4HEAA

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
b'MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 33
structure length 117
sequence length 117
chains with identical sequence P
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4heaA00
3RKOA 4HEAA 4HE8A 5LNKA
chains in the Genus database with same CATH superfamily
3MACA 2WSSV 5LGUB 4EB6E 2UXNB 4J2CA 2IAKA 2A2FX 4AQGA 1XDOA 1HNXT 3RKGA 1T98A 3RQWA 4GYRA 3ZJ1A 3FB2A 4AKHA 1US7B 4CZZB 5LGTB 2XQ3A 3HKEE 3AE3A 3CMLA 3Q5WA 3TLUA 4TWFA 2BBJA 3QOFA 4KUMB 2RP4A 3KV9A 1D0YA 2W63A 3KVBA 3ESLA 2NR4A 3AVSA 1EZ3A 2VASA 3QK6A 3SS1A 3N2KE 1W9RA 2JMHA 3GN5B 5JDNA 2N9DA 3CX8B 4JYAT 3D0TA 4IE0A 5DJQC 3PUQA 2IDOB 3C64A 2CBIA 5CB4E 2WAUA 4EZ4A 1E2AA 2WZIA 2LM2A 3ZMSB 1N32T 4AQYT 4O2AE 4QX7B 4OFZA 5FXXA 4OYKA 2WY2A 2X0LB 4LF6T 3FXEB 1DU2A 2XM2A 2K48A 5FP3A 3UUNA 4IDPA 5L3GB 2OLTA 2BS2A 2LT3A 2Y48B 3BK9A 4IL9A 3O9XA 2KXPB 1U5PA 3OVUA 4LF9T 2C5IT 4U74A 5H6QB 1G73A 2VKOA 3Q5EA 4V1Av 2VKHA 4KP3C 2D2SA 4E7SA 4LFCT 2CLYB 3BQIA 2V6YA 2ACXA 3N9PA 5AQVB 3RIAA 3JC6D 5JVDE 3LFMA 1KEYA 4ILCA 3ZYKA 5DABA 3N9QA 1X79A 2UXXB 2HN1A 1T8BA 4GOUA 4BJNA 1FJGT 3DP7A 2F4VT 1Z8UA 1MMGA 4IE7A 4TWHA 3PJAJ 4ISTA 5FXWA 2V7MA 2PJQA 2V5DA 5LMNT 5KDMC 3ZKRA 1IJ6A 4TUYE 1IJ5A 2XQ5A 3M3ZB 1YD8G 1XMQT 1X9BA 3BQKA 4QXHB 5AQSB 1WR6A 3WAJA 1ZHCA 4ZZBA 2NTXA 5ABEA 5HXCA 1UUSA 3P7IA 2E9XD 4WBOA 3B5MA 4EIWA 3KV4A 3LDQB 3ZN1B 2QA7A 3ZPOA 3VR8A 2IMLA 4AKLA 1V9DA 3NZPA 3ZMZB 2RPAA 3TLSA 5HWXA 3MXZA 4LMLA 1T7SA 3IF8B 2FUPA 1WYBA 4ADZA 3PTRB 1VRBA 4GK5E 5HCMA 3OTOT 1KNPA 2PFVA 4ISSA 4H9RC 4QKNA 5FVKA 3LK3B 4DMVA 2W66A 2WU5A 5M4YA 2LM9A 1FIOA 2BG9E 4P09A 4MFRA 3CQXC 3AVRA 4U2YA 4EEDA 3B13A 3AE6A 3RHWA 4ZXLA 2RA1A 4ILAA 2FBWA 2XTLA 5L3DB 4E7ZA 5HEHA 1XDPA 2CXFA 2BVLA 4ZS3A 5L3BB 1W0AA 4ZI2D 3ZC0A 2FJEA 2NW9A 1AJ3A 3RF1A 3K3OA 4DR1T 3CWZB 4UVBB 2NWBA 3A7MA 1MNEA 2ZM2A 4H63V 4AQFC 3KBUA 3UT5E 2YKSA 3OJAA 3PV0F 2WS3A 4I50E 3GA8A 3AE5A 4H9NC 4GKJT 3UFGA 5FY7A 3CVRA 5FVLA 3ZMVB 2NOXA 5C2TA 3ONXA 2PG8A 4DV7T 4ZS2A 2Z6EA 3O4XE 3MJXA 4YY3T 4C90A 3ZMTB 4XAXB 4X5TA 3G06A 3LSVA 2ODVA 2VKJA 4DBRA 3P4PA 2BBHA 3QB5A 5HXHA 2D9DA 1OEDA 4PK4A 4DNDA 4YSYA 4O4IE 5L4HA 5FXZA 1WYCA 3HL6A 4DR3T 2KWIB 3AE7A 3VU7H 2XHEB 3O1IA 4HFDA 2V1DB 2X0HA 1LVFA 2VB6A 2CA5A 3Q2MA 1W09A 5ABFB 2KNDA 4DMWA 3NRYA 2VQET 1J5ET 4K0KT 3N5LA 3X1DA 1CUNA 4H9QC 2EHOB 4B6XA 2X51A 5JR9C 2BKPA 4DIDB 4BA9A 5AQFB 1NWMX 2E9XA 4GYSA 4DV5T 3MKDA 3OKQA 3TKLB 2IUBA 2XQYA 4L0RA 2WDQA 4AKGA 1D1BA 4ZOLE 2YDQA 5LBMA 3PE0A 3RGLA 5LYJE 2OA5A 4I4TE 2Y6XA 2ACZA 3AE1A 3RX6A 3EI0A 4HWDA 3CQCB 3QUJA 3FHNA 4AXPA 4HWCA 3MZKB 2L3LA 1D0ZA 3JAEA 5JRCB 2E5LT 5JDQA 3RH3A 4YXDA 5FY0A 4EYYR 2K5BB 4QXCB 2IW5B 4X66T 3I9YA 2V7KA 4DV4T 2LSYA 4P0BA 3ETUA 2WMOA 5HXRA 2CCQA 2LLYA 4U2ZA 2UXBT 2Q9QD 5LB7B 5CGMA 5LXTE 2LHRA 3ONJA 4HE8A 5AQNB 2CHOA 3LK42 3T8OA 4QXBB 4Z91A 2JJ9A 2YN6A 5LG3A 3IHRA 2IC6A 3CX6B 2M67A 4YHHT 1I94T 1HS7A 2AXDS 2LOSA 2IC9A 3E22E 2E8IA 4HTEA 1MMNA 3HI2A 3O1HA 4ILBA 2B76A 4IIJE 3KDSE 1BR1A 3H3AA 2G0UA 4KMCA 4X20E 3K8PC 5AQMB 5AQQB 2XQAA 5AQGB 5JR9A 2WWUA 5HCJA 3RPUA 2MBGA 3V5UA 1YQ4A 4BJMA 1XWMA 3RYCE 1J1JA 4OX9T 4DR7T 5LBQB 3N9LA 4IE6A 4O4JE 1MNDA 5CJ5A 3VRBA 4MLKA 4PK5A 2WU2A 3AE2A 2PTFA 4EEBA 3U78A 2WDRA 4TV9E 4ANJA 2V7JA 3CPZA 2V8SV 5HAXA 1E7PA 1MMAA 2QGSA 2XQ6A 3P8CD 2DI4A 5HWYA 2MYSA 4NPPA 3N2OA 3UU6A 1KF6A 4B3MT 3OPCA 4I0UA 3JAFA 4TN7B 3LBXA 4IDOA 3RC3A 4H9SE 2UU9T 2KZ7B 4YT0A 5HEUA 4DV2T 4B3TT 4X1IE 3C4WA 5LHHB 1JNZA 4JLEA 2CM0A 4UEMA 3UU8A 4DUZT 4IREA 3L09A 2BG9A 5BR8T 4KBMB 1UURA 3PU3A 4DR2T 2Q9QA 4G2AA 4LF5T 3CK6A 3E0ZA 3ONLC 3TLWA 4HFBA 5C8YE 4ZI7E 2CLYC 2A72A 3ZYLA 4IDNA 3VKGA 4UF0A 3H37A 1JNRA 4DR5T 4WYVA 1WFDA 4CI2B 4PFOA 4JUYA 1YXRA 5ABHA 4F6RC 2KMFA 2JQQA 2K24A 2M6IA 3RRCA 3JCFA 4O8SA 1BR2A 2CWOA 3SWHA 3V5SA 4PNIA 4IT4A 1HR0T 3UULA 3FZFB 4L9IA 3C98B 3KFWX 1B7TA 5AQHB 2ODUA 2BDEA 3AB3B 4UR9A 5GONE 3EDUA 3IEEA 1HNZT 4HWHA 3RI5A 4LMJA 2WB5A 1Y64B 2A3DA 3CQGB 4Z90A 4IDZA 3L8RA 3HA4A 2WP9A 4MBQA 4EV6A 5HYAA 1OEDB 4MALA 3PURA 3RQUA 4A5XA 2DL1A 2DHRA 1UX4A 3NKZA 4JI0T 3L3PA 3ZT7A 5JH7E 2HPLA 2UUAT 5AFUL 3F57A 5CA1E 5EK2A 3ZLIA 2VK9A 5AQPB 2ZM0A 3HR0A 4I43B 3FZKB 4HN9A 5LMUT 4CN4A 2HHHT 5LHGB 