4HEAA

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 33
structure length 117
sequence length 117
chains with identical sequence P
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4heaA00
4HE8A 5LNKA 4HEAA 3RKOA
chains in the Genus database with same CATH superfamily
5LYJE 2YINA 2OV9A 3OVUA 2IHR1 2IMLA 1KK7A 3Q5XA 5FVLA 4JEHB 4IDPA 4J2CA 1LVKA 2X9HA 4YTNA 1IBMT 2V5CA 3MACA 3B57A 3G06A 2WQYA 2X66A 2KWHA 1ZEEA 5LGTB 3B13A 2JRKA 3EABA 2J62A 4BJNA 5HEJA 1W09A 3CX8B 1XMQT 3N2GE 3PUQA 3U78A 4OX9T 1NENA 3RYIE 4QHOA 1N33T 2EHOB 2LKGA 4IE4A 2VKOA 1X79A 3RKGA 2V5DA 5BMVE 1JNRA 2X0LB 4N78D 2YK0A 2BKOA 4DV6T 5AQUB 5J2UE 4HWCA 1MMGA 3PJAA 4LFAT 4IL4A 4YTPA 4UIGA 1D0XA 3H37A 1T98A 2QGSA 3NRXA 3I9WA 2SPCA 4ILCA 1D0ZA 3UT5E 3E22E 2LE8A 3P4QA 5LJNA 2MYSA 3TLWA 2CRBA 3RGLA 3PE0A 1T72A 3ZC0A 4H9QC 4JI3T 4JI2T 1ZKEA 3VR9A 1OWAA 3N9NA 5HXSA 2BG9E 2ZLYA 2BVMA 1VRBA 2WSSV 3ETVA 2V7LA 4JV5T 3A8YC 5L4EA 2FJEA 4KMCA 4Z8XA 3P4PA 1XDOA 4MFRA 1BR4A 2JPFA 3JC6D 3KVBA 3AB3B 4EEBA 5LP6E 5JQGE 4DMWA 3RRWA 3OPCA 3AVRA 4X1YE 4YSXA 2X9XA 5AQOB 4MBQA 3LDQB 3ZEFB 4G63A 4E7SA 3ZMTB 3C4XA 4XAXB 5CB4E 2M67A 3E08A 1AJ3A 2LM9A 3N9PA 2MBGA 3OJAA 1IJ6A 5LCYA 5JDGA 1FMWA 1I94T 2AXDS 3P4WA 2FJDA 2KLQA 4X66T 4ERRA 3SOLA 5LMUT 5LBMA 2PTFA 4AKGA 2XY8B 2E9XD 2XTLA 1WR0A 2VVSA 3NVOA 2Q9QA 3M65A 5AQPB 5HCMA 3RC3A 2PJQA 2W67A 4YTMA 4BAYB 2W2UA 2D2SA 5ABFB 4CN6A 2XSBA 1SHZC 3AAIA 2K48A 4QXHB 1D0YA 3QUJA 3I9YA 2M6IA 1OEDC 4MALA 2VURA 2QVAA 2CXLA 3R84B 3ZN1B 4U31A 2LJLA 2NTYA 4HWFA 3O1HA 3PDYA 2C5JA 3MXZA 2ZM8A 2I0MA 4YXDA 1U5PA 5C2TA 2J1DG 5FY1A 2WZIA 3ZMSB 3PURA 4H63V 3AE5A 2YU1A 4ZOLE 3ANWA 2KSRA 4JI0T 3CKDA 2X0YA 3ZN0B 4UEMA 3HL6A 5L3CB 4A5XA 4I50E 5FXVA 4X20E 1CUNA 3C51A 4DR4T 3FZKB 5LB7B 3J7Yq 4QH4A 4LMJA 3ZSSA 4DMVA 3GN5B 4AI6A 5FMNA 4EIWA 4G2AA 3CQGB 1ZV4X 5EZYE 4JI8T 2W61A 2NR4A 3F57A 1KNZA 2D0UA 4IHJE 2VQET 2WAUA 3AXJA 2PBIA 2UUAT 2FBWA 5DQWA 2L3LA 3T8OA 3TLTA 3NZQA 2WM9A 1N36T 1UCUA 5KXJA 3W15B 2R6GF 3V5SA 5JTGA 2JQKA 2L8KA 4UV9B 3BQKA 4GOUA 3X1DA 4HFVA 4CQIA 4O4IE 2CM0A 3IHRA 3UU6A 3PTRB 4P0AA 2N9DA 2XAFB 2V1DB 4WYVA 5A1LA 4TZ4C 5E0OA 1WLXA 3PU3A 1Y64B 3UU4A 3PUXF 1XZYA 5JVDE 4DO0A 2KWIB 4O4LE 2D9DA 2ODVA 5F8PA 1KNPA 2NTXA 1HF8A 2W62A 1SUMB 3AEBA 4HWHA 3LBXB 4YHJA 4U2ZA 4COFA 5EK2A 4AQGA 4IE7A 4DBRA 3M3ZB 1G8XA 3AA6B 3KV4A 4PNIA 4AKRB 4K0KT 5LOVE 5AQRB 4HGAA 2XAGB 2VL0A 4NPPA 4NXMT 2E5LT 4IL9A 2X67A 2LKHA 3ZPOA 4X62T 4LF6T 2YDRA 2E8IA 2HHHT 4EOZB 3PUZF 4U7IA 4ILUA 2QA7A 4HE8A 1MNDA 3GMIA 4AISA 3C64A 4EXTA 4E7ZA 3P4SA 2IC6A 3NZPA 2HPJA 3JADA 1HTJF 4KUMB 1HR0T 3RKOA 1MMNA 3ZYLA 1HFAA 1XMOT 3IEEA 3EVYA 2Q9QD 1HG5A 2V7IA 2UXCT 3QC9A 5ABEA 2Q9QC 4HTEA 5EK3A 4YJ2E 3PUVF 1L0VA 4HFCA 3MK7C 2NOXA 2WU2A 2QYWA 2BS3A 4O4JE 2A3DA 3PV0F 3H3AA 3S4UA 3L3PA 3UU5A 2E9XA 2E2AA 3UTKA 3AE4A 3VRBA 2DNXA 1LKXA 4AQYT 2WMOA 4B3TT 3CPZA 4GKJT 1XWMA 3CK6A 3VKGA 4P09A 3T1HT 5LXTE 2XSAA 3K1SA 4H9RC 1WCRA 4QH1A 1UGOA 5HXCA 3FZLB 1OEDA 5L2LA 4CN1A 3N9MA 3AE7A 3BQIA 2H7OA 4ZEYA 2IC9A 4AKHA 3AEFA 2CXFA 4B3RT 3A5XA 2AE9A 3DTOA 4YJ3E 3FHNA 3L39A 2PFVA 1MIVA 2VASA 3KV5A 3RIAA 5HEHA 1KF6A 5AQJB 4KHZF 4TUYE 3ZLIA 3FZFB 3F2EA 4U7YA 4WBOA 3FZHB 4JEUB 2XJ7A 1X9BA 2A72A 2BVLA 3I0OA 1XDPA 2BG9C 2V6XA 4JUYA 4PAGA 3VKHA 1UUSA 1VOMA 2WWVA 3GA8A 3HA4A 1BR2A 2RPAA 2V6YA 3E0ZA 4HFBA 4JBWF 3K3QC 1J1JA 4EB6E 4HWDA 2WZHA 5H6RB 4ZS2A 4DR1T 3LFMA 3N5LA 3WAJA 4IE5A 4IE0A 1S94A 5IHYA 5L3FB 3N9OA 4K0UA 1W0BA 4YLHA 4JI7T 3EI0A 4BJMA 2XM1A 3JAFA 2VVNA 3RF1A 3FBLA 4CXWA 2D5UA 3MZKB 4X5TA 3RQWA 2VL8A 4DIDB 2ZMAA 1HNXT 4NUVA 4YT0A 2WDQA 5ADXL 5AQMB 2B76A 1QLBA 2BS4A 1ZHCA 1HCIA 3KVAA 4ZHQE 1IBLT 3RYFE 2DWKA 2BKNA 5AQFB 3ZJ1A 1M7KA 3FXDB 4LF8T 3FBZA 3LG7A 3CIRA 1YXRA 4WBNE 4PJMA 2I59A 4O2AE 5JDLA 2YEVC 1B7TA 4PFOA 2CE7A 3UULA 5FYMA 4ISTA 3IBPA 1FIOA 2LSKA 1SE7A 3JC6C 2MOZA 5C3JA 3NBXX 5AQNB 4U74A 4WNKA 1UURA 4F6RC 4H9NC 1CHUA 4ZZCA 4PW8A 4LFCT 4JI4T 3O4XE 4OFZA 4HFDA 4NIQA 5HWXA 2FUPA 4IGUA 4Z90A 1QUUA 2Q9QB 4GYSA 4GK0E 1M62A 3PJAJ 2W4XA 2BS2A 5FY7A 1YQ3A 2LM2A 3ESLA 3VHLA 2LSJA 4GYRA 3SFEA 1VCSA 4C91A 4ZI3D 3SS1A 5LNKA 4ZI3C 3AE9A 5BR8T 1I6ZA 2CA5A 1FEWA 5AQHB 4EEDA 5FL1A 2JJ9A 3UU8A 2E9XC 2XPKA 4U33A 4DR2T 4MHCA 4PJNA 4LMLA 