4HEAA

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 33
structure length 117
sequence length 117
chains with identical sequence P
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4heaA00
4HE8A 5LNKA 3RKOA 4HEAA
chains in the Genus database with same CATH superfamily
3C4WA 2XZEA 3CKDA 4C91A 2RP4A 1BR2A 3G06A 3TLUA 4EAHA 2JQ9A 2K24A 2D5UA 4P0BA 5AQMB 2Y6XA 4ZS2A 2IMLA 3BQLA 3SFDA 1ZKEA 5DABA 3ZT5A 2Q9QD 4AKGA 2XSAA 3J9X1 1KNRA 1CHUA 2M67A 1HNXT 1SA0E 2JMHA 2WZIA 1ZP0A 4PFPA 5FP3A 3P4RA 4PK6A 1MMGA 4KHPT 4PFOA 5FXXA 4DVDA 3ANWA 4ADZA 2EHOB 4DR7T 1WYCA 5LG3A 5J2UE 4AKLA 3CMLA 3PJAJ 4TV8E 3WAJA 5JR9A 2E9XD 3UQ4A 1XZYA 2UXBT 4UF0A 3JC6C 3ZYMA 4QH1A 4WNKA 2W63A 4H9OC 1ZV4X 3FBLA 4X1KE 5AQGB 1FEWA 3I0OA 4ZOLE 4PJJA 2WWVA 4DV6T 4AXPA 3N9LA 4GKJT 4Z90A 5KX5E 2UXXB 2ACZA 2CBJA 3JADA 2CLYC 3ONLC 1VOMA 4HTEA 3CQGB 2XJ7A 3NKZA 1S94A 2YINA 3LBXB 2CBIA 5IYZE 3PUYF 2B76A 3N2OA 2PBIA 3A5XA 2VKDA 4HFVA 4A97A 4B6XA 5CFBA 5JQGE 5EZYE 3ZLIA 3ZMSB 3E0ZA 4JEHB 3SS1A 4CZZB 2M6IA 2CA5A 3PUGA 3C64A 2KT9A 4CN6A 4QXHB 4LMJA 5JDNA 2CWOA 2N1GA 4HE8A 2WY2A 2EHOD 3VRAA 3F57A 3PDYA 3CQXC 4JI0T 3UULA 2A2FX 4ASKA 5ETWA 2N9DA 5L3GB 1WYBA 3EDVA 3NVOA 1Z8UA 1E1HB 3CX8B 2WU5A 2VVNA 2X51A 4ZI3D 4AQFA 2GK9A 1LVKA 3EVYA 3C4XA 2HH7A 3M65A 3RI5A 2NWBA 2AE9A 5FXZA 4PK4A 3JAEA 4JEUB 2LKHA 4O4JE 4UVBB 3L09A 4DV3T 2BBHA 2KINB 2XHEB 3OVUA 4OHFA 2V7MA 4O2BE 1W0AA 5JDFA 4ZHQE 2V1DB 2FJEA 3HKBE 2XQ4A 1LVFA 2AXDS 1JNRA 5LG4A 4UR9A 4EEDA 5L3BB 4AI6A 1GQEA 4X20E 2VB6A 4HWFA 3HR0A 4AQFC 4JI7T 3RHWA 3PUSA 5FVKA 2L3LA 3P7IA 2RPAA 3EHZA 3U3IA 3C98B 5HEJA 5LGUB 2BKNA 4YHHT 4CN1A 5FXWA 3ZN1B 1VCSA 3V5SA 4HN9A 4IL9A 3VKHA 3O1HA 4JI8T 1XWMA 3ABVA 2YEVC 2W2UA 3L3PA 1WR0A 3N2GE 4JI6T 3UUXB 1HG2A 4WBNE 2BZBA 4U2YA 4IDZA 2MTQA 3C4ZA 3AE7A 4QXBB 3D0TA 3LFMA 4LF7T 3KVAA 2W0GA 2CHOA 3QNUA 3C50A 5JDMA 2MAWA 3FBZA 2XQ9A 2KXPB 2D0TA 5AQIB 1G8XA 1KK7A 2X0YA 5ABHA 4DV5T 4COFA 5HEOA 2W00A 5AQJB 4MHCA 4HFBA 2IW5B 3OPCA 2BG9E 2N2NA 5AQSB 2D0UA 4XBFB 1J5ET 2E5LT 3BQIA 4YJ2E 3ZC0A 2PG8A 2YDQA 1UCUA 4BJMA 1IBLT 3AE2A 5FNVE 5HAXA 2WM9A 1U5PA 1ZHCA 3EDUA 3VU7H 3KV4A 2QYWA 1OEDA 2J4GA 3AE5A 3N9MA 3AA6B 3ZMUB 2QVAA 4HWIB 4YHJA 3AEEA 2QRXA 3ZT7A 3DP7A 4XZCA 4X66T 3FXEB 4YTMA 4Z91A 4WYVA 4A5XA 2RA1A 2XPKA 1E2AA 2LSJA 3LG7A 1NENA 3ZMZB 4HWHA 3OJAA 1IJ5A 3IHRA 3IEEA 5ABFB 2SPCA 4NUVA 3ZMTB 4QX7B 4TUYE 3CX6B 3MACA 3RH3A 4GIWA 2IHR1 5L3CB 1OEDC 3N2KE 3AXJA 4OYKA 2CWYA 4ILBA 5HXCA 4H9RC 2V7IA 3Q9DA 3RYIE 2VASA 2BS3A 4P1NA 5HWXA 1J5WA 2UXDT 4IE6A 2NR4A 3TLVA 4LMLA 4PJMA 4JI1T 3H3AA 2J62A 1J1JA 3ZCIA 2YDSA 3ZPOA 3R84B 1T7SA 2LLYA 4L5GA 3TLSA 3AEAA 4FJOA 4DV0T 2XQ3A 2CXLA 3AEGA 3ONXA 2DWGA 5JR9B 3PUWF 2WBLA 1LRZA 4KP3C 4UVAB 1UK5A 5AQLB 1NEKA 3AE3A 4U2ZA 4YXDA 3TLTA 1US7B 5KDMC 2Q9QA 1XMQT 5LMNT 2V6YA 4CI3B 1U4QA 3JAFA 1S35A 4NXMT 3OYXA 3UFEA 2DNXA 2IUBA 4G2AA 4IREA 3SRZA 3ZCJA 2WQYA 1D0XA 5GONE 4DR2T 2YOEA 2XM1A 1XDPA 5HYAA 2UUAT 2WSSV 3UU8A 2NW8A 5LMUT 2JIWA 4AKHA 3PTRB 1HR0T 3CQCB 4O4LE 1Z0PA 1VCTA 1FMVA 3GWHA 1W0BA 5HXHA 5ABGA 3ETUA 2A9UA 3PUXF 2BG9B 4JUYA 1W9RA 5FY1A 2X9WA 1XNQT 4F8HA 2E9XA 3OTOT 3P4SA 3UT5E 4OX9T 4LFCT 2BVLA 2Q9QC 3AE9A 4I0UA 2VKHA 4A56A 3V5UA 4ILCA 4UELA 4UXNB 4H9NC 1MNEA 3AA0B 4TWFA 2HN2A 2UUBT 5AQTB 4UVCB 2C5IT 5HXRA 2R6GF 3Q5XA 4I50E 4E7ZA 5AQFB 2XUEA 5L2LA 3VKGA 1QLBA 1V9DA 3FZLB 3FB2A 3UTKA 5FL0A 2KNDA 3UUMA 2E9XC 4NXNT 3AECA 4TZ4C 3E22E 4HFEA 3RKGA 3ZYKA 2CXFA 1HNWT 3AE4A 5E0OA 3VR9A 2W4XA 3AB3B 4KI0F 2UXCT 4EV6A 2K48A 4NIQA 1CUNA 4QH5A 5AQHB 3RF1A 3RRWA 3K3NA 3HL6A 3AE1A 3KVBA 2V26A 3CPZA 1HX8A 4X1IE 3KBUA 2X67A 2CM0A 3PU3A 3LJCA 3RRCA 3NRXA 3KV9A 3PV0F 4CI2B 2KZ7B 2ZM8A 4J2CA 4U74A 3PUVF 5AQKB 3UQ7A 2LRLA 4TNWA 5LGTB 3F2EA 5JH7E 2LSIA 2PJQA 3FZFB 2H3RA 2BBJA 4EYYR 4ZI2D 4IE4A 3SWHA 4ISSA 2YK0A 4DR6T 4YSXA 3NBXX 3P8CD 4Q25A 2VL8A 1N33T 2EHOC 5HEUA 4DV1T 2DWKA 3L8RA 2FJBA 3AEBA 2WAUA 3W15B 4IDNA 2FBWA 4E7SA 3N5LA 2I59A 3HI2A 3LBXA 5JRCB 4CXYA 1QSDA 2WCAA 2YU1A 1XMOT 4ZI3C 4H9SE 3PUQA 2CPTA 4G63A 3AA1B 3UU3A 1BR1A 2BKPA 1G73A 2X9HA 4YY3T 5AQNB 2LM2A 2ODUA 5JDGA 1WFDA 4DBRA 5LJMA 3MJXA 2IC9A 2WU2A 3Q2MA 2JQKA 3RX6A 5IUXA 4HFDA 4DUZT 1IJ6A 3ESLA 4DR5T 4JBWF 4MFRA 3RYHE 2LHRA 5L3FB 2ZMAA 