3AEAA 2XPKA 3AECA 1LKXA 3AA0B 2QYWA 4YJ3E 3DTOA 3M65A 2E9XB 2IHR1 5AQKB 2W67A 3ZT5A 4HEAA 3E08A 4JI8T 4U7IA 5L3CB 1G8XA 2XAJB 4EYUA 1N36T 1N34T 3J7Yq 3F2EA 4WNKA 4EAHA 1BR4A 3UFEA 1FEWA 2J47A 4GK0E 5L47A 2SPCA 1LVKA 4N78D 2L9QA 2WBLA 4JBWF 3UTKA 4JI3T 3AXJB 4XBFB 2ZLYA 3UU3A 2XASB 4IE4A 1YW0A 3KVAA 2H88A 2LEHA 3SFEA 3GMIA 1W0BA 3FZHB 4CI1B 2X9WA 2YU1A 1SA0E 3AE8A 1FMVA 5DQVA 2MOZA 3HKCE 4IL4A 3ZC1A 1O3XA 2XAFB 3RYIE 3AE9A 1UGOA 1KNZA 5BMVE 4K0UA 1KFYA 4PFPA 2FJDA 3MK7C 1CHUA 3NBXX 5HXEA 4WBNE 5FYMA 2D0UA 2X68A 4A56A 2E5VA 2XQ4A 5AQIB 2K9AA 2XZEA 4QH5A 4ZI3C 2D0TA 2JQKA 2XY8B 1MIVA 5CFBA 5JDFA 2EHOC 4CI3B 5JQGE 4UXNB 4EGWA 3T1HT 3F31A 3PU8A 2YU2A 4YLHA 3LG7A 5F5WA 4CXYA 3EDVA 3B57A 1IBKT 2WM9A 1ZV4X 2YK0A 3RIUC 3KINB 5HXSA 3Q9DA 1H7CA 4U31A 3PUZF 5FL1A 2HN2A 3Q5DA 4G63A 2M6BA 3FBZA 4NIQA 5EK3A 3I0OA 2VL0A 3A5XA 1XNRT 5ABGA 4JI6T 2DCFA 2VL8A 4DV3T 3FZMB 4AKIA 4UV9B 3RRWA 3UQ4A 4PJNA 2YEVC 3ZCJA 2FJBA 2V6XA 2KLQA 2WWVA 5FKYA 1IAPA 2BVMA 4AQFA 3I0QA 2YDSA 2J62A 3ZSSA 4X1YE 3GWHA 4PK6A 3KV6A 3W15B 3N9MA 4PW8A 4U3CA 5AQTB 4IHJE 4KHPT 4JEUB 5L3FB 2HH7A 4HGAA 3LBXB 4QHOA 5JREA 5TAOA 4WZXA 4P0AA 4HFCA 3J9X1 3PDYA 1SHZC 3UU5A 2I0MA 4HFHA 3T1YT 4DR4T 5HEOA 1Y01A 3L39A 3FBLA 4A98A 2W00A 3AAEB 2WQYA 2CPTA 3AEFA 3OBVE 5LJMA 5IHYA 3FXDB 2UXDT 2BG9B 5LOVE 2CHNA 2YINA 3FZLB 2Q9QB 4JV5T 3MA9A 3EHZA 4DBQA 4YHJA 3CX7B 5EK4A 1HG2A 2JQHA 4P1NA 2H7OA 4X65T 4CXXA 1XNQT 3N9NA 2V6YB 3AEGA 5JDGA 3PUGA 5ABFA 3AEEA 2WMNA 4IGUA 4QWNB 4EOZB 4KX6A 5AQRB 5HEGA 1MIWA 3EUHA 4YTMA 4PAGA 2EHOA 4LFAT 5IYZE 4I55E 4M1PA 1LRZA 2LKGA 2H89A 3RYHE 2H7VC 2XAGB 1U4QA 3CIRA 1WCRA 2CMRA 2LKHA 1OXZA 3ZJ2A 4X1KE 4A97A 2ZMAA 3AEDA 2YDRA 1VCSA 2NW8A 3RIUA 5LNKA 4HFVA 2JMKA 1YQ3A 3OYXA 4QH4A 2CXDA 4ILUA 4LF7T 1HG5A 3ZMUB 2KINB 3AEBA 4Q25A 2Y8DA 4FI5A 4O4HE 5JRCA 2W2UA 4NUVA 4JI4T 4PJJA 5LGNB 5J1GA 4O4LE 3RYFE 2C5KT 2KWHA 1N33T 1QUUA 5LJNA 2DWKA 4WW0A 2X67A 2CXLA 3AA7B 2ES0A 2JIWA 3ANWA 4ERRA 2VVNA 1WLXA 3QB5K 2LRLA 2LSKA 4DVDA 3VRAA 2YOEA 3DJBA 4OYJA 3A8YC 5AQLB 2E2AA 4PJLA 1BR0A 2VKDA 3ETVA 3P50A 4GIWA 4UV8B 2QRXA 2CE7A 3KBTA 1OWAA 1QSDA 4DV1T 2N2NA 2KSRA 1VCTA 5C3JA 1UCUA 2NP9A 3ZEFB 4MHCA 1YKHB 5F8PA 3AAAB 3WAKA 3S4UA 5L3EB 4Z8XA 3BQLA 2CRBA 4CXWA 1MIYA 3PUYF 1J5WA 3SOLA 2LSJA 1M62A 3UQ7A 3HKBE 3PUXF 5F3JA 4AI6A 3AAIA 5LP6E 1GQEA 3UUBA 5E0OA 2W62A 1Z0PA 3K3NA 2MTQA 4TNVA 2BZBA 2DLRA 4YFSA 3TLTA 3K3QC 5FY1A 1I6ZA 4X62T 3TLVA 1NAFA 3JC6C 2V5CA 4DUYT 1UX5A 4UELA 1S35A 3VHLA 4U72A 5ETWA 3IBPA 2JQ9A 4JI2T 1OEDC 2I6HA 2N1GA 4CN1A 3SFDA 2XQ9A 4HWFA 2UXCT 1D1CA 3ZT6A 4QH1A 4JI1T 4HFIA 3LK2B 1T72A 4YSXA 2XQ8A 3ZYMA 1ZKEA 1S94A 1QLBA 3GN5A 4ZZCA 4OK0A 1E1HB 3N2GE 2GK9A 1SUMB 4O2BE 4UIGA 1R8IA 5J2UE 3R6NA 3CKDA 2XM1A 4JI7T 3ZSTA 3N9OA 4HWIB 3UU4A 5IWAT 2E9XC 3PUAA 3JADA 2D5UA 2J4GA 4UVAB 4H63H 3PUSA 2X9XA 3AA6B 2W61A 3C4ZA 5EZYE 3VKHA 2BKOA 4GKKT 4U7YA 3PUVF 4CN6A 4AIUA 2W4XA 3K1SA 2L8KA 4IE5A 1WRDA 2A9UA 3UUMA 2FJAA 4B3RT 5J2TE 3QNUA 1HX8A 3I9WA 3P4WA 4TNWA 2XAQB 2X9YA 2J1DG 1IZNB 2BS4A 2LOPA 3O1JA 5FXVA 2DNXA 4LF8T 2AE9A 2VVSA 5LHIB 5LG4A 3RLFF 4UVCB 5JTGA 3P4QA 5JDLA 2WCAA 3P4RA 2C0SA 4ZEYA 3U3IA 3AE4A 5J0ZA 4KHZF 1UK5A 4HKAA 4ZI2C 2R6GF 2QVAA 4TZ4C 3EABA 2JRKA 2WDVA 2CWYA 4QX8B 5A1LA 1NEKA 4DV6T 4EZHA 4TV8E 2V7IA 4HFEA 1HCIA 4TWDA 4KI0F 1L0VA 1HX1B 4ZI3D 2V7LA 2EHOD 4TX5A 3PJAA 2I59A 4L5GA 2PBIA 1ZP0A 3LJCA 3RKOA 4DV0T 2XSBA 2MPKA 3ZCIA 4YTPA 3Q5XA 2CBJA 3VR9A 1ZOYA 1FMWA 3EAMA 2VURA 1MMDA 2NTYA 2ZM6T 3C4XA 4F8HA 3P4SA 5AQUB 2IIUA 2BS3A 1ZEEA 2B1EA 2XSAA 4B3ST 3UUXB 4AKRB 2JPFA 5LA6E 3C50A 5JR9B 2UUBT 1XZYA 4YJ2E 2W0GA 4ZHQE 5KMGP 1D1AA 4ASKA 2LSIA 5FMNA 5DQWA 1M7KA 3OYZA 2LJLA 4OHFA 2BKNA 4YSZA 3H3MA 1IBMT 3NWIA 3NRXA 5JDHA 2LHNA 3HKDE 2V26A 4LFBT 2LSGA 4DR6T 2VQFT 1XMOT 4LMKA 2P9BA 4JEHB 5H6RB 3AXJA 3I1AA 5FNVE 1HNWT 3IA3A 2XAHB 2OV9A 5LCYA 2X0YA 4CQIA 3C51A 4DO0A 4H9PC 1HTJF 3NVOA 2NW7A 3PUWF 4C91A 1NENA 4U33A 2XQ7A 4H9OC 1OEDE 2UUCT 3WI3A 1IBLT 2CEAA 3ANWB 3EVYA 4NXNT 1VOMA 5AQOB 3NZQA 5KX5E 4IDQA 2K3WA 2VWAA 2XJ7A 4NUUA 4LF4T 2ZM8A 1WR0A 4COFA 5L4EA 4XZCA 3SRZA 5AQJB 4JI5T 2X66A 4BAYB 2DWGA 1KK7A 2BG9C 3AA1B 5ADXL 4EXTA 4PJMA 1SE7A 2LE8A 5FL0A 2Q9QC 5HEJA 1HF8A 3RC8A 3KV5A 3ZN0B 4AISA 2H3RA 5L2LA 1YKEB 4UF0B 1D0XA 3ABVA 2KT9A 4YTNA 1KNRA 2HPJA 2WZHA 1HFAA 4X64T 4NXMT 5JDMA 5CA0E 2MAWA 2LRKA 5KXJA 2XUEA 3RIFA 3QC9A 2C5JA 3R84B 5IUXA 4FJOA 2X9HA