5LHIB 1BR0A 2XQAA 2BDEA 1H7CA 4U2YA 3H3MA 4O4HE 2XQ9A 2LEHA 4F8HA 2N2NA 2JQHA 3ANWB 2HPLA 2WMNA 1MIYA 5LHHB 1ZOYA 3TLVA 5AQLB 2LRKA 3AEEA 3UQ4A 2XQ8A 3EHZA 1IBKT 2RP4A 1D1AA 4CI2B 3HKEE 4HKAA 4ADZA 4MLKA 5JDFA 1XNRT 3CX6B 3SFDA 5TAOA 3RQUA 5FNVE 3KBUA 5JREA 4IREA 2NWBA 4DV1T 3AA0B 2Z6EA 3ONLC 3RIUC 5LHGB 2ZM0A 1JNZA 1W0AA 1QSDA 4EGWA 3AXJB 2MAWA 1HNZT 5L3BB 2NW7A 2A2FX 4EV6A 3PUGA 4L9IA 1FMVA 3ZKRA 4IT4A 4AKLA 2YKSA 2C5KT 2X68A 5H6QB 4OHFA 2BG9A 2WU5A 4X1IE 3HKBE 2K24A 1D1CA 2LRLA 2LHNA 2YU2A 3ZCJA 3CX7B 3JCFA 3UUMA 3ZJ2A 5JDNA 2JIWA 2CMRA 2XAJB 4IE6A 4YSZA 2ZM6T 4LF4T 3HR0A 2IDOB 1R8IA 4DV5T 2UXDT 2BBHA 4X65T 3ZMVB 1KNRA 5JRCA 2FJAA 2W0GA 5AQGB 4I4TE 4NUUA 4KP3C 3K3NA 3I1AA 4DV0T 3OBVE 3LK2B 3J9X1 5FP3A 4L5GA 4V1Av 2CBJA 4TWHA 4PJLA 3VRAA 4UXNB 2EHOD 3HI2A 4AIUA 2EHOC 3AE6A 2Y48B 1KEYA 3MJXA 3UU3A 4NXNT 1Z0PA 4LMKA 1UK5A 2V7KA 1IZNB 4EYUA 3BQLA 4DV2T 3KV9A 2KXPB 2J47A 2QRXA 2CWYA 4ZZBA 1NEKA 2JMHA 2FJBA 1HS7A 4ANJA 2LSYA 3FB2A 1GQEA 4H63H 3P7IA 4JLEA 2H7VC 4IDQA 2VKHA 3AVSA 3NKZA 3ZT5A 3RRCA 1YD8G 2WBLA 1HNWT 2VQFT 5JR9A 3QOFA 5FKYA 4U72A 1LRZA 2ACZA 2WDVA 2D0TA 2LOSA 4HFHA 4HWIB 3ZMUB 4LF5T 3EDUA 4I43B 1WYCA 4U3CA 4DR6T 4PFPA 3FXEB 3QNUA 4UF0A 3PUWF 4QX8B 1WYBA 4HFEA 2MTQA 4UELA 4ZI7E 2E9XB 4UVCB 4LF7T 2LT3A 3ZC1A 4KHPT 3Q9DA 5HYAA 2LSIA 2YOEA 5L4HA 2VKDA 4QXCB 2KT9A 3D0TA 1HX1B 3R6NA 4AKIA 5L3GB 2V7MA 5AQIB 4ASKA 2RA1A 2CCQA 1OEDB 2KMFA 1D1BA 5GONE 5CA0E 3U3IA 3N9QA 3ZYKA 3AEGA 4GKKT 1OXZA 4QH5A 3ONJA 2CXDA 4OK0A 3LSVA 4A97A 1KFYA 3UFGA 2XZEA 2IW5B 2BBJA 2XQ5A 5IYZE 5ETWA 2A9UA 3FZMB 4H9OC 3DJBA 3L09A 4WW0A 4PJJA 4LF9T 3EUHA 1G73A 3L8RA 3F31A 1UX4A 2BZBA 5EK4A 4CI3B 1J5WA 2C5IT 4QKNA 4O8SA 2HH7A 3RIFA 2V6YB 2GK9A 4TV9E 3TLSA 4FJOA 4DV4T 1WR6A 2W63A 5LGUB 4P1NA 4B6XA 2PG8A 3ZT6A 5JDMA 5KDMC 5HEGA 4GIWA 3QK6A 4OYKA 2X51A 4OYJA 2CLYC 2WB5A 4TV8E 3RIUA 3PUAA 3UQ7A 4H9PC 4QX7B 5KMGP 4YHHT 4DV7T 1V9DA 4PK5A 3PU8A 1UX5A 4XBFB 2ACXA 3K8PC 3AA7B 3Q2MA 4JI1T 4GK5E 4H9SE 2XQ7A 3N2KE 4QXBB 2G0UA 5LG4A 3P8CD 3CMLA 3ZSTA 1HG2A 1T8BA 1W9RA 5LJMA 1IJ5A 4JYAT 4Z91A 2UUBT 2JQQA 3EAMA 1MNEA 2XQ4A 3O1JA 4QWNB 2CPTA 2K9AA 5L3EB 4ISSA 4UVAB 2V7JA 3PUYF 4C90A 5LBQB 4O2BE 3UUBA 3TKLB 1YKEB 5CGMA 2WDRA 3CQXC 5AQSB 5IUXA 2EHOA 3AECA 1XNQT 3KBTA 2KZ7B 3ZYMA 3RLFF 5ABGA 5DABA 4YFSA 2I6HA 5L47A 5LA6E 3HKDE 5JR9C 2JQ9A 3O1IA 4DNDA 2W00A 5J1GA 3RC8A 2UU9T 2LSGA 3RX6A 3NWIA 2CBIA 3K3OA 4EZ4A 4IDNA 4EAHA 4PK4A 2H89A 5HAXA 4ILAA 5FY0A 3P4RA 3C98B 1Y01A 3B5MA 3IA3A 4DBQA 5JDHA 4YSYA 3OYXA 2N1GA 2CHOA 3KDSE 5AQTB 4JI6T 5FL0A 4IDZA 5L3DB 2X9YA 4CN4A 1VCTA 3MA9A 3C4ZA 5CA1E 3LK3B 2XQ6A 1YW0A 3ZCIA 2CEAA 4TWFA 1WFDA 2IAKA 1HX8A 5AQVB 3C50A 2E5VA 5AQKB 5JH7E 3Q5WA 4AQFC 4CZZB 1WRDA 2WWUA 3RH3A 3VU7H 4PK6A 4WZXA 2DLRA 1NAFA 3AAEB 2M6BA 3IF8B 2NP9A 3RPUA 1LVFA 2DL1A 4BA9A 1MIWA 3BK9A 1Z8UA 4B3ST 5JDQA 4TN7B 4DVDA 3LJCA 2K3WA 3AE3A 2VB6A 2CLYB 3NRYA 2BG9B 2L9QA 4KBMB 2UXXB 3AA1B 1MMDA 4I0UA 4X1KE 2HN2A 3LK42 4I55E 4A56A 3UUXB 3ONXA 3KINB 3GWHA 1IAPA 3RHWA 2Y6XA 2DWGA 5ABFA 3RYCE 4UV8B 3AEDA 1S35A 3A7MA 1YKHB 2IUBA 5DJQC 2LOPA 3SRZA 5JRCB 3RI5A 1O3XA 2X0HA 2YN6A 5IWAT 5HEOA 2W66A 4UR9A 4KI0F 2VWAA 1MMAA 4HFIA 2IIUA 2X9WA 3ABVA 3CQCB 4AXPA 2K5BB 5FXZA 2WP9A 5LG3A 4HN9A 4Q25A 2CWOA 3JAEA 5HEUA 2XHEB 3ETUA 4DUZT 1OEDE 1N32T 2VK9A 3AEAA 5FXXA 3QB5A 2H88A 5HXEA 1NWMX 4FI5A 5F3JA 3CWZB 4TWDA 3KV6A 3T1YT 5HCJA 5F5WA 4HEAA 2NW9A 3QB5K 3ZT7A 3GN5A 2XQ3A 2F4VT 4CXYA 3HKCE 5JR9B 2ZM2A 5HWYA 3C4WA 2OLTA 1N34T 5FXWA 4X64T 5M4YA 2UXNB 3V5UA 2V26A 2CHNA 2DHRA 3O9XA 3OTOT 1EZ3A 4YY3T 2WS3A 3N9LA 1FJGT 1E1HB 2OA5A 4P0BA 4UF0B 2C0SA 2UXBT 4EZHA 4DR5T 3OKQA 5J2TE 4L0RA 2XUEA 4IDOA 5LMNT 2V8SV 2ODUA 2UUCT 2B1EA 2LLYA 2NW8A 5FVKA 3CVRA 2HN1A 4ZI2D 3OYZA 4ZI2C 1E7PA 2JMKA 3Q5EA 5AQQB 1BR1A 4UVBB 3UUNA 4CI1B 3SWHA 1SA0E 3WI3A 5HXRA 5KX5E 3I0QA 1US7B 4IIJE 4ZS3A 3LBXA 3AE2A 3EDVA 3AAAB 3DP7A 1E2AA 3AE1A 4TX5A 4DR3T 5LGNB 4JI5T 2Y8DA 4TNVA 4EYYR 2WY2A 2DI4A 3N2OA 1T7SA 4M1PA 3TLUA 4ZXLA 3AE8A 2J4GA 5DQVA 3WAKA 2YDQA 3PUSA 2ES0A 4AQFA 2MPKA 4ILBA 4CXXA 2KNDA 3Q5DA 2WCAA 5CFBA 2LHRA 5J0ZA 3MKDA 4TNWA 2H3RA 3VR8A 2XQYA 2XASB 2BKPA 3UFEA 5HXHA 4XZCA 1J5ET 2DCFA 1U4QA 2P9BA 4A98A 2VKJA 2XAQB 3RYHE 2KINB 4DR7T 5CJ5A 2XAHB 5ABHA 1ZP0A 2YDSA 4LFBT 2XM2A 4KX6A 3P50A 3ZMZB 4DV3T 4B3MT 5AFUL 1DU2A 5C8YE 1YQ4A 4DUYT 3KFWX