4LF9T 3RIFA 3X1DA 2WS3A 3ZJ1A 3LK2B 4H63H 3GN5B 3K1SA 2XAFB 4LF8T 5LBQB 2CCQA 1WR6A 5HWYA 3UUBA 2WDRA 2XQ7A 2FJAA 3RC8A 3WI3A 2LT3A 2OA5A 1MNDA 4GYSA 2K9AA 5KMGP 4ZZBA 5AQUB 1SE7A 3JCFA 1FIOA 3CVRA 3AVSA 4DR3T 2NP9A 4AQYT 3UU4A 4B3RT 5F8PA 1UUSA 4CQIA 5HEHA 1IBMT 5FY7A 2NTXA 1N32T 5DQVA 4ILUA 1OEDB 4TV9E 3ETVA 4IE5A 2BS2A 4X62T 4X5TA 4ANJA 2OLTA 3N9NA 2IIUA 2A3DA 4QWNB 4X1YE 2ES0A 4ERRA 3OYZA 2W66A 4NPPA 1MIYA 2I0MA 3ZKRA 4HWDA 3RPUA 3AEDA 4JI2T 2BS4A 3GA8A 2XY8B 5HCJA 3LSVA 4OK0A 3ZN0B 2J47A 2H88A 3LDQB 4U33A 3DTOA 4GYRA 1NWMX 2XTLA 3RIUA 4N78D 3GMIA 3Q5EA 4QX8B 2WB5A 1T98A 3I0QA 3ZSTA 3OBVE 4CXWA 3VRBA 5L3DB 4U31A 5EK2A 5LGNB 3A8YC 1FMWA 5ADXL 2K5BB 2VL0A 3HKCE 3AE8A 1WCRA 1XDOA 3VHLA 3RIAA 3H37A 3PJAA 4EB6E 2VK9A 1Y64B 3O4XE 4WBOA 5CA0E 4YLHA 4LFAT 4ISTA 4AKIA 2WDVA 2DCFA 4BJNA 2ZM2A 2NTYA 3NRYA 4K0UA 2XQ8A 2L9QA 5FKYA 5IHYA 2A72A 5A1LA 2W61A 3RIUC 2FJDA 2E8IA 4IE7A 3TKLB 2H7VC 4ZI7E 5JDQA 5C2TA 4FI5A 5HEGA 2VWAA 4AKRB 1HFAA 4O2AE 1E7PA 5AQVB 4UV9B 1XNRT 5BMVE 2IC6A 4JI3T 2F4VT 2HN1A 3NZQA 2Y48B 3Q5WA 1FJGT 4Z8XA 2X0LB 4ZZCA 1YKEB 2IDOB 5AQOB 2C5KT 3E08A 4EZ4A 4KBMB 5DQWA 2XASB 5J0ZA 2C0SA 3RQWA 2JQQA 4OFZA 4K0KT 3RYFE 2KWIB 4GK5E 2KLQA 5AQPB 1BR4A 5JTGA 4JV5T 1DU2A 5FYMA 5AQRB 2MYSA 4KUMB 2E2AA 2LKGA 2WDQA 3ANWB 4CN4A 5LA6E 5IWAT 2ZLYA 4U3CA 4HWCA 3RKOA 3FXDB 3MZKB 3UU6A 1IAPA 4KHZF 4DV4T 4YJ3E 2CLYB 2D2SA 5EK3A 5LYJE 4PW8A 4DIDB 3ZMVB 1MMNA 2UUCT 3CK6A 3ZSSA 1HS7A 3QB5A 2NW7A 4UF0B 1UX4A 2J1DG 2V7KA 4YSYA 2WZHA 4IDOA 4ZEYA 4JI5T 5ABFA 2VQFT 4PAGA 4LF5T 4L9IA 3KFWX 1KNPA 3EABA 3I1AA 2CMRA 5DJQC 3MK7C 5F5WA 2ODVA 2B1EA 4QKNA 3U78A 1EZ3A 2VQET 4EXTA 3OKQA 4TNVA 4JYAT 3RGLA 4IDQA 4MBQA 3R6NA 4UIGA 1OWAA 5LJNA 5H6QB 1HTJF 5BR8T 2IAKA 1IZNB 3J7Yq 3JC6D 3VR8A 4DNDA 2DL1A 4QHOA 1KFYA 1L0VA 3N9PA 1T8BA 5JREA 1D1CA 2XSBA 4IGUA 2LEHA 5FMNA 2PTFA 1SUMB 2XAJB 5LNKA 5M4YA 2KSRA 4H63V 3ZC1A 3T1HT 1N36T 2G0UA 5LHIB 4AQGA 4UV8B 4YT0A 2Y8DA 2V8SV 2ACXA 5J1GA 2LOPA 3AEFA 1OEDE 3DJBA 1X9BA 4JI4T 2YN6A 3O1JA 3BQKA 1YQ3A 2LJLA 2YU2A 3FHNA 3RYCE 3AE6A 5HXSA 5HCMA 3PE0A 4OYJA 2JQHA 5LBMA 3L39A 1D0YA 2LSYA 2WMNA 4HFIA 4HKAA 4X65T 3AA7B 1I94T 1WLXA 2BG9A 4EZHA 5CGMA 5JDHA 3PU8A 2DLRA 2P9BA 2EHOA 5JR9C 2ZM0A 5L3EB 2NW9A 2V5CA 2I6HA 5LHHB 3K3QC 3T8OA 1HNZT 1D1AA 4IT4A 5LP6E 2XM2A 4O4HE 4WW0A 5FL1A 2XAQB 3I9WA 5JDLA 2Z6EA 2MBGA 4AIUA 2HPLA 3C51A 4DV7T 2X0HA 3UFGA 5H6RB 1HX1B 3EI0A 1X79A 2X9XA 4YSZA 4CXXA 1H7CA 4U72A 3N9OA 4EYUA 4LMKA 3O9XA 2V5DA 4C90A 3IBPA 3UUNA 2CEAA 3B5MA 5LCYA 3ZYLA 3B13A 2LE8A 4HGAA 4U7IA 3TLWA 5CJ5A 2BG9C 3QB5K 2DHRA 1MIWA 1YD8G 3QUJA 5LHGB 2LRKA 2CHNA 2XAHB 1YW0A 1LKXA 1JNZA 4HFHA 4IHJE 4KX6A 2V7JA 2ZM6T 2VVSA 3A7MA 4ZI2C 2UU9T 3LK3B 3P4QA 5HXEA 4DMWA 3MA9A 4LFBT 2X9YA 3NZPA 4V1Av 4IE0A 4ZS3A 3T1YT 4MLKA 4HFCA 5EK4A 3SFEA 2LM9A 2WMOA 3P4WA 4KMCA 4U7YA 4DO0A 2XQ6A 2H7OA 1KEYA 2XAGB 4IL4A 2NOXA 4YTNA 2QA7A 4AISA 4DMVA 1BR0A 1SHZC 1UGOA 1MIVA 3CIRA 3KINB 4BA9A 3ZT6A 4I55E 4P0AA 3I9YA 4M1PA 4GKKT 4I4TE 2WP9A 1YXRA 4P09A 3M3ZB 2UXNB 4PJNA 1M62A 4F6RC 4B3ST 3QOFA 5KXJA 2YDRA 5CB4E 1YQ4A 3IA3A 4ZXLA 4DUYT 1YKHB 1B7TA 2BVMA 5ABEA 5J2TE 4B3TT 1QUUA 5LXTE 4L0RA 4EEBA 5JRCA 2BDEA 5F3JA 3PURA 2HHHT 3RLFF 1VRBA 4GK0E 1KNZA 2KMFA 3HKDE 3QC9A 3SOLA 4A98A 2MPKA 3BK9A 1AJ3A 3MXZA 4BAYB 2LOSA 3ZEFB 4JLEA 1O3XA 4CI1B 5TAOA 1MMAA 5LOVE 1ZEEA 4X64T 2DI4A 4O8SA 2MOZA 1UURA 4TWDA 1R8IA 2XQ5A 5C3JA 5LB7B 3KDSE 2VKJA 5FY0A 3K3OA 4MALA 3PUZF 3NWIA 1N34T 3KV6A 1WRDA 3GN5A 3IF8B 3HKEE 3N9QA 2JRKA 3AXJB 1HF8A 4UEMA 2WWUA 3FZKB 2C5JA 1KF6A 3HA4A 3AVRA 4I43B 3RQUA 2HPJA 1OXZA 2QGSA 2H89A 5C8YE 1HG5A 2W67A 4GOUA 4H9QC 3O1IA 3ONJA 2L8KA 3RC3A 3FZMB 5CA1E 2KWHA 3FZHB 1D1BA 2X66A 3K8PC 3ZJ2A 3AAEB 2LHNA 2V6XA 4ILAA 3CX7B 2YKSA 3PUAA 2CE7A 2W62A 3LK42 5AFUL 4HEAA 4DV2T 4QXCB 3B57A 2V7LA 3P50A 4QH4A 4TWHA 3AAAB 4DR4T 2LSKA 1Y01A 1IBKT 1M7KA 2LSGA 4B3MT 2Q9QB 2VURA 2X68A 4WZXA 2XQAA 2V6YB 1I6ZA 3H3MA 2CRBA 1HCIA 2JJ9A 2XQYA 4EOZB 5FVLA 2K3WA 3UU5A 4TX5A 4YFSA 3AAIA 2JMKA 5JVDE 4PK5A 5L47A 4NUUA 2FUPA 3WAKA 2VKOA 5AQQB 4IIJE 4YTPA 5FXVA 3S4UA 4PJLA 4DR1T 1ZOYA 4XAXB 2OV9A 3Q5DA 4LF6T 2E9XB 4DBQA 5L4EA 4PNIA 4LF4T 3KV5A 4H9PC 4EIWA 3F31A 1MMDA 3P4PA 2JPFA 2M6BA 1W09A 5L4HA 1T72A 4EGWA 4O4IE 3QK6A 2CXDA 3EUHA 2BKOA 3MKDA 2D9DA 1NAFA 3EAMA 4IDPA 3KBTA 3CWZB 4TN7B 2E5VA 1D0ZA 2PFVA 1UX5A