chains in the Genus database with same CATH topology
3MACA 2WSSV 4CXWA 3UTKA 5LBMA 3PE0A 1MIYA 5LYJE 2OA5A 4EB6E 5LGUB 2UXNB 3SOLA 4J2CA 2LSJA 2IAKA 2A2FX 4AQGA 4XBFB 2ZLYA 4I4TE 2Y6XA 1T98A 3RX6A 3HKBE 4GYRA 5F3JA 4AI6A 3AAIA 2XASB 3FB2A 3ZJ1A 1US7B 5LP6E 4AKHA 4CZZB 4IE4A 5LGTB 3CQCB 1YW0A 3KVAA 5E0OA 3QUJA 3FHNA 2W62A 4AXPA 2LEHA 2L3LA 3HKEE 3MZKB 1Z0PA 1D0ZA 2MTQA 3K3NA 3CMLA 3Q5WA 3GMIA 5JRCB 2BZBA 2DLRA 4KUMB 4YFSA 2X9WA 4CI1B 2YU1A 5JDQA 2RP4A 3KV9A 1D0YA 2W63A 3RH3A 3K3QC 5FY1A 5FY0A 4EYYR 1SA0E 3KVBA 2K5BB 1FMVA 4QXCB 3ESLA 3AVSA 2IW5B 1EZ3A 2VASA 1NAFA 3I9YA 2V7KA 2MOZA 5DQVA 3JC6C 1UX5A 2LSYA 4P0BA 3HKCE 4UELA 1S35A 3VHLA 3QK6A 4U72A 3N2KE 3SS1A 3ZC1A 5ETWA 1O3XA 3IBPA 3ETUA 2WMOA 2XAFB 5HXRA 2N1GA 3RYIE 2CCQA 1KNZA 2JMHA 3GN5B 5BMVE 4K0UA 5JDNA 2Q9QD 1D1CA 2N9DA 5LXTE 3CX8B 4PFPA 2LHRA 3D0TA 4IE0A 5DJQC 3PUQA 3MK7C 3LK2B 3ZYMA 3C64A 1ZKEA 5CB4E 2WAUA 1S94A 4HE8A 4EZ4A 3ZMSB 3GN5A 3LK42 3T8OA 4O2AE 3NBXX 4QXBB 4OK0A 1E1HB 5HXEA 3N2GE 4WBNE 2JJ9A 4QX7B 5FYMA 4OFZA 2GK9A 4O2BE 2D0UA 4UIGA 5FXXA 2X68A 3IHRA 4A56A 5J2UE 4OYKA 2X0LB 2IC6A 3FXEB 3R6NA 3CX6B 3CKDA 2M67A 2K48A 2K9AA 1HS7A 5FP3A 3UUNA 3N9OA 5L3GB 4ZI3C 2LOSA 2LT3A 2E9XC 2D0TA 3PUAA 1MIVA 2IC9A 5JDFA 2EHOC 3E22E 2D5UA 2E8IA 2Y48B 3BK9A 4HTEA 4CI3B 4UVAB 4H63H 5JQGE 3PUSA 2KXPB 3O9XA 2X9XA 1U5PA 3AA6B 2W61A 1MMNA 3C4ZA 3HI2A 5EZYE 3VKHA 2C5IT 3O1HA 4UXNB 3F31A 3PU8A 4U74A 2YU2A 5H6QB 4YLHA 3LG7A 1G73A 2VKOA 4IIJE 3KDSE 1BR1A 2L8KA 3H3AA 2G0UA 4IE5A 4KMCA 4V1Av 1WRDA 4X20E 2VKHA 3K8PC 4CXYA 4KP3C 3UUMA 3EDVA 2D2SA 3B57A 4E7SA 2CLYB 2WM9A 3BQIA 5J2TE 1ZV4X 1HX8A 2YK0A 3I9WA 3KINB 2XAQB 5JR9A 2ACXA 5HXSA 2WWUA 3N9PA 2X9YA 2J1DG 1IZNB 3Q9DA 3JC6D 5JVDE 2LOPA 1H7CA 3O1JA 5FXVA 3LFMA 2DNXA 3RPUA 2MBGA 3ZYKA 3V5UA 4G63A 4BJMA 5DABA 3N9QA 3FBZA 1X79A 5LHIB 5EK3A 3RYCE 3I0OA 3A5XA 2UXXB 5LG4A 2DCFA 2VL8A 4UVCB 4AKIA 4UV9B 3RRWA 4GOUA 4BJNA 3DP7A 5LBQB 3N9LA 4PJNA 2YEVC 4IE6A 5JDLA 4O4JE 1MMGA 3ZCJA 2C0SA 4IE7A 1MNDA 3U3IA 2KLQA 4MLKA 4ISTA 1IAPA 4PK5A 4HKAA 2BVMA 4ZI2C 4AQFA 4TZ4C 5FXWA 2JRKA 2V7MA 2PJQA 3I0QA 2CWYA 5KDMC 4X1YE 4QX8B 5A1LA 1IJ6A 3GWHA 4TUYE 1IJ5A 1YD8G 4PK6A 3KV6A 3W15B 3N9MA 4PW8A 4EZHA 4TV8E 3U78A 3BQKA 2V7IA 4QXHB 1WR6A 1HCIA 3WAJA 1ZHCA 4TV9E 2NTXA 4IHJE 4ANJA 4JEUB 5HXCA 2V7JA 3CPZA 5L3FB 2HH7A 3P7IA 4HGAA 5HAXA 4ZI3D 1MMAA 2QGSA 2E9XD 2V7LA 3LBXB 4QHOA 2EHOD 4TX5A 3P8CD 2DI4A 4WBOA 5HWYA 2MYSA 5TAOA 5JREA 4P0AA 3J9X1 4EIWA 3KV4A 2I59A 3PDYA 4L5GA 3N2OA 2QA7A 3ZN1B 1SHZC 3ZPOA 2PBIA 3LJCA 4AKLA 3RKOA 1V9DA 3NZPA 3ZMZB 4TN7B 5HWXA 3MXZA 3LBXA 3IF8B 1WYBA 3ZCIA 4ADZA 3RC3A 3PTRB 4H9SE 3Q5XA 1VRBA 3FBLA 4GK5E 2W00A 3AAEB 2KZ7B 2PFVA 4ISSA 1FMWA 4H9RC 4QKNA 1MMDA 2NTYA 3LK3B 3OBVE 4DMVA 5LJMA 5IHYA 3FXDB 5M4YA 3C4XA 2LM9A 1FIOA 5LOVE 4X1IE 3C4WA 5LHHB 2YINA 2Q9QB 3MA9A 4JLEA 4MFRA 4P09A 3CQXC 4DBQA 1ZEEA 2CM0A 4YHJA 2B1EA 3CX7B 4UEMA 3AVRA 5EK4A 1HG2A 3L09A 2H7OA 3UUXB 4AKRB 4CXXA 4KBMB 2JPFA 5LA6E 3B13A 3C50A 3PU3A 3N9NA 2Q9QA 5JR9B 4G2AA 3E0ZA 5JDGA 4YJ2E 2W0GA 2RA1A 4ZHQE 3PUGA 5KMGP 1D1AA 2XTLA 5L3DB 4E7ZA 4ASKA 2WMNA 4IGUA 2LSIA 4QWNB 4EOZB 1MIWA 5C8YE 3EUHA 5FMNA 4ZI7E 2CXFA 2CLYC 2A72A 2BVLA 2EHOA 4PAGA 5DQWA 4ZS3A 3ZYLA 3VKGA 3OYZA 2LJLA 3H37A 4UF0A 4OHFA 5IYZE 4I55E 4ZI2D 5L3BB 4M1PA 3ZC0A 1LRZA 4CI2B 4PFOA 2NW9A 3RYHE 2H7VC 2XAGB 1AJ3A 4JUYA 1U4QA 3NRXA 3K3OA 4F6RC 2KMFA 2JQQA 3CWZB 4UVBB 2K24A 5JDHA 2LHNA 3RRCA 2CMRA 3HKDE 4O8SA 1BR2A 2NWBA 2V26A 2CWOA 1MNEA 1OXZA 3SWHA 3ZJ2A 2ZM2A 3V5SA 4H63V 2LSGA 4PNIA 4AQFC 3KBUA 4X1KE 3UT5E 3UULA 3OJAA 4L9IA 2ZMAA 3C98B 3KFWX 2P9BA 4I50E 1B7TA 3GA8A 2NW8A 4H9NC 5LNKA 4HFVA 2JMKA 3OYXA 5FY7A 3CVRA 4JEHB 5H6RB 2ODUA 3I1AA 5FNVE 2BDEA 2XAHB 3AB3B 5GONE 3EDUA 3IEEA 3ZMVB 2NOXA 5LCYA 2CXDA 4ILUA 4CQIA 1HG5A 3ONXA 2PG8A 3C51A 3ZMUB 2KINB 4DO0A 4H9PC 1HTJF 1Y64B 2A3DA 4ZS2A 2NW7A 2Y8DA 4FI5A 3CQGB 2Z6EA 4O4HE 4IDZA 4C91A 5JRCA 3HA4A 3O4XE 4MBQA 4NUVA 3MJXA 5HYAA 4H9OC 4C90A 3ZMTB 4XAXB 4PJJA 4MALA 2ODVA 3WI3A 5LGNB 5J1GA 2VKJA 3PURA 2CEAA 3ANWB 3EVYA 4O4LE 1VOMA 3RYFE 