5ABRA 2WRTA 3CTGA 3TUEA 5D9TA 5CAXA 5DJLA 2VCWA 2H0GA 1WIKA 1TI3A 5J3RA 1YEPA 2HNLA 5ECLB 2GSQA 3H79A 4BWSA 3VWUA 4K7OA 5ECRB 3TDGA 3QD9A 3FW2A 1R7HA 2C1YA 2GQLA 4LMWA 1B48A 1GNWA 5DCGA 3RAZA 2K9FA 4KDXA 3N5OA 5EPFA 2OBKA 1HNBA 5CO3A 2VLUA 2HXKA 5HQPA 2C0EA 3GYKA 3H4KA 1GSSA 5HR3A 2C4JA 1GWCA 3IAS2 5D93A 1XXUA 4RI7A 1FAAA 4EUYA 1J08A 2C3NA 3K8NA 3DYRA 2GSSA 1XOBA 2X8CA 3TJJA 1EEMA 2OA7A 1RW1A 4ZL7A 1TTZA 3C1RA 2K18A 4MZWA 1ZCPA 6GSYA 1YF1A 4BWQA 1O85A 2FCHA 3E9JB 4PURA 5G31A 2IMKA 1U88A 2LQQA 3A3TA 3W8SA 1M7TA 2E2MA 4OFTA 5ECQB 1PL1A 2YWMA 1DUGA 3MWHA 1PRXA 4WR5A 2HZEB 5IMCA 2HFDA 1TK0B 2HRFA 4KAEA 3Q6OA 2VD1A 5F0GA 3M9JA 1GTBA 1G6YA 3RPNA 1TOFA 2C3QA 5CRHA 4AJ8A 3GX8A 4YAVA 3EU4A 4Q5RA 1WOUA 1NW2A 4HQSA 7GSSA 4KDYA 5G1LA 1GTUA 1DE2A 5GAND 2L57A 4MF7A 3D21A 1WMJA 3DVWA 3NIVA 2HSYA 2RM6A 4ACSA 2MMOA 3RDWA 3QFBC 3IOSA 1HNCA 2TIRA 3KMOA 3BCKA 5ECKB 3SWLA 5IPGA 4AF2A 2MMZA 3ME8A 2RUEA 1V57A 4L5OA 4NHWA 2DJ0A 3IE3A 3F8UA 4MK3A 3VPQA 3VI7A 5C04A 1EWXA 2A2SA 1M2BA 2DMLA 2VCTA 1GL8A 2VIMA 1BAYA 4KH7A 1XPVA 4ECIA 4IS0A 3JCML 1SJ6A 3ZMLA 4I5QA 1FHEA 5IIZA 2YANA 2R4VA 3LXTA 2B5XA 3ZFLA 3MAKA 2FA4A 4F82A 1NHOA 2C80A 3TOUA 2F9SA 2CV4A 2FWFA 3Q19A 2MBSA 4PNGA 3TB2A 3GSSA 3UVHA 4K1FA 5F8BA 3KXOA 2RIIA 1XW6A 4DSQA 1H4OA 4WBRD 2FWEA 5CRGA 4IKHA 1PX6A 3LORA 1YKCA 4POKA 2B3SA 4DSSA 4NXIA 3DKSA 3VURA 5F05A 4KSOA 3VWXA 3NZNA 2GSRA 2IFQA 3QPMA 1N8JA 2IPAA 4NHZA 3C8EA 1PSQA 3HKRA 1F6MC 4GXZA 4ID0A 3QMXA 2DJ3A 2KLXA 2WJUA 1A2MA 3D5JA 2G2QA 3D6IA 2FUG2 1Z7RA 4ECJA 3HVXA 4MF5A 1KEBA 6GSXA 5G2ZA 1BYEA 4ECBA 4PXOA 4GSNA 2L4QA 3EINA 2N5FA 3D22A 4WETA 5DJMA 1PD21 2YWIA 3HHVA 4MH3A 3IXRA 4XS4B 5L71A 1KTEA 2H1DA 3G9BA 1GSDA 4GCIA 2DJKA 2IL3A 1F37A 1A8YA 2G0FA 1GSEA 2PBJA 2N5BA 1A23A 3VWWA 2OE1A 4PGTA 1YKAA 1QUWA 3TKSA 5G5EA 17GSA 2F3MA 3LYPA 4PQHA 5ECPB 3HZ4A 2B1LA 3CRTA 1EEJA 5D96A 1MDIA 1XFLA 4ZXGA 3F9UA 1K0AA 4HZ2A 4FYUA 2P31A 2H70A 2NDOA 3BJ5A 5ECNB 3ZLPA 2V32A 3UEMA 1XOAA 2H71A 4MPFA 3KM6A 2YNXA 2JZTA 4QQ7A 5KEJA 3D4MA 4TR4A 4MJCA 4ILFA 3ZIJA 2O7KA 1X5CA 2MMNA 2YZHA 2CVBA 2M80A 4GSSA 5HFKA 3A2WA 3U5RE 3TKRA 2HZEA 4JBBA 2IIYA 1RQMA 2LS5A 5DALA 3IRAA 5AN1A 1K0BA 4ULXA 3QR6A 4KE3A 1FVJA 3LG6A 2K6VA 1ZMAA 5DAKA 2IJYA 2K8VA 5AGYA 2RLIA 3P7XA 5IMAA 2XBIA 3TGZA 1VF3A 3CMIA 5CRWA 2C0DA 2WB9A 4E8HA 5B8BA 4G10A 3UOMA 5IOXA 3TJFA 4BPYA 2A2RA 3WGXA 1OC8A 2TRXA 2CAIA 4WR4A 5DAKB 3ZITA 1PGTA 3M3MA 2OADA 3GIXA 2H1AA 3IK9A 2GLRA 3TRQA 2LJAA 3KTLA 3UBLA 3O6TA 4F2IA 3CXGA 1X9SB 4IBPA 3J7Yk 1H75A 4XCSA 3F4RA 4MA9A 1AAZA 1R5AA 4HQZA 1PKWA 2XBQA 5B7CA 4XS4A 2VOCA 3WYWA 2FLSA 5C00A 1K0CA 3HA9A 3EURA 1GSYA 2DMMA 18GSA 2AAWA 3QAWA 2CVDA 2A4VA 2H0IA 2DIZA 5IQYA 4V2LA 3GL5A 5ID2A 5J4UA 1T4YA 4X43A 1GP1A 3LFLA 5JCGA 2L6DA 3W8JA 3WGEA 2YP6A 1K0NA 3FR3A 1QK8A 1OAZA 2R6KA 3HZ8A 2WCIA 2YOIA 4PUAA 3CYNA 5H5RA 4NV5A 4TR0A 1JLVA 2VL3A 1G6WA 4TXVA 1FB0A 1XWKA 1SYRA 3ZVJD 3PH9A 3GKNA 4X0XA 2M46A 3HJMA 2VL2C 1HNAA 5DQYA 3QAVA 1B8XA 4L8EA 4MZCA 2GSTA 4POMA 2CT6A 3S9FA 3HJPA 1GH2A 4PUFC 1AQWA 1PQNA 3P90A 4IN0A 4V2NA 2YWNA 2QSIA 3L0HA 3U6VA 5JCUA 1F2EA 4Z7XA 1O7UA 3HYPA 5DBQA 4EKZA 5KN3A 2DC5A 1X9WB 1T1VA 3GRXA 1G7EA 2PVOC 1T3BA 4OO4A 4N10A 2GZPA 2OE3A 4PX1A 4O5RA 2VLTA 2H6ZA 5FT3A 4IP1A 3VI5A 3F3QA 4HZ4A 1URMA 2F8AA 3GN3A 1SKRB 1YEXA 2YJ7A 3L78A 5G30A 4FH8A 5DVBA 1M9BA 2DJJA 4J2FA 1ON4A 1UA5A 4I2TA 4IW9A 1GSQA 2CX3A 1XWCA 5CYYA 3EU3A 2PMTA 2B1KA 3HCZA 1K3LA 2QKEA 1AC1A 3C73A 3M0FA 5G1KA 3ZTLA 3KH7A 1QGVA 2VM2A 6GSWA 2FD3A 4OWYA 4LMVA 4XHMA 2LJKA 2HT9A 4ZL9A 3KP8A 1TRSA 5GAPD 4DEJA 4MJEA 5H5SA 4Q5FA 1S3CA 2P5QA 1M99A 5J41A 3L9VA 2VL2A 2WDUA 4HOJA 1G7OA 2BTOT 4XIHA 2WFCA 4NWYA 1GRXA 1SKSB 3KZQA 2HLSA 3LGCA 3EC3A 5AISA 5EY6A 4V2MA 2H6YA 1HD2A 1WWJA 4EO3A 1M9AA 1SKWB 11GSA 1R4WA 3UBKA 5DCHA 2LV3A 2PPTA 3SBCA 3CTFA 4YQVA 2I4AA 3UJ1A 2DJ1A 1SK0A 1EGRA 2TRCP 1JZOA 4EVMA 1MD4A 1ACVA 3GNJA 2GGTA 3KH9A 5A4WA 1ERWA 3QFAC 5HR0A 6GSSA 1ERUA 22GSA 1GSUA 4KW6A 1TJDA 4EL1A 3DGQA 5ECHB 2F51A 2NBSA 3D0ZA 2GVPA 2R2JA 4IELA 1TP9A 4HJ2A 2LJRA 2L59A 6GSTA 1TU7A 4RI6A 1O6JA 2GZYA 4QL9A 5A4VA 1TKDB 2YWOA 5CREA 1HYUA 4D73A 2C0GA 1U3AA 4F03A 3WD6A 4IHUA 3TJGA 2AB6A 5ELAA 3ZREA 2AUVA 1XWBA 1K3YA 4YH2A 2FY6A 4ZIJA 2I9HA 3KP9A 4N0ZA 1TRWA 2LKUA 3F6DA 2EIQA 3R2QA 2DIYA 4KX4A 3GUSA 1BEDA 5GSTA 3DXBA 4HU9A 4XS6A 2MBTA 4ZB8A 2J9HA 3DWVA 2BMXA 2X64A 5ELGA 1LJRA 3EVIA 2QGVA 8GSSA 2FNOA 1V98A 3MSZA 3ZRDA 1YQ1A 3HXSA 2FWGA 1E6BA 4MABA 3RBTA 4KGIA 2XHFA 1SU9A 4WF5A 4EXJA 5D9XA 3KTBA 3HD5A 2LUSA 3LYKA 3DEXA 4IVFA 4AGSA 4TR1A 4FO5A 3UVTA 2VCVA 1F3AA 1EOGA 3L9UA 3BCIA 5D9WA 2LQOA 