chains in the Genus database with same CATH topology
3C4WA 1IJ6A 3ESLA 3EDUA 3VU7H 3KV4A 3CKDA 4MFRA 4C91A 3RYHE 3AA7B 2RP4A 2LHRA 1BR2A 1WLXA 4EZHA 5L3FB 2ZMAA 5JDHA 4EAHA 3PU8A 2DLRA 3N9MA 3AA6B 3ZMUB 2P9BA 2EHOA 2K24A 5JR9C 3ZJ1A 2ZM0A 4YHJA 3LK2B 5L3EB 4H63H 2NW9A 2D5UA 3GN5B 3DP7A 4P0BA 5LHHB 2XAFB 2Y6XA 5LBQB 2CCQA 4XZCA 3K3QC 1WR6A 3T8OA 5HWYA 3FXEB 4ZS2A 1D1AA 3BQLA 1ZKEA 2RA1A 5LP6E 5DABA 3RC8A 4O4HE 4WW0A 2LSJA 2XAQB 2LT3A 3LG7A 3WI3A 2OA5A 1MNDA 3I9WA 4GYSA 2Q9QD 4AKGA 5JDLA 2K9AA 2Z6EA 5KMGP 2MBGA 3J9X1 2HPLA 2M67A 3C51A 3ZMZB 1SA0E 3OJAA 1FIOA 5H6RB 2JMHA 3CVRA 1IJ5A 3IHRA 4PFPA 3IEEA 5FP3A 3AVSA 1X79A 2NP9A 2SPCA 2X9XA 4PK6A 1MMGA 4NUVA 3ZMTB 4CXXA 5F8PA 4QX7B 1H7CA 4CQIA 4TUYE 1U5PA 3CX6B 4PFOA 4U72A 5FY7A 3N9OA 4EYUA 2NTXA 3O9XA 5DQVA 5FXXA 4DVDA 4ILUA 4C90A 3ANWA 3IBPA 3MACA 3UUNA 3RH3A 4ADZA 2CEAA 4GIWA 5LCYA 2EHOB 3ZYLA 3B13A 2LE8A 4TV9E 4HGAA 3ETVA 5L3CB 4IE5A 2DHRA 1WYCA 5J2UE 1MIWA 4ANJA 3N2KE 4AKLA 3N9NA 4OYKA 2A3DA 2CWYA 5HXCA 3CMLA 4H9RC 4TV8E 1YD8G 4QWNB 3WAJA 3QUJA 4X1YE 2ES0A 2V7IA 4ERRA 3Q9DA 3OYZA 5JR9A 5LHGB 3RYIE 2E9XD 2VASA 2XAHB 1MIYA 5HWXA 1YW0A 4UF0A 3JC6C 1LKXA 4IE6A 3ZYMA 3RPUA 4WNKA 4IHJE 2W63A 2V7JA 3GA8A 4H9OC 1ZV4X 4OK0A 3ZN0B 3FBLA 4PJMA 3H3AA 4ZI2C 3LK3B 5HXEA 4X1KE 4DMWA 3MA9A 2X9YA 3DTOA 3NZPA 4GYRA 3ZCIA 3ZPOA 4V1Av 1NWMX 4IE0A 4ZS3A 1FEWA 4MLKA 3R84B 3I0OA 4ZOLE 5EK4A 2XTLA 4PJJA 2LM9A 4N78D 2WMOA 3GMIA 4KMCA 4DO0A 4L5GA 4AXPA 4QX8B 1T98A 3I0QA 4FJOA 3N9LA 3OBVE 2H7OA 4CXWA 5KX5E 2XAGB 2CXLA 3ONXA 2NOXA 2UXXB 2DWGA 5JR9B 2QA7A 2CLYC 5L3DB 5EK2A 4DMVA 5LGNB 2WBLA 1LRZA 1SHZC 1VOMA 4HTEA 4KP3C 3CQGB 4UVAB 1FMWA 5ADXL 1S94A 2YINA 3LBXB 1MIVA 2K5BB 5IYZE 3HKCE 3KINB 4BA9A 3N2OA 2PBIA 4I55E 4P0AA 1US7B 2VKDA 3A5XA 4HFVA 3VHLA 5KDMC 3I9YA 2Q9QA 4M1PA 4B6XA 3H37A 4CI3B 4I4TE 1U4QA 1S35A 4EB6E 2VK9A 3OYXA 5JQGE 4P09A 5EZYE 3ZLIA 3UFEA 2DNXA 3ZMSB 3E0ZA 4G2AA 3SRZA 4JEHB 1Y64B 3O4XE 3ZCJA 2UXNB 4WBOA 3SS1A 4PJNA 5CA0E 1D0XA 4YLHA 5GONE 4CZZB 4F6RC 4ISTA 4AKIA 2DCFA 4BJNA 2CA5A 2ZM2A 5HYAA 2NTYA 3PUGA 3NRYA 3C64A 2KT9A 4K0UA 2WSSV 4QXHB 5CB4E 2NW8A 4AKHA 3PTRB 2L9QA 5IHYA 1YKHB 3CQCB 4O4LE 1Z0PA 2A72A 5A1LA 1B7TA 2W61A 2BVMA 5JDNA 2CWOA 2N1GA 1FMVA 4HE8A 3GWHA 2E8IA 2EHOD 4IE7A 3F57A 3PDYA 3CQXC 3TKLB 5J2TE 2H7VC 5HXHA 4ZI7E 5JDQA 1QUUA 5LXTE 3ETUA 4L0RA 4FI5A 4JUYA 5FY1A 2X9WA 2BDEA 5JRCA 2VWAA 4AKRB 1HFAA 2A2FX 4O2AE 3UULA 4ASKA 5F3JA 3PURA 5ETWA 2N9DA 2E9XA 4UV9B 5BMVE 2IC6A 1VRBA 4GK0E 1WYBA 3EDVA 5L3GB 2KMFA 3HKDE 3QC9A 3UT5E 1KNZA 3SOLA 3NZQA 1E1HB 2Y48B 3Q5WA 4Z8XA 2X0LB 3CX8B 1YKEB 3BK9A 2BVLA 1AJ3A 2Q9QC 3MXZA 4BAYB 2C5KT 3E08A 4EZ4A 2LOSA 4KBMB 2VKHA 2X51A 4ZI3D 4AQFA 4A56A 3ZEFB 1BR0A 5DQWA 3V5UA 2XASB 2GK9A 1O3XA 4JLEA 2C0SA 4CI1B 4UELA 5TAOA 1MMAA 5LOVE 1ZEEA 1LVKA 4UXNB 4H9NC 1MNEA 3EVYA 2JQQA 4OFZA 3AA0B 3C4XA 3RYFE 2HH7A 2KWIB 2DI4A 3M65A 4O8SA 2MOZA 4UVCB 2C5IT 4GK5E 5HXRA 2KLQA 2NWBA 1BR4A 3Q5XA 5FXZA 5FYMA 3KDSE 2VKJA 5FY0A 3K3OA 2MYSA 4KUMB 4MALA 4PK4A 4I50E 4E7ZA 4JEUB 4O4JE 3ANWB 4UVBB 5LA6E 3L09A 2XUEA 2ZLYA 3KV6A 2KINB 2XHEB 3RKOA 1WRDA 3GN5A 3FXDB 3IF8B 4OHFA 2V7MA 3MZKB 5L2LA 3VKGA 1V9DA 1IAPA 3FB2A 3HKEE 3UTKA 4YJ3E 4O2BE 3N9QA 2CLYB 2D2SA 2JRKA 2KNDA 3UUMA 1HF8A 2E9XC 4UEMA 5EK3A 5JDFA 2V1DB 2WWUA 4TZ4C 4ZHQE 5LYJE 2C5JA 4PW8A 3E22E 3HKBE 1LVFA 3ZMVB 1MMNA 3ZYKA 2CXFA 3HA4A 5E0OA 5LG4A 1HS7A 3AB3B 5L3BB 4AI6A 3AVRA 4I43B 2NW7A 4X20E 4UF0B 2HPJA 1UX4A 2J1DG 2VB6A 1OXZA 2V7KA 2QGSA 2K48A 1CUNA 3HR0A 4AQFC 3PUSA 5C8YE 3RRWA 3K3NA 2L3LA 4PAGA 1HG5A 3HL6A 3P7IA 3U3IA 4GOUA 3C98B 4L9IA 3KVBA 5LGUB 3KFWX 4H9QC 3O1IA 2L8KA 2CMRA 3I1AA 2V26A 5DJQC 5FXWA 3RC3A 3MK7C 3CPZA 3V5SA 3ZN1B 1HX8A 4X1IE 3KBUA 5CA1E 2ODVA 4HN9A 2X67A 2KWHA 2B1EA 1D1BA 2CM0A 2X66A 3PU3A 4QKNA 3U78A 1EZ3A 3K8PC 3ZJ2A 3AAEB 4EXTA 3VKHA 2LHNA 3OKQA 3O1HA 3CX7B 3LJCA 3RRCA 3NRXA 3KV9A 3PUAA 2YEVC 2CE7A 2W62A 3LK42 5AFUL 4HEAA 4QXCB 4MBQA 3B57A 3R6NA 4UIGA 3L3PA 3N2GE 1OWAA 2V7LA 4CI2B 5LJNA 2KZ7B 5H6QB 2ZM8A 3UUXB 1HG2A 1HTJF 3AAAB 4J2CA 4WBNE 2BZBA 2LSKA 2IAKA 4U74A 1IZNB 3J7Yq 2LSGA 3JC6D 4DNDA 