4HEAA

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 33
structure length 117
sequence length 117
chains with identical sequence P
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4heaA00
4HE8A 3RKOA 4HEAA 5LNKA
chains in the Genus database with same CATH superfamily
3RC3A 3K3NA 5AQRB 2BS2A 5JRCA 2VL8A 1KNPA 1IBLT 2BKPA 1U4QA 2WCAA 4HFDA 5AQNB 1YW0A 2LSIA 1CHUA 4PK5A 4U2ZA 1VRBA 3SS1A 3PUAA 1B7TA 5DQVA 1KEYA 3PUVF 2JRKA 2WMNA 3UU4A 2RP4A 2WU2A 2EHOB 1EZ3A 3I1AA 1Y01A 3AEBA 2Q9QD 2H7VC 4A56A 1S94A 2UUCT 2H7OA 2LSYA 4QX8B 4X20E 4HWDA 5EK4A 5ABFA 3AXJB 3X1DA 3Q5EA 4OYKA 4UELA 3SWHA 2BZBA 2VQET 3N5LA 1D1CA 2CLYB 2NTXA 2YKSA 3A7MA 3O1HA 3J9X1 4QKNA 2E5LT 2K24A 4ZEYA 1XMOT 4OX9T 3I9WA 3R84B 2V5CA 5FVLA 2LOPA 3VRAA 2KT9A 4CXXA 1SUMB 3SOLA 4YSZA 3BQIA 1YD8G 2XTLA 4AQFC 5IYZE 2CM0A 4IDOA 5AQKB 4CZZB 4DV5T 5JDHA 3RIUC 1NEKA 2E9XA 4ILCA 1W9RA 3FXDB 3UFGA 2X9HA 4J2CA 5AQLB 4DR5T 2X67A 3QB5A 4O4HE 2IMLA 4OK0A 4UVCB 5JDFA 3ZN1B 4DR2T 3WAKA 4DV7T 3BK9A 1IBMT 4K0KT 1YKEB 3PE0A 4ZS2A 5FY1A 2OA5A 1W09A 1ZOYA 2OLTA 3MK7C 4P0BA 4V1Av 1NWMX 3EI0A 5HXEA 4YSYA 2EHOD 2J1DG 3QB5K 4WW0A 5DABA 2KWHA 3DJBA 4HWCA 2X68A 4QXCB 2GK9A 2WBLA 1WCRA 4H9QC 5AQQB 5ADXL 1HNXT 4DR6T 2XM2A 2VVSA 3EABA 3HKCE 2E2AA 5HEGA 2WU5A 3RYCE 4K0UA 3NVOA 1IAPA 2XHEB 1L0VA 3RRCA 5FP3A 2KZ7B 5GONE 1HX1B 4QXHB 4AQGA 4YTNA 3RYFE 3AVSA 1R8IA 1XNQT 2AXDS 3ONLC 2YDQA 2ZLYA 1J1JA 5HCJA 4YHJA 4A5XA 3V5SA 3AAEB 3C50A 3C51A 5HXHA 4IDPA 1HFAA 3AEDA 3E22E 4LF9T 3AA7B 3AE8A 3UUNA 4HFCA 5LGTB 1H7CA 3TLVA 1NENA 2XAQB 2KXPB 4O2AE 3LBXA 3KBTA 2D2SA 2PBIA 2KINB 5J1GA 2C5IT 3AEEA 3ZMTB 5FL1A 3AAAB 2LE8A 2LRKA 2H88A 2YOEA 5AQFB 4L0RA 3O1IA 4N78D 5FXVA 2X0HA 5L3GB 3FXEB 2KLQA 2W4XA 4JLEA 4ZI3D 4ILAA 4PK6A 4UV9B 2UXBT 4EIWA 2JMKA 1ZHCA 2B1EA 3PUSA 2LLYA 3QK6A 2IIUA 4BA9A 4DMWA 4DUZT 3FHNA 3FZKB 1YKHB 2DCFA 4IHJE 5LBQB 4HWFA 2IAKA 2BG9A 5L4EA 3ESLA 5L3FB 5AQHB 2L3LA 4GIWA 4KI0F 3RH3A 5FYMA 2CMRA 2CBJA 2D9DA 3OJAA 2SPCA 2H3RA 2UU9T 5H6QB 5JH7E 2K48A 3NKZA 2LT3A 2FJDA 4TN7B 3SFDA 2V5DA 3ZMVB 5M4YA 2KNDA 2LEHA 3ZSSA 4NPPA 4HKAA 2DI4A 5EK3A 3UU6A 3M3ZB 1FMVA 3QOFA 1MMAA 4IL9A 4X5TA 4F6RC 2ZMAA 4EEDA 4B3ST 1G73A 1M62A 2WZIA 1MIYA 3ETUA 3OBVE 2VKOA 2XSAA 3KVBA 1MIVA 5FKYA 5LCYA 1WLXA 2V7KA 3N9OA 3RC8A 4DV6T 2LKHA 3RX6A 3UQ7A 1ZKEA 2WDQA 3V5UA 2N9DA 4O8SA 4UXNB 3LK3B 5AQMB 3RIUA 4L9IA 2YU2A 2CEAA 2HPLA 3AE7A 2JQHA 4UF0A 3VHLA 2NW8A 1ZV4X 4U72A 4ZZCA 5L2LA 3E0ZA 4AKLA 2ZM8A 2YDSA 4ADZA 3C98B 4DV0T 3RGLA 3CQXC 2WAUA 4IGUA 3AE5A 3CX6B 4LFCT 2MTQA 2PG8A 4AQFA 4PJMA 3AAIA 5J0ZA 4KUMB 5AQPB 3RKGA 4EGWA 2E5VA 3AE9A 2LM9A 1Z0PA 2W63A 3OYXA 2LOSA 2E9XB 3IA3A 3Q5XA 5HXRA 5BMVE 2CHNA 3BQLA 1OEDA 3F57A 3CX7B 5IWAT 4BAYB 2V8SV 4E7SA 4IE6A 3LK42 3P4WA 4GYRA 4QHOA 4F8HA 2LSJA 3PUXF 4C90A 3P7IA 3AECA 4MHCA 4CI1B 2VL0A 3TKLB 2UXXB 2CWYA 1IJ6A 2OV9A 2WM9A 3W15B 4UV8B 1XDOA 1YQ4A 1ZP0A 1XDPA 3FB2A 2YEVC 1ZEEA 2CCQA 3KFWX 3QC9A 4DBQA 4DR1T 3ANWA 3AA1B 3O4XE 2V7LA 1SHZC 2CXFA 2DNXA 4HFBA 1QLBA 3QNUA 2LKGA 4XAXB 5HEOA 3RQUA 1KNZA 1BR2A 4I0UA 4U7IA 5AQTB 3GA8A 4Q25A 2Q9QC 2ODVA 2JQQA 2LJLA 2N2NA 4LMJA 5FMNA 2FJEA 2QVAA 3AVRA 1BR1A 3HA4A 3IHRA 4TUYE 3T1HT 4UVBB 2X0YA 2PTFA 2LRLA 2XAGB 3P4RA 4JI5T 3RIFA 3LBXB 5FY0A 2VVNA 4WBOA 2CPTA 4DBRA 2WQYA 1BR0A 5JTGA 3MA9A 3JC6D 2IC6A 5HAXA 5LOVE 5HYAA 1KNRA 4HEAA 1IZNB 3AE4A 2X0LB 4WBNE 3KVAA 5HEJA 1N34T 3DP7A 3ONJA 3RPUA 2XUEA 1E7PA 1JNRA 2FUPA 2KMFA 3AEFA 5LA6E 3VRBA 2V7JA 2QGSA 3ETVA 1BR4A 5FVKA 2E8IA 5LNKA 2RPAA 4FI5A 4UR9A 2Q9QB 3Q5WA 1MIWA 3RRWA 4YLHA 4JI8T 5KMGP 4PJLA 1W0AA 2C5JA 4A97A 2DWGA 2FJBA 4NIQA 4X64T 4GK0E 4YJ2E 1XZYA 3A5XA 1U5PA 1OEDC 3K3OA 2I59A 3N9PA 1SE7A 1MMNA 