chains in the Genus database with same CATH topology
1G8XA 3AA6B 2NWBA 3KV4A 4PNIA 4AKRB 3AA0B 5LOVE 2Z6EA 5LYJE 2YINA 4HGAA 2XAGB 5J1GA 3RC8A 5LHGB 2ZM0A 1KK7A 2LSGA 3RX6A 3K3OA 4EZ4A 3Q5XA 4EAHA 4PK4A 5HAXA 1QSDA 5FY0A 4JEHB 2X67A 4J2CA 3ZPOA 5L3BB 3C98B 1LVKA 2NW7A 2A2FX 2X9HA 2E8IA 3PUGA 4L9IA 1FMVA 4EOZB 4DBQA 5JDHA 3MACA 3OYXA 3B57A 2N1GA 4ILUA 4AKLA 2QA7A 2C5KT 3KDSE 4HE8A 2X66A 1MNDA 2X68A 5H6QB 3GMIA 2KWHA 1ZEEA 4OHFA 3C64A 5LGTB 4IDZA 4EXTA 5L3DB 2X9YA 3B13A 4X1IE 4E7ZA 3MA9A 3HKBE 2JRKA 3C4ZA 2IC6A 2K24A 1D1CA 3NZPA 4BJNA 2HPJA 5CA1E 3LK3B 2LHNA 2YU2A 3ZCJA 3CX7B 1HTJF 4KUMB 1YW0A 3ZCIA 3UUMA 3ZJ2A 3CX8B 3RKOA 1MMNA 5JDNA 2CEAA 3N2GE 3ZYLA 2IAKA 3PUQA 2CMRA 3U78A 1HX8A 3RYIE 4QHOA 1HFAA 2XAJB 3C50A 3IEEA 4IE6A 2EHOB 3EVYA 4IE4A 2Q9QD 1HG5A 2V7IA 2VKOA 3HR0A 1X79A 3Q5WA 3QC9A 4AQFC 5JH7E 2Q9QC 4CZZB 4HTEA 5EK3A 4YJ2E 3ZMVB 1WRDA 5JRCA 5BMVE 2WWUA 2X0LB 2YK0A 4N78D 3RH3A 2W0GA 4PK6A 3VU7H 4I4TE 5J2UE 3MK7C 4NUUA 1MMGA 2NOXA 4KP3C 3K3NA 3I1AA 2DLRA 1NAFA 3AAEB 3OBVE 3LK2B 4O4JE 2A3DA 3IF8B 3J9X1 5FP3A 3H3AA 4L5GA 4V1Av 2NP9A 3RPUA 3S4UA 3L3PA 4PJLA 1LVFA 4UXNB 2E9XA 4UIGA 1D0XA 3H37A 3UTKA 1T98A 2EHOD 1MIWA 2QGSA 3HI2A 3I9WA 3NRXA 2SPCA 3BK9A 1D0ZA 2DNXA 3UT5E 2EHOC 3E22E 2LE8A 1LKXA 2Y48B 2WMOA 3MJXA 5LJNA 3CPZA 5JDQA 2MYSA 4TN7B 3VKGA 1Z0PA 3PE0A 4P09A 2V7KA 5LXTE 1IZNB 4DVDA 4EYUA 3ZC0A 3LJCA 4H9QC 3BQLA 4H9RC 1ZKEA 5HXCA 1OWAA 3KV9A 2VB6A 2CLYB 5L2LA 3N9NA 5HXSA 3NRYA 2KXPB 2ZLYA 3N9MA 2L9QA 3BQIA 2BVMA 1VRBA 2H7OA 2WSSV 2V7LA 2IC9A 3ETVA 2CWYA 4KBMB 4AKHA 2UXXB 3AA1B 2JMHA 1MMDA 2CXFA 1HS7A 3A5XA 3DTOA 4KMCA 4YJ3E 4ANJA 4Z8XA 2LSYA 3FHNA 4X1KE 2PFVA 1MIVA 3FB2A 4H63H 3LK42 3P7IA 4I55E 4A56A 4JLEA 3UUXB 2H7VC 3ONXA 3KINB 2VASA 2VKHA 3GWHA 3KV5A 4MFRA 3AVSA 1IAPA 1BR4A 3RRCA 1YD8G 2JPFA 3JC6D 2WBLA 2Y6XA 2DWGA 3KVBA 3AB3B 3RYCE 4UV8B 5JR9A 1S35A 5LP6E 1YKHB 4TUYE 4U72A 3ZLIA 1LRZA 5JQGE 3F2EA 2D0TA 2LOSA 4WBOA 5DJQC 3RRWA 4JEUB 2LOPA 3ZMUB 3SRZA 4DMWA 2A72A 2BVLA 3I0OA 5JRCB 3AVRA 4X1YE 3EDUA 4JUYA 4PAGA 4I43B 1WYCA 1O3XA 4PFPA 3VKHA 2X9XA 3FXEB 1VOMA 4MBQA 3ZEFB 4G63A 4UF0A 4E7SA 3ZMTB 3GA8A 2VWAA 3HA4A 4QX8B 1WYBA 1BR2A 1MMAA 3C4XA 2X9WA 4XAXB 5CB4E 3CQCB 3E0ZA 2MTQA 4UELA 2M67A 4AXPA 2K5BB 2E9XB 3E08A 4ZI7E 3K3QC 1AJ3A 2LM9A 4UVCB 3N9PA 5FXZA 2MBGA 2LT3A 3ZC1A 4HN9A 4EB6E 3OJAA 2CWOA 1IJ6A 3Q9DA 5LCYA 5H6RB 5JDGA 4ZS2A 1FMWA 2XHEB 5HYAA 2LSIA 3ETUA 3LFMA 3N5LA 2VKDA 3WAJA 4QXCB 2KT9A 2KLQA 4IE5A 3D0TA 4IE0A 3R6NA 1S94A 5IHYA 4ERRA 5L3FB 3SOLA 3N9OA 5L3GB 2V7MA 4K0UA 4AKIA 5LBMA 4ASKA 2RA1A 2CCQA 4YLHA 2VK9A 4AKGA 2KMFA 1D1BA 5FXXA 4BJMA 5GONE 5CA0E 5HXEA 4BA9A 1NWMX 3U3IA 2E9XD 3N9QA 2XTLA 4FI5A 3ZYKA 5F3JA 3CWZB 1OXZA 3KV6A 3FBLA 2Q9QA 3M65A 4CXWA 2CXDA 2D5UA 3MZKB 4OK0A 2VL8A 3RC3A 2ZMAA 4HEAA 2NW9A 4NUVA 2PJQA 2IW5B 3GN5A 5IYZE 5ETWA 4BAYB 5ADXL 2D2SA 4H9OC 3HKCE 4CXYA 3DJBA 3L09A 4WW0A 2ZM2A 4PJJA 5JR9B 5HWYA 1SHZC 3AAIA 3C4WA 1ZHCA 5FXWA 1HCIA 3KVAA 4ZHQE 2K48A 3EUHA 4QXHB 1D0YA 3QUJA 5M4YA 1G73A 2UXNB 3I9YA 3F31A 3RYFE 3V5UA 1UX4A 2V26A 4MALA 2DHRA 2DWKA 2BZBA 5EK4A 2CXLA 3ZJ1A 3R84B 3O9XA 1EZ3A 3FXDB 3N9LA 4CI3B 3FBZA 3LG7A 3ZN1B 4WBNE 4PJMA 2C5IT 4QKNA 2I59A 1E1HB 2LJLA 2OA5A 4P0BA 4UF0B 2NTYA 4O8SA 4O2AE 5JDLA 2HH7A 2YEVC 1B7TA 2C0SA 4PFOA 3O1HA 3PDYA 2C5JA 3MXZA 2GK9A 2ZM8A 2CE7A 3UULA 4TV9E 4FJOA 5FYMA 4ISTA 4EZHA 1WR6A 3OKQA 1U5PA 3IBPA 1FIOA 2W63A 2J1DG 5J2TE 5FY1A 2LSKA 4L0RA 2XUEA 5LGUB 3ZMSB 4B6XA 2PG8A 5JDMA 5KDMC 3PURA 4H63V 2ODUA 4GIWA 2B1EA 2YU1A 3JC6C 4ZOLE 3ANWA 2MOZA 2NW8A 3QK6A 4OYKA 2X51A 3CVRA 3NBXX 4ZI2D 3CKDA 4OYJA 3OYZA 4ZI2C 4U74A 3ZN0B 2CLYC 4TV8E 4UEMA 3HL6A 5L3CB 2JMKA 4WNKA 3PUAA 4F6RC 1BR1A 4I50E 5FXVA 4H9NC 4X20E 4UVBB 4PW8A 4H9PC 4QX7B 3O4XE 3UUNA 4CI1B 3SWHA 1SA0E 1CUNA 3WI3A 5HXRA 4OFZA 5KX5E 5HWXA 3C51A 4IGUA 3J7Yq 3I0QA 5KMGP 1QUUA 1V9DA 4PK5A 2Q9QB 3PU8A 1US7B 4GYSA 4IIJE 4ZS3A 4GK0E 3LBXA 3EDVA 3AAAB 3DP7A 1UX5A 4XBFB 2ACXA 4DMVA 3GN5B 4TX5A 4AI6A 5FMNA 5FY7A 4EIWA 4G2AA 3CQGB 1ZV4X 5EZYE 3ESLA 3K8PC 3VHLA 5LGNB 2LSJA 3AA7B 3Q2MA 2W61A 4GYRA 3F57A 4C91A 4GK5E 2Y8DA 4ZI3D 