4IDZA 2Q9QB 4QHOA 2MTQA 2X68A 3C4ZA 4QXBB 3N9PA 3D0TA 3LFMA 5LGTB 3F2EA 5JH7E 5JREA 2LSIA 1D1CA 4IGUA 3KVAA 2PJQA 1HCIA 2JJ9A 2W0GA 2XQYA 2H3RA 4EOZB 4EYYR 4ZI2D 3C50A 4IE4A 3SWHA 4ISSA 5JDMA 2YK0A 2LEHA 3FBZA 5FMNA 3NBXX 3P8CD 4TX5A 4YFSA 2XAJB 5LNKA 5M4YA 3AAIA 2KXPB 2JMKA 4H63V 2D0TA 2VL8A 5JVDE 3ZC1A 1G8XA 4PK5A 4NUUA 1KK7A 2EHOC 3WAKA 2G0UA 2VKOA 1UX5A 2DWKA 5LHIB 2W00A 4AQGA 4IIJE 4MHCA 4UV8B 2WAUA 5FXVA 3S4UA 3W15B 2Y8DA 5J1GA 2ACXA 4PJLA 4E7SA 2LOPA 3N5LA 2IW5B 2I59A 3HI2A 3LBXA 4XAXB 5JRCB 2N2NA 4CXYA 1QSDA 2E9XB 4DBQA 4PNIA 2D0UA 4XBFB 3DJBA 3KV5A 4H9PC 4EIWA 2YU1A 3F31A 1MMDA 3O1JA 3BQKA 2JPFA 4ZI3C 4H9SE 2LJLA 2YU2A 3PUQA 3FHNA 4G63A 3RYCE 3AA1B 1BR1A 3BQIA 4O4IE 5HXSA 1G73A 2X9HA 4YJ2E 3ZC0A 2PG8A 3PE0A 3QK6A 2CXDA 2ODUA 1UCUA 3EUHA 4OYJA 5JDGA 3MKDA 1NAFA 4DBRA 5LJMA 3MJXA 4BJMA 5FNVE 2IC9A 3KBTA 3Q2MA 5LBMA 3CWZB 5HAXA 4TN7B 1D0YA 2LSYA 2WMNA 3RX6A 2WM9A 1D0ZA 4HKAA 2PFVA 1ZHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE8 A;  5LNK A;  3RKO A;  4HEA A; 
#chains in the Genus database with same CATH topology
 3C4W A;  2XZE A;  3CKD A;  4C91 A;  2RP4 A;  1BR2 A;  3G06 A;  3TLU A;  4EAH A;  2JQ9 A;  2K24 A;  2D5U A;  4P0B A;  5AQM B;  2Y6X A;  4ZS2 A;  2IML A;  3BQL A;  3SFD A;  1ZKE A;  5DAB A;  3ZT5 A;  2Q9Q D;  4AKG A;  2XSA A;  3J9X 1;  1KNR A;  1CHU A;  2M67 A;  1HNX T;  1SA0 E;  2JMH A;  2WZI A;  1ZP0 A;  4PFP A;  5FP3 A;  3P4R A;  4PK6 A;  1MMG A;  4KHP T;  4PFO A;  5FXX A;  4DVD A;  3ANW A;  4ADZ A;  2EHO B;  4DR7 T;  1WYC A;  5LG3 A;  5J2U E;  4AKL A;  3CML A;  3PJA J;  4TV8 E;  3WAJ A;  5JR9 A;  2E9X D;  3UQ4 A;  1XZY A;  2UXB T;  4UF0 A;  3JC6 C;  3ZYM A;  4QH1 A;  4WNK A;  2W63 A;  4H9O C;  1ZV4 X;  3FBL A;  4X1K E;  5AQG B;  1FEW A;  3I0O A;  4ZOL E;  4PJJ A;  2WWV A;  4DV6 T;  4AXP A;  3N9L A;  4GKJ T;  4Z90 A;  5KX5 E;  2UXX B;  2ACZ A;  2CBJ A;  3JAD A;  2CLY C;  3ONL C;  1VOM A;  4HTE A;  3CQG B;  2XJ7 A;  3NKZ A;  1S94 A;  2YIN A;  3LBX B;  2CBI A;  5IYZ E;  3PUY F;  2B76 A;  3N2O A;  2PBI A;  3A5X A;  2VKD A;  4HFV A;  4A97 A;  4B6X A;  5CFB A;  5JQG E;  5EZY E;  3ZLI A;  3ZMS B;  3E0Z A;  4JEH B;  3SS1 A;  4CZZ B;  2M6I A;  2CA5 A;  3PUG A;  3C64 A;  2KT9 A;  4CN6 A;  4QXH B;  4LMJ A;  5JDN A;  2CWO A;  2N1G A;  4HE8 A;  2WY2 A;  2EHO D;  3VRA A;  3F57 A;  3PDY A;  3CQX C;  4JI0 T;  3UUL A;  2A2F X;  4ASK A;  5ETW A;  2N9D A;  5L3G B;  1WYB A;  3EDV A;  3NVO A;  1Z8U A;  1E1H B;  3CX8 B;  2WU5 A;  2VVN A;  2X51 A;  4ZI3 D;  4AQF A;  2GK9 A;  1LVK A;  3EVY A;  3C4X A;  2HH7 A;  3M65 A;  3RI5 A;  2NWB A;  2AE9 A;  5FXZ A;  4PK4 A;  3JAE A;  4JEU B;  2LKH A;  4O4J E;  4UVB B;  3L09 A;  4DV3 T;  2BBH A;  2KIN B;  2XHE B;  3OVU A;  4OHF A;  2V7M A;  4O2B E;  1W0A A;  5JDF A;  4ZHQ E;  2V1D B;  2FJE A;  3HKB E;  2XQ4 A;  1LVF A;  2AXD S;  1JNR A;  5LG4 A;  4UR9 A;  4EED A;  5L3B B;  4AI6 A;  1GQE A;  4X20 E;  2VB6 A;  4HWF A;  3HR0 A;  4AQF C;  4JI7 T;  3RHW A;  3PUS A;  5FVK A;  2L3L A;  3P7I A;  2RPA A;  3EHZ A;  3U3I A;  3C98 B;  5HEJ A;  5LGU B;  2BKN A;  4YHH T;  4CN1 A;  5FXW A;  3ZN1 B;  1VCS A;  3V5S A;  4HN9 A;  4IL9 A;  3VKH A;  3O1H A;  4JI8 T;  1XWM A;  3ABV A;  2YEV C;  2W2U A;  3L3P A;  1WR0 A;  3N2G E;  4JI6 T;  3UUX B;  1HG2 A;  4WBN E;  2BZB A;  4U2Y A;  4IDZ A;  2MTQ A;  3C4Z A;  3AE7 A;  4QXB B;  3D0T A;  3LFM A;  4LF7 T;  3KVA A;  2W0G A;  2CHO A;  3QNU A;  3C50 A;  5JDM A;  2MAW A;  3FBZ A;  2XQ9 A;  2KXP B;  2D0T A;  5AQI B;  1G8X A;  1KK7 A;  2X0Y A;  5ABH A;  4DV5 T;  4COF A;  5HEO A;  2W00 A;  5AQJ B;  4MHC A;  4HFB A;  2IW5 B;  3OPC A;  2BG9 E;  2N2N A;  5AQS B;  2D0U A;  4XBF B;  1J5E T;  2E5L T;  3BQI A;  4YJ2 E;  3ZC0 A;  2PG8 A;  2YDQ A;  1UCU A;  4BJM A;  1IBL T;  3AE2 A;  5FNV E;  5HAX A;  2WM9 A;  1U5P A;  1ZHC A;  3EDU A;  3VU7 H;  3KV4 A;  2QYW A;  1OED A;  2J4G A;  3AE5 A;  3N9M A;  3AA6 B;  3ZMU B;  2QVA A;  4HWI B;  4YHJ A;  3AEE A;  2QRX A;  3ZT7 A;  3DP7 A;  4XZC A;  4X66 T;  3FXE B;  4YTM A;  4Z91 A;  4WYV A;  4A5X A;  2RA1 A;  2XPK A;  1E2A A;  2LSJ A;  3LG7 A;  1NEN A;  3ZMZ B;  4HWH A;  3OJA A;  1IJ5 A;  3IHR A;  3IEE A;  5ABF B;  2SPC A;  4NUV A;  3ZMT B;  4QX7 