2C5KT 2KWHA 4DBRA 1QUUA 2DHRA 3NZQA 1UX4A 2DWKA 5HXHA 5LJNA 3L3PA 4WW0A 5JH7E 4PK4A 5KX5E 2HPLA 2X67A 5AFUL 2CXLA 3F57A 3AA7B 4DNDA 2ES0A 5CA1E 5EK2A 2VWAA 3ANWA 4NUUA 4ERRA 1WLXA 4O4IE 2ZM8A 3ZLIA 2VK9A 5FXZA 2LSKA 2ZM0A 1WYCA 4XZCA 3HL6A 2KWIB 4DVDA 3HR0A 3SRZA 3DJBA 4OYJA 2XHEB 3O1IA 4I43B 3VU7H 4HN9A 2X66A 4PJLA 2V1DB 4BAYB 1BR0A 2DWGA 1KK7A 2VKDA 3AA1B 3ETVA 1LVFA 5ADXL 4EXTA 4PJMA 5LHGB 2LE8A 2VB6A 2CA5A 3Q2MA 2Q9QC 2KNDA 4GIWA 4UV8B 4DMWA 3NRYA 1HF8A 2CE7A 1LKXA 3AA0B 3N5LA 4YJ3E 3RC8A 1CUNA 3DTOA 3KV5A 3M65A 3KBTA 1OWAA 2E9XB 3ZN0B 1QSDA 4H9QC 2H3RA 5L2LA 1YKEB 2EHOB 2N2NA 4HEAA 3E08A 4B6XA 4UF0B 1D0XA 2X51A 5JR9C 5L3CB 4BA9A 1G8XA 2XAJB 2KT9A 4EYUA 1NWMX 2HPJA 3J7Yq 1UCUA 1HFAA 2NP9A 3F2EA 2E9XA 4WNKA 3ZEFB 4EAHA 1BR4A 3UFEA 5JDMA 5CA0E 4GYSA 1FEWA 4MHCA 1YKHB 4GK0E 2XUEA 3AAAB 3MKDA 3OKQA 5F8PA 2SPCA 3TKLB 1LVKA 2XQYA 3QC9A 4L0RA 2C5JA 4N78D 3WAKA 3S4UA 2L9QA 2WBLA 3R84B 5L3EB 4AKGA 4Z8XA 4FJOA 1D1BA 4ZOLE 2X9HA 3BQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO A;  4HEA A;  4HE8 A;  5LNK A; 
#chains in the Genus database with same CATH topology
 3MAC A;  2WSS V;  5LGU B;  4EB6 E;  2UXN B;  4J2C A;  2IAK A;  2A2F X;  4AQG A;  1XDO A;  1HNX T;  3RKG A;  1T98 A;  3RQW A;  4GYR A;  3ZJ1 A;  3FB2 A;  4AKH A;  1US7 B;  4CZZ B;  5LGT B;  2XQ3 A;  3HKE E;  3AE3 A;  3CML A;  3Q5W A;  3TLU A;  4TWF A;  2BBJ A;  3QOF A;  4KUM B;  2RP4 A;  3KV9 A;  1D0Y A;  2W63 A;  3KVB A;  3ESL A;  2NR4 A;  3AVS A;  1EZ3 A;  2VAS A;  3QK6 A;  3SS1 A;  3N2K E;  1W9R A;  2JMH A;  3GN5 B;  5JDN A;  2N9D A;  3CX8 B;  4JYA T;  3D0T A;  4IE0 A;  5DJQ C;  3PUQ A;  2IDO B;  3C64 A;  2CBI A;  5CB4 E;  2WAU A;  4EZ4 A;  1E2A A;  2WZI A;  2LM2 A;  3ZMS B;  1N32 T;  4AQY T;  4O2A E;  4QX7 B;  4OFZ A;  5FXX A;  4OYK A;  2WY2 A;  2X0L B;  4LF6 T;  3FXE B;  1DU2 A;  2XM2 A;  2K48 A;  5FP3 A;  3UUN A;  4IDP A;  5L3G B;  2OLT A;  2BS2 A;  2LT3 A;  2Y48 B;  3BK9 A;  4IL9 A;  3O9X A;  2KXP B;  1U5P A;  3OVU A;  4LF9 T;  2C5I T;  4U74 A;  5H6Q B;  1G73 A;  2VKO A;  3Q5E A;  4V1A v;  2VKH A;  4KP3 C;  2D2S A;  4E7S A;  4LFC T;  2CLY B;  3BQI A;  2V6Y A;  2ACX A;  3N9P A;  5AQV B;  3RIA A;  3JC6 D;  5JVD E;  3LFM A;  1KEY A;  4ILC A;  3ZYK A;  5DAB A;  3N9Q A;  1X79 A;  2UXX B;  2HN1 A;  1T8B A;  4GOU A;  4BJN A;  1FJG T;  3DP7 A;  2F4V T;  1Z8U A;  1MMG A;  4IE7 A;  4TWH A;  3PJA J;  4IST A;  5FXW A;  2V7M A;  2PJQ A;  2V5D A;  5LMN T;  5KDM C;  3ZKR A;  1IJ6 A;  4TUY E;  1IJ5 A;  2XQ5 A;  3M3Z B;  1YD8 G;  1XMQ T;  1X9B A;  3BQK A;  4QXH B;  5AQS B;  1WR6 A;  3WAJ A;  1ZHC A;  4ZZB A;  2NTX A;  5ABE A;  5HXC A;  1UUS A;  3P7I A;  2E9X D;  4WBO A;  3B5M A;  4EIW A;  3KV4 A;  3LDQ B;  3ZN1 B;  2QA7 A;  3ZPO A;  3VR8 A;  2IML A;  4AKL A;  1V9D A;  3NZP A;  3ZMZ B;  2RPA A;  3TLS A;  5HWX A;  3MXZ A;  4LML A;  1T7S A;  3IF8 B;  2FUP A;  1WYB A;  4ADZ A;  3PTR B;  1VRB A;  4GK5 E;  5HCM A;  3OTO T;  1KNP A;  2PFV A;  4ISS A;  4H9R C;  4QKN A;  5FVK A;  3LK3 B;  4DMV A;  2W66 A;  2WU5 A;  5M4Y A;  2LM9 A;  1FIO A;  2BG9 E;  4P09 A;  4MFR A;  3CQX C;  3AVR A;  4U2Y A;  4EED A;  3B13 A;  3AE6 A;  3RHW A;  4ZXL A;  2RA1 A;  4ILA A;  2FBW A;  2XTL A;  5L3D B;  4E7Z A;  5HEH A;  1XDP A;  2CXF A;  2BVL A;  4ZS3 A;  5L3B B;  1W0A A;  4ZI2 D;  3ZC0 A;  2FJE A;  2NW9 A;  1AJ3 A;  3RF1 A;  3K3O A;  4DR1 T;  3CWZ B;  4UVB B;  2NWB A;  3A7M A;  1MNE A;  2ZM2 A;  4H63 V;  4AQF C;  3KBU A;  3UT5 E;  2YKS A;  3OJA A;  3PV0 F;  2WS3 A;  4I50 E;  3GA8 A;  3AE5 A;  4H9N C;  4GKJ T;  3UFG A;  5FY7 A;  3CVR A;  5FVL A;  3ZMV B;  2NOX A;  5C2T A;  3ONX A;  2PG8 A;  4DV7 T;  4ZS2 A;  2Z6E A;  3O4X E;  3MJX A;  4YY3 T;  4C90 A;  3ZMT B;  4XAX B;  4X5T A;  3G06 A;  3LSV A;  2ODV A;  2VKJ A;  4DBR A;  3P4P A;  2BBH A;  3QB5 A;  5HXH A;  2D9D A;  1OED A;  4PK4 A;  4DND A;  4YSY A;  4O4I E;  5L4H A;  5FXZ A;  1WYC A;  3HL6 A;  4DR3 T;  2KWI B;  3AE7 A;  3VU7 H;  2XHE B;  3O1I A;  4HFD A;  2V1D B;  2X0H A;  1LVF A;  2VB6 A;  2CA5 A;  3Q2M A;  1W09 A;  5ABF B;  2KND A;  4DMW A;  3NRY A;  2VQE T;  1J5E T;  4K0K T;  3N5L A;  3X1D A;  1CUN A;  4H9Q C;  2EHO B;  4B6X A;  2X51 A;  5JR9 C;  2BKP A;  4DID B;  4BA9 