4H9SE 3SS1A 5LNKA 1KNZA 2D0UA 4EYYR 4IHJE 4ZI3C 3N2KE 4QXBB 2CA5A 2DI4A 2G0UA 2WAUA 3N2OA 5LG4A 4M1PA 2PBIA 1FEWA 3P8CD 3CMLA 5DQWA 1HG2A 2JJ9A 2L3LA 5LJMA 1IJ5A 2E9XC 5DQVA 3T8OA 3WAKA 3NZQA 2WM9A 2ES0A 3PUSA 4MHCA 4AQFA 1UCUA 4PJNA 2JQQA 5LHIB 1BR0A 3W15B 4CXXA 2KNDA 3V5SA 2BDEA 1H7CA 1MNEA 3O1JA 4QWNB 2L8KA 4UV9B 2K9AA 5L3EB 4O4HE 3BQKA 4GOUA 4HFVA 4CQIA 4O4IE 4ISSA 2LEHA 2CM0A 4DBRA 2LHRA 3IHRA 2N2NA 4UVAB 2V7JA 3MKDA 3PTRB 4P0AA 2H3RA 3ANWB 2N9DA 2HPLA 2WMNA 2XAFB 4C90A 1MIYA 5LBQB 5LHHB 2V1DB 4O2BE 2XQYA 5A1LA 2XASB 3TKLB 1YKEB 2RP4A 4TZ4C 3UFEA 5HXHA 3CQXC 4XZCA 5E0OA 1D1AA 4CI2B 1WLXA 2DCFA 1Y64B 2EHOA 3PU3A 1U4QA 2P9BA 5JVDE 4DO0A 3KBTA 2VKJA 2XAQB 3RYHE 3HKEE 2KWIB 2KINB 4O4LE 4HKAA 4ADZA 4MLKA 2ODVA 2KZ7B 5JDFA 5F8PA 2XAHB 3CX6B 3ZYMA 2NTXA 1HF8A 2W62A 5TAOA 5DABA 4YFSA 3LBXB 3ZMZB 5FNVE 3KBUA 4YHJA 5JREA 5LA6E 3HKDE 5AFUL 5C8YE 5JR9C 3O1IA 5EK2A 4AQGA 4IE7A 4DNDA 2W00A 3KFWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE8 A;  5LNK A;  4HEA A;  3RKO A; 
#chains in the Genus database with same CATH topology
 5LYJ E;  2YIN A;  2OV9 A;  3OVU A;  2IHR 1;  2IML A;  1KK7 A;  3Q5X A;  5FVL A;  4JEH B;  4IDP A;  4J2C A;  1LVK A;  2X9H A;  4YTN A;  1IBM T;  2V5C A;  3MAC A;  3B57 A;  3G06 A;  2WQY A;  2X66 A;  2KWH A;  1ZEE A;  5LGT B;  3B13 A;  2JRK A;  3EAB A;  2J62 A;  4BJN A;  5HEJ A;  1W09 A;  3CX8 B;  1XMQ T;  3N2G E;  3PUQ A;  3U78 A;  4OX9 T;  1NEN A;  3RYI E;  4QHO A;  1N33 T;  2EHO B;  2LKG A;  4IE4 A;  2VKO A;  1X79 A;  3RKG A;  2V5D A;  5BMV E;  1JNR A;  2X0L B;  4N78 D;  2YK0 A;  2BKO A;  4DV6 T;  5AQU B;  5J2U E;  4HWC A;  1MMG A;  3PJA A;  4LFA T;  4IL4 A;  4YTP A;  4UIG A;  1D0X A;  3H37 A;  1T98 A;  2QGS A;  3NRX A;  3I9W A;  2SPC A;  4ILC A;  1D0Z A;  3UT5 E;  3E22 E;  2LE8 A;  3P4Q A;  5LJN A;  2MYS A;  3TLW A;  2CRB A;  3RGL A;  3PE0 A;  1T72 A;  3ZC0 A;  4H9Q C;  4JI3 T;  4JI2 T;  1ZKE A;  3VR9 A;  1OWA A;  3N9N A;  5HXS A;  2BG9 E;  2ZLY A;  2BVM A;  1VRB A;  2WSS V;  3ETV A;  2V7L A;  4JV5 T;  3A8Y C;  5L4E A;  2FJE A;  4KMC A;  4Z8X A;  3P4P A;  1XDO A;  4MFR A;  1BR4 A;  2JPF A;  3JC6 D;  3KVB A;  3AB3 B;  4EEB A;  5LP6 E;  5JQG E;  4DMW A;  3RRW A;  3OPC A;  3AVR A;  4X1Y E;  4YSX A;  2X9X A;  5AQO B;  4MBQ A;  3LDQ B;  3ZEF B;  4G63 A;  4E7S A;  3ZMT B;  3C4X A;  4XAX B;  5CB4 E;  2M67 A;  3E08 A;  1AJ3 A;  2LM9 A;  3N9P A;  2MBG A;  3OJA A;  1IJ6 A;  5LCY A;  5JDG A;  1FMW A;  1I94 T;  2AXD S;  3P4W A;  2FJD A;  2KLQ A;  4X66 T;  4ERR A;  3SOL A;  5LMU T;  5LBM A;  2PTF A;  4AKG A;  2XY8 B;  2E9X D;  2XTL A;  1WR0 A;  2VVS A;  3NVO A;  2Q9Q A;  3M65 A;  5AQP B;  5HCM A;  3RC3 A;  2PJQ A;  2W67 A;  4YTM A;  4BAY B;  2W2U A;  2D2S A;  5ABF B;  4CN6 A;  2XSB A;  1SHZ C;  3AAI A;  2K48 A;  4QXH B;  1D0Y A;  3QUJ A;  3I9Y A;  2M6I A;  1OED C;  4MAL A;  2VUR A;  2QVA A;  2CXL A;  3R84 B;  3ZN1 B;  4U31 A;  2LJL A;  2NTY A;  4HWF A;  3O1H A;  3PDY A;  2C5J A;  3MXZ A;  2ZM8 A;  2I0M A;  4YXD A;  1U5P A;  5C2T A;  2J1D G;  5FY1 A;  2WZI A;  3ZMS B;  3PUR A;  4H63 V;  3AE5 A;  2YU1 A;  4ZOL E;  3ANW A;  2KSR A;  4JI0 T;  3CKD A;  2X0Y A;  3ZN0 B;  4UEM A;  3HL6 A;  5L3C B;  4A5X A;  4I50 E;  5FXV A;  4X20 E;  1CUN A;  3C51 A;  4DR4 T;  3FZK B;  5LB7 B;  3J7Y q;  4QH4 A;  4LMJ A;  3ZSS A;  4DMV A;  3GN5 B;  4AI6 A;  5FMN A;  4EIW A;  4G2A A;  3CQG B;  1ZV4 X;  5EZY E;  4JI8 T;  2W61 A;  2NR4 A;  3F57 A;  1KNZ A;  2D0U A;  4IHJ E;  2VQE T;  2WAU A;  3AXJ A;  2PBI A;  2UUA T;  2FBW A;  5DQW A;  2L3L A;  3T8O A;  3TLT A;  3NZQ A;  2WM9 A;  1N36 T;  1UCU A;  5KXJ A;  3W15 B;  2R6G F;  3V5S A;  5JTG A;  2JQK A;  2L8K A;  4UV9 B;  3BQK A;  4GOU A;  3X1D A;  4HFV A;  4CQI A;  4O4I E;  2CM0 A;  3IHR A;  3UU6 A;  3PTR B;  4P0A A;  2N9D A;  2XAF B;  2V1D B;  4WYV A;  5A1L A;  4TZ4 C;  5E0O A;  1WLX A;  3PU3 A;  1Y64 B;  3UU4 A;  3PUX F;  1XZY A;  5JVD E;  4DO0 A;  2KWI B;  4O4L E;  2D9D A;  2ODV A;  5F8P A;  1KNP A;  2NTX A;  1HF8 A;  2W62 A;  1SUM B;  3AEB A;  4HWH A;  3LBX B;  4YHJ A;  4U2Z A;  4COF A;  5EK2 A;  4AQG A;  4IE7 A;  4DBR A;  3M3Z B;  1G8X A;  3AA6 B;  3KV4 A;  4PNI A;  4AKR B;  4K0K T;  5LOV E;  5AQR