2PVQA 4JZQA 2VCXA 2X8HA 1TXXA 1USBA 12GSA 1PN9A 3GA4A 4HJMA 2BJXA 5LD0A 3ZFBA 1YDKA 1THXA 1OC9B 2HI7A 4OMVA 2L6CA 2V1MA 1J9BA 5KN0A 4GQCA 3F6FA 5J9BA 3IHQA 1Q98A 3IDVA 2WS2A 1FVKA 2FA8A 1FW1A 4PQIA 1I5GA 4ML6A 1SK1A 3LJRA 1SK2A 3LSZA 2V6OA 3E0UA 4TVEA 3GTUA 4IJ3A 4O32A 1AW9A 3VK9A 1VF4A 2R3XA 4I6XA 1QQ2A 2XPDA 1QXHA 3GV1A 1Z7PA 1IYHA 1S3DA 2O8VB 4YAPA 2VCQA 3HY2A 1GULA 5EVOA 4N0VA 2H75A 4MJAA 5CRDA 3UL3A 5FHIA 1U3IA 1SENA 4EDYA 4GWRA 1TDIA 4FYCA 1JZWA 1GTIA 4YQMA 3DD3A 4TR3A 1B4PA 5HR2A 1WE0A 1BX9A 1SD8A 5J5NA 3IV4A 2H73A 1AUCA 2VD0A 2M72A 4NMUA 2ZNMA 4PNFA 2ALBA 4BA7A 2IFQB 2IMFA 3GKXA 4HU7A 3EYTA 4OD7A 1PX7A 5E59A 1AXDA 3APSA 1CQHA 1J0FA 4X1UA 10GSA 3RHCA 3F4TA 1MEKA 2VAFA 4DSSB 1V9WA 1GUKA 4MJBA 3VWVA 1EP7A 1XVWA 1T00A 1JLWA 3UIWA 19GSA 1E2YA 1YY7A 2KP2A 1N2AA 2JACA 5JCWA 4LLRA 1QMVA 1OC3A 2CA8A 3KJYA 1RK4A 1O73A 2LNTA 2CZ3A 1TI1A 3FKFA 4Q5QA 4F0CA 1PA3A 4D73B 3F3RA 4FIWA 4QL7A 1ML6A 5HFIA 1XIYA 2GDRA 3G7JA 4CDOA 2X99A 1AQXA 2AYTA 4MMMA 2NPBA 1GLPA 3DRNA 3ED3A 3A2XA 2IWTA 2MYGA 4HDEA 3PGTA 3ERWA 4F0BA 1Z9HA 1SYXA 1JHBA 1A24A 1ERTA 1YJ6A 2JSZA 2I1UA 2LEGA 1X5DA 2LNSA 3QAGA 14GSA 2I81A 1OE7A 4POLA 3L4NA 3ZMKA 1NM3A 5JWQB 5AIXA 2PGTA 2MMAA 3J7Yb 3GH6A 5IMFA 2JZRA 3FR6A 3TKQA 1SL2B 1SJIA 2OBIA 3TJKA 4OCFA 2V41A 1VF2A 5FWGA 4L0UA 4CHSA 2PUKC 5IMZA 3CSJA 4OO5A 4HUAA 4I97A 1DSBA 4IGJA 4IJIA 2NTOA 1WJKA 1OKDA 1KNGA 5B6NA 3EWLA 4JU5A 1JZDA 5JWOB 1MDJA 4XTSA 3FZ9A 5CP1A 3FEUA 1UN2A 2KOKA 4F9ZA 3ZZXA 3O3TA 2IMDA 4H86A 1XZOA 4MZBA 4KA0A 3M8NA 2DBCA 1U6TA 2DLXA 4K8MA 2PWJA 2H1BA 4TRXA 1XW5A 4LL4B 1ILOA
chains in the Genus database with same CATH superfamily
3FXUA 4V19K 2Y0MA 2YU3A 1MD3A 3QDNA 1FBQA 2KFDA 2ADUA 2XPVA 3TKPA 3BBYA 5B6MA 2E2HJ 3I58A 1FZPB 5D73A 2LBFB 1R5GA 3KZYA 2BXYA 3KYDB 4RGRA 4RM3A 1P7JA 3LAJA 5DALB 2AV4A 13GSA 1B9YC 5IP9J 1GV5A 1XVQA 2CVKA 1WJDA 2A6EF 4YIIA 2R3SA 2H30A 2AQEA 4O5UA 3TRPA 2UXXA 2GZZA 3ZCOA 1ZYEA 3TOTA 3MVPA 3KIJA 3L09A 4GTUA 4ZJZA 5KK1A 2GLOA 1Z6MA 4I02A 2KLOA 3GTPJ 1P6RA 2LF8A 5E3OA 1H88C 5CVJA 3HSEA 2MLKA 3CSIA 2M1BA 3K69A 3AG2H 5GADJ 5F6FA 2EIJH 2HTSA 3DPUA 2GQKA 4K9ZA 1TNTA 1S5LC 1YLFA 2GA2A 5L3GA 2K8SA 4IP6A 3ZVJA 2AHEA 4P96A 3CCSI 1FT9A 1Z77A 1FG4A 3LEFA 4BVXA 4K2DA 3V1WA 5GPAA 2WAEA 1HSJA 4B3XA 3GZ6A 3ZL5A 2GTUA 3P2AA 3CLQA 2PMHA 2F8FA 3C71A 3DEEA 1ZLKA 3IH3A 5GAGJ 1YW9A 3EDPA 3HJEA 1S3AA 1X5EA 3A5WA 3G7YA 2FBHA 2XPWA 2VQHA 3OYLA 1FC3A 3PFIA 3RKQA 2VJJA 4M6YA 3OOUA 2YU9J 1WJEA 2FWHA 4BE0A 4BDZA 2JZYA 3A0HC 3TOAA 1R5PA 3V8LA 2ZNYA 3GN3A 3N9JA 3HVSA 4I8BA 2DSAA 3LWFA 3PIPF 1ZGWA 1ABAA 1OYYA 4CYCA 3ISOA 3AG1H 3BPVA 2FHEA 3FXMA 1OYJA 1FSEA 2XF5A 1TZLA 3ZQIA 2O87A 3H8QA 4BL0B 1MGTA 2WZ9A 3CTAA 2IEKA 4Y3OA 1BJZA 2DFFA 2L54A 4KJZA 2CX4A 3Q18A 1VF9A 5EL8A 3E5UA 3W6JB 2OU2A 2R37A 2QYOA 3EPTA 2HYFA 1SD9A 1YW8A 4XRAA 4KT6A 3NRVA 2PJRA 2FGXA 1G3SA 3APOA 4MCUA 2KPMA 2HFHA 2COBA 3CF5F 2KZGA 3RPPA 4CW9A 5HS7A 4E7KA 1Z3XA 5IYDJ 4ZBAA 4WCGA 2XPEA 4BQAA 2KJBA 3FXJA 1CQGA 1Z1DA 1HQCA 4KISA 4B44A 3IBHA 3I56I 4P3YB 1Y8QB 2QBYB 1LJ9A 5J47A 4XLPF 3FK8A 4U0WA 3CC2I 1TRUA 1H9TA 3DTKA 3F0IA 4Q4ZF 2K9NA 3OYHA 1DU6A 3W6GA 4KN7X 2R7ZJ 1I6XA 2BVMA 3RHBA 2XKOA 1XCVA 3JCUC 4LB6B 4A5NA 3GZ5A 1GUMA 2L4CA 2V9VA 2CYYA 1AA7A 2WULA 3FHKA 3NAUA 3BR2A 3FRCA 4GO1A 3VDXA 2FXAA 4KIBA 2IMEA 4JE1A 4ISDA 3OYKA 1UAAA 1XCCA 4HX8A 3I43A 3IWFA 2XC2A 2CW0F 4RA2A 5L3CA 4A3EJ 2PJRB 2H6BA 2B7JA 3VLNA 1LVAA 3MN2A 1LBKA 3FY7A 2HZFA 2B5YA 1ZHFA 2MFZA 3F8FA 2KIMA 1XGSA 1ZARA 9GSSA 1TLHB 3X2QH 3ERGA 4RQXA 4MF6A 3OR5A 2EILH 5E8IA 2LRNA 2DTRA 2Z3YA 3N97A 1Z91A 1LDKB 3QU3A 1W4VA 1WQ2A 2FMYA 2HYJA 1TW9A 1S7OA 1S7AA 2KISA 2DA3A 1K0MA 5IPHA 16GSA 2XKPA 1D0YA 4NQWB 2DA2A 1U2WA 2L02A 2FSWA 2BXZA 4GQFA 1T8EB 2LBFA 4YEJA 1Q1HA 1ENHA 4K7NA 4OFNA 4CCNA 2DN0A 4GFBA 2M8GX 4HZFA 3D1NI 4WXTA 5C44J 3F8NA 3A01A 4HDVA 3DP7A 2VT2A 1N25A 2COMA 2YJHA 1Z21A 4BVYA 3CF2A 5IO0A 4KIFA 3LA3A 4QPQA 4NPBA 1T39A 5ECMB 3GTLJ 4BAYA 4MP4A 1ZL9A 2E2GA 2OF7A 1ZYQB 1IRXA 2IP2A 4PJNA 3OYBA 3PIOF 1SJZA 2XAQA 1D8KA 4C2MJ 4LG0A 3L7WA 4N0BA 3O76A 1LDJA 5L3BA 4MH2A 1ZOFA 1V5EA 2KIFA 2HRNA 3WT2A 5A5KA 3M7GA 3CUQC 2IGMA 3K4NA 1OR7A 5TJJA 3APQA 1OMIA 1R5HA 2QF7A 4GF0A 1ST9A 3BWGA 2BW3A 3GFJA 5HDGA 3LSPA 4L5LA 2FQ4A 1TTYA 2RREA 2XIGA 5EZHA 4L0WA 3AFHA 2KQRA 3JRCA 3KP4A 5F07A 1V3FA 4TV7A 1K83J 2R4GA 4XK4A 4XRSG 2ESHA 4RDUA 2VL9A 3VPTA 4A2UA 2V6KA 2JZSA 2L7KA 3S14J 5CNWA 3HPHA 3IWZA 4RUVA 2R92J 3ZMSA 20GSA 1JUPA 2BGCA 3Q0WA 4XORA 4DIQA 2JA7J 3FF5A 3GCMA 3FMRA 1V2AA 5E79C 1WKMA 4ZILA 3ABLH 2YN1A 2NVXJ 4WBJA 4PSWA 2REMA 2PX9A 2UUZA 2IGOA 2OBPA 3O6BB 5ED4A 