4HFVA 4MBQA 3TLUA 5J2UE 3Q9DA 2C0SA 4HWHA 3TLSA 1T7SA 4BJNA 3Q5DA 4YT0A 4WYVA 2V1DB 2YK0A 1S35A 5C3JA 2NW7A 5HCMA 4GKKT 4HFIA 2XQAA 2UXNB 4H9PC 2XQ7A 1D0ZA 1MMGA 3D0TA 5L3CB 3LG7A 2K3WA 2KWIB 4U33A 3NZQA 4ASKA 2X9YA 3EDVA 3F2EA 2WP9A 2VKHA 2E9XC 3OVUA 4IE7A 4LMKA 4I43B 3DTOA 1HCIA 3FZFB 3UU3A 3ZLIA 4EEBA 3N2KE 4U2YA 5C8YE 2HN2A 3GN5A 4EZ4A 4HWIB 5LMUT 3H3AA 3ZYLA 3ZEFB 3NBXX 4QH5A 3BQKA 2VWAA 2Z6EA 3HKEE 4LF8T 3NZPA 1HF8A 2WSSV 5JR9A 5L47A 3CWZB 2QYWA 1I94T 3EUHA 4QX7B 4TV9E 3ZT6A 3ZC1A 2FJAA 5AQVB 3CQCB 1HG5A 2IHR1 3HL6A 3PU8A 4L5GA 4TV8E 2X9XA 1WR0A 3I9YA 3E08A 3UU5A 1Z8UA 2ZM6T 3RQWA 2D0TA 3Q2MA 2XQ6A 5HXCA 2XQ3A 5ABGA 3K3QC 4IIJE 1UGOA 4JYAT 4HN9A 5AQOB 2J62A 3VR9A 4UVAB 4AKGA 2BBJA 2Y48B 3AEGA 4UIGA 3G06A 3N2OA 3O1JA 4JUYA 3L39A 2IW5B 4MFRA 3RI5A 3ZKRA 4AKRB 4AQYT 1HTJF 2XQYA 3SFEA 3MJXA 4U3CA 4PW8A 3RHWA 4IE4A 2IUBA 1UX5A 3ABVA 3PU3A 4LMLA 3VR8A 3ZCJA 5LP6E 1QSDA 1UCUA 2BVLA 2H89A 2WDVA 1HX8A 1WYBA 5HWYA 2IDOB 2NTYA 4C91A 4M1PA 3ZJ1A 1E2AA 4CN1A 4YHHT 5F3JA 2NP9A 4PK4A 4AISA 5LGNB 2W2UA 3RKOA 4GOUA 5HEUA 1X79A 4DMVA 5KX5E 4LF7T 1QUUA 1AJ3A 3L09A 2YINA 3TLWA 4X62T 2DL1A 2MYSA 5AQIB 5LB7B 4H63H 3HI2A 4JI0T 2D5UA 5CA1E 5JDNA 3OTOT 3UULA 4QH1A 1DU2A 2V26A 5A1LA 4TZ4C 3UUXB 5C2TA 3C4ZA 2XAHB 4IDQA 2CA5A 4UEMA 1WYCA 2NW9A 4CI2B 3ZT7A 4KBMB 2J47A 2Y6XA 5IHYA 3FBZA 4ANJA 2BG9C 2MOZA 4IREA 1O3XA 5AQSB 3UFEA 2KSRA 5IUXA 4IE0A 3KINB 4TNWA 2K5BB 2VKDA 5CA0E 4JI1T 2WMOA 3ZCIA 4DV3T 3M65A 4CXWA 1N36T 3RIAA 3ANWB 2UUAT 5CFBA 3PUZF 1M7KA 3A8YC 3CPZA 4IE5A 4X1YE 4DO0A 5EK2A 3FZHB 3LSVA 5F5WA 3PV0F 4HFHA 3MZKB 1NAFA 3LK2B 4ILBA 2WB5A 4TWFA 3VKHA 1FMWA 4CN6A 1JNZA 4JI3T 4LFAT 1LVFA 1YQ3A 2WWVA 4TX5A 3ZN0B 5FXWA 1HNWT 5LJMA 3T1YT 4PFPA 4UF0B 4X1KE 3ZMSB 4NXMT 4AI6A 1LVKA 1MNDA 1T72A 2BKNA 2JPFA 2W0GA 3UQ4A 4JI7T 3CX8B 2DLRA 5CB4E 2VURA 1N32T 3HKDE 5AFUL 5LHHB 2EHOA 1J5WA 4HE8A 4HFEA 4QXBB 4YFSA 4ZZBA 4ZI7E 1XNRT 3AE3A 3KV5A 1HS7A 2W61A 4O4JE 5LBMA 3R6NA 3N9MA 1GQEA 2P9BA 2W62A 3O9XA 4EOZB 5L4HA 4LF5T 4XBFB 5AQUB 2XSBA 1UK5A 2M67A 4ISTA 2W66A 2NR4A 5E0OA 2HN1A 5FXXA 4YSXA 3QUJA 3GMIA 3IBPA 2XAFB 3EVYA 2CE7A 2UUBT 2PFVA 2W67A 1OEDB 2V6YB 2B76A 2BG9E 4EXTA 5JDGA 1WRDA 4CXYA 5LG4A 4KHZF 3B57A 5JVDE 2XQ4A 2ACZA 1UURA 5FY7A 3HR0A 1D0XA 4TWHA 4TWDA 1XWMA 3UTKA 2EHOC 1FEWA 4BJMA 5L3DB 2PJQA 5JR9B 2R6GF 3VKGA 1E1HB 2CHOA 2V7IA 3LFMA 1HNZT 4KHPT 3EAMA 5ABHA 3RF1A 2FBWA 3CIRA 4GYSA 3RLFF 3ZYKA 4EZHA 4G2AA 5KXJA 4IL4A 2J4GA 4ISSA 2VB6A 2QRXA 4CN4A 3P50A 1SA0E 4HGAA 5DJQC 3ZSTA 3AXJA 4GK5E 4EAHA 5LXTE 4DUYT 4JI4T 2WDRA 2D0UA 2ODUA 3SRZA 1I6ZA 2W00A 4DR7T 1D1BA 5LYJE 3IEEA 2V6XA 2X51A 2XZEA 2XQ9A 1LKXA 3PUWF 4U74A 4OHFA 3C64A 3KDSE 4B3MT 3P4PA 5ETWA 2MBGA 2M6IA 5FNVE 4ILUA 5FXZA 2CXLA 3CK6A 4H9OC 3OKQA 3NRXA 1IBKT 4WZXA 4XZCA 4ZI3C 2MAWA 2M6BA 4ERRA 3FZMB 2BS4A 4IDNA 4PNIA 4Z8XA 4PFOA 3AA6B 3GWHA 3H37A 4O2BE 3PTRB 5JDLA 3MACA 2JIWA 1VCSA 1VCTA 3MXZA 4PAGA 4YXDA 5L3EB 2WWUA 1FJGT 1X9BA 2YDRA 2A3DA 3AEAA 3AE2A 3P8CD 4GKJT 4YJ3E 1OEDE 2BG9B 3NWIA 2VQFT 3KV9A 2A2FX 2ZM2A 4P1NA 4JI2T 1FIOA 4JV5T 4AKIA 1HR0T 3CQGB 1MMDA 3AE1A 2BS3A 5JR9C 3PUYF 2JQKA 4JBWF 3NRYA 2ZM0A 2G0UA 2YN6A 1D0YA 4A98A 5JRCB 2DWKA 2CRBA 2XQ5A 3EDUA 3PUGA 4MLKA 4NUUA 2CLYC 4JEUB 4YTMA 2K9AA 4Z91A 4B6XA 5JDQA 3WI3A 1N33T 4O4IE 3PJAJ 3N9LA 5F8PA 3KV4A 3L8RA 3LDQB 4DR4T 2BBHA 3CKDA 4E7ZA 4EB6E 3H3MA 4HTEA 2V7MA 1UUSA 3FZLB 2VKJA 3JAEA 3LJCA 2HPJA 4Z90A 3J7Yq 3AE6A 3ZYMA 4X1IE 3PJAA 5LMNT 3KV6A 3OYZA 4PJNA 3F31A 4NXNT 3K1SA 1HG2A 1G8XA 2XM1A 3AA0B 4FJOA 4PJJA 1T8BA 3VU7H 4CQIA 1IJ5A 3GN5B 3JC6C 4G63A 2QA7A 4ZOLE 4DR3T 4EV6A 2HHHT 5FL0A 2XASB 3ZJ2A 2CWOA 4H9SE 5EZYE 4ZI2C 2XY8B 3UUMA 2JJ9A 3IF8B 