A;  5AQF B;  1NWM X;  2E9X A;  4GYS A;  4DV5 T;  3MKD A;  3OKQ A;  3TKL B;  2IUB A;  2XQY A;  4L0R A;  2WDQ A;  4AKG A;  1D1B A;  4ZOL E;  2YDQ A;  5LBM A;  3PE0 A;  3RGL A;  5LYJ E;  2OA5 A;  4I4T E;  2Y6X A;  2ACZ A;  3AE1 A;  3RX6 A;  3EI0 A;  4HWD A;  3CQC B;  3QUJ A;  3FHN A;  4AXP A;  4HWC A;  3MZK B;  2L3L A;  1D0Z A;  3JAE A;  5JRC B;  2E5L T;  5JDQ A;  3RH3 A;  4YXD A;  5FY0 A;  4EYY R;  2K5B B;  4QXC B;  2IW5 B;  4X66 T;  3I9Y A;  2V7K A;  4DV4 T;  2LSY A;  4P0B A;  3ETU A;  2WMO A;  5HXR A;  2CCQ A;  2LLY A;  4U2Z A;  2UXB T;  2Q9Q D;  5LB7 B;  5CGM A;  5LXT E;  2LHR A;  3ONJ A;  4HE8 A;  5AQN B;  2CHO A;  3LK4 2;  3T8O A;  4QXB B;  4Z91 A;  2JJ9 A;  2YN6 A;  5LG3 A;  3IHR A;  2IC6 A;  3CX6 B;  2M67 A;  4YHH T;  1I94 T;  1HS7 A;  2AXD S;  2LOS A;  2IC9 A;  3E22 E;  2E8I A;  4HTE A;  1MMN A;  3HI2 A;  3O1H A;  4ILB A;  2B76 A;  4IIJ E;  3KDS E;  1BR1 A;  3H3A A;  2G0U A;  4KMC A;  4X20 E;  3K8P C;  5AQM B;  5AQQ B;  2XQA A;  5AQG B;  5JR9 A;  2WWU A;  5HCJ A;  3RPU A;  2MBG A;  3V5U A;  1YQ4 A;  4BJM A;  1XWM A;  3RYC E;  1J1J A;  4OX9 T;  4DR7 T;  5LBQ B;  3N9L A;  4IE6 A;  4O4J E;  1MND A;  5CJ5 A;  3VRB A;  4MLK A;  4PK5 A;  2WU2 A;  3AE2 A;  2PTF A;  4EEB A;  3U78 A;  2WDR A;  4TV9 E;  4ANJ A;  2V7J A;  3CPZ A;  2V8S V;  5HAX A;  1E7P A;  1MMA A;  2QGS A;  2XQ6 A;  3P8C D;  2DI4 A;  5HWY A;  2MYS A;  4NPP A;  3N2O A;  3UU6 A;  1KF6 A;  4B3M T;  3OPC A;  4I0U A;  3JAF A;  4TN7 B;  3LBX A;  4IDO A;  3RC3 A;  4H9S E;  2UU9 T;  2KZ7 B;  4YT0 A;  5HEU A;  4DV2 T;  4B3T T;  4X1I E;  3C4W A;  5LHH B;  1JNZ A;  4JLE A;  2CM0 A;  4UEM A;  3UU8 A;  4DUZ T;  4IRE A;  3L09 A;  2BG9 A;  5BR8 T;  4KBM B;  1UUR A;  3PU3 A;  4DR2 T;  2Q9Q A;  4G2A A;  4LF5 T;  3CK6 A;  3E0Z A;  3ONL C;  3TLW A;  4HFB A;  5C8Y E;  4ZI7 E;  2CLY C;  2A72 A;  3ZYL A;  4IDN A;  3VKG A;  4UF0 A;  3H37 A;  1JNR A;  4DR5 T;  4WYV A;  1WFD A;  4CI2 B;  4PFO A;  4JUY A;  1YXR A;  5ABH A;  4F6R C;  2KMF A;  2JQQ A;  2K24 A;  2M6I A;  3RRC A;  3JCF A;  4O8S A;  1BR2 A;  2CWO A;  3SWH A;  3V5S A;  4PNI A;  4IT4 A;  1HR0 T;  3UUL A;  3FZF B;  4L9I A;  3C98 B;  3KFW X;  1B7T A;  5AQH B;  2ODU A;  2BDE A;  3AB3 B;  4UR9 A;  5GON E;  3EDU A;  3IEE A;  1HNZ T;  4HWH A;  3RI5 A;  4LMJ A;  2WB5 A;  1Y64 B;  2A3D A;  3CQG B;  4Z90 A;  4IDZ A;  3L8R A;  3HA4 A;  2WP9 A;  4MBQ A;  4EV6 A;  5HYA A;  1OED B;  4MAL A;  3PUR A;  3RQU A;  4A5X A;  2DL1 A;  2DHR A;  1UX4 A;  3NKZ A;  4JI0 T;  3L3P A;  3ZT7 A;  5JH7 E;  2HPL A;  2UUA T;  5AFU L;  3F57 A;  5CA1 E;  5EK2 A;  3ZLI A;  2VK9 A;  5AQP B;  2ZM0 A;  3HR0 A;  4I43 B;  3FZK B;  4HN9 A;  5LMU T;  4CN4 A;  2HHH T;  5LHG B;  3AEA A;  2XPK A;  3AEC A;  1LKX A;  3AA0 B;  2QYW A;  4YJ3 E;  3DTO A;  3M65 A;  2E9X B;  2IHR 1;  5AQK B;  2W67 A;  3ZT5 A;  4HEA A;  3E08 A;  4JI8 T;  4U7I A;  5L3C B;  1G8X A;  2XAJ B;  4EYU A;  1N36 T;  1N34 T;  3J7Y q;  3F2E A;  4WNK A;  4EAH A;  1BR4 A;  3UFE A;  1FEW A;  2J47 A;  4GK0 E;  5L47 A;  2SPC A;  1LVK A;  4N78 D;  2L9Q A;  2WBL A;  4JBW F;  3UTK A;  4JI3 T;  3AXJ B;  4XBF B;  2ZLY A;  3UU3 A;  2XAS B;  4IE4 A;  1YW0 A;  3KVA A;  2H88 A;  2LEH A;  3SFE A;  3GMI A;  1W0B A;  3FZH B;  4CI1 B;  2X9W A;  2YU1 A;  1SA0 E;  3AE8 A;  1FMV A;  5DQV A;  2MOZ A;  3HKC E;  4IL4 A;  3ZC1 A;  1O3X A;  2XAF B;  3RYI E;  3AE9 A;  1UGO A;  1KNZ A;  5BMV E;  4K0U A;  1KFY A;  4PFP A;  2FJD A;  3MK7 C;  1CHU A;  3NBX X;  5HXE A;  4WBN E;  5FYM A;  2D0U A;  2X68 A;  4A56 A;  2E5V A;  2XQ4 A;  5AQI B;  2K9A A;  2XZE A;  4QH5 A;  4ZI3 C;  2D0T A;  2JQK A;  2XY8 B;  1MIV A;  5CFB A;  5JDF A;  2EHO C;  4CI3 B;  5JQG E;  4UXN B;  4EGW A;  3T1H T;  3F31 A;  3PU8 A;  2YU2 A;  4YLH A;  3LG7 A;  5F5W A;  4CXY A;  3EDV A;  3B57 A;  1IBK T;  2WM9 A;  1ZV4 X;  2YK0 A;  3RIU C;  3KIN B;  5HXS A;  3Q9D A;  1H7C A;  4U31 A;  3PUZ F;  5FL1 A;  2HN2 A;  3Q5D A;  4G63 A;  2M6B A;  3FBZ A;  4NIQ A;  5EK3 A;  3I0O A;  2VL0 A;  3A5X A;  1XNR T;  5ABG A;  4JI6 T;  2DCF A;  2VL8 A;  4DV3 T;  3FZM B;  4AKI A;  4UV9 B;  3RRW A;  3UQ4 A;  4PJN A;  2YEV C;  3ZCJ A;  2FJB A;  2V6X A;  2KLQ A;  2WWV A;  5FKY A;  1IAP A;  2BVM A;  4AQF A;  3I0Q