4EE0A 2QQ9A 2DOFA 1YI2I 1QFNA 1PN0A 1VI0A 3US3A 5AIPA 4LL1B 1SL1B 1OPCA 3ZP5A 2HXOA 4DVCA 4HX7A 3LWAA 2A5WA 2WTEA 3OIQA 5IMVA 1XBSA 3IK7A 1I50J 2QLZA 4WF4A 2LKPA 4PQ1A 1HW5A 1FJLA 4F91B 5E4WA 4J57E 1R1UA 3CCUI 4NV2A 2I10A 3C3WA 2OJLA 2D5VA 3A2VA 3HL2A 2NVUB 2OZUA 1SFEA 2NAZA 3C7MA 4HQMA 4HBLA 1U5TA 3M8JA 3TKSC 1TT0A 3GO5A 2GOMA 1O3SA 5EYRA 1CQTA 4HX4A 1R00A 3HOWJ 2FF4A 3GKMA 1TQIA 5ICFA 1XD7A 1XGNA 2E1OA 4Y52J 3DIEA 4M9ZA 2LRDA 1T4ZA 3IAM2 1FOVA 2CQQA 1JKPC 2PMUA 1VQNI 5IM9A 4EC0A 1JKRC 2BY1A 3GSTA 1WWXA 3HTSB 4KUMA 3K6GA 3TKSE 5E1XA 2OKAA 2QBYA 1UCRA 5CVIA 4E4HA 1XMAA 1S3RA 1VRSD 4CO8A 4IO9F 3LA2A 3VSLA 2KUCA 3I55I 1TQPA 1ZK8A 4QWQA 4IQ4A 3RJPA 1LQ1A 2H01A 4G19A 2B7KA 4EMSA 1AQVA 3CRUA 4A6DA 4AJ6A 3R61A 2ON5A 1SL0B 4KMFA 5E20A 3F0CA 1FOHA 1Y39A 3M9KA 1STZA 4YFXF 3C1DA 5IYCJ 3IRQA 3OIOA 3OV8A 5CYVA 1LE8B 3KP7A 1K79A 3GFKA 2CS3A 3L9FA 4LOCA 4CZZA 3N4MA 3PINA 2NOGA 1WPKA 2VUPA 3LSGA 5IOWA 4M6VA 5M3MJ 2C0FA 4LK1F 1RC9A 1S8NA 1W89A 2YX7A 3H1NA 3OSFA 4KCAA 4HQEA 1WRYA 4MDCA 2WY7Q 4A0XA 5ID2B 1I1GA 2XAGA 2IPQX 1RKWA 4K0GA 4JRRA 2LRCA 1IN8A 4M6XA 3I53A 3SYTA 2VOOA 1W5SA 4KICA 2HE3A 3HVVA 3ZRGA 4IXAA 3OYJA 1XWGA 2JU5A 1DDNA 3FZAA 2WWYA 2XPUA 2VCZA 4P55A 1QZZA 3GURA 3BTJA 1OJLA 3DEWA 4HI7A 3ZIVA 2DOEA 3QOUA 1OCTC 4YG2F 3OYNA 2VPLA 4BBRJ 3VWBA 2MSYA 1EV9A 1G0TA 3LSKA 3BR3A 2ZFUA 4V1Ap 2PFBA 3DLAA 2VE8A 2MZCA 1X1AA 2OACA 1EGOA 5IOYA 1LFBA 1FYKA 2WB1A 3HDDA 4KB3A 4G94A 1YG2A 2AO9A 1DE1A 4J56E 1U6GA 1PL2A 4IZZA 3GHAA 4LA1A 5FKMA 1R4NB 5D5UB 1GXQA 3ZYWA 6GSVA 4HV5A 4B43A 2R7FA 2W84A 3WE2A 1G8XA 3V7CA 2XF7A 1MJAA 4AJ7A 2CUZA 3SXYA 3GTUB 5KN2A 4K0NA 4IOCF 3IR4A 2R5ZB 2VQCA 3BR1A 3HDCA 3RYRA 3C2HA 2WY8Q 1FYMA 3FWEA 3MMYB 4E6KG 2RV8A 1LB2A 3KP3A 4HEA2 1YTYA 1Z5YE 2R7WA 2CH0A 1R49A 1ERVA 4JR4A 4KDUA 1Z67A 4ZBDA 3BTCA 2H0HA 4EIQA 4G9HA 1XCBA 2IA1A 3IKVA 2VO4A 3I69A 3WT1A 2CAQA 5H5QA 2R5GA 2WAQN 1V58A 1PJRA 3EMPA 4Z6YA 4EGZA 1NSWA 2ON7A 3WU0A 3LXZA 5E3NA 4HF1A 4HS1A 1K0DA 2PQ8A 3TJBA 2PERA 2GZWA 1UB9A 2P0GA 2KJCA 4QLCU 2E0QA 4TKYA 1X2NA 1VF1A 1GLQA 2JADA 2DMUA 4BVXB 4LLLA 2LOOA 4AIJA 1CF7B 5DD8A 4EF0A 1B8IA 4ZB9A 4Z2TA 2KKOA 3CMAI 2VKVA 4EIPA 1GSFA 1V55H 1ZYNA 1WGXA 3IKTA 2CGPA 3KIOA 4RAZA 4OINF 1I9DA 1POGA 2CV2A 1MMDA 2L5OA 3HJOA 3PR8A 2OCCH 2LY1A 3JAMZ 1G3TA 5A2QZ 3I6AA 4WKWA 2NVTJ 5AIVA 5ENUA 4GCVA 1HDDC 2IS2A 3VFIA 1W7PB 1TK8B 3DKXA 4GRFA 3JRDA 2VJ4A 2KP6A 3DBLB 2C3TA 2H76A 1Y25A 3D5LA 2HVRA 5IMDA 2Y9YA 2ZNZA 3BOQA 3BG3A 1YIOA 2VKEA 4KIGA 3WE3A 3IA1A 2VBYA 2V1DA 5LHHA 2Q0OA 3WG9A 1FSHA 1PYVA 1OLTA 3GMFA 4GSTA 1A6IA 4V2FA 4DSRA 1WP0A 2QQ8A 1VFCA 2V7FA 1QVUA 5F1JA 2LDUA 2DI3A 2Z9OA 3GX0A 4Q5NA 2CZ2A 2H19A 4BXXJ 1ZYRF 2DT5A 2C6YA 1XGOA 3GTOJ 3CSHA 4XS1A 2HGCA 4ZB6A 5GZZB 2I5UA 4I2UA 3GX4X 3F4SA 2G7UA 1B9NA 1YW7A 2Y31A 3H35A 3PQKA 2H8LA 5ECIB 2C8UA 1SD4A 2MBFA 1QPIA 2X8GA 5GSSA 3F63A 2VBWA 3FXOA 5DDGA 2Z1DA 3FZ5A 3Q74A 3TCOA 4UB6C 3J7ZI 3FDYA 4USSA 4MPGA 1Z05A 2CQNA 5CKTA 5LRRA 3SFIA 1KBNA 3EE2A 2VKDA 4ENKA 1JUSA 3FYGA 2RKHA 2O61A 2YCDA 1LEBA 1B9XC 4IQ1A 4HNTA 1Z6TA 3L9SA 5EZGA 1YZXA 4KUNA 3F8MA 1J09A 3BTIA 3IUOA 4AVPA 3D4TA 4XR6A 2N5AA 2K9MA 4ECCA 2HDCA 4PFOA 4BS9A 3GL3A 1F9MA 4JX6A 1ETKA 2HWVA 4B3AA 3GH9A 4K6XA 4KSMA 1O8WA 2R0GA 2O8XA 2HDDA 4NHJA 4A0ZA 4Q48A 3PSFA 1CGPA 3L2RA 1LFUP 5JWRB 2E35A 1MBHA 1VQ5I 1LU4A 3QCPA 1R7JA 4RAYA 2BEOA 1IXRC 2EC4A 1REPC 3BT9A 3GYHX 1JFUA 1K0OA 4U87A 4BEHB 2NYXA 2XGDA 1MTCA 2MH9A 2LSTA 4GLTA 1M0UA 3V4GA 2KDZA 1ZR2A 3EUAA 3S2DJ 2CW8A 3J7YJ 3NARA 1EP8A 1R58A 4II3A 1KGSA 1WI3A 3BY6A 1SAXA 3BD2A 4O7HA 2VL8A 4U7DA 1X0RA 4IPAA 3UAPA 1LFPA 3IC4A 1DBYA 1QO0D 2QUFA 5LLQA 3CUQB 3FZ4A 1JXSA 2GS3A 2L5LA 1PKZA 3F6VA 3OYIA 2BW3B 2A07F 3H0DA 1A2JA 2HYXA 4WWCA 2E7WA 1I6HJ 2DQRA 4ML1A 5D8IA 1JZRA 3BR0A 1TRVA 3G2BA 1BR1A 1JGSA 5LCZA 4MLYA 2DBBA 1YE9A 2EINH 1VGLA 4N11A 4TXOB 5JCWA 2B6MA 1TK5B 1DPRA 3E6BA 1XG8A 1HBXG 2K5CA 4FASD 3AY8A 3ERFA 4FYBA 5DDLA 3ZXSA 1T7PB 3K2AA 5HFGA 1D5YA 1BR2A 2PU9C 1GNEA 2GQMA 5GAEJ 2W25A 4HDUA 4MQVA 3VPRA 3RDIA 2H74A 3LQ7A 1W5CC 4ITVA 2QC7A 3P5JA 2JL4A 3BR5A 4RB0A 3W2VA 1OE8A 4YRVA 3FX3A 5E8GA 3ME7A 5F04A 3KCMA 2WBMA 1VQ6I 1IYIA 5COHA 4ZBBA 1OCZH 1M2AA 1BJXA 5JHUA 3QRFF 1XC5A 3HZJA 4NUBA 5J3LA 1RUOA 2GT5A 1Y56A 3BDDA 2STTA 3H3UA 2G7HA 1K6OA 2ME0A 4EM0B 4MTDA 2I3YA 3BQYA 3LSHA 3PL8A 4RLQA 5LHGA 4KYWA 2NVQJ 1EV4A 1M2DA 3HHGA 2H1GA 2H6XA 4PCQA 3KD0A 5FRNA 2KP1A 2AJQB 2R0QC 4A3LJ 2WGRA 1OVNA 4AUXA 1VQLI 2YZUA 1XX5A 3JRFA 3E3EA 2HS5A 4N30A 4JR6A 4O5QA 5KAIC 3GLLA 3EYIA 4TW5A 3E0JB 5FLVA 2YV7A 1KU2A 4BQQA 1C72A 2ZCWA 4TXOA 2NVLA 4JBAA 2CQ7A 3ML6A 5ECOB 4ZZLA 