3U3IA 5CGMA 3WAJA 1YXRA 2F4VT 3ZC0A 2C5KT 2NWBA 3CMLA 3FBLA 5CJ5A 2I0MA 2CBIA 3ZT5A 3HKBE 5LJNA 4JEHB 1US7B 2ES0A 3I0QA 4KP3C 4CI3B 5JDMA 3T8OA 3N2GE 3B5MA 2BKOA 2XJ7A 2YU1A 4OFZA 4QWNB 3TLTA 2VASA 1T98A 4O4LE 3JAFA 3S4UA 3U78A 5TAOA 4B3RT 3ZPOA 4DIDB 2A9UA 2MPKA 3ONXA 4DV1T 2CXDA 2V6YA 4KX6A 2E9XD 4U7YA 2XQ8A 2AE9A 1MNEA 2I6HA 4NUVA 4IT4A 4EYUA 4DV4T 4QH4A 3ZMZB 4H63V 4LF6T 4ZXLA 1CUNA 1OWAA 1WR6A 2UXCT 2BVMA 4H9NC 4LF4T 5ABFB 2LSGA 3UUBA 1OXZA 4EYYR 2L8KA 3RYIE 2JQ9A 4ZI2D 5L3BB 1WFDA 5J2TE 2UXDT 4I50E 4DNDA 2BDEA 4KMCA 4P0AA 2IC9A 3C4WA 5LHGB 2NOXA 5BR8T 1KF6A 2WZHA 4IDZA 2A72A 3CVRA 4DVDA 4AKHA 3C4XA 2WS3A 2Q9QA 3L3PA 3EHZA 3I0OA 3B13A 3OPCA 3K8PC 3PURA 5ABEA 5LGUB 2LSKA 4X65T 5HWXA 4MALA 5AQJB 4DV2T 3MKDA 3ZMUB 1XMQT 4B3TT 2HH7A 1W0BA 3PDYA 2Y8DA 4YTPA 4YY3T 2DHRA 4ZHQE 4H9RC 4I55E 5H6RB 4LFBT 3N9NA 1LRZA 5LHIB 2L9QA 5AQGB 4WNKA 3P4QA 4I4TE 1Y64B 3JADA 1KFYA 2XPKA 3UT5E 3UU8A 4TNVA 3P4SA 4P09A 2X9WA 1KK7A 3PUQA 5HEHA 4U31A 5JREA 1J5ET 5KDMC 3N9QA 4AIUA 4JI6T 2RA1A 1UX4A 5HXSA 1VOMA 3RYHE 3JCFA 2X66A 2LHNA 2XAJB 2ACXA 5DQWA 2JMHA 1V9DA 1D1AA 4ZS3A 2N1GA 2WY2A 4COFA 3AB3B 5LG3A 4OYJA 5JQGE 4AXPA 2VK9A 2LHRA 4X66T 3KBUA 2LM2A
chains in the Genus database with same CATH topology
3RC3A 3K3NA 5JRCA 2VL8A 1U4QA 1YW0A 2LSIA 4PK5A 1VRBA 3SS1A 3PUAA 1B7TA 5DQVA 2JRKA 2WMNA 2RP4A 2EHOB 1EZ3A 3I1AA 4A56A 2Q9QD 2H7VC 1S94A 2H7OA 2LSYA 4QX8B 4X20E 5EK4A 4OYKA 4UELA 3SWHA 2BZBA 3N5LA 1D1CA 2CLYB 2NTXA 3O1HA 3J9X1 4QKNA 2K24A 3I9WA 3R84B 2LOPA 4CXXA 2KT9A 3SOLA 3BQIA 1YD8G 2XTLA 4AQFC 5IYZE 2CM0A 4CZZB 5JDHA 2E9XA 3FXDB 2X9HA 4J2CA 2X67A 4O4HE 4OK0A 4UVCB 5JDFA 3ZN1B 3WAKA 3BK9A 1YKEB 3PE0A 4ZS2A 5FY1A 2OA5A 3MK7C 4P0BA 4V1Av 1NWMX 5HXEA 2EHOD 2J1DG 5DABA 4WW0A 3DJBA 2KWHA 2X68A 4QXCB 2GK9A 2WBLA 5ADXL 4H9QC 3HKCE 3RYCE 4K0UA 1IAPA 2XHEB 3RRCA 4AQGA 5FP3A 2KZ7B 5GONE 4QXHB 3RYFE 3AVSA 2ZLYA 4YHJA 3V5SA 3AAEB 3C50A 3C51A 5HXHA 1HFAA 3E22E 3AA7B 3UUNA 5LGTB 1H7CA 2XAQB 2KXPB 4O2AE 3LBXA 3KBTA 2D2SA 2PBIA 2KINB 5J1GA 2C5IT 3ZMTB 3AAAB 2LE8A 4L0RA 3O1IA 4N78D 5FXVA 5L3GB 3FXEB 2KLQA 4JLEA 4ZI3D 4PK6A 4UV9B 4EIWA 2JMKA 1ZHCA 2B1EA 3PUSA 4BA9A 3QK6A 4DMWA 3FHNA 5LBQB 1YKHB 2DCFA 4IHJE 5L3FB 2IAKA 3ESLA 2L3LA 4GIWA 3RH3A 5FYMA 2CMRA 3OJAA 2SPCA 2H3RA 5H6QB 5JH7E 2K48A 4TN7B 2LT3A 5M4YA 3ZMVB 2KNDA 2LEHA 4HKAA 2DI4A 5EK3A 4F6RC 5CA0E 1FMVA 1MMAA 2ZMAA 1G73A 3ETUA 1MIYA 3OBVE 2VKOA 3KVBA 1MIVA 5LCYA 1WLXA 2V7KA 3N9OA 3RX6A 1ZKEA 3V5UA 2N9DA 4O8SA 4UXNB 3LK3B 4L9IA 2YU2A 2CEAA 2HPLA 4UF0A 3VHLA 2NW8A 1ZV4X 4U72A 5L2LA 3E0ZA 4AKLA 2ZM8A 4ADZA 3C98B 3CQXC 2WAUA 4IGUA 3CX6B 2MTQA 2PG8A 4AQFA 4PJMA 3AAIA 4KUMB 3OYXA 2LM9A 1Z0PA 2W63A 2LOSA 2E9XB 5HXRA 3Q5XA 5BMVE 3BQLA 3F57A 3CX7B 4BAYB 4E7SA 4IE6A 3LK42 4GYRA 4QHOA 2LSJA 4C90A 3P7IA 4MHCA 4CI1B 3TKLB 2UXXB 2CWYA 1IJ6A 3W15B 2WM9A 4UV8B 3FB2A 2YEVC 1ZEEA 2CCQA 3KFWX 3QC9A 4DBQA 3ANWA 3AA1B 3O4XE 2V7LA 1SHZC 2CXFA 2DNXA 4XAXB 1KNZA 1BR2A 3GA8A 2Q9QC 2ODVA 2JQQA 2LJLA 2N2NA 5FMNA 3AVRA 3IHRA 1BR1A 3HA4A 4TUYE 4UVBB 2XAGB 3LBXB 5FY0A 4WBOA 4DBRA 1BR0A 3MA9A 3JC6D 2IC6A 5HAXA 5LOVE 5HYAA 4HEAA 1IZNB 2X0LB 3KVAA 3DP7A 3RPUA 2XUEA 2KMFA 5LA6E 2V7JA 2QGSA 3ETVA 1BR4A 2E8IA 5LNKA 4FI5A 2Q9QB 3Q5WA 1MIWA 3RRWA 4YLHA 5KMGP 4PJLA 2C5JA 2DWGA 4GK0E 4YJ2E 3A5XA 3K3OA 1U5PA 4P0AA 2I59A 3N9PA 1MMNA 5J2UE 4HFVA 4MBQA 3Q9DA 2C0SA 4BJNA 2V1DB 2YK0A 1S35A 2NW7A 2UXNB 4H9PC 3D0TA 1D0ZA 1MMGA 5L3CB 3LG7A 2KWIB 3NZQA 4ASKA 2X9YA 3EDVA 3F2EA 2VKHA 2E9XC 4IE7A 4I43B 3ZLIA 3DTOA 1HCIA 3N2KE 5C8YE 3GN5A 4EZ4A 3H3AA 3ZYLA 3ZEFB 3NBXX 3BQKA 2VWAA 2Z6EA 3HKEE 3NZPA 1HF8A 2WSSV 5JR9A 3CWZB 3EUHA 4QX7B 4TV9E 3ZC1A 3CQCB 1HG5A 3HL6A 