A;  2YDS A;  2J62 A;  3ZSS A;  4X1Y E;  3GWH A;  4PK6 A;  3KV6 A;  3W15 B;  3N9M A;  4PW8 A;  4U3C A;  5AQT B;  4IHJ E;  4KHP T;  4JEU B;  5L3F B;  2HH7 A;  4HGA A;  3LBX B;  4QHO A;  5JRE A;  5TAO A;  4WZX A;  4P0A A;  4HFC A;  3J9X 1;  3PDY A;  1SHZ C;  3UU5 A;  2I0M A;  4HFH A;  3T1Y T;  4DR4 T;  5HEO A;  1Y01 A;  3L39 A;  3FBL A;  4A98 A;  2W00 A;  3AAE B;  2WQY A;  2CPT A;  3AEF A;  3OBV E;  5LJM A;  5IHY A;  3FXD B;  2UXD T;  2BG9 B;  5LOV E;  2CHN A;  2YIN A;  3FZL B;  2Q9Q B;  4JV5 T;  3MA9 A;  3EHZ A;  4DBQ A;  4YHJ A;  3CX7 B;  5EK4 A;  1HG2 A;  2JQH A;  4P1N A;  2H7O A;  4X65 T;  4CXX A;  1XNQ T;  3N9N A;  2V6Y B;  3AEG A;  5JDG A;  3PUG A;  5ABF A;  3AEE A;  2WMN A;  4IGU A;  4QWN B;  4EOZ B;  4KX6 A;  5AQR B;  5HEG A;  1MIW A;  3EUH A;  4YTM A;  4PAG A;  2EHO A;  4LFA T;  5IYZ E;  4I55 E;  4M1P A;  1LRZ A;  2LKG A;  2H89 A;  3RYH E;  2H7V C;  2XAG B;  1U4Q A;  3CIR A;  1WCR A;  2CMR A;  2LKH A;  1OXZ A;  3ZJ2 A;  4X1K E;  4A97 A;  2ZMA A;  3AED A;  2YDR A;  1VCS A;  2NW8 A;  3RIU A;  5LNK A;  4HFV A;  2JMK A;  1YQ3 A;  3OYX A;  4QH4 A;  2CXD A;  4ILU A;  4LF7 T;  1HG5 A;  3ZMU B;  2KIN B;  3AEB A;  4Q25 A;  2Y8D A;  4FI5 A;  4O4H E;  5JRC A;  2W2U A;  4NUV A;  4JI4 T;  4PJJ A;  5LGN B;  5J1G A;  4O4L E;  3RYF E;  2C5K T;  2KWH A;  1N33 T;  1QUU A;  5LJN A;  2DWK A;  4WW0 A;  2X67 A;  2CXL A;  3AA7 B;  2ES0 A;  2JIW A;  3ANW A;  4ERR A;  2VVN A;  1WLX A;  3QB5 K;  2LRL A;  2LSK A;  4DVD A;  3VRA A;  2YOE A;  3DJB A;  4OYJ A;  3A8Y C;  5AQL B;  2E2A A;  4PJL A;  1BR0 A;  2VKD A;  3ETV A;  3P50 A;  4GIW A;  4UV8 B;  2QRX A;  2CE7 A;  3KBT A;  1OWA A;  1QSD A;  4DV1 T;  2N2N A;  2KSR A;  1VCT A;  5C3J A;  1UCU A;  2NP9 A;  3ZEF B;  4MHC A;  1YKH B;  5F8P A;  3AAA B;  3WAK A;  3S4U A;  5L3E B;  4Z8X A;  3BQL A;  2CRB A;  4CXW A;  1MIY A;  3PUY F;  1J5W A;  3SOL A;  2LSJ A;  1M62 A;  3UQ7 A;  3HKB E;  3PUX F;  5F3J A;  4AI6 A;  3AAI A;  5LP6 E;  1GQE A;  3UUB A;  5E0O A;  2W62 A;  1Z0P A;  3K3N A;  2MTQ A;  4TNV A;  2BZB A;  2DLR A;  4YFS A;  3TLT A;  3K3Q C;  5FY1 A;  1I6Z A;  4X62 T;  3TLV A;  1NAF A;  3JC6 C;  2V5C A;  4DUY T;  1UX5 A;  4UEL A;  1S35 A;  3VHL A;  4U72 A;  5ETW A;  3IBP A;  2JQ9 A;  4JI2 T;  1OED C;  2I6H A;  2N1G A;  4CN1 A;  3SFD A;  2XQ9 A;  4HWF A;  2UXC T;  1D1C A;  3ZT6 A;  4QH1 A;  4JI1 T;  4HFI A;  3LK2 B;  1T72 A;  4YSX A;  2XQ8 A;  3ZYM A;  1ZKE A;  1S94 A;  1QLB A;  3GN5 A;  4ZZC A;  4OK0 A;  1E1H B;  3N2G E;  2GK9 A;  1SUM B;  4O2B E;  4UIG A;  1R8I A;  5J2U E;  3R6N A;  3CKD A;  2XM1 A;  4JI7 T;  3ZST A;  3N9O A;  4HWI B;  3UU4 A;  5IWA T;  2E9X C;  3PUA A;  3JAD A;  2D5U A;  2J4G A;  4UVA B;  4H63 H;  3PUS A;  2X9X A;  3AA6 B;  2W61 A;  3C4Z A;  5EZY E;  3VKH A;  2BKO A;  4GKK T;  4U7Y A;  3PUV F;  4CN6 A;  4AIU A;  2W4X A;  3K1S A;  2L8K A;  4IE5 A;  1WRD A;  2A9U A;  3UUM A;  2FJA A;  4B3R T;  5J2T E;  3QNU A;  1HX8 A;  3I9W A;  3P4W A;  4TNW A;  2XAQ B;  2X9Y A;  2J1D G;  1IZN B;  2BS4 A;  2LOP A;  3O1J A;  5FXV A;  2DNX A;  4LF8 T;  2AE9 A;  2VVS A;  5LHI B;  5LG4 A;  3RLF F;  4UVC B;  5JTG A;  3P4Q A;  5JDL A;  2WCA A;  3P4R A;  2C0S A;  4ZEY A;  3U3I A;  3AE4 A;  5J0Z A;  4KHZ F;  1UK5 A;  4HKA A;  4ZI2 C;  2R6G F;  2QVA A;  4TZ4 C;  3EAB A;  2JRK A;  2WDV A;  2CWY A;  4QX8 B;  5A1L A;  1NEK A;  4DV6 T;  4EZH A;  4TV8 E;  2V7I A;  4HFE A;  1HCI A;  4TWD A;  4KI0 F;  1L0V A;  1HX1 B;  4ZI3 D;  2V7L A;  2EHO D;  4TX5 A;  3PJA A;  2I59 A;  4L5G A;  2PBI A;  1ZP0 A;  3LJC A;  3RKO A;  4DV0 T;  2XSB A;  2MPK A;  3ZCI A;  4YTP A;  3Q5X A;  2CBJ A;  3VR9 A;  1ZOY A;  1FMW A;  3EAM A;  2VUR A;  1MMD A;  2NTY A;  2ZM6 T;  3C4X A;  4F8H A;  3P4S A;  5AQU B;  2IIU A;  2BS3 A;  1ZEE A;  2B1E A;  2XSA A;  4B3S T;  3UUX B;  4AKR B;  2JPF A;  5LA6 E;  3C50 A;  5JR9 B;  2UUB T;  1XZY A;  4YJ2 E;  2W0G A;  4ZHQ E;  5KMG P;  1D1A A;  4ASK A;  2LSI A;  5FMN A;  5DQW A;  1M7K A;  3OYZ A;  2LJL A;  4OHF A;  2BKN A;  4YSZ A;  3H3M A;  1IBM T;  3NWI A;  3NRX A;  5JDH A;  2LHN A;  3HKD E;  2V26 A;  4LFB T;  2LSG A;  4DR6 T;  2VQF T;  1XMO T;  4LMK A;  2P9B A;  4JEH B;  5H6R B;  3AXJ A;  3I1A A;  5FNV E;  1HNW T;  3IA3 