1T6SA 3GBGA 3GLXA 4U0VA 3BOAA 5DQSA 1YF0A 1V40A 4RAFA 2DMPA 1Z6NA 4HSTA 6GSUA 4HNUA 2Z99A 3CBUA 2E19A 2MC3A 2VOPA 2CQ9A 1HW1A 3WTTC 1H8AC 4XRDA 4MQ9F 2V2GA 1OCRH 3R6SA 2CUJA 5EGOA 1FO5A 1FIPA 2HSHA 1IJWC 4CICA 3LQRA 3COAC 2EIRA 2KIUA 2V6CA 3IP4B 1O81A 4BL7A 1GTAA 2ZXHA 4F55A 3OYEA 4TOPA 1MDMB 5DTDA 4XRFA 3HRTA 2E71A 5D5XB 2H72A 1A2LA 1EOHA 4D7NA 1QZEA 1X1PA 5B8AA 2X1CA 1WPIA 1HXDA 3TKYA 1N75A 3W2WA 5HDNA 3Q0VA 1J2XA 3CLOA 1T0FA 3LOCA 1HQOA 3MNGA 1THOA 1BI2A 1S6LA 4G9YA 5B66C 5CJ9A 3RI4A 4K7IA 4EDZA 3CCRI 2R5YB 2M7AA 5FFXA 1A0FA 4KCEA 4C3IJ 2O85A 3DVXA 2ME6A 4DGWB 5HR1A 1UVZA 4IQAA 4IRHA 1TU8A 4O92A 1OKTA 1ZZYA 3K7AJ 2M0CA 3S2HJ 2DAOA 1U8BA 1EZKA 1GUHA 2D2ZA 2JPCA 3OYCA 3JSPA 4C3HJ 1MZBA 2XSJC 1XMKA 5EG0A 3H93A 4E8EA 1ZGNA 2RUFA 3QODA 1BG5A 4RB1A 2LD5A 3ZQGA 1J9IA 1Q4JA 1E3OC 4JEDA 3WGDA 1WH7A 1X4PA 4UV9A 4JP0A 2BY0A 2K4JA 2W00A 4G7HF 4ZL8A 3KMNA 1K3OA 4EJVA 1X9MB 2RM5A 2ZUPA 5GTHC 4CXFA 4XBFA 4BXFA 4CCOA 4YQUA 4R1HA 4DZPA 1O8XA 2XAHA 2Y0SA 3DF8A 2PN8A 1E3HA 5F06A 1KQ9A 1NHYA 3CJRB 4ZDPA 1Y6EA 2JSYA 2LRTA 4XKVA 3KGKA 2WADA 2VPRA 5EG0B 1XWAA 3M1GA 3JR9A 2VLVA 1SD7A 5KN1A 4Z2RA 3F8CA 4C2TA 3NOFA 5F64A 2R7SA 3MZYA 4OFMA 1B4QA 1QZYA 1FB6A 4RQRA 1N78A 3MZHA 2NS7A 4HNVA 3AL0C 1ETXA 3TP3A 3ZN0A 3G7IA 2IMIA 3GKKA 2HXIA 2Z33A 4TN8A 2JUCA 4G2EA 1MBEA 2QM3A 4UUSB 3EMXA 4MFEA 4YFNF 3S32A 1R26A 1ZKGA 1F3BA 1QNTA 3S17J 2DJ2A 1E3PA 3GZNB 3HYIA 2LTKA 2L4MA 2M5WA 3KEBA 5LNKe 3Q0UA 4WEYA 1A35A 1YRNB 2J23A 3K70C 1BQ7A 2B5EA 3IPZA 5IO2A 4MGRA 3FM5A 2O6GE 3UARA 3I9V2 4KNDA 2GT6A 4AD9A 2H66A 2OE0A 1A0RP 3DMLA 4PJLA 3P9IA 5EGOB 4EM1A 4ENNA 2O89A 3HGGA 1KZHA 4EEFG 3ZQFA 4BJ6C 4EJUA 4YIFA 1GXPA 4C2UA 1V5FA 4B09A 4XOPA 2KHPA 3C1SA 2MD5A 4EQQA 1NH3A 2O9LA 1PMTA 5ECSA 1A8LA 4A5PA 1Z3EA 2ZCTA 4TR1B 3TRXA 5D9VA 3I4NJ 2ZBKA 2Z9SA 3QU6A 4POBA 4LD5A 3FR9A 5INYA 2FJ1A 2IN3A 3CCQI 2K27A 2VUMJ 5EEGA 1UC7A 5KVRA 2L9VA 2KRFA 1IRFA 5J8CA 1VQMI 3HOTA 1AIUA 4IHYA 5K7FA 3KP2A 1AKHA 1AKHB 1MD0A 2CUFA 3IH4A 2YPMA 1D0ZA 2P5RA 5AONA 3BCBA 3BQZA 3I3LA 3D5SC 1MDIA 4G0IA 3FISA 3H9JA 3ZQQA 1MDKA 1Y6IA 3U21A 2QVOA 1U87A 3F23A 4EGYA 3GVAA 2K9QA 1TW3A 3KP6A 1ZRCA 3MDKA 4DJAA 4BACA 4NAXA 3WG7H 3SZPA 1OCOH 1YYVA 1B72B 1KQ8A 3T0YA 1EKEA 2OCEA 4PJMA 2X6YA 4BU2A 2EIOA 3UMAA 2E7PA 3CJQB 1XW9A 3ELKA 5A4UA 1I5ZA 1OC9A 4A0YA 4OCEA 3I0TA 4A3JJ 3P8WA 1HA8A 3RIRA 4RGUA 2HOSA 2A3SA 1A31A 5J9CA 2KT0A 2XAJA 2Z16A 1M3IA 3WTWC 3I5UA 2B0LA 2OJED 3OS1A 4CUGA 5G5FA 2VM1A 5M3FJ 4OIQF 2YV9A 2ES7A 2HYGD 2WAQA 5ABRA 2WRTA 1P4WA 4IHXA 3CTGA 2LKSA 3TUEA 4E7ZA 5LBQA 5D9TA 5CAXA 2Q8KA 5DJLA 2VCWA 2XF6A 5E1ZB 1Z3YA 2H0GA 1IN5A 1WIKA 3LFKA 3L00A 1H0MA 4R8HA 1Y0UA 3VB2A 3RDWA 3OL4A 1F9NA 1TI3A 2B7EA 4HF2A 3F21A 5J3RA 3M4OJ 3MZ8A 3J7AO 3Q9VA 4S04A 2GXBA 4J01A 2HPIA 1OQYA 3HB9A 5FRMA 3WGGA 5D5VB 3H5AA 1SD5A 1W0TA 1W36D 2EA2A 3MKZA 1YEPA 2HNLA 4UB8C 5ECLB 1VQ9I 3H3VK 2GSQA 1WHUA 2JJ7A 5FB2A 3H79A 4OU0A 3TW7A 4C3JJ 3VWUA 4BWSA 1UELB 1ZH5A 3B73A 1JT6A 1QMVA 4K7OA 3PPUA 5ECRB 3GTMJ 2WB1N 2VN2A 5HS9A 3TDGA 5L3EA 3QD9A 3FW2A 1R7HA 1LEAA 2C1YA 1O3RA 1YHQI 2GQLA 2KZVA 1B48A 3M9AA 4LMWA 3I54A 1GNWA 2JSCA 1ZYPA 5DCGA 3RAZA 2K9FA 1IXSB 5ERIA 4KDXA 3N5OA 4QIWN 2ZSIB 1IDZA 5EPFA 2TCTA 3OMYA 4CGZA 1BIAA 1R1VA 3ABKH 3HKZA 2P4WA 1N77A 1BC8C 1JJ6C 1WZ2A 2OBKA 1HNBA 2MGQA 5CO3A 2VLUA 3FXLA 2IT0A 2HXKA 5HQPA 1OYWA 4MO7A 2FEZA 3F72A 2C0EA 1SFUA 3GYKA 3H4KA 4HW0A 3JRHA 1GSSA 5HR3A 2TRTA 2C4JA 1GWCA 3OSGA 3ZPLA 3E6MA 4N9IA 5IP6A 5HODA 1TT5B 2DK8A 3SHFA 2EJRA 3IAS2 2KMUA 4K2XA 2E60A 2MD0A 3GFLA 3DU6A 5D93A 2MLGA 1XXUA 5JR3A 4RI7A 1FAAA 4AC0A 3OYGA 4EUYA 4H0EA 1I3AA 1MJ9A 1XS9A 1ON1A 2JA5J 1J08A 4AVZA 2C3NA 3ECOA 3DYRA 2GSSA 1XOBA 2X8CA 3K8NA 1EEMA 2OA7A 3TJJA 2B63J 2ZB9A 4A3GJ 1RW1A 1TTZA 1OYIA 3CCLI 3C1RA 3O8HA 5H2FC 4ZL7A 2XASA 1NG7A 2LSOA 4ZXGA 4IRIA 2K18A 3M3YJ 5GP9A 4MZWA 1ZG1A 1ZCPA 3G3ZA 5D4RA 1QGPA 2Z5UA 5CLSA 6GSYA 2FRHA 5D6EA 1YF1A 1U9NA 1U0JA 4BWQA 3B6AA 4UXNA 4AYBN 1E2XA 1O85A 2FCHA 3E9JB 1DGWY 4PURA 4B47A 4C9YA 3GTQJ 5G31A 3F3XA 3H5NA 2L3DA 1GLNA 2IMKA 1DP3A 3MKYB 1U88A 2LQQA 3A3TA 2R5YA 3W8SA 1M7TA 2DKHA 4BEHA 5IP7J 2HU9A 3DXJF 1D1BA 2VI6A 3IC8A 3LFUA 2E2MA 5C3EJ 2RAEA 4OAZA 4OFTA 5ECQB 2RC4A 4ON0A 2R93J 3ZR8X 2DDAA 1PL1A 4GRIA 4P5OA 2WA0A 3RZOJ 1YS6A 4A3DJ 4WXDA 2YWMA 1DUGA 4AIDA 2LG4A 3E6DA 1DU0A 1EH6A 4PJ0C 3MWHA 3T8TA 1PRXA 4WR5A 2HZEB 3K2ZA 3K4LA 5IMCA 1ORKA 4W97A 3H0GJ 2HFDA 1TK0B 2HRFA 4OIRF 2I8DA 4KAEA 1HKQA 3Q6OA 2VD1A 5F0GA 3M9JA 2QA4I 1TBXA 3G4SI 1GTBA 2JTVA 1TQMA 1F36A 2LREA 4H4KC 1G6YA 4XM3A 3RPNA 2YX4A 1J59A 4PTSA 3VSKA 3REOA 4CY8A 2HQNA 1IZ1A 2L0KA 2M87A 