3PU8A 4L5GA 4TV8E 2X9XA 3I9YA 3E08A 2D0TA 3Q2MA 5HXCA 3K3QC 4IIJE 4HN9A 4UVAB 4AKGA 2Y48B 4UIGA 4JUYA 3N2OA 3O1JA 3RC8A 2IW5B 4MFRA 4AKRB 1HTJF 2XQYA 3MJXA 4PW8A 4IE4A 3PU3A 1UX5A 5LP6E 3ZCJA 1QSDA 1UCUA 2BVLA 1HX8A 1WYBA 5HWYA 2NTYA 4C91A 4M1PA 3ZJ1A 5F3JA 2NP9A 4PK4A 5LGNB 3RKOA 4GOUA 4DMVA 1X79A 5KX5E 1QUUA 1AJ3A 3L09A 2YINA 2MYSA 4H63H 3HI2A 2D5UA 5CA1E 5JDNA 3UULA 2V26A 5A1LA 4TZ4C 3UUXB 3C4ZA 2XAHB 4CI2B 2CA5A 4UEMA 1WYCA 2NW9A 4KBMB 2Y6XA 5IHYA 4ANJA 3FBZA 2MOZA 1O3XA 3UFEA 4IE0A 3KINB 2K5BB 2VKDA 2WMOA 3ZCIA 3M65A 4CXWA 3ANWB 3CPZA 4IE5A 4X1YE 4DO0A 5EK2A 3MZKB 1NAFA 3LK2B 3VKHA 1FMWA 1LVFA 3ZN0B 4TX5A 5FXWA 5LJMA 4PFPA 4UF0B 4X1KE 3ZMSB 4AI6A 1LVKA 1MNDA 2JPFA 2W0GA 3CX8B 2DLRA 5CB4E 3HKDE 5LHHB 2EHOA 4HE8A 4QXBB 4YFSA 4ZI7E 3KV5A 1HS7A 2W61A 4O4JE 5LBMA 3R6NA 3N9MA 2P9BA 2W62A 3O9XA 4EOZB 4XBFB 2M67A 4ISTA 5E0OA 5FXXA 3QUJA 3GMIA 3IBPA 2XAFB 3EVYA 2CE7A 2PFVA 4EXTA 5JDGA 1WRDA 4CXYA 5LG4A 3B57A 5JVDE 5FY7A 3UTKA 3HR0A 1D0XA 4BJMA 2EHOC 1FEWA 5L3DB 2PJQA 5JR9B 3VKGA 1E1HB 2V7IA 3LFMA 4GYSA 4EZHA 3ZYKA 4G2AA 4ISSA 2VB6A 4HGAA 1SA0E 4EAHA 5DJQC 4GK5E 5LXTE 2D0UA 2ODUA 3SRZA 2W00A 1D1BA 5LYJE 3IEEA 2X51A 1LKXA 4U74A 4OHFA 3C64A 3KDSE 5ETWA 2MBGA 5FNVE 4ILUA 5FXZA 2CXLA 4H9OC 3OKQA 3NRXA 4ERRA 4XZCA 4ZI3C 4PNIA 4Z8XA 4PFOA 3AA6B 3GWHA 3H37A 4O2BE 3PTRB 5JDLA 3MACA 5L3EB 3MXZA 4PAGA 2WWUA 2A3DA 3P8CD 4YJ3E 3KV9A 2A2FX 2ZM2A 1FIOA 4AKIA 3CQGB 1MMDA 5JR9C 3NRYA 2ZM0A 2G0UA 5JRCB 1D0YA 2DWKA 3EDUA 3PUGA 4MLKA 4WBNE 4NUUA 2CLYC 4JEUB 2K9AA 4B6XA 5JDQA 3WI3A 4O4IE 3N9LA 5F8PA 3KV4A 3CKDA 4E7ZA 4EB6E 4HTEA 2V7MA 3LJCA 2VKJA 2HPJA 3J7Yq 3ZYMA 4X1IE 3KV6A 3OYZA 4PJNA 3F31A 1HG2A 1G8XA 4FJOA 3AA0B 4PJJA 3VU7H 4CQIA 1IJ5A 3GN5B 3JC6C 4G63A 2QA7A 4ZOLE 2XASB 3ZJ2A 2CWOA 4H9SE 5EZYE 4ZI2C 3UUMA 3WAJA 2JJ9A 3IF8B 3U3IA 3ZC0A 2C5KT 2NWBA 3CMLA 3FBLA 3HKBE 5LJNA 4JEHB 1US7B 2ES0A 3I0QA 4KP3C 4CI3B 5JDMA 3T8OA 3N2GE 2YU1A 4OFZA 4QWNB 2VASA 1T98A 4O4LE 3S4UA 3U78A 5TAOA 3ZPOA 3ONXA 2CXDA 2E9XD 4EYUA 1MNEA 4NUVA 3ZMZB 4H63V 1CUNA 1OWAA 1WR6A 2BVMA 4H9NC 2LSGA 5L3BB 1OXZA 4EYYR 2L8KA 3RYIE 4ZI2D 5J2TE 4I50E 4DNDA 2BDEA 4KMCA 2IC9A 3C4WA 5LHGB 2NOXA 4IDZA 2A72A 3CVRA 4DVDA 4AKHA 3C4XA 2Q9QA 3L3PA 3PURA 3I0OA 3B13A 5LGUB 3K8PC 2LSKA 5HWXA 4MALA 3MKDA 3ZMUB 2HH7A 3PDYA 2Y8DA 2DHRA 4ZHQE 4H9RC 4I55E 5H6RB 3N9NA 1LRZA 5LHIB 2L9QA 4WNKA 4I4TE 1Y64B 3UT5E 4P09A 2X9WA 1KK7A 3PUQA 5JREA 5KDMC 3N9QA 2RA1A 1UX4A 5HXSA 1VOMA 3RYHE 2X66A 2LHNA 2XAJB 2ACXA 5DQWA 2JMHA 1V9DA 1D1AA 4ZS3A 2N1GA 3AB3B 4OYJA 5JQGE 4AXPA 2VK9A 2LHRA 3KBUA 5AFUL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE8 A;  3RKO A;  4HEA A;  5LNK A; 
#chains in the Genus database with same CATH topology
 3RC3 A;  3K3N A;  5AQR B;  2BS2 A;  5JRC A;  2VL8 A;  1KNP A;  1IBL T;  2BKP A;  1U4Q A;  2WCA A;  4HFD A;  5AQN B;  1YW0 A;  2LSI A;  1CHU A;  4PK5 A;  4U2Z A;  1VRB A;  3SS1 A;  3PUA A;  1B7T A;  5DQV A;  1KEY A;  3PUV F;  2JRK A;  2WMN A;  3UU4 A;  2RP4 A;  2WU2 A;  2EHO B;  1EZ3 A;  3I1A A;  1Y01 A;  3AEB A;  2Q9Q D;  2H7V C;  4A56 A;  1S94 A;  2UUC T;  2H7O A;  2LSY A;  4QX8 B;  4X20 E;  4HWD A;  5EK4 A;  5ABF A;  3AXJ B;  3X1D A;  3Q5E A;  4OYK A;  4UEL A;  3SWH A;  2BZB A;  2VQE T;  3N5L A;  1D1C A;  2CLY B;  2NTX A;  2YKS A;  3A7M A;  3O1H A;  3J9X 1;  4QKN A;  2E5L T;  2K24 A;  4ZEY A;  1XMO T;  4OX9 T;  3I9W A;  3R84 B;  2V5C A;  5FVL A;  2LOP A;  3VRA A;  2KT9 A;  4CXX A;  1SUM B;  3SOL A;  4YSZ A;  3BQI A;  1YD8 G;  2XTL A;  4AQF C;  5IYZ E;  2CM0 A;  4IDO A;  5AQK B;  4CZZ B;  4DV5 T;  5JDH A;  3RIU C;  1NEK A;  2E9X A;  4ILC A;  1W9R A;  3FXD B;  3UFG A;  2X9H A;  