B;  4TUY E;  3CX6 B;  3MAC A;  3RH3 A;  4GIW A;  2IHR 1;  5L3C B;  1OED C;  3N2K E;  3AXJ A;  4OYK A;  2CWY A;  4ILB A;  5HXC A;  4H9R C;  2V7I A;  3Q9D A;  3RYI E;  2VAS A;  2BS3 A;  4P1N A;  5HWX A;  1J5W A;  2UXD T;  4IE6 A;  2NR4 A;  3TLV A;  4LML A;  4PJM A;  4JI1 T;  3H3A A;  2J62 A;  1J1J A;  3ZCI A;  2YDS A;  3ZPO A;  3R84 B;  1T7S A;  2LLY A;  4L5G A;  3TLS A;  3AEA A;  4FJO A;  4DV0 T;  2XQ3 A;  2CXL A;  3AEG A;  3ONX A;  2DWG A;  5JR9 B;  3PUW F;  2WBL A;  1LRZ A;  4KP3 C;  4UVA B;  1UK5 A;  5AQL B;  1NEK A;  3AE3 A;  4U2Z A;  4YXD A;  3TLT A;  1US7 B;  5KDM C;  2Q9Q A;  1XMQ T;  5LMN T;  2V6Y A;  4CI3 B;  1U4Q A;  3JAF A;  1S35 A;  4NXM T;  3OYX A;  3UFE A;  2DNX A;  2IUB A;  4G2A A;  4IRE A;  3SRZ A;  3ZCJ A;  2WQY A;  1D0X A;  5GON E;  4DR2 T;  2YOE A;  2XM1 A;  1XDP A;  5HYA A;  2UUA T;  2WSS V;  3UU8 A;  2NW8 A;  5LMU T;  2JIW A;  4AKH A;  3PTR B;  1HR0 T;  3CQC B;  4O4L E;  1Z0P A;  1VCT A;  1FMV A;  3GWH A;  1W0B A;  5HXH A;  5ABG A;  3ETU A;  2A9U A;  3PUX F;  2BG9 B;  4JUY A;  1W9R A;  5FY1 A;  2X9W A;  1XNQ T;  4F8H A;  2E9X A;  3OTO T;  3P4S A;  3UT5 E;  4OX9 T;  4LFC T;  2BVL A;  2Q9Q C;  3AE9 A;  4I0U A;  2VKH A;  4A56 A;  3V5U A;  4ILC A;  4UEL A;  4UXN B;  4H9N C;  1MNE A;  3AA0 B;  4TWF A;  2HN2 A;  2UUB T;  5AQT B;  4UVC B;  2C5I T;  5HXR A;  2R6G F;  3Q5X A;  4I50 E;  4E7Z A;  5AQF B;  2XUE A;  5L2L A;  3VKG A;  1QLB A;  1V9D A;  3FZL B;  3FB2 A;  3UTK A;  5FL0 A;  2KND A;  3UUM A;  2E9X C;  4NXN T;  3AEC A;  4TZ4 C;  3E22 E;  4HFE A;  3RKG A;  3ZYK A;  2CXF A;  1HNW T;  3AE4 A;  5E0O A;  3VR9 A;  2W4X A;  3AB3 B;  4KI0 F;  2UXC T;  4EV6 A;  2K48 A;  4NIQ A;  1CUN A;  4QH5 A;  5AQH B;  3RF1 A;  3RRW A;  3K3N A;  3HL6 A;  3AE1 A;  3KVB A;  2V26 A;  3CPZ A;  1HX8 A;  4X1I E;  3KBU A;  2X67 A;  2CM0 A;  3PU3 A;  3LJC A;  3RRC A;  3NRX A;  3KV9 A;  3PV0 F;  4CI2 B;  2KZ7 B;  2ZM8 A;  4J2C A;  4U74 A;  3PUV F;  5AQK B;  3UQ7 A;  2LRL A;  4TNW A;  5LGT B;  3F2E A;  5JH7 E;  2LSI A;  2PJQ A;  3FZF B;  2H3R A;  2BBJ A;  4EYY R;  4ZI2 D;  4IE4 A;  3SWH A;  4ISS A;  2YK0 A;  4DR6 T;  4YSX A;  3NBX X;  3P8C D;  4Q25 A;  2VL8 A;  1N33 T;  2EHO C;  5HEU A;  4DV1 T;  2DWK A;  3L8R A;  2FJB A;  3AEB A;  2WAU A;  3W15 B;  4IDN A;  2FBW A;  4E7S A;  3N5L A;  2I59 A;  3HI2 A;  3LBX A;  5JRC B;  4CXY A;  1QSD A;  2WCA A;  2YU1 A;  1XMO T;  4ZI3 C;  4H9S E;  3PUQ A;  2CPT A;  4G63 A;  3AA1 B;  3UU3 A;  1BR1 A;  2BKP A;  1G73 A;  2X9H A;  4YY3 T;  5AQN B;  2LM2 A;  2ODU A;  5JDG A;  1WFD A;  4DBR A;  5LJM A;  3MJX A;  2IC9 A;  2WU2 A;  3Q2M A;  2JQK A;  3RX6 A;  5IUX A;  4HFD A;  4DUZ T;  1IJ6 A;  3ESL A;  4DR5 T;  4JBW F;  4MFR A;  3RYH E;  2LHR A;  5L3F B;  2ZMA A;  4LF9 T;  3RIF A;  3X1D A;  2WS3 A;  3ZJ1 A;  3LK2 B;  4H63 H;  3GN5 B;  3K1S A;  2XAF B;  4LF8 T;  5LBQ B;  2CCQ A;  1WR6 A;  5HWY A;  3UUB A;  2WDR A;  2XQ7 A;  2FJA A;  3RC8 A;  3WI3 A;  2LT3 A;  2OA5 A;  1MND A;  4GYS A;  2K9A A;  5KMG P;  4ZZB A;  5AQU B;  1SE7 A;  3JCF A;  1FIO A;  3CVR A;  3AVS A;  4DR3 T;  2NP9 A;  4AQY T;  3UU4 A;  4B3R T;  5F8P A;  1UUS A;  4CQI A;  5HEH A;  1IBM T;  5FY7 A;  2NTX A;  1N32 T;  5DQV A;  4ILU A;  1OED B;  4TV9 E;  3ETV A;  4IE5 A;  2BS2 A;  4X62 T;  4X5T A;  4ANJ A;  2OLT A;  3N9N A;  2IIU A;  2A3D A;  4QWN B;  4X1Y E;  2ES0 A;  4ERR A;  3OYZ A;  2W66 A;  4NPP A;  1MIY A;  2I0M A;  3ZKR A;  4HWD A;  3RPU A;  3AED A;  4JI2 T;  2BS4 A;  3GA8 A;  2XY8 B;  5HCJ A;  3LSV A;  4OK0 A;  3ZN0 B;  2J47 A;  2H88 A;  3LDQ B;  4U33 A;  3DTO A;  4GYR A;  1NWM X;  2XTL A;  3RIU A;  4N78 D;  3GMI A;  3Q5E A;  4QX8 B;  2WB5 A;  1T98 A;  3I0Q A;  3ZST A;  3OBV E;  4CXW A;  3VRB A;  5L3D B;  4U31 A;  5EK2 A;  5LGN B;  3A8Y C;  1FMW A;  5ADX L;  2K5B B;  2VL0 A;  3HKC E;  3AE8 A;  1WCR A;  1XDO A;  3VHL A;  3RIA A;  3H37 A;  3PJA A;  4EB6 E;  2VK9 A;  1Y64 B;  3O4X E;  4WBO A;  5CA0 E;  4YLH A;  4LFA T;  4IST A;  4AKI A;  2WDV A;  2DCF A;  4BJN A;  2ZM2 A;  2NTY A;  3NRY A;  4K0U A;  2XQ8 A;  2L9Q A;  5FKY A;  5IHY A;  2A72 A;  5A1L A;  2W61 A;  3RIU C;  2FJD A;  2E8I A;  4IE7 A;  3TKL B;  2H7V C;  4ZI7 E;  5JDQ A;  5C2T A;  4FI5 A;  5HEG A;  