A;  2XAH B;  2OV9 A;  5LCY A;  2X0Y A;  4CQI A;  3C51 A;  4DO0 A;  4H9P C;  1HTJ F;  3NVO A;  2NW7 A;  3PUW F;  4C91 A;  1NEN A;  4U33 A;  2XQ7 A;  4H9O C;  1OED E;  2UUC T;  3WI3 A;  1IBL T;  2CEA A;  3ANW B;  3EVY A;  4NXN T;  1VOM A;  5AQO B;  3NZQ A;  5KX5 E;  4IDQ A;  2K3W A;  2VWA A;  2XJ7 A;  4NUU A;  4LF4 T;  2ZM8 A;  1WR0 A;  4COF A;  5L4E A;  4XZC A;  3SRZ A;  5AQJ B;  4JI5 T;  2X66 A;  4BAY B;  2DWG A;  1KK7 A;  2BG9 C;  3AA1 B;  5ADX L;  4EXT A;  4PJM A;  1SE7 A;  2LE8 A;  5FL0 A;  2Q9Q C;  5HEJ A;  1HF8 A;  3RC8 A;  3KV5 A;  3ZN0 B;  4AIS A;  2H3R A;  5L2L A;  1YKE B;  4UF0 B;  1D0X A;  3ABV A;  2KT9 A;  4YTN A;  1KNR A;  2HPJ A;  2WZH A;  1HFA A;  4X64 T;  4NXM T;  5JDM A;  5CA0 E;  2MAW A;  2LRK A;  5KXJ A;  2XUE A;  3RIF A;  3QC9 A;  2C5J A;  3R84 B;  5IUX A;  4FJO A;  2X9H A; 
#chains in the Genus database with same CATH homology
 3MAC A;  2WSS V;  4CXW A;  3UTK A;  5LBM A;  3PE0 A;  1MIY A;  5LYJ E;  2OA5 A;  4EB6 E;  5LGU B;  2UXN B;  3SOL A;  4J2C A;  2LSJ A;  2IAK A;  2A2F X;  4AQG A;  4XBF B;  2ZLY A;  4I4T E;  2Y6X A;  1T98 A;  3RX6 A;  3HKB E;  4GYR A;  5F3J A;  4AI6 A;  3AAI A;  2XAS B;  3FB2 A;  3ZJ1 A;  1US7 B;  5LP6 E;  4AKH A;  4CZZ B;  4IE4 A;  5LGT B;  3CQC B;  1YW0 A;  3KVA A;  5E0O A;  3QUJ A;  3FHN A;  2W62 A;  4AXP A;  2LEH A;  2L3L A;  3HKE E;  3MZK B;  1Z0P A;  1D0Z A;  2MTQ A;  3K3N A;  3CML A;  3Q5W A;  3GMI A;  5JRC B;  2BZB A;  2DLR A;  4KUM B;  4YFS A;  2X9W A;  4CI1 B;  2YU1 A;  5JDQ A;  2RP4 A;  3KV9 A;  1D0Y A;  2W63 A;  3RH3 A;  3K3Q C;  5FY1 A;  5FY0 A;  4EYY R;  1SA0 E;  3KVB A;  2K5B B;  1FMV A;  4QXC B;  3ESL A;  3AVS A;  2IW5 B;  1EZ3 A;  2VAS A;  1NAF A;  3I9Y A;  2V7K A;  2MOZ A;  5DQV A;  3JC6 C;  1UX5 A;  2LSY A;  4P0B A;  3HKC E;  4UEL A;  1S35 A;  3VHL A;  3QK6 A;  4U72 A;  3N2K E;  3SS1 A;  3ZC1 A;  5ETW A;  1O3X A;  3IBP A;  3ETU A;  2WMO A;  2XAF B;  5HXR A;  2N1G A;  3RYI E;  2CCQ A;  1KNZ A;  2JMH A;  3GN5 B;  5BMV E;  4K0U A;  5JDN A;  2Q9Q D;  1D1C A;  2N9D A;  5LXT E;  3CX8 B;  4PFP A;  2LHR A;  3D0T A;  4IE0 A;  5DJQ C;  3PUQ A;  3MK7 C;  3LK2 B;  3ZYM A;  3C64 A;  1ZKE A;  5CB4 E;  2WAU A;  1S94 A;  4HE8 A;  4EZ4 A;  3ZMS B;  3GN5 A;  3LK4 2;  3T8O A;  4O2A E;  3NBX X;  4QXB B;  4OK0 A;  1E1H B;  5HXE A;  3N2G E;  4WBN E;  2JJ9 A;  4QX7 B;  5FYM A;  4OFZ A;  2GK9 A;  4O2B E;  2D0U A;  4UIG A;  5FXX A;  2X68 A;  3IHR A;  4A56 A;  5J2U E;  4OYK A;  2X0L B;  2IC6 A;  3FXE B;  3R6N A;  3CX6 B;  3CKD A;  2M67 A;  2K48 A;  2K9A A;  1HS7 A;  5FP3 A;  3UUN A;  3N9O A;  5L3G B;  4ZI3 C;  2LOS A;  2LT3 A;  2E9X C;  2D0T A;  3PUA A;  1MIV A;  2IC9 A;  5JDF A;  2EHO C;  3E22 E;  2D5U A;  2E8I A;  2Y48 B;  3BK9 A;  4HTE A;  4CI3 B;  4UVA B;  4H63 H;  5JQG E;  3PUS A;  2KXP B;  3O9X A;  2X9X A;  1U5P A;  3AA6 B;  2W61 A;  1MMN A;  3C4Z A;  3HI2 A;  5EZY E;  3VKH A;  2C5I T;  3O1H A;  4UXN B;  3F31 A;  3PU8 A;  4U74 A;  2YU2 A;  5H6Q B;  4YLH A;  3LG7 A;  1G73 A;  2VKO A;  4IIJ E;  3KDS E;  1BR1 A;  2L8K A;  3H3A A;  2G0U A;  4IE5 A;  4KMC A;  4V1A v;  1WRD A;  4X20 E;  2VKH A;  3K8P C;  4CXY A;  4KP3 C;  3UUM A;  3EDV A;  2D2S A;  3B57 A;  4E7S A;  2CLY B;  2WM9 A;  3BQI A;  5J2T E;  1ZV4 X;  1HX8 A;  2YK0 A;  3I9W A;  3KIN B;  2XAQ B;  5JR9 A;  2ACX A;  5HXS A;  2WWU A;  3N9P A;  2X9Y A;  2J1D G;  1IZN B;  3Q9D A;  3JC6 D;  5JVD E;  2LOP A;  1H7C A;  3O1J A;  5FXV A;  3LFM A;  2DNX A;  3RPU A;  2MBG A;  3ZYK A;  3V5U A;  4G63 A;  4BJM A;  5DAB A;  3N9Q A;  3FBZ A;  1X79 A;  5LHI B;  5EK3 A;  3RYC E;  3I0O A;  3A5X A;  2UXX B;  5LG4 A;  2DCF A;  2VL8 A;  4UVC B;  4AKI A;  4UV9 B;  3RRW A;  4GOU A;  4BJN A;  3DP7 A;  5LBQ B;  3N9L A;  4PJN A;  2YEV C;  4IE6 A;  5JDL A;  4O4J E;  1MMG A;  3ZCJ A;  2C0S A;  4IE7 A;  1MND A;  3U3I A;  2KLQ A;  4MLK A;  4IST A;  1IAP A;  4PK5 A;  4HKA A;  2BVM A;  4ZI2 C;  4AQF A;  4TZ4 C;  5FXW A;  2JRK A;  2V7M A;  2PJQ A;  3I0Q A;  2CWY A;  5KDM C;  4X1Y E;  4QX8 B;  5A1L A;  1IJ6 A;  3GWH A;  4TUY E;  1IJ5 A;  1YD8 G;  4PK6 A;  3KV6 A;  3W15 B;  3N9M A;  4PW8 A;  4EZH A;  4TV8 E;  3U78 A;  3BQK A;  2V7I A;  4QXH B;  1WR6 A;  1HCI A;  3WAJ A;  1ZHC A;  4TV9 