1TOFA 2C3QA 2XGCA 1H9GA 2PEXA 5CRHA 4AJ8A 3GX8A 4YAVA 2DA4A 2EA4A 2B9SA 1D0XA 2KIQA 2D45A 3EU4A 2MC4A 4Q5RA 2YUSA 3A01B 1WOUA 1T33A 5F1RA 1NW2A 2OUMA 4HQSA 7GSSA 2GM4A 2YSRA 3GF2A 3HHHA 1FEXA 4W1UA 1SKRB 1ODDA 1XSVA 3TDUC 2LF7A 2BOLA 1S9HA 4KDYA 1T98A 2BY2A 2H1KA 4UNOA 5G1LA 2RNGA 4ZDOA 1GTUA 1E0EA 5GAND 1DE2A 4G7OF 2L57A 3RCOA 3D21A 1WMJA 3DVWA 3CCVI 3NIVA 4MF7A 2HSYA 2RM6A 2XVCA 5BPDA 4X6AJ 4ACSA 2X6XA 3KETA 1FP1D 1MNDA 2PJPA 5FLXZ 5DUKA 3OYAA 2MMOA 1ZTRA 4E7SA 2ELHA 2LNBA 4U88A 3WODF 3QFBC 4XSXF 3IOSA 2X6WA 2K4BA 2X51A 1WRJA 1HNCA 2TIRA 2FD5A 2OV7A 3KMOA 2M34A 3NWTA 3BCKA 5ECKB 1QBJA 1SFKA 3HTUA 4G6QA 4XONA 3SWLA 1USTA 2HZDA 3VYRB 4ZYHA 1PDNC 5IPGA 2CO5A 1NHAA 3I59B 4JYKA 5LHIA 3HSRA 2ZJQF 1RUNA 4AF2A 1X1BA 2MMZA 3ME8A 2RUEA 5E1WA 1HCRA 1V57A 4L5OA 3H36A 2NXNB 3K10A 3OYDA 3K70D 1Y8RB 2HNHA 3EUHC 4NHWA 2CMPA 5FGMA 2DJ0A 3F8UA 3BG6A 3BG7A 3IE3A 3ASOH 2QGUA 1T56A 4MK3A 5ILUA 2XV4S 2E7XA 3S8PA 3VPQA 1UG0A 1ETVA 3V8KA 1F43A 1YJWI 4KDPA 2PMZA 1XSDA 5J40A 3VI7A 3TO6A 1VQ8I 3AKZA 1YO5C 3WTSC 5C04A 2GWRA 1EWXA 3S1RJ 2A2SA 2XDVA 1M2BA 1KONA 1GHCA 2RQPA 4U0YA 2DMLA 2VCTA 3H9GA 1VQ4I 2GA1A 4F93B 1GL8A 4M3BA 1BAYA 2VIMA 2F4IA 4EJTA 4A3IJ 4BIKA 1RETA 5K5OA 4KH7A 4XMYA 1KU3A 1XPVA 4L5EA 4ECIA 5EJCA 1K78B 4IS0A 3JCML 3OY9A 1YX5A 5FD5A 3BC8A 1SJ6A 3ZMLA 4BHCA 4I5QA 2AQFA 1FHEA 4I7HA 3FXKA 1BC7C 2P7VB 5IIZA 3TP0A 2W48A 2YANA 2DYSH 2H94A 2EV5A 2R4VA 3LL7A 2XAUA 5BNGA 5HLIA 3LXTA 2EFQA 3M1EA 1P4AA 3ZMVA 5K7ZA 2B5XA 3ZMDA 1QRYA 2LY9A 3ZFLA 1T2KA 4DBQA 1J0RA 3MAKA 2X4AA 2FA4A 2Z2SB 1O7FA 1WJAA 2HOAA 2M8EA 2VC1A 2O3FA 4F82A 2X9DA 5BQTA 1VNDA 1T38A 4FTHA 1NHOA 4I09A 1VQKI 2C80A 3TOUA 2F9SA 2CV4A 2FWFA 3Q19A 2MBSA 4PNGA 4M3GA 3TB2A 2PLYA 2STWA 2DMMA 3GSSA 1K4TA 2VKHA 3UVHA 2RGVA 4GXOA 4Q5SF 1P92A 1YFHA 3EETA 1VQPI 1HSTA 4K1FA 5F8BA 1EV7A 2W7NA 3KXOA 2RIIA 3H1CA 1XW6A 3TQNA 3R60A 4CHUA 1W36C 1H4OA 4DSQA 2FOWA 2IGKA 3RQIA 2FWEA 4WBRD 5CRGA 1IV6A 4PSXA 3S1NJ 4V2GA 4IKHA 1PX6A 2OC6A 4E7IA 3LORA 3J80K 1YKCA 4G7ZF 1XSXA 4L0YB 4POKA 1R9TJ 1A04A 2O8KA 3S2WA 2D1VA 2B3SA 4BVYB 4XIDA 1MW7A 2P6SA 4DSSA 1HOMA 1B59A 1L0OC 3N05A 3C18A 1TL8A 2VT3A 4Z2YA 3ZMUA 2V1UA 3DKSA 4NXIA 1TWCJ 3VURA 4CH7A 5F05A 1QVTA 4YKFA 2JRTA 4A6EA 4KSOA 3VWXA 2RDPA 3FBIB 2IS6A 3NZNA 2FBIA 2ZKZA 3IHUA 3GFMA 2M0MA 2LP0A 3HXLA 3OIPA 4A12A 1TWHJ 2GSRA 3PJRA 2IFQA 3QPMA 5FLXK 1N8JA 3MD2A 4IRGA 2W82A 5B1AH 2X6OA 2ISZA 2IPAA 4FHTA 4UVBA 2BV6A 1IUFA 3PQJA 4AU7A 2VJ5A 1ZG5A 3C8EA 4ICYA 4NHZA 1PSQA 1BI1A 4MIMA 3OYMA 1F6MC 2CFOA 3J80Z 3HKRA 1IN6A 4GXZA 2BY3A 3BR6A 4ID0A 3QMXA 4LIVA 4Z2UA 2DJ3A 2KLXA 3FKJA 2OPTA 5FKNA 2HQRA 5HS8A 2WJUA 1A2MA 3G1OA 3D5JA 1FX7A 2G2QA 2E2JJ 1B8IB 4L5IA 3D6IA 2FUG2 5IOZA 2R0PA 1R71A 1Z7RA 4ECJA 5KHDA 5F08A 1JTYA 2GXGA 1BL0A 4IQJA 3HVXA 3KPHA 4MF5A 3A5IA 2K3FA 1KEBA 5BMUA 6GSXA 5HVQC 3ZZXA 5G2ZA 4M3DA 1BYEA 5D8LB 4DOZA 3DU5A 4D0PA 4ECBA 4PXOA 4GSNA 2L4QA 3EINA 2N5FA 2LYCA 2R7QA 1FTZA 1S29A 3JRBA 1PFOA 3D22A 4XLAA 1GV2A 1WJBA 2FU4A 2RN7A 4WETA 5DJMA 1PD21 2F2EA 3A03A 3KEYA 2YWIA 2R7DA 3HHVA 5HR2A 4E7LA 4MH3A 2E2IJ 1LNWA 3SQNA 3IXRA 1U3EM 2UZ8A 4LK0F 4GYIA 3ZMTA 4XS4B 4DBRA 1YRNA 5L71A 1M3JA 2GXAA 4NC7A 3CQFA 1EH8A 2W4SA 2AS5F 1KTEA 2H1DA 1RRJA 3P7NA 3G9BA 1GSDA 4GCIA 3G71I 2DJKA 4ZTFA 2IL3A 5LGUA 3ZN1A 1F37A 1A8YA 2HKOA 1SANA 2Y75A 3HRMA 4LMYA 5FLMJ 2G0FA 1RI7A 3GFIA 1GSEA 1ERDA 2PBJA 1HF0A 2EK5A 3MWMA 3HUGA 2N5BA 4D7MA 2E36A 1A23A 3VWWA 2OE1A 4BKXA 4PGTA 2E1CA 1YKAA 4AWXB 4HF0A 1QUWA 3TKSA 5G5EA 17GSA 2F3MA 3LYPA 5IT3A 3E3VA 3EPZA 3HG9A 4PQHA 5ECPB 3HZ4A 1FP2A 3RQ4A 2B1LA 3CRTA 1EEJA 1YS7A 5D96A 1J75A 3CZ6A 3W6VA 2L4AA 1C0WA 1U5TB 2DMNA 2D2WA 2FOKA 4KITB 5H6QA 5IT9Z 3BJOA 2CQKA 4DNCA 1K0AA 4HZ2A 4FYUA 4IF4A 2P31A 2H70A 4B4CA 2NDOA 3DKYA 3BJ5A 5ECNB 4WXHA 5JLXA 4LB5A 3S15J 3HOSA 4EV0A 4A93J 3ZLPA 2A69F 2V9KA 3HBLA 3MEXA 2M4KA 2V32A 2IXSA 4Y4RA 3UEMA 1XOAA 2VXDA 2NOJB 3KCCA 2H71A 4MPFA 3KM6A 2JN6A 1X2MA 2YNXA 3K4CA 3S3MA 2VE9A 2JZTA 1PUFB 4QQ7A 5KEJA 2XSDC 5KOXA 1HKSA 4HG2A 3D4MA 4CSWA 3M07A 3TMOA 3T8RA 4TR4A 2EPFA 4MJCA 4ILFA 3ZIJA 2O7KA 2M7BA 1YJNI 3PNTA 4IL6C 3PO2J 1X5CA 2MMNA 1FPQA 1ITYA 2YZHA 2CVBA 2EZHA 2M80A 4GSSA 3GTJJ 3A2WA 3DV8A 5L3DA 1MMNA 5HFKA 1WJCA 1R4MB 3U5RE 4MEXF 2CSOA 3DWLE 3TKRA 2HZEA 1WJFA 4O6JA 4JBBA 2IIYA 4HLXA 4AIHA 2H6CA 2DW4A 3BZ6A 3HIFA 3HKZN 3JRGA 1RQMA 2LS5A 2CRGA 1T08B 2L7FP 3MKLA 2ACJA 5DALA 5B3SH 3IRAA 4OWRB 4ESFA 3CCYA 3L2VA 5AN1A 2P5VA 4FISA 1X58A 1K0BA 4ULXA 3QR6A 2P7CB 4KE3A 4BXUA 4YFKF 1JI8A 3QPSA 1FVJA 2DFEA 2IVMA 4KNYA 1D1CA 2MA3A 1F5TA 3SZGA 2K6VA 3LG6A 3E1SA 3DBRB 1ZMAA 3HOUJ 5DAKA 