2VWA A;  4AKR B;  1HFA A;  4O2A E;  1E7P A;  5AQV B;  4UV9 B;  1XNR T;  5BMV E;  2IC6 A;  4JI3 T;  2F4V T;  2HN1 A;  3NZQ A;  2Y48 B;  3Q5W A;  1FJG T;  4Z8X A;  2X0L B;  4ZZC A;  1YKE B;  2IDO B;  5AQO B;  2C5K T;  3E08 A;  4EZ4 A;  4KBM B;  5DQW A;  2XAS B;  5J0Z A;  2C0S A;  3RQW A;  2JQQ A;  4OFZ A;  4K0K T;  3RYF E;  2KWI B;  4GK5 E;  2KLQ A;  5AQP B;  1BR4 A;  5JTG A;  4JV5 T;  1DU2 A;  5FYM A;  5AQR B;  2MYS A;  4KUM B;  2E2A A;  2LKG A;  2WDQ A;  3ANW B;  4CN4 A;  5LA6 E;  5IWA T;  2ZLY A;  4U3C A;  4HWC A;  3RKO A;  3FXD B;  3MZK B;  3UU6 A;  1IAP A;  4KHZ F;  4DV4 T;  4YJ3 E;  2CLY B;  2D2S A;  5EK3 A;  5LYJ E;  4PW8 A;  4DID B;  3ZMV B;  1MMN A;  2UUC T;  3CK6 A;  3ZSS A;  1HS7 A;  3QB5 A;  2NW7 A;  4UF0 B;  1UX4 A;  2J1D G;  2V7K A;  4YSY A;  2WZH A;  4IDO A;  4ZEY A;  4JI5 T;  5ABF A;  2VQF T;  4PAG A;  4LF5 T;  4L9I A;  3KFW X;  1KNP A;  3EAB A;  3I1A A;  2CMR A;  5DJQ C;  3MK7 C;  5F5W A;  2ODV A;  2B1E A;  4QKN A;  3U78 A;  1EZ3 A;  2VQE T;  4EXT A;  3OKQ A;  4TNV A;  4JYA T;  3RGL A;  4IDQ A;  4MBQ A;  3R6N A;  4UIG A;  1OWA A;  5LJN A;  5H6Q B;  1HTJ F;  5BR8 T;  2IAK A;  1IZN B;  3J7Y q;  3JC6 D;  3VR8 A;  4DND A;  2DL1 A;  4QHO A;  1KFY A;  1L0V A;  3N9P A;  1T8B A;  5JRE A;  1D1C A;  2XSB A;  4IGU A;  2LEH A;  5FMN A;  2PTF A;  1SUM B;  2XAJ B;  5LNK A;  5M4Y A;  2KSR A;  4H63 V;  3ZC1 A;  3T1H T;  1N36 T;  2G0U A;  5LHI B;  4AQG A;  4UV8 B;  4YT0 A;  2Y8D A;  2V8S V;  2ACX A;  5J1G A;  2LOP A;  3AEF A;  1OED E;  3DJB A;  1X9B A;  4JI4 T;  2YN6 A;  3O1J A;  3BQK A;  1YQ3 A;  2LJL A;  2YU2 A;  3FHN A;  3RYC E;  3AE6 A;  5HXS A;  5HCM A;  3PE0 A;  4OYJ A;  2JQH A;  5LBM A;  3L39 A;  1D0Y A;  2LSY A;  2WMN A;  4HFI A;  4HKA A;  4X65 T;  3AA7 B;  1I94 T;  1WLX A;  2BG9 A;  4EZH A;  5CGM A;  5JDH A;  3PU8 A;  2DLR A;  2P9B A;  2EHO A;  5JR9 C;  2ZM0 A;  5L3E B;  2NW9 A;  2V5C A;  2I6H A;  5LHH B;  3K3Q C;  3T8O A;  1HNZ T;  1D1A A;  4IT4 A;  5LP6 E;  2XM2 A;  4O4H E;  4WW0 A;  5FL1 A;  2XAQ B;  3I9W A;  5JDL A;  2Z6E A;  2MBG A;  4AIU A;  2HPL A;  3C51 A;  4DV7 T;  2X0H A;  3UFG A;  5H6R B;  1HX1 B;  3EI0 A;  1X79 A;  2X9X A;  4YSZ A;  4CXX A;  1H7C A;  4U72 A;  3N9O A;  4EYU A;  4LMK A;  3O9X A;  2V5D A;  4C90 A;  3IBP A;  3UUN A;  2CEA A;  3B5M A;  5LCY A;  3ZYL A;  3B13 A;  2LE8 A;  4HGA A;  4U7I A;  3TLW A;  5CJ5 A;  2BG9 C;  3QB5 K;  2DHR A;  1MIW A;  1YD8 G;  3QUJ A;  5LHG B;  2LRK A;  2CHN A;  2XAH B;  1YW0 A;  1LKX A;  1JNZ A;  4HFH A;  4IHJ E;  4KX6 A;  2V7J A;  2ZM6 T;  2VVS A;  3A7M A;  4ZI2 C;  2UU9 T;  3LK3 B;  3P4Q A;  5HXE A;  4DMW A;  3MA9 A;  4LFB T;  2X9Y A;  3NZP A;  4V1A v;  4IE0 A;  4ZS3 A;  3T1Y T;  4MLK A;  4HFC A;  5EK4 A;  3SFE A;  2LM9 A;  2WMO A;  3P4W A;  4KMC A;  4U7Y A;  4DO0 A;  2XQ6 A;  2H7O A;  1KEY A;  2XAG B;  4IL4 A;  2NOX A;  4YTN A;  2QA7 A;  4AIS A;  4DMV A;  1BR0 A;  1SHZ C;  1UGO A;  1MIV A;  3CIR A;  3KIN B;  4BA9 A;  3ZT6 A;  4I55 E;  4P0A A;  3I9Y A;  4M1P A;  4GKK T;  4I4T E;  2WP9 A;  1YXR A;  4P09 A;  3M3Z B;  2UXN B;  4PJN A;  1M62 A;  4F6R C;  4B3S T;  3QOF A;  5KXJ A;  2YDR A;  5CB4 E;  1YQ4 A;  3IA3 A;  4ZXL A;  4DUY T;  1YKH B;  1B7T A;  2BVM A;  5ABE A;  5J2T E;  4B3T T;  1QUU A;  5LXT E;  4L0R A;  4EEB A;  5JRC A;  2BDE A;  5F3J A;  3PUR A;  2HHH T;  3RLF F;  1VRB A;  4GK0 E;  1KNZ A;  2KMF A;  3HKD E;  3QC9 A;  3SOL A;  4A98 A;  2MPK A;  3BK9 A;  1AJ3 A;  3MXZ A;  4BAY B;  2LOS A;  3ZEF B;  4JLE A;  1O3X A;  4CI1 B;  5TAO A;  1MMA A;  5LOV E;  1ZEE A;  4X64 T;  2DI4 A;  4O8S A;  2MOZ A;  1UUR A;  4TWD A;  1R8I A;  2XQ5 A;  5C3J A;  5LB7 B;  3KDS E;  2VKJ A;  5FY0 A;  3K3O A;  4MAL A;  3PUZ F;  3NWI A;  1N34 T;  3KV6 A;  1WRD A;  3GN5 A;  3IF8 B;  3HKE E;  3N9Q A;  2JRK A;  3AXJ B;  1HF8 A;  4UEM A;  2WWU A;  3FZK B;  2C5J A;  1KF6 A;  3HA4 A;  3AVR A;  4I43 B;  3RQU A;  2HPJ A;  1OXZ A;  2QGS A;  2H89 A;  5C8Y E;  1HG5 A;  2W67 A;  4GOU A;  4H9Q C;  3O1I A;  3ONJ A;  2L8K A;  3RC3 A;  3FZM B;  5CA1 E;  2KWH A;  3FZH B;  1D1B A;  2X66 A;  3K8P C;  3ZJ2 A;  3AAE B;  2LHN A;  2V6X A;  4ILA A;  3CX7 B;  2YKS A;  3PUA A;  2CE7 A;  2W62 A;  3LK4 2;  5AFU L;  4HEA A;  