B;  4HGA A;  2XAG B;  2VL0 A;  4NPP A;  4NXM T;  2E5L T;  4IL9 A;  2X67 A;  2LKH A;  3ZPO A;  4X62 T;  4LF6 T;  2YDR A;  2E8I A;  2HHH T;  4EOZ B;  3PUZ F;  4U7I A;  4ILU A;  2QA7 A;  4HE8 A;  1MND A;  3GMI A;  4AIS A;  3C64 A;  4EXT A;  4E7Z A;  3P4S A;  2IC6 A;  3NZP A;  2HPJ A;  3JAD A;  1HTJ F;  4KUM B;  1HR0 T;  3RKO A;  1MMN A;  3ZYL A;  1HFA A;  1XMO T;  3IEE A;  3EVY A;  2Q9Q D;  1HG5 A;  2V7I A;  2UXC T;  3QC9 A;  5ABE A;  2Q9Q C;  4HTE A;  5EK3 A;  4YJ2 E;  3PUV F;  1L0V A;  4HFC A;  3MK7 C;  2NOX A;  2WU2 A;  2QYW A;  2BS3 A;  4O4J E;  2A3D A;  3PV0 F;  3H3A A;  3S4U A;  3L3P A;  3UU5 A;  2E9X A;  2E2A A;  3UTK A;  3AE4 A;  3VRB A;  2DNX A;  1LKX A;  4AQY T;  2WMO A;  4B3T T;  3CPZ A;  4GKJ T;  1XWM A;  3CK6 A;  3VKG A;  4P09 A;  3T1H T;  5LXT E;  2XSA A;  3K1S A;  4H9R C;  1WCR A;  4QH1 A;  1UGO A;  5HXC A;  3FZL B;  1OED A;  5L2L A;  4CN1 A;  3N9M A;  3AE7 A;  3BQI A;  2H7O A;  4ZEY A;  2IC9 A;  4AKH A;  3AEF A;  2CXF A;  4B3R T;  3A5X A;  2AE9 A;  3DTO A;  4YJ3 E;  3FHN A;  3L39 A;  2PFV A;  1MIV A;  2VAS A;  3KV5 A;  3RIA A;  5HEH A;  1KF6 A;  5AQJ B;  4KHZ F;  4TUY E;  3ZLI A;  3FZF B;  3F2E A;  4U7Y A;  4WBO A;  3FZH B;  4JEU B;  2XJ7 A;  1X9B A;  2A72 A;  2BVL A;  3I0O A;  1XDP A;  2BG9 C;  2V6X A;  4JUY A;  4PAG A;  3VKH A;  1UUS A;  1VOM A;  2WWV A;  3GA8 A;  3HA4 A;  1BR2 A;  2RPA A;  2V6Y A;  3E0Z A;  4HFB A;  4JBW F;  3K3Q C;  1J1J A;  4EB6 E;  4HWD A;  2WZH A;  5H6R B;  4ZS2 A;  4DR1 T;  3LFM A;  3N5L A;  3WAJ A;  4IE5 A;  4IE0 A;  1S94 A;  5IHY A;  5L3F B;  3N9O A;  4K0U A;  1W0B A;  4YLH A;  4JI7 T;  3EI0 A;  4BJM A;  2XM1 A;  3JAF A;  2VVN A;  3RF1 A;  3FBL A;  4CXW A;  2D5U A;  3MZK B;  4X5T A;  3RQW A;  2VL8 A;  4DID B;  2ZMA A;  1HNX T;  4NUV A;  4YT0 A;  2WDQ A;  5ADX L;  5AQM B;  2B76 A;  1QLB A;  2BS4 A;  1ZHC A;  1HCI A;  3KVA A;  4ZHQ E;  1IBL T;  3RYF E;  2DWK A;  2BKN A;  5AQF B;  3ZJ1 A;  1M7K A;  3FXD B;  4LF8 T;  3FBZ A;  3LG7 A;  3CIR A;  1YXR A;  4WBN E;  4PJM A;  2I59 A;  4O2A E;  5JDL A;  2YEV C;  1B7T A;  4PFO A;  2CE7 A;  3UUL A;  5FYM A;  4IST A;  3IBP A;  1FIO A;  2LSK A;  1SE7 A;  3JC6 C;  2MOZ A;  5C3J A;  3NBX X;  5AQN B;  4U74 A;  4WNK A;  1UUR A;  4F6R C;  4H9N C;  1CHU A;  4ZZC A;  4PW8 A;  4LFC T;  4JI4 T;  3O4X E;  4OFZ A;  4HFD A;  4NIQ A;  5HWX A;  2FUP A;  4IGU A;  4Z90 A;  1QUU A;  2Q9Q B;  4GYS A;  4GK0 E;  1M62 A;  3PJA J;  2W4X A;  2BS2 A;  5FY7 A;  1YQ3 A;  2LM2 A;  3ESL A;  3VHL A;  2LSJ A;  4GYR A;  3SFE A;  1VCS A;  4C91 A;  4ZI3 D;  3SS1 A;  5LNK A;  4ZI3 C;  3AE9 A;  5BR8 T;  1I6Z A;  2CA5 A;  1FEW A;  5AQH B;  4EED A;  5FL1 A;  2JJ9 A;  3UU8 A;  2E9X C;  2XPK A;  4U33 A;  4DR2 T;  4MHC A;  4PJN A;  4LML A;  5LHI B;  1BR0 A;  2XQA A;  2BDE A;  1H7C A;  4U2Y A;  3H3M A;  4O4H E;  2XQ9 A;  2LEH A;  4F8H A;  2N2N A;  2JQH A;  3ANW B;  2HPL A;  2WMN A;  1MIY A;  5LHH B;  1ZOY A;  3TLV A;  5AQL B;  2LRK A;  3AEE A;  3UQ4 A;  2XQ8 A;  3EHZ A;  1IBK T;  2RP4 A;  1D1A A;  4CI2 B;  3HKE E;  4HKA A;  4ADZ A;  4MLK A;  5JDF A;  1XNR T;  3CX6 B;  3SFD A;  5TAO A;  3RQU A;  5FNV E;  3KBU A;  5JRE A;  4IRE A;  2NWB A;  4DV1 T;  3AA0 B;  2Z6E A;  3ONL C;  3RIU C;  5LHG B;  2ZM0 A;  1JNZ A;  1W0A A;  1QSD A;  4EGW A;  3AXJ B;  2MAW A;  1HNZ T;  5L3B B;  2NW7 A;  2A2F X;  4EV6 A;  3PUG A;  4L9I A;  1FMV A;  3ZKR A;  4IT4 A;  4AKL A;  2YKS A;  2C5K T;  2X68 A;  5H6Q B;  4OHF A;  2BG9 A;  2WU5 A;  4X1I E;  3HKB E;  2K24 A;  1D1C A;  2LRL A;  2LHN A;  2YU2 A;  3ZCJ A;  3CX7 B;  3JCF A;  3UUM A;  3ZJ2 A;  5JDN A;  2JIW A;  2CMR A;  2XAJ B;  4IE6 A;  4YSZ A;  2ZM6 T;  4LF4 T;  3HR0 A;  2IDO B;  1R8I A;  4DV5 T;  2UXD T;  2BBH A;  4X65 T;  3ZMV B;  1KNR A;  5JRC A;  2FJA A;  2W0G A;  5AQG B;  4I4T E;  4NUU A;  4KP3 C;  3K3N A;  3I1A A;  4DV0 T;  3OBV E;  3LK2 B;  3J9X 1;  5FP3 A;  4L5G A;  4V1A v;  2CBJ A;  4TWH A;  4PJL A;  3VRA A;  4UXN B;  2EHO D;  3HI2 A;  4AIU A;  2EHO C;  3AE6 A;  2Y48 B;  1KEY A;  3MJX A;  3UU3 A;  4NXN T;  1Z0P A;  4LMK A;  1UK5 A;  2V7K A;  1IZN B;  4EYU A;  3BQL A;  4DV2 T;  3KV9 A;  2KXP B;  2J47 A;  2QRX A;  2CWY A;  4ZZB A;  1NEK A;  2JMH A;  2FJB A;  1HS7 A;  