1MH4A 4I6ZA 2IJYA 2EFWA 1SEUA 1BW5A 4KF9A 4WX9A 2K8VA 5AGYA 2RLIA 3P7XA 2OA4A 4L0ZB 2JUGA 4A3CJ 2CUEA 2UV1A 4E70A 2BZTA 5K7HA 2XBIA 5IMAA 3TGZA 2FE3A 1VF3A 3R0AA 2DDBA 3CMIA 1V4RA 4XLNF 5CRWA 2C0DA 1ETYA 4BQOA 2WB9A 3LSJA 1ZQ3P 2HVSA 4E8HA 5B8BA 4G10A 3UOMA 2RNJA 5GAHJ 1OFCX 3CCEI 3NWSA 2R7RA 2K7LA 5IOXA 2HQ5A 3CUQA 2AXLA 3TJFA 4BPYA 3OYFA 2A2RA 4AYBA 3WGXA 1OC8A 2TRXA 2L01A 2CAIA 1TWGJ 4WR4A 5DAKB 5JHFA 1GUUA 2VQGA 1PGTA 4P9FA 2OADA 3M3MA 3ZITA 3GIXA 1UFMA 1DGRM 2H1AA 4RS8A 4CDGA 5HLGA 3ISPA 5JVTA 2P5LC 5BOXA 3IK9A 2BE5F 2GLRA 1PUEE 3TRQA 1SFOJ 1B72A 2LJAA 3KTLA 3UBLA 4JX4A 3O6TA 2GBYA 4F2IA 3KFWX 1RKTA 3CXGA 2EFNA 3Q9SA 2R7TA 4IBPA 3J7Yk 1X9SB 4O3MA 1A5JA 4FX4A 1SC7A 1H75A 1K78A 4XCSA 3F4RA 4MA9A 3J81K 1AAZA 1R5AA 3CO7C 5TISC 4HSRA 4HQZA 1PKWA 2XBQA 4CCKA 5B7CA 4XS4A 2NNNA 2VOCA 3WYWA 1B6AA 3ZGKA 2FNPA 5IT9K 2FLSA 5C00A 4Y33A 1HDPA 2EZLA 4BE1A 2HOTA 1K0CA 3HA9A 3WTZA 3QYEA 2DTZA 5DYMA 4LG0B 3EURA 1SVOA 2Y69H 4MFDA 9ANTA 18GSA 2DJNA 2NVYJ 3GW2A 5FD6A 4IHSA 1GSYA 2VQLA 2AAWA 1OCCH 1ZGAA 2CVDA 2F5DA 2MABA 3W6KB 2A4VA 2HZTA 3KZIC 2H0IA 4PZJA 2DIZA 5IQYA 1BIBA 2E1NA 3WTUC 2W57A 4V2LA 3GL5A 5ID2A 3M8FA 4ZTJA 5J4UA 1T4YA 1MIJA 3HOYJ 1IN7A 4PJJA 4X43A 1GP1A 3FZVA 3R4KA 4PFPA 4N4NB 5DV5A 2CG4A 5D5WB 4HRIA 3LFLA 3ABTA 3AG3H 5JCGA 2L6DA 1H89C 3W8JA 2VB6A 2A6TA 2BVLA 3WGEA 4M73A 4NC8A 2YP6A 1K0NA 3CUOA 5CVRA 1P9QC 2DT6A 5FJ8J 2A5YB 3FR3A 2CW7A 2O0YA 4Y15A 1FMWA 1QK8A 3DTEA 1OAZA 2CJJA 3DEUA 2R6KA 2MH2A 2LLKA 1I39A 3HZ8A 2WCIA 4RM2A 3BG9A 5JLWA 2HDWA 3TW6A 4JQFA 1MNEA 3PNYA 3JW4A 3ZQCA 4QTRA 2YOIA 4PUAA 3PFYA 4PUSA 3CYNA 5H5RA 5M5YJ 2EH3A 4NV5A 2DO7A 3U9GA 3VFZA 4TR0A 2MW8A 3G6EI 3FHNA 2K9LA 4FCYA 1JLVA 3J81Z 3OOPA 1MMSA 4L18B 1G6WA 2VL3A 4TXVA 2ZXWH 4YKGA 1FB0A 1XWKA 5IPAA 1SYRA 2PMZN 1YQAA 4G6TB 3C2GA 2DA1A 3QP6A 2P0WA 3GKNA 3PH9A 2M46A 4X0XA 3ZVJD 3EUHA 4N9HA 4OOIA 1FBSA 1ZN2A 2P81A 4J00A 3HJMA 2JA2A 1ACIA 1RPWA 2VL2C 4ZYEA 5K1YA 3AL0B 3OR1C 1HNAA 1JTXA 2KL4A 5DQYA 2Q2EA 3M1CA 1MMAA 5CQEA 3QAVA 1Z7UA 1B8XA 1EH7A 3VEPA 1IW7F 1IUYA 3GWZA 1R6RA 2HRAA 3QAHA 1AHDP 2E1MB 4L8EA 2UZKA 4I99C 4BQNA 2IAIA 2DA7A 2K9SA 4BUPA 4A3KJ 4MZCA 2GSTA 4POMA 3UKGA 2CT6A 1ETWA 3KZZA 3K1NA 3CMYA 3S9FA 2KHMA 4WF2A 3HJPA 1GH2A 4PUFC 4JOMA 3CESA 5GTIC 1XG1A 1BR4A 1F1ZA 2WV1A 2ZXJA 4NNJA 3ZOBA 5IYBJ 4IX7A 4HOBA 1AQWA 1PQNA 1WH5A 1OKRA 2XB5A 3P90A 5DS9A 1YITI 4UY8I 4IN0A 1BOAA 4ESBA 4FE7A 1DQUA 4G12A 4XSZF 1UHWA 4FT8A 5FKKA 5FO5A 1JJ8C 1FLIA 4V2NA 4CZCA 4E7JA 3HM5A 2QSIA 2YWNA 4Y13A 2LK2A 3O3KA 3HPGA 3L0HA 2EFPA 3RKYA 3I71A 4XLHA 1JKQC 2HKXA 5LFAA 1ZRDA 1VQ7I 3NQOA 3U6VA 5H6RA 2HPMA 4V1Ag 5JCUA 4UUTA 2IS4A 1XDSA 1F2EA 2WAFA 4Z7XA 3QQAA 1K61A 1O7UA 3HYPA 5DBQA 4EKZA 3RPQA 2DC5A 3MYDA 5KN3A 1X9WB 1MBFA 2GIVA 4WXCA 4NBQA 4F52A 1TWAJ 1HKTA 1T1VA 2V6EA 3GRXA 1MKMA 1G7EA 3G1LA 3Q3SA 1T3BA 2PVOC 1OCPA 4OO4A 4N10A 2CWEA 2GZPA 2OE3A 4PX1A 2HSMA 1TC3C 4O5RA 2VLTA 2H6ZA 1PVEA 2W1OA 5FT3A 2LMDA 4IP1A 3VI5A 2LH9A 1BJAA 3F3QA 2EZKA 2X48A 5L3FA 4HZ4A 1URMA 1VZ0A 1O3TA 1R23A 1W4MA 2EV6A 3NEUA 4L5JA 5GPCA 2XROA 1G6NA 1I1SA 1JE8A 3CQZJ 3WU2C 3ONQA 2NNYA 2RQQA 1YEXA 2YJ7A 4HPQA 3L78A 5G30A 4BDYA 4FH8A 5DVBA 1M9BA 2DJJA 4MLOA 4J2FA 5LD2C 2JA8J 5HOOA 2ELKA 4UV8A 2EIMH 1JHHA 2HQAA 5ICEA 5H20A 5KAFC 2KRHA 2M4GA 1ON4A 1SVMA 2VBZA 2UXNA 3EYYA 4I0AA 1UA5A 2A4HA 1XPXA 2VONA 4I2TA 4IW9A 4XKCA 1VTNC 1GSQA 3VODA 3WHCA 2CX3A 1XWCA 5CYYA 4R79A 3EU3A 3SEQA 4RMNA 1IF1A 2PMTA 4KFCA 2GQQA 2B1KA 2L5QA 4L9TA 3HCZA 2L7ZA 2K86A 2DYRH 3ZMZA 1V54H 3CD6I 3AAFA 1K3LA 1AC1A 4K2EA 2QKEA 3C73A 3M0FA 5G1KA 3ZTLA 3MFKA 3KH7A 4ZYAA 2HVQA 4UHTA 3CJNA 1FTTA 2JT1A 1QGVA 2XAFA 2VM2A 4G0KA 2OTLI 1DPUA 2A6HF 2QKMB 5B5EC 4A3FJ 6GSWA 5F0HA 3U1KA 2FD3A 1PUFA 5EF6A 4LMVA 1ETQA 3JAMK 5A2QK 2LJKA 3PSIA 4OWYA 4XHMA 3PUFA 4BHBA 2HT9A 4ZL9A 3ULQB 5J4VA 2V9PA 3BCAA 3PNVA 5CQGA 5EEAA 1RNLA 2IA0A 3KP8A 1TRSA 1Q1VA 5GAPD 4DEJA 3FIWA 2F5VA 5J8FA 2P6TA 4MJEA 3AG4H 5H5SA 3FK7A 2IW5A 4Q5FA 4XN0A 2DMQA 1S3CA 2P5QA 2G0EA 2IBDA 3I59A 2Y9ZA 5BRTA 1M99A 4OMYA 1OISA 1JT0A 1SMYF 2R7VA 1FWZA 5J41A 1ONVA 2A2PA 3L9VA 4BY7J 1D5VA 5K5QA 1SD6A 5HDKA 1VQOI 4UUVA 2VL2A 1RR8C 4IKFA 2OAZA 1Y1VJ 4IHWA 2WDUA 4HOJA 3S3NA 1G7OA 3F9UA 1Y1WJ 2BTOT 4XIHA 2WFCA 4BJTA 4NWYA 1GRXA 1SKSB 3KZQA 2HLSA 3LGCA 3EC3A 3HUGB 3I64A 4IHVA 3PUBA 3SDGA 3KEQA 4RBOA 2DMTA 4I0BA 3J7AY 2H1LA 5AISA 5EY6A 3HOXJ 4RB2C 3FXRA 4V2MA 6PAXA 2EB7A 2H6YA 1HD2A 2XGEA 5J1UA 2DPUA 1WWJA 4EO3A 3FHZA 1M9AA 4DW6A 11GSA 1KQ0A 3LNQA 2JA6J 1R4WA 4QPOA 3CJTB 3KYCB 1AOYA 1MDMA 3O2PE 2Y2ZA 1G4DA 2E5ZA 2LFBA 4XKBA 3U1DA 2O7OA 4MEYF 5DCHA 3UBKA 1X19A 