4J2C A;  5AQL B;  4DR5 T;  2X67 A;  3QB5 A;  4O4H E;  2IML A;  4OK0 A;  4UVC B;  5JDF A;  3ZN1 B;  4DR2 T;  3WAK A;  4DV7 T;  3BK9 A;  1IBM T;  4K0K T;  1YKE B;  3PE0 A;  4ZS2 A;  5FY1 A;  2OA5 A;  1W09 A;  1ZOY A;  2OLT A;  3MK7 C;  4P0B A;  4V1A v;  1NWM X;  3EI0 A;  5HXE A;  4YSY A;  2EHO D;  2J1D G;  3QB5 K;  4WW0 A;  5DAB A;  2KWH A;  3DJB A;  4HWC A;  2X68 A;  4QXC B;  2GK9 A;  2WBL A;  1WCR A;  4H9Q C;  5AQQ B;  5ADX L;  1HNX T;  4DR6 T;  2XM2 A;  2VVS A;  3EAB A;  3HKC E;  2E2A A;  5HEG A;  2WU5 A;  3RYC E;  4K0U A;  3NVO A;  1IAP A;  2XHE B;  1L0V A;  3RRC A;  5FP3 A;  2KZ7 B;  5GON E;  1HX1 B;  4QXH B;  4AQG A;  4YTN A;  3RYF E;  3AVS A;  1R8I A;  1XNQ T;  2AXD S;  3ONL C;  2YDQ A;  2ZLY A;  1J1J A;  5HCJ A;  4YHJ A;  4A5X A;  3V5S A;  3AAE B;  3C50 A;  3C51 A;  5HXH A;  4IDP A;  1HFA A;  3AED A;  3E22 E;  4LF9 T;  3AA7 B;  3AE8 A;  3UUN A;  4HFC A;  5LGT B;  1H7C A;  3TLV A;  1NEN A;  2XAQ B;  2KXP B;  4O2A E;  3LBX A;  3KBT A;  2D2S A;  2PBI A;  2KIN B;  5J1G A;  2C5I T;  3AEE A;  3ZMT B;  5FL1 A;  3AAA B;  2LE8 A;  2LRK A;  2H88 A;  2YOE A;  5AQF B;  4L0R A;  3O1I A;  4N78 D;  5FXV A;  2X0H A;  5L3G B;  3FXE B;  2KLQ A;  2W4X A;  4JLE A;  4ZI3 D;  4ILA A;  4PK6 A;  4UV9 B;  2UXB T;  4EIW A;  2JMK A;  1ZHC A;  2B1E A;  3PUS A;  2LLY A;  3QK6 A;  2IIU A;  4BA9 A;  4DMW A;  4DUZ T;  3FHN A;  3FZK B;  1YKH B;  2DCF A;  4IHJ E;  5LBQ B;  4HWF A;  2IAK A;  2BG9 A;  5L4E A;  3ESL A;  5L3F B;  5AQH B;  2L3L A;  4GIW A;  4KI0 F;  3RH3 A;  5FYM A;  2CMR A;  2CBJ A;  2D9D A;  3OJA A;  2SPC A;  2H3R A;  2UU9 T;  5H6Q B;  5JH7 E;  2K48 A;  3NKZ A;  2LT3 A;  2FJD A;  4TN7 B;  3SFD A;  2V5D A;  3ZMV B;  5M4Y A;  2KND A;  2LEH A;  3ZSS A;  4NPP A;  4HKA A;  2DI4 A;  5EK3 A;  3UU6 A;  3M3Z B;  1FMV A;  3QOF A;  1MMA A;  4IL9 A;  4X5T A;  4F6R C;  2ZMA A;  4EED A;  4B3S T;  1G73 A;  1M62 A;  2WZI A;  1MIY A;  3ETU A;  3OBV E;  2VKO A;  2XSA A;  3KVB A;  1MIV A;  5FKY A;  5LCY A;  1WLX A;  2V7K A;  3N9O A;  3RC8 A;  4DV6 T;  2LKH A;  3RX6 A;  3UQ7 A;  1ZKE A;  2WDQ A;  3V5U A;  2N9D A;  4O8S A;  4UXN B;  3LK3 B;  5AQM B;  3RIU A;  4L9I A;  2YU2 A;  2CEA A;  2HPL A;  3AE7 A;  2JQH A;  4UF0 A;  3VHL A;  2NW8 A;  1ZV4 X;  4U72 A;  4ZZC A;  5L2L A;  3E0Z A;  4AKL A;  2ZM8 A;  2YDS A;  4ADZ A;  3C98 B;  4DV0 T;  3RGL A;  3CQX C;  2WAU A;  4IGU A;  3AE5 A;  3CX6 B;  4LFC T;  2MTQ A;  2PG8 A;  4AQF A;  4PJM A;  3AAI A;  5J0Z A;  4KUM B;  5AQP B;  3RKG A;  4EGW A;  2E5V A;  3AE9 A;  2LM9 A;  1Z0P A;  2W63 A;  3OYX A;  2LOS A;  2E9X B;  3IA3 A;  3Q5X A;  5HXR A;  5BMV E;  2CHN A;  3BQL A;  1OED A;  3F57 A;  3CX7 B;  5IWA T;  4BAY B;  2V8S V;  4E7S A;  4IE6 A;  3LK4 2;  3P4W A;  4GYR A;  4QHO A;  4F8H A;  2LSJ A;  3PUX F;  4C90 A;  3P7I A;  3AEC A;  4MHC A;  4CI1 B;  2VL0 A;  3TKL B;  2UXX B;  2CWY A;  1IJ6 A;  2OV9 A;  2WM9 A;  3W15 B;  4UV8 B;  1XDO A;  1YQ4 A;  1ZP0 A;  1XDP A;  3FB2 A;  2YEV C;  1ZEE A;  2CCQ A;  3KFW X;  3QC9 A;  4DBQ A;  4DR1 T;  3ANW A;  3AA1 B;  3O4X E;  2V7L A;  1SHZ C;  2CXF A;  2DNX A;  4HFB A;  1QLB A;  3QNU A;  2LKG A;  4XAX B;  5HEO A;  3RQU A;  1KNZ A;  1BR2 A;  4I0U A;  4U7I A;  5AQT B;  3GA8 A;  4Q25 A;  2Q9Q C;  2ODV A;  2JQQ A;  2LJL A;  2N2N A;  4LMJ A;  5FMN A;  2FJE A;  2QVA A;  3AVR A;  1BR1 A;  3HA4 A;  3IHR A;  4TUY E;  3T1H T;  4UVB B;  2X0Y A;  2PTF A;  2LRL A;  2XAG B;  3P4R A;  4JI5 T;  3RIF A;  3LBX B;  5FY0 A;  2VVN A;  4WBO A;  2CPT A;  4DBR A;  2WQY A;  1BR0 A;  5JTG A;  3MA9 A;  3JC6 D;  2IC6 A;  5HAX A;  5LOV E;  5HYA A;  1KNR A;  4HEA A;  1IZN B;  3AE4 A;  2X0L B;  4WBN E;  3KVA A;  5HEJ A;  