4ANJ A;  2LSY A;  3FB2 A;  1GQE A;  4H63 H;  3P7I A;  4JLE A;  2H7V C;  4IDQ A;  2VKH A;  3AVS A;  3NKZ A;  3ZT5 A;  3RRC A;  1YD8 G;  2WBL A;  1HNW T;  2VQF T;  5JR9 A;  3QOF A;  5FKY A;  4U72 A;  1LRZ A;  2ACZ A;  2WDV A;  2D0T A;  2LOS A;  4HFH A;  4HWI B;  3ZMU B;  4LF5 T;  3EDU A;  4I43 B;  1WYC A;  4U3C A;  4DR6 T;  4PFP A;  3FXE B;  3QNU A;  4UF0 A;  3PUW F;  4QX8 B;  1WYB A;  4HFE A;  2MTQ A;  4UEL A;  4ZI7 E;  2E9X B;  4UVC B;  4LF7 T;  2LT3 A;  3ZC1 A;  4KHP T;  3Q9D A;  5HYA A;  2LSI A;  2YOE A;  5L4H A;  2VKD A;  4QXC B;  2KT9 A;  3D0T A;  1HX1 B;  3R6N A;  4AKI A;  5L3G B;  2V7M A;  5AQI B;  4ASK A;  2RA1 A;  2CCQ A;  1OED B;  2KMF A;  1D1B A;  5GON E;  5CA0 E;  3U3I A;  3N9Q A;  3ZYK A;  3AEG A;  4GKK T;  1OXZ A;  4QH5 A;  3ONJ A;  2CXD A;  4OK0 A;  3LSV A;  4A97 A;  1KFY A;  3UFG A;  2XZE A;  2IW5 B;  2BBJ A;  2XQ5 A;  5IYZ E;  5ETW A;  2A9U A;  3FZM B;  4H9O C;  3DJB A;  3L09 A;  4WW0 A;  4PJJ A;  4LF9 T;  3EUH A;  1G73 A;  3L8R A;  3F31 A;  1UX4 A;  2BZB A;  5EK4 A;  4CI3 B;  1J5W A;  2C5I T;  4QKN A;  4O8S A;  2HH7 A;  3RIF A;  2V6Y B;  2GK9 A;  4TV9 E;  3TLS A;  4FJO A;  4DV4 T;  1WR6 A;  2W63 A;  5LGU B;  4P1N A;  4B6X A;  2PG8 A;  3ZT6 A;  5JDM A;  5KDM C;  5HEG A;  4GIW A;  3QK6 A;  4OYK A;  2X51 A;  4OYJ A;  2CLY C;  2WB5 A;  4TV8 E;  3RIU A;  3PUA A;  3UQ7 A;  4H9P C;  4QX7 B;  5KMG P;  4YHH T;  4DV7 T;  1V9D A;  4PK5 A;  3PU8 A;  1UX5 A;  4XBF B;  2ACX A;  3K8P C;  3AA7 B;  3Q2M A;  4JI1 T;  4GK5 E;  4H9S E;  2XQ7 A;  3N2K E;  4QXB B;  2G0U A;  5LG4 A;  3P8C D;  3CML A;  3ZST A;  1HG2 A;  1T8B A;  1W9R A;  5LJM A;  1IJ5 A;  4JYA T;  4Z91 A;  2UUB T;  2JQQ A;  3EAM A;  1MNE A;  2XQ4 A;  3O1J A;  4QWN B;  2CPT A;  2K9A A;  5L3E B;  4ISS A;  4UVA B;  2V7J A;  3PUY F;  4C90 A;  5LBQ B;  4O2B E;  3UUB A;  3TKL B;  1YKE B;  5CGM A;  2WDR A;  3CQX C;  5AQS B;  5IUX A;  2EHO A;  3AEC A;  1XNQ T;  3KBT A;  2KZ7 B;  3ZYM A;  3RLF F;  5ABG A;  5DAB A;  4YFS A;  2I6H A;  5L47 A;  5LA6 E;  3HKD E;  5JR9 C;  2JQ9 A;  3O1I A;  4DND A;  2W00 A;  5J1G A;  3RC8 A;  2UU9 T;  2LSG A;  3RX6 A;  3NWI A;  2CBI A;  3K3O A;  4EZ4 A;  4IDN A;  4EAH A;  4PK4 A;  2H89 A;  5HAX A;  4ILA A;  5FY0 A;  3P4R A;  3C98 B;  1Y01 A;  3B5M A;  3IA3 A;  4DBQ A;  5JDH A;  4YSY A;  3OYX A;  2N1G A;  2CHO A;  3KDS E;  5AQT B;  4JI6 T;  5FL0 A;  4IDZ A;  5L3D B;  2X9Y A;  4CN4 A;  1VCT A;  3MA9 A;  3C4Z A;  5CA1 E;  3LK3 B;  2XQ6 A;  1YW0 A;  3ZCI A;  2CEA A;  4TWF A;  1WFD A;  2IAK A;  1HX8 A;  5AQV B;  3C50 A;  2E5V A;  5AQK B;  5JH7 E;  3Q5W A;  4AQF C;  4CZZ B;  1WRD A;  2WWU A;  3RH3 A;  3VU7 H;  4PK6 A;  4WZX A;  2DLR A;  1NAF A;  3AAE B;  2M6B A;  3IF8 B;  2NP9 A;  3RPU A;  1LVF A;  2DL1 A;  4BA9 A;  1MIW A;  3BK9 A;  1Z8U A;  4B3S T;  5JDQ A;  4TN7 B;  4DVD A;  3LJC A;  2K3W A;  3AE3 A;  2VB6 A;  2CLY B;  3NRY A;  2BG9 B;  2L9Q A;  4KBM B;  2UXX B;  3AA1 B;  1MMD A;  4I0U A;  4X1K E;  2HN2 A;  3LK4 2;  4I55 E;  4A56 A;  3UUX B;  3ONX A;  3KIN B;  3GWH A;  1IAP A;  3RHW A;  2Y6X A;  2DWG A;  5ABF A;  3RYC E;  4UV8 B;  3AED A;  1S35 A;  3A7M A;  1YKH B;  2IUB A;  5DJQ C;  2LOP A;  3SRZ A;  5JRC B;  3RI5 A;  1O3X A;  2X0H A;  2YN6 A;  5IWA T;  5HEO A;  2W66 A;  4UR9 A;  4KI0 F;  2VWA A;  1MMA A;  4HFI A;  2IIU A;  2X9W A;  3ABV A;  3CQC B;  4AXP A;  2K5B B;  5FXZ A;  2WP9 A;  5LG3 A;  4HN9 A;  4Q25 A;  2CWO A;  3JAE A;  5HEU A;  2XHE B;  3ETU A;  4DUZ T;  1OED E;  1N32 T;  2VK9 A;  3AEA A;  5FXX A;  3QB5 A;  2H88 A;  5HXE A;  1NWM X;  4FI5 A;  5F3J A;  3CWZ B;  4TWD A;  3KV6 A;  3T1Y T;  5HCJ A;  5F5W A;  4HEA A;  2NW9 A;  3QB5 K;  3ZT7 A;  3GN5 A;  2XQ3 A;  2F4V T;  4CXY A;  3HKC E;  5JR9 B;  2ZM2 A;  5HWY A;  3C4W A;  2OLT A;  1N34 T;  5FXW A;  4X64 T;  5M4Y A;  2UXN B;  3V5U A;  2V26 A;  2CHN A;  2DHR A;  3O9X A;  3OTO T;  1EZ3 A;  4YY3 T;  2WS3 A;  3N9L A;  1FJG T;  1E1H B;  2OA5 A;  4P0B A;  4UF0 B;  2C0S A;  2UXB T;  4EZH A;  4DR5 T;  3OKQ A;  5J2T E;  4L0R A;  2XUE A;  4IDO A;  5LMN T;  2V8S V;  2ODU A;  2UUC T;  2B1E A;  2LLY A;  2NW8 A;  5FVK A;  3CVR A;  2HN1 A;  4ZI2 D;  3OYZ A;  4ZI2 C;  1E7P A;  2JMK A;  3Q5E A;  5AQQ B;  1BR1 A;  