4BL7B 3GTGJ 2LV3A 1BN5A 4P1WA 2PPTA 1XN7A 3SBCA 3WTVC 3CTFA 5DCMA 3F8BA 2V4JC 2ZJPF 2DK5A 3S1MJ 4YQVA 3C2BA 3B02A 1O3QA 2I4AA 3UJ1A 1Z0XA 3H5RA 2DJ1A 4L9JA 4XNFA 2VBXA 2YS9A 1XDUA 2ZXIA 4M9SA 1IDYA 1PP8F 3CC7I 3TO9A 1SK0A 2TRCP 1EGRA 3DTIA 1ETOA 2HOEA 1WVRA 2EV0A 2DJIA 4RGSA 3ABUA 1JZOA 1IGNA 4EVMA 3QAWA 4QSHA 1A36A 5F27A 1NK2P 1ACVA 1MD4A 3GNJA 3HRSA 3QOEA 3V42A 4HSCX 2GGTA 2FBKA 3BZKA 1XTAA 3ZQ7A 3KH9A 3MAJA 2G9WA 1J7KA 2ZO4A 3H9QA 3K4KA 5A4WA 3RYPA 2JMWA 5LGNA 1ERWA 3QFAC 1IO2A 1X3ZB 4DYCA 2P5KA 2FNAA 1TNSA 2Q1ZB 3P9CA 4KMUX 5HR0A 2DA5A 2ZMEB 6GSSA 1ZR4A 3GUDA 4XLCA 1TWFJ 3A2KA 1ERUA 1K6YA 3L2QA 3F22A 1ZREA 1GSUA 22GSA 4KW6A 1TJDA 4ZDLA 2JPBA 2YPRA 3RKXA 3DGQA 5ECHB 4EL1A 4ZYDA 1WJ5A 3EQLF 2LC2A 1V5GA 1GT0C 2F51A 2NBSA 2JVHA 5J6XA 3D0ZA 2GVPA 1LVKA 2R2JA 4IELA 1MSFC 5K5RA 1TP9A 4HJ2A 1W7PA 4II2A 4NDLA 3UR3C 2M30A 2LJRA 2EZIA 3OS2A 5M5WJ 3L2UA 2IRFG 2L59A 2MYSA 3P9KA 1TU7A 6GSTA 2L2OA 4RI6A 2HTJA 1SAUA 4G8XA 1O6JA 2GZYA 4QL9A 3T5XA 5A4VA 1TKDB 2YWOA 3M8EA 2NRAC 3E7LA 5CREA 3QPLA 2DT7B 1HYUA 4D73A 2K40A 3MKWB 4I01A 3UNGC 2C0GA 3S1QJ 1CF7A 1U3AA 3HOVJ 1X3UA 2M2EA 3LSTA 4B1RA 4ESJA 1R5ID 4F03A 1IRGA 3BROA 3WD6A 1YJ9I 2Y0SN 4IHUA 3TJGA 2AB6A 5ELAA 3ZREA 3CDHA 3I4MJ 2LTPA 3F9KA 4LG3A 2V26A 2AUVA 4HA8A 2OD5A 1XWBA 1YOVB 2ETHA 2ID3A 1K3YA 4AIKA 2RVCA 2FY6A 3SEZA 3RPUA 4YH2A 2M9HA 4ZIJA 4K5RA 2I9HA 3KP9A 3CP2A 4IEJA 4N0ZA 3JTGA 1LE8A 3K9TA 3BG5A 2F8AA 1TRWA 4G0LA 1P4XA 2W24A 4ENJA 3TDZC 2LKUA 4LIUA 5D6FA 3F6DA 5E17F 2EIQA 1UHSA 3PM1A 3R2QA 4GYGA 2DIYA 4KX4A 4BJ5C 3GUSA 4ETSA 1BEDA 3BJ6A 5GSTA 2W85A 3A02A 3ECHA 2WC2A 3DXBA 3I4PA 3O8GA 4HU9A 4XS6A 2TDXA 2MBTA 3CMEI 1IRZA 5HNHA 4ZB8A 2QA2A 4A5MA 2J9HA 1EA3A 3DWVA 3GEZA 2IJLA 3E5XA 2H8WA 4FQGA 2BMXA 3PO3J 2X64A 5ELGA 1LDDA 1LJRA 3EVIA 3B6CA 3ERMA 3CMMA 1QQIA 1D1AA 4OAYA 2O5RA 2FNOA 2QGVA 8GSSA 3L2WA 2AHQA 2CFXA 3SZTA 1V98A 3HRUA 3ERED 2VODA 3MSZA 3ZRDA 2GIZA 1GVDA 3R3EA 4DYRA 1YQ1A 4ZYGA 2FWGA 4EM2A 3HXSA 1E6BA 1MBJA 4MABA 1B9MA 3RBTA 2HR3A 3LSMA 3MIXA 4KGIA 2XUBA 2ID6A 1MSEC 2XHFA 1SU9A 4WF5A 4EXJA 2ECCA 3LMMA 1U78A 2VLAA 4KN4X 2A68F 4EATA 1IXCA 1R22A 5D9XA 3KTBA 1J5YA 4PDKA 1TP4A 3QPHA 5D4SA 3H3ZA 1R36A 3HD5A 4HLYA 5DCFA 2LUSA 3LYKA 1JGGA 2JVGA 5ICGA 1U8RA 1SVLA 5ICCA 3DEXA 4IOAF 4IVFA 4AGSA 1LUJB 1X4OA 4TR1A 5E3LA 4FETA 4FO5A 1U5TC 3UVTA 5HLHA 1GVJA 3ZQLA 2VCVA 3TOBA 1F3AA 2QQBA 4S05A 1EOGA 3R0JA 4BY1J 3L9UA 3BCIA 1T8IA 2UWMA 3VYTB 3VYUB 5D9WA 2LQOA 1W0UA 1ULYA 3DBHB 2HEOA 4FE4A 2NS0A 4OIPF 2PVQA 2VCXA 4JZQA 2PG4A 4MNNA 1HLVA 2X8HA 1W5TA 1UG2A 2ICWG 2ZJ2A 3FMQA 4PGGA 2KDOA 3KEOA 1TXXA 1USBA 12GSA 5BPIA 1PN9A 3GA4A 2BHZA 4HJMA 2BJXA 5LD0A 3OL3A 4DZJA 4Y17A 2KRCA 3ZFBA 1YDKA 3KX2A 3WGHA 1HW2A 1THXA 1NK3P 4MNUA 1MBKA 1OC9B 2HI7A 4OMVA 2L6CA 2V1MA 2F5EA 1X1CA 1J9BA 3IH2A 1X1DA 3A4CA 3FKIJ 3LSIA 4XKWA 3JREA 1RZ4A 4PK4A 4BYYA 5KN0A 4GQCA 5D8KB 3F6FA 3OWTA 2VXZA 5J9BA 3IHQA 1YIJI 1Q98A 3IDVA 5EDNA 3LA7A 2WS2A 3BPXA 2H09A 4OIOF 3ZQHA 3QPTA 1FVKA 1FW1A 2FA8A 4PQIA 1I5GA 4LITA 5LEKA 1MBGA 5BMZA 2R7OA 2F6CA 2XGXA 3FXQA 5HNFA 1IG7A 3KE2A 4MHGA 1XFLA 4ML6A 3FBNB 5KOWA 1SK1A 3FM3A 3LJRA 1RR7A 2GAUA 3WGIA 4IJAA 1BW6A 4GGGA 4NQWA 5EEHA 1SK2A 4LJZF 5FFZA 3DPTA 3V7RA 2F4MB 2XB0X 1USSA 2QCOA 2XRLA 2ZFWA 3QWLA 4BH9A 4F92B 3LSZA 2GOXB 1QPMA 1UZCA 3WTYC 2D1HA 2V6OA 3E0UA 3HVNA 4TVEA 4X0GA 3GTUA 4IJ3A 4O32A 3VYSB 2DFIA 3S3OA 1AW9A 2EWNA 1P7IA 1QA6A 3K4BA 2DU9A 3VK9A 4UUSA 1VF4A 4F7ZA 2QSGX 2R3XA 4I6XA 3ROUA 1QQ2A 2R7UA 1QXHA 2XPDA 3GV1A 4BNCA 1Z7PA 1JKOC 4ENMA 3LW9A 4I2OA 2J5OA 5LEJA 1LKXA 1MMGA 4RAGA 5DUIA 3CCMI 1IYHA 1S3DA 2O8VB 4YAPA 2VCQA 1ZG3A 2JQ7A 3HY2A 4K5SA 2MG4A 4BGDA 2DPDA 3RZDJ 1MJBA 1GULA 1FOWA 3E5QA 5EVOA 4N0VA 3DPLC 5FROA 2H75A 2IGNA 3HSFA 4ABZA 4MJAA 4UVAA 1S3JA 2Y30A 4MTEA 5CRDA 2Q2EB 3UL3A 3K1MA 5FHIA 1U3IA 2HI3A 2X1DA 1UJ8A 4WK8F 5LRSA 1SENA 4L9NA 1XB4A 4EDYA 4GWRA 2V1XA 3VOEA 1F4KA 1I3QJ 5KCMA 3DQVC 2X85A 1TDIA 4FYCA 3DCFA 5J4YA 1FIAA 2DQLA 4Q47A 4X4JA 1JZWA 1GTIA 4YQMA 4O5VA 3DD3A 1RIOH 4LLNA 2E5NA 4TR3A 4X1EA 1O7LA 3RTRA 4P9UA 1U9OA 1B4PA 3LQQA 1FYLA 1BX9A 2OQRA 1I27A 1WE0A 3K4JA 1JHFA 3T1BA 1SD8A 3GTKJ 4XLFA 1IN4A 3BLYA 4U7BA 1G59A 1FOKA 3IV4A 3W3CA 5J5NA 2H73A 4CY6A 3MCZA 3SJMA 3K4MA 1AUCA 3A0BC 3HGYA 3GMEA 2VD0A 1T95A 2QWWA 2K3PA 2PN6A 3BZCA 1MNMC 2K85A 5F0CA 2YR2A 3L1PA 2M72A 5CPRB 4NMUA 2ZNMA 3QOPA 4CYDA 1K7AA 4PNFA 2ALBA 4BA7A 1ZGJA 2IFQB 4XOTA 1GDTA 2IMFA 1Z6RA 2BHYA 1W7PD 1DUXC 3EYTA 1K4SA 3GKXA 1PX7A 4HU7A 4OD7A 5E59A 1Z7LA 4JK1X 2ZJRF 1G3YA 1AXDA 3APSA 2OZ6A 1CQHA 1J0FA 4X1UA 10GSA 5TGTA 3RHCA 3F4TA 1MEKA 1OR7C 2VAFA 4DSSB 2JK3A 