4DV2 T;  4QXC B;  3B57 A;  2V7L A;  3P50 A;  4QH4 A;  4TWH A;  3AAA B;  4DR4 T;  2LSK A;  1Y01 A;  1IBK T;  1M7K A;  2LSG A;  4B3M T;  2Q9Q B;  2VUR A;  2X68 A;  4WZX A;  2XQA A;  2V6Y B;  1I6Z A;  3H3M A;  2CRB A;  1HCI A;  2JJ9 A;  2XQY A;  4EOZ B;  5FVL A;  2K3W A;  3UU5 A;  4TX5 A;  4YFS A;  3AAI A;  2JMK A;  5JVD E;  4PK5 A;  5L47 A;  4NUU A;  2FUP A;  3WAK A;  2VKO A;  5AQQ B;  4IIJ E;  4YTP A;  5FXV A;  3S4U A;  4PJL A;  4DR1 T;  1ZOY A;  4XAX B;  2OV9 A;  3Q5D A;  4LF6 T;  2E9X B;  4DBQ A;  5L4E A;  4PNI A;  4LF4 T;  3KV5 A;  4H9P C;  4EIW A;  3F31 A;  1MMD A;  3P4P A;  2JPF A;  2M6B A;  1W09 A;  5L4H A;  1T72 A;  4EGW A;  4O4I E;  3QK6 A;  2CXD A;  3EUH A;  2BKO A;  3MKD A;  2D9D A;  1NAF A;  3EAM A;  4IDP A;  3KBT A;  3CWZ B;  4TN7 B;  2E5V A;  1D0Z A;  2PFV A;  1UX5 A; 
#chains in the Genus database with same CATH homology
 3C4W A;  1IJ6 A;  3ESL A;  3EDU A;  3VU7 H;  3KV4 A;  3CKD A;  4MFR A;  4C91 A;  3RYH E;  3AA7 B;  2RP4 A;  2LHR A;  1BR2 A;  1WLX A;  4EZH A;  5L3F B;  2ZMA A;  5JDH A;  4EAH A;  3PU8 A;  2DLR A;  3N9M A;  3AA6 B;  3ZMU B;  2P9B A;  2EHO A;  2K24 A;  5JR9 C;  3ZJ1 A;  2ZM0 A;  4YHJ A;  3LK2 B;  5L3E B;  4H63 H;  2NW9 A;  2D5U A;  3GN5 B;  3DP7 A;  4P0B A;  5LHH B;  2XAF B;  2Y6X A;  5LBQ B;  2CCQ A;  4XZC A;  3K3Q C;  1WR6 A;  3T8O A;  5HWY A;  3FXE B;  4ZS2 A;  1D1A A;  3BQL A;  1ZKE A;  2RA1 A;  5LP6 E;  5DAB A;  3RC8 A;  4O4H E;  4WW0 A;  2LSJ A;  2XAQ B;  2LT3 A;  3LG7 A;  3WI3 A;  2OA5 A;  1MND A;  3I9W A;  4GYS A;  2Q9Q D;  4AKG A;  5JDL A;  2K9A A;  2Z6E A;  5KMG P;  2MBG A;  3J9X 1;  2HPL A;  2M67 A;  3C51 A;  3ZMZ B;  1SA0 E;  3OJA A;  1FIO A;  5H6R B;  2JMH A;  3CVR A;  1IJ5 A;  3IHR A;  4PFP A;  3IEE A;  5FP3 A;  3AVS A;  1X79 A;  2NP9 A;  2SPC A;  2X9X A;  4PK6 A;  1MMG A;  4NUV A;  3ZMT B;  4CXX A;  5F8P A;  4QX7 B;  1H7C A;  4CQI A;  4TUY E;  1U5P A;  3CX6 B;  4PFO A;  4U72 A;  5FY7 A;  3N9O A;  4EYU A;  2NTX A;  3O9X A;  5DQV A;  5FXX A;  4DVD A;  4ILU A;  4C90 A;  3ANW A;  3IBP A;  3MAC A;  3UUN A;  3RH3 A;  4ADZ A;  2CEA A;  4GIW A;  5LCY A;  2EHO B;  3ZYL A;  3B13 A;  2LE8 A;  4TV9 E;  4HGA A;  3ETV A;  5L3C B;  4IE5 A;  2DHR A;  1WYC A;  5J2U E;  1MIW A;  4ANJ A;  3N2K E;  4AKL A;  3N9N A;  4OYK A;  2A3D A;  2CWY A;  5HXC A;  3CML A;  4H9R C;  4TV8 E;  1YD8 G;  4QWN B;  3WAJ A;  3QUJ A;  4X1Y E;  2ES0 A;  2V7I A;  4ERR A;  3Q9D A;  3OYZ A;  5JR9 A;  5LHG B;  3RYI E;  2E9X D;  2VAS A;  2XAH B;  1MIY A;  5HWX A;  1YW0 A;  4UF0 A;  3JC6 C;  1LKX A;  4IE6 A;  3ZYM A;  3RPU A;  4WNK A;  4IHJ E;  2W63 A;  2V7J A;  3GA8 A;  4H9O C;  1ZV4 X;  4OK0 A;  3ZN0 B;  3FBL A;  4PJM A;  3H3A A;  4ZI2 C;  3LK3 B;  5HXE A;  4X1K E;  4DMW A;  3MA9 A;  2X9Y A;  3DTO A;  3NZP A;  4GYR A;  3ZCI A;  3ZPO A;  4V1A v;  1NWM X;  4IE0 A;  4ZS3 A;  1FEW A;  4MLK A;  3R84 B;  3I0O A;  4ZOL E;  5EK4 A;  2XTL A;  4PJJ A;  2LM9 A;  4N78 D;  2WMO A;  3GMI A;  4KMC A;  4DO0 A;  4L5G A;  4AXP A;  4QX8 B;  1T98 A;  3I0Q A;  4FJO A;  3N9L A;  3OBV E;  2H7O A;  4CXW A;  5KX5 E;  2XAG B;  2CXL A;  3ONX A;  2NOX A;  2UXX B;  2DWG A;  5JR9 B;  2QA7 A;  2CLY C;  5L3D B;  5EK2 A;  4DMV A;  5LGN B;  2WBL A;  1LRZ A;  1SHZ C;  1VOM A;  4HTE A;  4KP3 C;  3CQG B;  4UVA B;  1FMW A;  5ADX L;  1S94 A;  2YIN A;  3LBX B;  1MIV A;  2K5B B;  5IYZ E;  3HKC E;  3KIN B;  4BA9 A;  3N2O A;  2PBI A;  4I55 E;  4P0A A;  1US7 B;  2VKD A;  3A5X A;  4HFV A;  3VHL A;  5KDM C;  3I9Y A;  2Q9Q A;  4M1P A;  4B6X A;  3H37 A;  4CI3 B;  4I4T E;  1U4Q A;  1S35 A;  4EB6 E;  2VK9 A;  3OYX A;  5JQG E;  4P09 A;  5EZY E;  3ZLI A;  3UFE A;  2DNX A;  3ZMS B;  3E0Z A;  4G2A A;  3SRZ A;  4JEH B;  1Y64 B;  3O4X E;  3ZCJ A;  2UXN B;  4WBO A;  3SS1 A;  4PJN A;  5CA0 E;  1D0X A;  4YLH A;  5GON E;  4CZZ B;  4F6R C;  4IST A;  4AKI A;  2DCF A;  4BJN A;  2CA5 A;  2ZM2 A;  5HYA A;  2NTY A;  3PUG A;  3NRY A;  3C64 A;  2KT9 A;  4K0U A;  2WSS V;  4QXH B;  5CB4 E;  2NW8 A;  4AKH A;  3PTR B;  2L9Q A;  5IHY A;  1YKH B;  3CQC B;  4O4L E;  1Z0P A;  2A72 A;  5A1L A;  1B7T A;  2W61 A;  2BVM A;  5JDN A;  2CWO A;  2N1G A;  1FMV A;  4HE8 A;  3GWH A;  2E8I A;  2EHO D;  4IE7 A;  3F57 A;  