4UVB B;  3UUN A;  4CI1 B;  3SWH A;  1SA0 E;  3WI3 A;  5HXR A;  5KX5 E;  3I0Q A;  1US7 B;  4IIJ E;  4ZS3 A;  3LBX A;  3AE2 A;  3EDV A;  3AAA B;  3DP7 A;  1E2A A;  3AE1 A;  4TX5 A;  4DR3 T;  5LGN B;  4JI5 T;  2Y8D A;  4TNV A;  4EYY R;  2WY2 A;  2DI4 A;  3N2O A;  1T7S A;  4M1P A;  3TLU A;  4ZXL A;  3AE8 A;  2J4G A;  5DQV A;  3WAK A;  2YDQ A;  3PUS A;  2ES0 A;  4AQF A;  2MPK A;  4ILB A;  4CXX A;  2KND A;  3Q5D A;  2WCA A;  5CFB A;  2LHR A;  5J0Z A;  3MKD A;  4TNW A;  2H3R A;  3VR8 A;  2XQY A;  2XAS B;  2BKP A;  3UFE A;  5HXH A;  4XZC A;  1J5E T;  2DCF A;  1U4Q A;  2P9B A;  4A98 A;  2VKJ A;  2XAQ B;  3RYH E;  2KIN B;  4DR7 T;  5CJ5 A;  2XAH B;  5ABH A;  1ZP0 A;  2YDS A;  4LFB T;  2XM2 A;  4KX6 A;  3P50 A;  3ZMZ B;  4DV3 T;  4B3M T;  5AFU L;  1DU2 A;  5C8Y E;  1YQ4 A;  4DUY T;  3KFW X; 
#chains in the Genus database with same CATH homology
 1G8X A;  3AA6 B;  2NWB A;  3KV4 A;  4PNI A;  4AKR B;  3AA0 B;  5LOV E;  2Z6E A;  5LYJ E;  2YIN A;  4HGA A;  2XAG B;  5J1G A;  3RC8 A;  5LHG B;  2ZM0 A;  1KK7 A;  2LSG A;  3RX6 A;  3K3O A;  4EZ4 A;  3Q5X A;  4EAH A;  4PK4 A;  5HAX A;  1QSD A;  5FY0 A;  4JEH B;  2X67 A;  4J2C A;  3ZPO A;  5L3B B;  3C98 B;  1LVK A;  2NW7 A;  2A2F X;  2X9H A;  2E8I A;  3PUG A;  4L9I A;  1FMV A;  4EOZ B;  4DBQ A;  5JDH A;  3MAC A;  3OYX A;  3B57 A;  2N1G A;  4ILU A;  4AKL A;  2QA7 A;  2C5K T;  3KDS E;  4HE8 A;  2X66 A;  1MND A;  2X68 A;  5H6Q B;  3GMI A;  2KWH A;  1ZEE A;  4OHF A;  3C64 A;  5LGT B;  4IDZ A;  4EXT A;  5L3D B;  2X9Y A;  3B13 A;  4X1I E;  4E7Z A;  3MA9 A;  3HKB E;  2JRK A;  3C4Z A;  2IC6 A;  2K24 A;  1D1C A;  3NZP A;  4BJN A;  2HPJ A;  5CA1 E;  3LK3 B;  2LHN A;  2YU2 A;  3ZCJ A;  3CX7 B;  1HTJ F;  4KUM B;  1YW0 A;  3ZCI A;  3UUM A;  3ZJ2 A;  3CX8 B;  3RKO A;  1MMN A;  5JDN A;  2CEA A;  3N2G E;  3ZYL A;  2IAK A;  3PUQ A;  2CMR A;  3U78 A;  1HX8 A;  3RYI E;  4QHO A;  1HFA A;  2XAJ B;  3C50 A;  3IEE A;  4IE6 A;  2EHO B;  3EVY A;  4IE4 A;  2Q9Q D;  1HG5 A;  2V7I A;  2VKO A;  3HR0 A;  1X79 A;  3Q5W A;  3QC9 A;  4AQF C;  5JH7 E;  2Q9Q C;  4CZZ B;  4HTE A;  5EK3 A;  4YJ2 E;  3ZMV B;  1WRD A;  5JRC A;  5BMV E;  2WWU A;  2X0L B;  2YK0 A;  4N78 D;  3RH3 A;  2W0G A;  4PK6 A;  3VU7 H;  4I4T E;  5J2U E;  3MK7 C;  4NUU A;  1MMG A;  2NOX A;  4KP3 C;  3K3N A;  3I1A A;  2DLR A;  1NAF A;  3AAE B;  3OBV E;  3LK2 B;  4O4J E;  2A3D A;  3IF8 B;  3J9X 1;  5FP3 A;  3H3A A;  4L5G A;  4V1A v;  2NP9 A;  3RPU A;  3S4U A;  3L3P A;  4PJL A;  1LVF A;  4UXN B;  2E9X A;  4UIG A;  1D0X A;  3H37 A;  3UTK A;  1T98 A;  2EHO D;  1MIW A;  2QGS A;  3HI2 A;  3I9W A;  3NRX A;  2SPC A;  3BK9 A;  1D0Z A;  2DNX A;  3UT5 E;  2EHO C;  3E22 E;  2LE8 A;  1LKX A;  2Y48 B;  2WMO A;  3MJX A;  5LJN A;  3CPZ A;  5JDQ A;  2MYS A;  4TN7 B;  3VKG A;  1Z0P A;  3PE0 A;  4P09 A;  2V7K A;  5LXT E;  1IZN B;  4DVD A;  4EYU A;  3ZC0 A;  3LJC A;  4H9Q C;  3BQL A;  4H9R C;  1ZKE A;  5HXC A;  1OWA A;  3KV9 A;  2VB6 A;  2CLY B;  5L2L A;  3N9N A;  5HXS A;  3NRY A;  2KXP B;  2ZLY A;  3N9M A;  2L9Q A;  3BQI A;  2BVM A;  1VRB A;  2H7O A;  2WSS V;  2V7L A;  2IC9 A;  3ETV A;  2CWY A;  4KBM B;  4AKH A;  2UXX B;  3AA1 B;  2JMH A;  1MMD A;  2CXF A;  1HS7 A;  3A5X A;  3DTO A;  4KMC A;  4YJ3 E;  4ANJ A;  4Z8X A;  2LSY A;  3FHN A;  4X1K E;  2PFV A;  1MIV A;  3FB2 A;  4H63 H;  3LK4 2;  3P7I A;  4I55 E;  4A56 A;  4JLE A;  3UUX B;  2H7V C;  3ONX A;  3KIN B;  2VAS A;  2VKH A;  3GWH A;  3KV5 A;  4MFR A;  3AVS A;  1IAP A;  1BR4 A;  3RRC A;  1YD8 G;  2JPF A;  3JC6 D;  2WBL A;  2Y6X A;  2DWG A;  3KVB A;  3AB3 B;  3RYC E;  4UV8 B;  5JR9 A;  1S35 A;  5LP6 E;  1YKH B;  4TUY E;  4U72 A;  3ZLI A;  1LRZ A;  5JQG E;  3F2E A;  2D0T A;  2LOS A;  4WBO A;  5DJQ C;  3RRW A;  4JEU B;  2LOP A;  3ZMU B;  3SRZ A;  4DMW A;  2A72 A;  2BVL A;  3I0O A;  5JRC B;  3AVR A;  4X1Y E;  3EDU A;  4JUY A;  4PAG A;  4I43 B;  1WYC A;  1O3X A;  4PFP A;  3VKH A;  2X9X A;  3FXE B;  1VOM A;  4MBQ A;  3ZEF B;  4G63 A;  4UF0 A;  4E7S A;  3ZMT B;  3GA8 A;  2VWA A;  3HA4 A;  4QX8 B;  1WYB A;  1BR2 A;  1MMA A;  3C4X A;  2X9W A;  4XAX B;  5CB4 E;  3CQC B;  3E0Z A;  2MTQ A;  4UEL A;  2M67 A;  4AXP A;  2K5B B;  2E9X B;  3E08 A;  4ZI7 E;  3K3Q