E;  2NTX A;  4IHJ E;  4ANJ A;  4JEU B;  5HXC A;  2V7J A;  3CPZ A;  5L3F B;  2HH7 A;  3P7I A;  4HGA A;  5HAX A;  4ZI3 D;  1MMA A;  2QGS A;  2E9X D;  2V7L A;  3LBX B;  4QHO A;  2EHO D;  4TX5 A;  3P8C D;  2DI4 A;  4WBO A;  5HWY A;  2MYS A;  5TAO A;  5JRE A;  4P0A A;  3J9X 1;  4EIW A;  3KV4 A;  2I59 A;  3PDY A;  4L5G A;  3N2O A;  2QA7 A;  3ZN1 B;  1SHZ C;  3ZPO A;  2PBI A;  3LJC A;  4AKL A;  3RKO A;  1V9D A;  3NZP A;  3ZMZ B;  4TN7 B;  5HWX A;  3MXZ A;  3LBX A;  3IF8 B;  1WYB A;  3ZCI A;  4ADZ A;  3RC3 A;  3PTR B;  4H9S E;  3Q5X A;  1VRB A;  3FBL A;  4GK5 E;  2W00 A;  3AAE B;  2KZ7 B;  2PFV A;  4ISS A;  1FMW A;  4H9R C;  4QKN A;  1MMD A;  2NTY A;  3LK3 B;  3OBV E;  4DMV A;  5LJM A;  5IHY A;  3FXD B;  5M4Y A;  3C4X A;  2LM9 A;  1FIO A;  5LOV E;  4X1I E;  3C4W A;  5LHH B;  2YIN A;  2Q9Q B;  3MA9 A;  4JLE A;  4MFR A;  4P09 A;  3CQX C;  4DBQ A;  1ZEE A;  2CM0 A;  4YHJ A;  2B1E A;  3CX7 B;  4UEM A;  3AVR A;  5EK4 A;  1HG2 A;  3L09 A;  2H7O A;  3UUX B;  4AKR B;  4CXX A;  4KBM B;  2JPF A;  5LA6 E;  3B13 A;  3C50 A;  3PU3 A;  3N9N A;  2Q9Q A;  5JR9 B;  4G2A A;  3E0Z A;  5JDG A;  4YJ2 E;  2W0G A;  2RA1 A;  4ZHQ E;  3PUG A;  5KMG P;  1D1A A;  2XTL A;  5L3D B;  4E7Z A;  4ASK A;  2WMN A;  4IGU A;  2LSI A;  4QWN B;  4EOZ B;  1MIW A;  5C8Y E;  3EUH A;  5FMN A;  4ZI7 E;  2CXF A;  2CLY C;  2A72 A;  2BVL A;  2EHO A;  4PAG A;  5DQW A;  4ZS3 A;  3ZYL A;  3VKG A;  3OYZ A;  2LJL A;  3H37 A;  4UF0 A;  4OHF A;  5IYZ E;  4I55 E;  4ZI2 D;  5L3B B;  4M1P A;  3ZC0 A;  1LRZ A;  4CI2 B;  4PFO A;  2NW9 A;  3RYH E;  2H7V C;  2XAG B;  1AJ3 A;  4JUY A;  1U4Q A;  3NRX A;  3K3O A;  4F6R C;  2KMF A;  2JQQ A;  3CWZ B;  4UVB B;  2K24 A;  5JDH A;  2LHN A;  3RRC A;  2CMR A;  3HKD E;  4O8S A;  1BR2 A;  2NWB A;  2V26 A;  2CWO A;  1MNE A;  1OXZ A;  3SWH A;  3ZJ2 A;  2ZM2 A;  3V5S A;  4H63 V;  2LSG A;  4PNI A;  4AQF C;  3KBU A;  4X1K E;  3UT5 E;  3UUL A;  3OJA A;  4L9I A;  2ZMA A;  3C98 B;  3KFW X;  2P9B A;  4I50 E;  1B7T A;  3GA8 A;  2NW8 A;  4H9N C;  5LNK A;  4HFV A;  2JMK A;  3OYX A;  5FY7 A;  3CVR A;  4JEH B;  5H6R B;  2ODU A;  3I1A A;  5FNV E;  2BDE A;  2XAH B;  3AB3 B;  5GON E;  3EDU A;  3IEE A;  3ZMV B;  2NOX A;  5LCY A;  2CXD A;  4ILU A;  4CQI A;  1HG5 A;  3ONX A;  2PG8 A;  3C51 A;  3ZMU B;  2KIN B;  4DO0 A;  4H9P C;  1HTJ F;  1Y64 B;  2A3D A;  4ZS2 A;  2NW7 A;  2Y8D A;  4FI5 A;  3CQG B;  2Z6E A;  4O4H E;  4IDZ A;  4C91 A;  5JRC A;  3HA4 A;  3O4X E;  4MBQ A;  4NUV A;  3MJX A;  5HYA A;  4H9O C;  4C90 A;  3ZMT B;  4XAX B;  4PJJ A;  4MAL A;  2ODV A;  3WI3 A;  5LGN B;  5J1G A;  2VKJ A;  3PUR A;  2CEA A;  3ANW B;  3EVY A;  4O4L E;  1VOM A;  3RYF E;  2C5K T;  2KWH A;  4DBR A;  1QUU A;  2DHR A;  3NZQ A;  1UX4 A;  2DWK A;  5HXH A;  5LJN A;  3L3P A;  4WW0 A;  5JH7 E;  4PK4 A;  5KX5 E;  2HPL A;  2X67 A;  5AFU L;  2CXL A;  3F57 A;  3AA7 B;  4DND A;  2ES0 A;  5CA1 E;  5EK2 A;  2VWA A;  3ANW A;  4NUU A;  4ERR A;  1WLX A;  4O4I E;  2ZM8 A;  3ZLI A;  2VK9 A;  5FXZ A;  2LSK A;  2ZM0 A;  1WYC A;  4XZC A;  3HL6 A;  2KWI B;  4DVD A;  3HR0 A;  3SRZ A;  3DJB A;  4OYJ A;  2XHE B;  3O1I A;  4I43 B;  3VU7 H;  4HN9 A;  2X66 A;  4PJL A;  2V1D B;  4BAY B;  1BR0 A;  2DWG A;  1KK7 A;  2VKD A;  3AA1 B;  3ETV A;  1LVF A;  5ADX L;  4EXT A;  4PJM A;  5LHG B;  2LE8 A;  2VB6 A;  2CA5 A;  3Q2M A;  2Q9Q C;  2KND A;  4GIW A;  4UV8 B;  4DMW A;  3NRY A;  1HF8 A;  2CE7 A;  1LKX A;  3AA0 B;  3N5L A;  4YJ3 E;  3RC8 A;  1CUN A;  3DTO A;  3KV5 A;  3M65 A;  3KBT A;  1OWA A;  2E9X B;  3ZN0 B;  1QSD A;  4H9Q C;  2H3R A;  5L2L A;  1YKE B;  2EHO B;  2N2N A;  4HEA A;  3E08 A;  4B6X A;  4UF0 B;  1D0X A;  2X51 A;  5JR9 C;  5L3C B;  4BA9 A;  1G8X A;  2XAJ B;  2KT9 A;  4EYU A;  1NWM X;  2HPJ A;  3J7Y q;  1UCU A;  1HFA A;  2NP9 A;  3F2E A;  2E9X A;  4WNK A;  3ZEF B;  4EAH A;  1BR4 A;  3UFE A;  5JDM A;  5CA0 E;  4GYS A;  1FEW A;  4MHC A;  1YKH B;  4GK0 E;  2XUE A;  3AAA B;  3MKD A;  3OKQ A;  5F8P A;  2SPC A;  3TKL B;  1LVK A;  2XQY A;  3QC9 A;  4L0R A;  2C5J A;  4N78 D;  3WAK A;  3S4U A;  2L9Q A;  2WBL A;  3R84 B;  5L3E B;  4AKG A;  4Z8X A;  4FJO A;  1D1B A;  4ZOL E;  2X9H A;  3BQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...