1N34 T;  3DP7 A;  3ONJ A;  3RPU A;  2XUE A;  1E7P A;  1JNR A;  2FUP A;  2KMF A;  3AEF A;  5LA6 E;  3VRB A;  2V7J A;  2QGS A;  3ETV A;  1BR4 A;  5FVK A;  2E8I A;  5LNK A;  2RPA A;  4FI5 A;  4UR9 A;  2Q9Q B;  3Q5W A;  1MIW A;  3RRW A;  4YLH A;  4JI8 T;  5KMG P;  4PJL A;  1W0A A;  2C5J A;  4A97 A;  2DWG A;  2FJB A;  4NIQ A;  4X64 T;  4GK0 E;  4YJ2 E;  1XZY A;  3A5X A;  1U5P A;  1OED C;  3K3O A;  2I59 A;  3N9P A;  1SE7 A;  1MMN A;  4HFV A;  4MBQ A;  3TLU A;  5J2U E;  3Q9D A;  2C0S A;  4HWH A;  3TLS A;  1T7S A;  4BJN A;  3Q5D A;  4YT0 A;  4WYV A;  2V1D B;  2YK0 A;  1S35 A;  5C3J A;  2NW7 A;  5HCM A;  4GKK T;  4HFI A;  2XQA A;  2UXN B;  4H9P C;  2XQ7 A;  1D0Z A;  1MMG A;  3D0T A;  5L3C B;  3LG7 A;  2K3W A;  2KWI B;  4U33 A;  3NZQ A;  4ASK A;  2X9Y A;  3EDV A;  3F2E A;  2WP9 A;  2VKH A;  2E9X C;  3OVU A;  4IE7 A;  4LMK A;  4I43 B;  3DTO A;  1HCI A;  3FZF B;  3UU3 A;  3ZLI A;  4EEB A;  3N2K E;  4U2Y A;  5C8Y E;  2HN2 A;  3GN5 A;  4EZ4 A;  4HWI B;  5LMU T;  3H3A A;  3ZYL A;  3ZEF B;  3NBX X;  4QH5 A;  3BQK A;  2VWA A;  2Z6E A;  3HKE E;  4LF8 T;  3NZP A;  1HF8 A;  2WSS V;  5JR9 A;  5L47 A;  3CWZ B;  2QYW A;  1I94 T;  3EUH A;  4QX7 B;  4TV9 E;  3ZT6 A;  3ZC1 A;  2FJA A;  5AQV B;  3CQC B;  1HG5 A;  2IHR 1;  3HL6 A;  3PU8 A;  4L5G A;  4TV8 E;  2X9X A;  1WR0 A;  3I9Y A;  3E08 A;  3UU5 A;  1Z8U A;  2ZM6 T;  3RQW A;  2D0T A;  3Q2M A;  2XQ6 A;  5HXC A;  2XQ3 A;  5ABG A;  3K3Q C;  4IIJ E;  1UGO A;  4JYA T;  4HN9 A;  5AQO B;  2J62 A;  3VR9 A;  4UVA B;  4AKG A;  2BBJ A;  2Y48 B;  3AEG A;  4UIG A;  3G06 A;  3N2O A;  3O1J A;  4JUY A;  3L39 A;  2IW5 B;  4MFR A;  3RI5 A;  3ZKR A;  4AKR B;  4AQY T;  1HTJ F;  2XQY A;  3SFE A;  3MJX A;  4U3C A;  4PW8 A;  3RHW A;  4IE4 A;  2IUB A;  1UX5 A;  3ABV A;  3PU3 A;  4LML A;  3VR8 A;  3ZCJ A;  5LP6 E;  1QSD A;  1UCU A;  2BVL A;  2H89 A;  2WDV A;  1HX8 A;  1WYB A;  5HWY A;  2IDO B;  2NTY A;  4C91 A;  4M1P A;  3ZJ1 A;  1E2A A;  4CN1 A;  4YHH T;  5F3J A;  2NP9 A;  4PK4 A;  4AIS A;  5LGN B;  2W2U A;  3RKO A;  4GOU A;  5HEU A;  1X79 A;  4DMV A;  5KX5 E;  4LF7 T;  1QUU A;  1AJ3 A;  3L09 A;  2YIN A;  3TLW A;  4X62 T;  2DL1 A;  2MYS A;  5AQI B;  5LB7 B;  4H63 H;  3HI2 A;  4JI0 T;  2D5U A;  5CA1 E;  5JDN A;  3OTO T;  3UUL A;  4QH1 A;  1DU2 A;  2V26 A;  5A1L A;  4TZ4 C;  3UUX B;  5C2T A;  3C4Z A;  2XAH B;  4IDQ A;  2CA5 A;  4UEM A;  1WYC A;  2NW9 A;  4CI2 B;  3ZT7 A;  4KBM B;  2J47 A;  2Y6X A;  5IHY A;  3FBZ A;  4ANJ A;  2BG9 C;  2MOZ A;  4IRE A;  1O3X A;  5AQS B;  3UFE A;  2KSR A;  5IUX A;  4IE0 A;  3KIN B;  4TNW A;  2K5B B;  2VKD A;  5CA0 E;  4JI1 T;  2WMO A;  3ZCI A;  4DV3 T;  3M65 A;  4CXW A;  1N36 T;  3RIA A;  3ANW B;  2UUA T;  5CFB A;  3PUZ F;  1M7K A;  3A8Y C;  3CPZ A;  4IE5 A;  4X1Y E;  4DO0 A;  5EK2 A;  3FZH B;  3LSV A;  5F5W A;  3PV0 F;  4HFH A;  3MZK B;  1NAF A;  3LK2 B;  4ILB A;  2WB5 A;  4TWF A;  3VKH A;  1FMW A;  4CN6 A;  1JNZ A;  4JI3 T;  4LFA T;  1LVF A;  1YQ3 A;  2WWV A;  4TX5 A;  3ZN0 B;  5FXW A;  1HNW T;  5LJM A;  3T1Y T;  4PFP A;  4UF0 B;  4X1K E;  3ZMS B;  4NXM T;  4AI6 A;  1LVK A;  1MND A;  1T72 A;  2BKN A;  2JPF A;  2W0G A;  3UQ4 A;  4JI7 T;  3CX8 B;  2DLR A;  5CB4 E;  2VUR A;  1N32 T;  3HKD E;  5AFU L;  5LHH B;  2EHO A;  1J5W A;  4HE8 A;  4HFE A;  4QXB B;  4YFS A;  4ZZB A;  4ZI7 E;  1XNR T;  3AE3 A;  3KV5 A;  1HS7 A;  2W61 A;  4O4J E;  5LBM A;  3R6N A;  3N9M A;  1GQE A;  2P9B A;  2W62 A;  3O9X A;  4EOZ B;  5L4H A;  4LF5 T;  4XBF B;  5AQU B;  2XSB A;  1UK5 A;  2M67 A;  4IST A;  2W66 A;  2NR4 A;  5E0O A;  2HN1 A;  5FXX A;  4YSX A;  3QUJ A;  3GMI A;  3IBP A;  2XAF B;  3EVY A;  2CE7 A;  2UUB T;  2PFV