C;  1AJ3 A;  2LM9 A;  4UVC B;  3N9P A;  5FXZ A;  2MBG A;  2LT3 A;  3ZC1 A;  4HN9 A;  4EB6 E;  3OJA A;  2CWO A;  1IJ6 A;  3Q9D A;  5LCY A;  5H6R B;  5JDG A;  4ZS2 A;  1FMW A;  2XHE B;  5HYA A;  2LSI A;  3ETU A;  3LFM A;  3N5L A;  2VKD A;  3WAJ A;  4QXC B;  2KT9 A;  2KLQ A;  4IE5 A;  3D0T A;  4IE0 A;  3R6N A;  1S94 A;  5IHY A;  4ERR A;  5L3F B;  3SOL A;  3N9O A;  5L3G B;  2V7M A;  4K0U A;  4AKI A;  5LBM A;  4ASK A;  2RA1 A;  2CCQ A;  4YLH A;  2VK9 A;  4AKG A;  2KMF A;  1D1B A;  5FXX A;  4BJM A;  5GON E;  5CA0 E;  5HXE A;  4BA9 A;  1NWM X;  3U3I A;  2E9X D;  3N9Q A;  2XTL A;  4FI5 A;  3ZYK A;  5F3J A;  3CWZ B;  1OXZ A;  3KV6 A;  3FBL A;  2Q9Q A;  3M65 A;  4CXW A;  2CXD A;  2D5U A;  3MZK B;  4OK0 A;  2VL8 A;  3RC3 A;  2ZMA A;  4HEA A;  2NW9 A;  4NUV A;  2PJQ A;  2IW5 B;  3GN5 A;  5IYZ E;  5ETW A;  4BAY B;  5ADX L;  2D2S A;  4H9O C;  3HKC E;  4CXY A;  3DJB A;  3L09 A;  4WW0 A;  2ZM2 A;  4PJJ A;  5JR9 B;  5HWY A;  1SHZ C;  3AAI A;  3C4W A;  1ZHC A;  5FXW A;  1HCI A;  3KVA A;  4ZHQ E;  2K48 A;  3EUH A;  4QXH B;  1D0Y A;  3QUJ A;  5M4Y A;  1G73 A;  2UXN B;  3I9Y A;  3F31 A;  3RYF E;  3V5U A;  1UX4 A;  2V26 A;  4MAL A;  2DHR A;  2DWK A;  2BZB A;  5EK4 A;  2CXL A;  3ZJ1 A;  3R84 B;  3O9X A;  1EZ3 A;  3FXD B;  3N9L A;  4CI3 B;  3FBZ A;  3LG7 A;  3ZN1 B;  4WBN E;  4PJM A;  2C5I T;  4QKN A;  2I59 A;  1E1H B;  2LJL A;  2OA5 A;  4P0B A;  4UF0 B;  2NTY A;  4O8S A;  4O2A E;  5JDL A;  2HH7 A;  2YEV C;  1B7T A;  2C0S A;  4PFO A;  3O1H A;  3PDY A;  2C5J A;  3MXZ A;  2GK9 A;  2ZM8 A;  2CE7 A;  3UUL A;  4TV9 E;  4FJO A;  5FYM A;  4IST A;  4EZH A;  1WR6 A;  3OKQ A;  1U5P A;  3IBP A;  1FIO A;  2W63 A;  2J1D G;  5J2T E;  5FY1 A;  2LSK A;  4L0R A;  2XUE A;  5LGU B;  3ZMS B;  4B6X A;  2PG8 A;  5JDM A;  5KDM C;  3PUR A;  4H63 V;  2ODU A;  4GIW A;  2B1E A;  2YU1 A;  3JC6 C;  4ZOL E;  3ANW A;  2MOZ A;  2NW8 A;  3QK6 A;  4OYK A;  2X51 A;  3CVR A;  3NBX X;  4ZI2 D;  3CKD A;  4OYJ A;  3OYZ A;  4ZI2 C;  4U74 A;  3ZN0 B;  2CLY C;  4TV8 E;  4UEM A;  3HL6 A;  5L3C B;  2JMK A;  4WNK A;  3PUA A;  4F6R C;  1BR1 A;  4I50 E;  5FXV A;  4H9N C;  4X20 E;  4UVB B;  4PW8 A;  4H9P C;  4QX7 B;  3O4X E;  3UUN A;  4CI1 B;  3SWH A;  1SA0 E;  1CUN A;  3WI3 A;  5HXR A;  4OFZ A;  5KX5 E;  5HWX A;  3C51 A;  4IGU A;  3J7Y q;  3I0Q A;  5KMG P;  1QUU A;  1V9D A;  4PK5 A;  2Q9Q B;  3PU8 A;  1US7 B;  4GYS A;  4IIJ E;  4ZS3 A;  4GK0 E;  3LBX A;  3EDV A;  3AAA B;  3DP7 A;  1UX5 A;  4XBF B;  2ACX A;  4DMV A;  3GN5 B;  4TX5 A;  4AI6 A;  5FMN A;  5FY7 A;  4EIW A;  4G2A A;  3CQG B;  1ZV4 X;  5EZY E;  3ESL A;  3K8P C;  3VHL A;  5LGN B;  2LSJ A;  3AA7 B;  3Q2M A;  2W61 A;  4GYR A;  3F57 A;  4C91 A;  4GK5 E;  2Y8D A;  4ZI3 D;  4H9S E;  3SS1 A;  5LNK A;  1KNZ A;  2D0U A;  4EYY R;  4IHJ E;  4ZI3 C;  3N2K E;  4QXB B;  2CA5 A;  2DI4 A;  2G0U A;  2WAU A;  3N2O A;  5LG4 A;  4M1P A;  2PBI A;  1FEW A;  3P8C D;  3CML A;  5DQW A;  1HG2 A;  2JJ9 A;  2L3L A;  5LJM A;  1IJ5 A;  2E9X C;  5DQV A;  3T8O A;  3WAK A;  3NZQ A;  2WM9 A;  2ES0 A;  3PUS A;  4MHC A;  4AQF A;  1UCU A;  4PJN A;  2JQQ A;  5LHI B;  1BR0 A;  3W15 B;  4CXX A;  2KND A;  3V5S A;  2BDE A;  1H7C A;  1MNE A;  3O1J A;  4QWN B;  2L8K A;  4UV9 B;  2K9A A;  5L3E B;  4O4H E;  3BQK A;  4GOU A;  4HFV A;  4CQI A;  4O4I E;  4ISS A;  2LEH A;  2CM0 A;  4DBR A;  2LHR A;  3IHR A;  2N2N A;  4UVA B;  2V7J A;  3MKD A;  3PTR B;  4P0A A;  2H3R A;  3ANW B;  2N9D A;  2HPL A;  2WMN A;  2XAF B;  4C90 A;  1MIY A;  5LBQ B;  5LHH B;  2V1D B;  4O2B E;  2XQY A;  5A1L A;  2XAS B;  3TKL B;  1YKE B;  2RP4 A;  4TZ4 C;  3UFE A;  5HXH A;  3CQX C;  4XZC A;  5E0O A;  1D1A A;  4CI2 B;  1WLX A;  2DCF A;  1Y64 B;  2EHO A;  3PU3 A;  1U4Q A;  2P9B A;  5JVD E;  4DO0 A;  3KBT A;  2VKJ A;  2XAQ B;  3RYH E;  3HKE E;  2KWI B;  2KIN B;  4O4L E;  4HKA A;  4ADZ A;  4MLK A;  2ODV A;  2KZ7 B;  5JDF A;  5F8P A;  2XAH B;  3CX6 B;  3ZYM A;  2NTX A;  1HF8 A;  2W62 A;  5TAO A;  5DAB A;  4YFS A;  3LBX B;  3ZMZ B;  5FNV E;  3KBU A;  4YHJ A;  5JRE A;  5LA6 E;  3HKD E;  5AFU L;  5C8Y E;  5JR9 C;  3O1I A;  5EK2 A;  4AQG A;  4IE7 A;  4DND A;  2W00 A;  3KFW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...