3PDY A;  3CQX C;  3TKL B;  5J2T E;  2H7V C;  5HXH A;  4ZI7 E;  5JDQ A;  1QUU A;  5LXT E;  3ETU A;  4L0R A;  4FI5 A;  4JUY A;  5FY1 A;  2X9W A;  2BDE A;  5JRC A;  2VWA A;  4AKR B;  1HFA A;  2A2F X;  4O2A E;  3UUL A;  4ASK A;  5F3J A;  3PUR A;  5ETW A;  2N9D A;  2E9X A;  4UV9 B;  5BMV E;  2IC6 A;  1VRB A;  4GK0 E;  1WYB A;  3EDV A;  5L3G B;  2KMF A;  3HKD E;  3QC9 A;  3UT5 E;  1KNZ A;  3SOL A;  3NZQ A;  1E1H B;  2Y48 B;  3Q5W A;  4Z8X A;  2X0L B;  3CX8 B;  1YKE B;  3BK9 A;  2BVL A;  1AJ3 A;  2Q9Q C;  3MXZ A;  4BAY B;  2C5K T;  3E08 A;  4EZ4 A;  2LOS A;  4KBM B;  2VKH A;  2X51 A;  4ZI3 D;  4AQF A;  4A56 A;  3ZEF B;  1BR0 A;  5DQW A;  3V5U A;  2XAS B;  2GK9 A;  1O3X A;  4JLE A;  2C0S A;  4CI1 B;  4UEL A;  5TAO A;  1MMA A;  5LOV E;  1ZEE A;  1LVK A;  4UXN B;  4H9N C;  1MNE A;  3EVY A;  2JQQ A;  4OFZ A;  3AA0 B;  3C4X A;  3RYF E;  2HH7 A;  2KWI B;  2DI4 A;  3M65 A;  4O8S A;  2MOZ A;  4UVC B;  2C5I T;  4GK5 E;  5HXR A;  2KLQ A;  2NWB A;  1BR4 A;  3Q5X A;  5FXZ A;  5FYM A;  3KDS E;  2VKJ A;  5FY0 A;  3K3O A;  2MYS A;  4KUM B;  4MAL A;  4PK4 A;  4I50 E;  4E7Z A;  4JEU B;  4O4J E;  3ANW B;  4UVB B;  5LA6 E;  3L09 A;  2XUE A;  2ZLY A;  3KV6 A;  2KIN B;  2XHE B;  3RKO A;  1WRD A;  3GN5 A;  3FXD B;  3IF8 B;  4OHF A;  2V7M A;  3MZK B;  5L2L A;  3VKG A;  1V9D A;  1IAP A;  3FB2 A;  3HKE E;  3UTK A;  4YJ3 E;  4O2B E;  3N9Q A;  2CLY B;  2D2S A;  2JRK A;  2KND A;  3UUM A;  1HF8 A;  2E9X C;  4UEM A;  5EK3 A;  5JDF A;  2V1D B;  2WWU A;  4TZ4 C;  4ZHQ E;  5LYJ E;  2C5J A;  4PW8 A;  3E22 E;  3HKB E;  1LVF A;  3ZMV B;  1MMN A;  3ZYK A;  2CXF A;  3HA4 A;  5E0O A;  5LG4 A;  1HS7 A;  3AB3 B;  5L3B B;  4AI6 A;  3AVR A;  4I43 B;  2NW7 A;  4X20 E;  4UF0 B;  2HPJ A;  1UX4 A;  2J1D G;  2VB6 A;  1OXZ A;  2V7K A;  2QGS A;  2K48 A;  1CUN A;  3HR0 A;  4AQF C;  3PUS A;  5C8Y E;  3RRW A;  3K3N A;  2L3L A;  4PAG A;  1HG5 A;  3HL6 A;  3P7I A;  3U3I A;  4GOU A;  3C98 B;  4L9I A;  3KVB A;  5LGU B;  3KFW X;  4H9Q C;  3O1I A;  2L8K A;  2CMR A;  3I1A A;  2V26 A;  5DJQ C;  5FXW A;  3RC3 A;  3MK7 C;  3CPZ A;  3V5S A;  3ZN1 B;  1HX8 A;  4X1I E;  3KBU A;  5CA1 E;  2ODV A;  4HN9 A;  2X67 A;  2KWH A;  2B1E A;  1D1B A;  2CM0 A;  2X66 A;  3PU3 A;  4QKN A;  3U78 A;  1EZ3 A;  3K8P C;  3ZJ2 A;  3AAE B;  4EXT A;  3VKH A;  2LHN A;  3OKQ A;  3O1H A;  3CX7 B;  3LJC A;  3RRC A;  3NRX A;  3KV9 A;  3PUA A;  2YEV C;  2CE7 A;  2W62 A;  3LK4 2;  5AFU L;  4HEA A;  4QXC B;  4MBQ A;  3B57 A;  3R6N A;  4UIG A;  3L3P A;  3N2G E;  1OWA A;  2V7L A;  4CI2 B;  5LJN A;  2KZ7 B;  5H6Q B;  2ZM8 A;  3UUX B;  1HG2 A;  1HTJ F;  3AAA B;  4J2C A;  4WBN E;  2BZB A;  2LSK A;  2IAK A;  4U74 A;  1IZN B;  3J7Y q;  2LSG A;  3JC6 D;  4DND A;  4IDZ A;  2Q9Q B;  4QHO A;  2MTQ A;  2X68 A;  3C4Z A;  4QXB B;  3N9P A;  3D0T A;  3LFM A;  5LGT B;  3F2E A;  5JH7 E;  5JRE A;  2LSI A;  1D1C A;  4IGU A;  3KVA A;  2PJQ A;  1HCI A;  2JJ9 A;  2W0G A;  2XQY A;  2H3R A;  4EOZ B;  4EYY R;  4ZI2 D;  3C50 A;  4IE4 A;  3SWH A;  4ISS A;  5JDM A;  2YK0 A;  2LEH A;  3FBZ A;  5FMN A;  3NBX X;  3P8C D;  4TX5 A;  4YFS A;  2XAJ B;  5LNK A;  5M4Y A;  3AAI A;  2KXP B;  2JMK A;  4H63 V;  2D0T A;  2VL8 A;  5JVD E;  3ZC1 A;  1G8X A;  4PK5 A;  4NUU A;  1KK7 A;  2EHO C;  3WAK A;  2G0U A;  2VKO A;  1UX5 A;  2DWK A;  5LHI B;  2W00 A;  4AQG A;  4IIJ E;  4MHC A;  4UV8 B;  2WAU A;  5FXV A;  3S4U A;  3W15 B;  2Y8D A;  5J1G A;  2ACX A;  4PJL A;  4E7S A;  2LOP A;  3N5L A;  2IW5 B;  2I59 A;  3HI2 A;  3LBX A;  4XAX B;  5JRC B;  2N2N A;  4CXY A;  1QSD A;  2E9X B;  4DBQ A;  4PNI A;  2D0U A;  4XBF B;  3DJB A;  3KV5 A;  4H9P C;  4EIW A;  2YU1 A;  3F31 A;  1MMD A;  3O1J A;  3BQK A;  2JPF A;  4ZI3 C;  4H9S E;  2LJL A;  2YU2 A;  3PUQ A;  3FHN A;  4G63 A;  3RYC E;  3AA1 B;  1BR1 A;  3BQI A;  4O4I E;  5HXS A;  1G73 A;  2X9H A;  4YJ2 E;  3ZC0 A;  2PG8 A;  3PE0 A;  3QK6 A;  2CXD A;  2ODU A;  1UCU A;  3EUH A;  4OYJ A;  5JDG A;  3MKD A;  1NAF A;  4DBR A;  5LJM A;  3MJX A;  4BJM A;  5FNV E;  2IC9 A;  3KBT A;  3Q2M A;  5LBM A;  3CWZ B;  5HAX A;  4TN7 B;  1D0Y A;  2LSY A;  2WMN A;  3RX6 A;  2WM9 A;  1D0Z A;  4HKA A;  2PFV A;  1ZHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...