A;  2W67 A;  1OED B;  2V6Y B;  2B76 A;  2BG9 E;  4EXT A;  5JDG A;  1WRD A;  4CXY A;  5LG4 A;  4KHZ F;  3B57 A;  5JVD E;  2XQ4 A;  2ACZ A;  1UUR A;  5FY7 A;  3HR0 A;  1D0X A;  4TWH A;  4TWD A;  1XWM A;  3UTK A;  2EHO C;  1FEW A;  4BJM A;  5L3D B;  2PJQ A;  5JR9 B;  2R6G F;  3VKG A;  1E1H B;  2CHO A;  2V7I A;  3LFM A;  1HNZ T;  4KHP T;  3EAM A;  5ABH A;  3RF1 A;  2FBW A;  3CIR A;  4GYS A;  3RLF F;  3ZYK A;  4EZH A;  4G2A A;  5KXJ A;  4IL4 A;  2J4G A;  4ISS A;  2VB6 A;  2QRX A;  4CN4 A;  3P50 A;  1SA0 E;  4HGA A;  5DJQ C;  3ZST A;  3AXJ A;  4GK5 E;  4EAH A;  5LXT E;  4DUY T;  4JI4 T;  2WDR A;  2D0U A;  2ODU A;  3SRZ A;  1I6Z A;  2W00 A;  4DR7 T;  1D1B A;  5LYJ E;  3IEE A;  2V6X A;  2X51 A;  2XZE A;  2XQ9 A;  1LKX A;  3PUW F;  4U74 A;  4OHF A;  3C64 A;  3KDS E;  4B3M T;  3P4P A;  5ETW A;  2MBG A;  2M6I A;  5FNV E;  4ILU A;  5FXZ A;  2CXL A;  3CK6 A;  4H9O C;  3OKQ A;  3NRX A;  1IBK T;  4WZX A;  4XZC A;  4ZI3 C;  2MAW A;  2M6B A;  4ERR A;  3FZM B;  2BS4 A;  4IDN A;  4PNI A;  4Z8X A;  4PFO A;  3AA6 B;  3GWH A;  3H37 A;  4O2B E;  3PTR B;  5JDL A;  3MAC A;  2JIW A;  1VCS A;  1VCT A;  3MXZ A;  4PAG A;  4YXD A;  5L3E B;  2WWU A;  1FJG T;  1X9B A;  2YDR A;  2A3D A;  3AEA A;  3AE2 A;  3P8C D;  4GKJ T;  4YJ3 E;  1OED E;  2BG9 B;  3NWI A;  2VQF T;  3KV9 A;  2A2F X;  2ZM2 A;  4P1N A;  4JI2 T;  1FIO A;  4JV5 T;  4AKI A;  1HR0 T;  3CQG B;  1MMD A;  3AE1 A;  2BS3 A;  5JR9 C;  3PUY F;  2JQK A;  4JBW F;  3NRY A;  2ZM0 A;  2G0U A;  2YN6 A;  1D0Y A;  4A98 A;  5JRC B;  2DWK A;  2CRB A;  2XQ5 A;  3EDU A;  3PUG A;  4MLK A;  4NUU A;  2CLY C;  4JEU B;  4YTM A;  2K9A A;  4Z91 A;  4B6X A;  5JDQ A;  3WI3 A;  1N33 T;  4O4I E;  3PJA J;  3N9L A;  5F8P A;  3KV4 A;  3L8R A;  3LDQ B;  4DR4 T;  2BBH A;  3CKD A;  4E7Z A;  4EB6 E;  3H3M A;  4HTE A;  2V7M A;  1UUS A;  3FZL B;  2VKJ A;  3JAE A;  3LJC A;  2HPJ A;  4Z90 A;  3J7Y q;  3AE6 A;  3ZYM A;  4X1I E;  3PJA A;  5LMN T;  3KV6 A;  3OYZ A;  4PJN A;  3F31 A;  4NXN T;  3K1S A;  1HG2 A;  1G8X A;  2XM1 A;  3AA0 B;  4FJO A;  4PJJ A;  1T8B A;  3VU7 H;  4CQI A;  1IJ5 A;  3GN5 B;  3JC6 C;  4G63 A;  2QA7 A;  4ZOL E;  4DR3 T;  4EV6 A;  2HHH T;  5FL0 A;  2XAS B;  3ZJ2 A;  2CWO A;  4H9S E;  5EZY E;  4ZI2 C;  2XY8 B;  3UUM A;  2JJ9 A;  3IF8 B;  3U3I A;  5CGM A;  3WAJ A;  1YXR A;  2F4V T;  3ZC0 A;  2C5K T;  2NWB A;  3CML A;  3FBL A;  5CJ5 A;  2I0M A;  2CBI A;  3ZT5 A;  3HKB E;  5LJN A;  4JEH B;  1US7 B;  2ES0 A;  3I0Q A;  4KP3 C;  4CI3 B;  5JDM A;  3T8O A;  3N2G E;  3B5M A;  2BKO A;  2XJ7 A;  2YU1 A;  4OFZ A;  4QWN B;  3TLT A;  2VAS A;  1T98 A;  4O4L E;  3JAF A;  3S4U A;  3U78 A;  5TAO A;  4B3R T;  3ZPO A;  4DID B;  2A9U A;  2MPK A;  3ONX A;  4DV1 T;  2CXD A;  2V6Y A;  4KX6 A;  2E9X D;  4U7Y A;  2XQ8 A;  2AE9 A;  1MNE A;  2I6H A;  4NUV A;  4IT4 A;  4EYU A;  4DV4 T;  4QH4 A;  3ZMZ B;  4H63 V;  4LF6 T;  4ZXL A;  1CUN A;  1OWA A;  1WR6 A;  2UXC T;  2BVM A;  4H9N C;  4LF4 T;  5ABF B;  2LSG A;  3UUB A;  1OXZ A;  4EYY R;  2L8K A;  3RYI E;  2JQ9 A;  4ZI2 D;  5L3B B;  1WFD A;  5J2T E;  2UXD T;  4I50 E;  4DND A;  2BDE A;  4KMC A;  4P0A A;  2IC9 A;  3C4W A;  5LHG B;  2NOX A;  5BR8 T;  1KF6 A;  2WZH A;  4IDZ A;  2A72 A;  3CVR A;  4DVD A;  4AKH A;  3C4X A;  2WS3 A;  2Q9Q A;  3L3P A;  3EHZ A;  3I0O A;  3B13 A;  3OPC A;  3K8P C;  3PUR A;  5ABE A;  5LGU B;  2LSK A;  4X65 T;  5HWX A;  4MAL A;  5AQJ B;  4DV2 T;  3MKD A;  3ZMU B;  1XMQ T;  4B3T T;  2HH7 A;  1W0B A;  3PDY A;  2Y8D A;  4YTP A;  4YY3 T;  2DHR A;  4ZHQ E;  4H9R C;  4I55 E;  5H6R B;  4LFB T;  3N9N A;  1LRZ A;  5LHI B;  2L9Q A;  5AQG B;  4WNK A;  3P4Q A;  4I4T E;  1Y64 B;  3JAD A;  1KFY A;  2XPK A;  3UT5 E;  3UU8 A;  4TNV A;  3P4S A;  4P09 A;  2X9W A;  1KK7 A;  3PUQ A;  5HEH A;  4U31 A;  5JRE A;  1J5E T;  5KDM C;  3N9Q A;  4AIU A;  4JI6 T;  2RA1 A;  1UX4 A;  5HXS A;  1VOM A;  3RYH E;  3JCF A;  2X66 A;  2LHN A;  2XAJ B;  2ACX A;  5DQW A;  2JMH A;  1V9D A;  1D1A A;  4ZS3 A;  2N1G A;  2WY2 A;  4COF A;  3AB3 B;  5LG3 A;  4OYJ A;  5JQG E;  4AXP A;  2VK9 A;  2LHR A;  4X66 T;  3KBU A;  2LM2 A; 