1V9WA 5J1RA 1IC8A 2XHKA 1QHGA 4KA4A 4D5CA 1GUKA 2EBIA 4OMZA 1APLC 2M3AA 1HC8A 3S16J 1L3LA 4M72A 4MJBA 5JVGF 1A6QA 3CDIA 2V79A 1IV8A 1EP7A 1XVWA 4ZZDA 2H8RA 3VWVA 1T00A 3K0LA 1JLWA 3F6OA 4RGXA 4BHPA 4UVCA 5E3MA 2DKIA 3UIWA 3WU1B 19GSA 4CCJA 3DLLF 1E2YA 2DA6A 1YY7A 2KP2A 1N2AA 3TO7A 2ISYA 4KT5C 1BBYA 3D5RC 4ANJA 3WHBA 1NG6A 1O57A 2LVSA 2QKLB 2JACA 3FMWA 2ZMEC 4LLRA 2BBYA 1WSUA 3H92A 2E1MC 1SMTA 2FMLA 2XRNA 3RPUD 1KU9A 1E17A 1DP7P 1OC3A 2CA8A 3KJYA 3QYFA 3TGNA 2LY2A 3CDLA 5DM6F 1O73A 1RK4A 2LNTA 2CZ3A 1TI1A 2L7MP 3FKFA 5KNLA 4Q5QA 1D8JA 4F0CA 1P2FA 2L9SA 1LPQA 4LLGF 1PA3A 5FKOA 4D73B 3F3RA 4FIWA 1M1EB 1BM9A 2JWTA 3U2RA 5DEQA 4QL7A 5DD4A 1PP7U 2ZC2A 1ML6A 4DYQA 3QYBA 5HFIA 4Y7NJ 5BS6A 2ZSHB 1RESA 2ZMEA 1XIYA 3FMSA 2PBIA 1FMVA 3WTXC 2NS8A 2GDRA 3IV5A 4HYEA 3G7JA 4A3BJ 2CV1A 4CDOA 2X99A 2J5PA 1AQXA 3IRRA 3KLOA 1IAWA 3ABMH 1D3YA 2AXTC 4YIRX 2F48A 2AYTA 4MMMA 4E7HA 4CCMA 2NPBA 1ON2A 1B4AA 1GLPA 2A61A 1BOBA 4YELA 3DRNA 1KA8A 3CP8A 1EF4A 5DM7F 2X1EA 1FBUA 5C4XJ 3ED3A 2JRMA 4C30A 3V8JA 3A2XA 1JUMA 2HRKA 2IWTA 5J1YA 1SFXA 1UMQA 2CU7A 2OTJI 2MYGA 1KYZA 4HDEA 3PGTA 3MQ0A 4AM3A 3OR2C 4HV6A 3ERWA 4EVIA 4F0BA 1Z9HA 1ZLJA 4EJOA 1SYXA 1JHBA 4RLFA 4ASNA 1A24A 3TEDA 4XICA 3LSRA 1FOXA 1ERTA 1YJ6A 2LKXA 2JSZA 1MH3A 3KP5A 2I1UA 1ZRFA 2LEGA 2QENA 2QSHX 2R7XA 1X5DA 4EJWA 4HAMA 3FK6A 4ZC3A 2P8TA 1ZELA 2LNSA 1WI9A 4LGWA 5IY5H 3KYLA 1UHMA 1B1BA 3CCJI 1X3WB 2F5CA 4ZH4F 5JI6A 3G1MA 3V7SA 2X49A 3QAGA 14GSA 4XN3A 2I81A 1OE7A 4POLA 3L4NA 4D5FA 2JSPA 3TL4X 2DOAA 2EIKH 5JFRA 2ESNA 3ZMKA 5HLTA 4NB5A 1NM3A 1G3WA 3CC4I 5JWQB 3DKWA 2IS1A 5AIXA 4N4OB 4XLEA 1S7EA 1KU7A 2PGTA 2MMAA 3RKWA 4RB3C 5AIQA 4CYCB 4B48A 2ECBA 5CVVA 3K1PA 2WV0A 3CO6C 3J7Yb 1QHHD 3HEFA 2EQRA 2XC7A 3JSOA 4PGHA 3SFZA 2DODA 3GH6A 3E6CC 5IMFA 3HC7A 3BTLA 1R1TA 3DFGA 2CV0A 1S72I 2JZRA 3FR6A 1FOYA 3TKQA 4M9XA 3JRAA 1NTCA 1SJIA 1SL2B 2OBIA 2X0LA 2QQAA 2DFHA 5DCMB 3TJKA 4M3EA 4OCFA 2V41A 3C7JA 1VF2A 2OQGA 1W1WE 4I76A 5F0FA 5FKLA 1G2HA 2R0CA 1AWCA 4XRSA 4L0UA 4F3QA 5E18F 2PUKC 4CHSA 5IMZA 1SKWB 2Y48A 2FQ3A 3CSJA 4NC6A 3KLNA 2VC0A 2QEXI 4OO5A 4XL9A 3A1YA 3E97A 4HUAA 4I97A 3Q5FA 1DSBA 4G6DA 4IGJA 1BI3A 2A05A 4IJIA 3IHGA 4I98B 2NTOA 1BA5A 1KYWA 1WJKA 2ELJA 4GDFA 3W2AA 1WFXA 1XMXA 2R5ZA 1Y0NA 3BP8A 2VASA 2PI0A 1OKDA 5FWGA 4IHTA 1KNGA 2QSFX 2EFOA 2L9RA 4IVNA 3HOZJ 3EWLA 4JU5A 1JZDA 5B6NA 2F4OB 2IA2A 5LGTA 1ZAOA 1MDJA 5JWOB 3QP5A 4XTSA 5ILVA 4J19A 3GXOA 4FX0A 3FZ9A 4XRMA 5CP1A 5B1BH 3S93A 3ESWB 4L9VA 3FEUA 1UN2A 1XGMA 2KOKA 1EJ9A 3ASNH 5TRDA 5ILSA 4M71A 5CVUA 1AU7A 2VIXA 4F9ZA 1BI0A 3L2CA 2F5FA 4XQFA 3IL2A 3JRIA 4FQUA 1TW2A 2O03A 4A69C 4D9JA 4D1QA 3OS0A 4JX5A 4BBSJ 3O3TA 4B8XA 3RSNA 2QZ8A 5M5XJ 2IMDA 4CA0A 2BYVE 3TBIA 4H86A 4M74A 1T0FC 2E34A 4M3FA 3EUKL 1XZOA 4MZBA 1FY7A 2FX0A 1FNNA 2N8GA 4KA0A 3M8NA 4DQ2A 2X4HA 2DXIA 1U6TA 2L9NA 1WCMJ 2VJIA 2DBCA 2DLXA 4K8MA 2PWJA 5C4JJ 2H1BA 2DCEA 4LFUA 2LR8A 2CQXA 3D0SA 2H27A 1QU3A 3JTHA 3BJAA 3SDBA 4BE2A 2V1NA 4A3MJ 1Z9CA 4TRXA 3IC7A 3LAPA 4CCLA 2FA5A 2DLLA 4S0HB 3G73A 1O4XA 1XW5A 2QA1A 4LL4B 1ILOA 2K02A 1YX3A 2M45A
chains in the Genus database with same CATH topology
1MD3A 3QDNA 3TKPA 3BBYA 5B6MA 5D73A 2LBFB 4RM3A 5DALB 2AV4A 13GSA 1B9YC 1XVQA 2CVKA 1WJDA 3TRPA 2H30A 2AQEA 4O5UA 2GZZA 3ZCOA 1ZYEA 3TOTA 3KIJA 4GTUA 4ZJZA 1Z6MA 2KLOA 3CSIA 3DPUA 2GQKA 4K9ZA 2K8SA 4IP6A 3ZVJA 2AHEA 1FG4A 3LEFA 4BVXA 4K2DA 3V1WA 3ZL5A 2WAEA 4B3XA 2GTUA 3P2AA 2F8FA 3C71A 3DEEA 3A5WA 1X5EA 1S3AA 3G7YA 2VQHA 3OYLA 2VJJA 3OOUA 1WJEA 2FWHA 4BE0A 4BDZA 1R5PA 3N9JA 3HVSA 4I8BA 2DSAA 1ABAA 3ISOA 2O87A 2FHEA 3H8QA 1OYJA 2XF5A 1TZLA 4BL0B 2WZ9A 4Y3OA 4KJZA 2CX4A 3Q18A 5EL8A 2R37A 3EPTA 1SD9A 4XRAA 4KT6A 2PJRA 2FGXA 3APOA 4MCUA 2KPMA 3RPPA 4CW9A 4E7KA 1Z3XA 4ZBAA 2XPEA 1CQGA 4KISA 4B44A 3IBHA 4P3YB 3FK8A 1TRUA 3DTKA 3F0IA 3OYHA 3W6GA 3RHBA 2BVMA 2L4CA 1GUMA 1AA7A 2WULA 3FHKA 3FRCA 3VDXA 2IMEA 4JE1A 4ISDA 3OYKA 1UAAA 1XCCA 3I43A 2XC2A 3VLNA 2PJRB 2B7JA 3FY7A 1LBKA 2HZFA 2B5YA 2MFZA 9GSSA 3ERGA 4RQXA 4MF6A 3OR5A 2LRNA 1LDKB 1W4VA 1TW9A 1K0MA 5IPHA 16GSA 1D0YA 4NQWB 1T8EB 4GQFA 2LBFA 4YEJA 4K7NA 4OFNA 4CCNA 4WXTA 2YJHA 4BVYA 1Z21A 3CF2A 5IO0A 4QPQA 4NPBA 5ECMB 4MP4A 1ZL9A 2E2GA 1ZYQB 1IRXA 4PJNA 3OYBA 1SJZA 3O76A 4MH2A 1ZOFA 1V5EA 2HRNA 3WT2A 5A5KA 2IGMA 3K4NA 3APQA 4GF0A 1ST9A 2BW3A 4L5LA 2RREA 4L0WA 3AFHA 2KQRA 5F07A 2R4GA 2VL9A 3VPTA 2V6KA 2JZSA 2L7KA 5CNWA 3HPHA 4RUVA 20GSA 4XORA 4DIQA 1V2AA 4ZILA 2YN1A 4WBJA 4PSWA 2REMA 2UUZA 2IGOA 4EE0A 1QFNA 1PN0A 3US3A 4LL1B 1SL1B 4DVCA 3LWAA 2A5WA 3OIQA 5IMVA 1XBSA 3IK7A 4WF4A 4PQ1A 4F91B 5E4WA 4J57E 4NV2A 2OJLA