#chains in the Genus database with same CATH homology
 3RC3 A;  3K3N A;  5JRC A;  2VL8 A;  1U4Q A;  1YW0 A;  2LSI A;  4PK5 A;  1VRB A;  3SS1 A;  3PUA A;  1B7T A;  5DQV A;  2JRK A;  2WMN A;  2RP4 A;  2EHO B;  1EZ3 A;  3I1A A;  4A56 A;  2Q9Q D;  2H7V C;  1S94 A;  2H7O A;  2LSY A;  4QX8 B;  4X20 E;  5EK4 A;  4OYK A;  4UEL A;  3SWH A;  2BZB A;  3N5L A;  1D1C A;  2CLY B;  2NTX A;  3O1H A;  3J9X 1;  4QKN A;  2K24 A;  3I9W A;  3R84 B;  2LOP A;  4CXX A;  2KT9 A;  3SOL A;  3BQI A;  1YD8 G;  2XTL A;  4AQF C;  5IYZ E;  2CM0 A;  4CZZ B;  5JDH A;  2E9X A;  3FXD B;  2X9H A;  4J2C A;  2X67 A;  4O4H E;  4OK0 A;  4UVC B;  5JDF A;  3ZN1 B;  3WAK A;  3BK9 A;  1YKE B;  3PE0 A;  4ZS2 A;  5FY1 A;  2OA5 A;  3MK7 C;  4P0B A;  4V1A v;  1NWM X;  5HXE A;  2EHO D;  2J1D G;  5DAB A;  4WW0 A;  3DJB A;  2KWH A;  2X68 A;  4QXC B;  2GK9 A;  2WBL A;  5ADX L;  4H9Q C;  3HKC E;  3RYC E;  4K0U A;  1IAP A;  2XHE B;  3RRC A;  4AQG A;  5FP3 A;  2KZ7 B;  5GON E;  4QXH B;  3RYF E;  3AVS A;  2ZLY A;  4YHJ A;  3V5S A;  3AAE B;  3C50 A;  3C51 A;  5HXH A;  1HFA A;  3E22 E;  3AA7 B;  3UUN A;  5LGT B;  1H7C A;  2XAQ B;  2KXP B;  4O2A E;  3LBX A;  3KBT A;  2D2S A;  2PBI A;  2KIN B;  5J1G A;  2C5I T;  3ZMT B;  3AAA B;  2LE8 A;  4L0R A;  3O1I A;  4N78 D;  5FXV A;  5L3G B;  3FXE B;  2KLQ A;  4JLE A;  4ZI3 D;  4PK6 A;  4UV9 B;  4EIW A;  2JMK A;  1ZHC A;  2B1E A;  3PUS A;  4BA9 A;  3QK6 A;  4DMW A;  3FHN A;  5LBQ B;  1YKH B;  2DCF A;  4IHJ E;  5L3F B;  2IAK A;  3ESL A;  2L3L A;  4GIW A;  3RH3 A;  5FYM A;  2CMR A;  3OJA A;  2SPC A;  2H3R A;  5H6Q B;  5JH7 E;  2K48 A;  4TN7 B;  2LT3 A;  5M4Y A;  3ZMV B;  2KND A;  2LEH A;  4HKA A;  2DI4 A;  5EK3 A;  4F6R C;  5CA0 E;  1FMV A;  1MMA A;  2ZMA A;  1G73 A;  3ETU A;  1MIY A;  3OBV E;  2VKO A;  3KVB A;  1MIV A;  5LCY A;  1WLX A;  2V7K A;  3N9O A;  3RX6 A;  1ZKE A;  3V5U A;  2N9D A;  4O8S A;  4UXN B;  3LK3 B;  4L9I A;  2YU2 A;  2CEA A;  2HPL A;  4UF0 A;  3VHL A;  2NW8 A;  1ZV4 X;  4U72 A;  5L2L A;  3E0Z A;  4AKL A;  2ZM8 A;  4ADZ A;  3C98 B;  3CQX C;  2WAU A;  4IGU A;  3CX6 B;  2MTQ A;  2PG8 A;  4AQF A;  4PJM A;  3AAI A;  4KUM B;  3OYX A;  2LM9 A;  1Z0P A;  2W63 A;  2LOS A;  2E9X B;  5HXR A;  3Q5X A;  5BMV E;  3BQL A;  3F57 A;  3CX7 B;  4BAY B;  4E7S A;  4IE6 A;  3LK4 2;  4GYR A;  4QHO A;  2LSJ A;  4C90 A;  3P7I A;  4MHC A;  4CI1 B;  3TKL B;  2UXX B;  2CWY A;  1IJ6 A;  3W15 B;  2WM9 A;  4UV8 B;  3FB2 A;  2YEV C;  1ZEE A;  2CCQ A;  3KFW X;  3QC9 A;  4DBQ A;  3ANW A;  3AA1 B;  3O4X E;  2V7L A;  1SHZ C;  2CXF A;  2DNX A;  4XAX B;  1KNZ A;  1BR2 A;  3GA8 A;  2Q9Q C;  2ODV A;  2JQQ A;  2LJL A;  2N2N A;  5FMN A;  3AVR A;  3IHR A;  1BR1 A;  3HA4 A;  4TUY E;  4UVB B;  2XAG B;  3LBX B;  5FY0 A;  4WBO A;  4DBR A;  1BR0 A;  3MA9 A;  3JC6 D;  2IC6 A;  5HAX A;  5LOV E;  5HYA A;  4HEA A;  1IZN B;  2X0L B;  3KVA A;  3DP7 A;  3RPU A;  2XUE A;  2KMF A;  5LA6 E;  2V7J A;  2QGS A;  3ETV A;  1BR4 A;  2E8I A;  5LNK A;  4FI5 A;  2Q9Q B;  3Q5W A;  1MIW A;  3RRW A;  4YLH A;  5KMG P;  4PJL A;  2C5J A;  2DWG A;  4GK0 E;  4YJ2 E;  3A5X A;  3K3O A;  1U5P A;  4P0A A;  2I59 A;  3N9P A;  1MMN A;  5J2U E;  4HFV A;  4MBQ A;  3Q9D A;  2C0S A;  4BJN A;  2V1D B;  2YK0 A;  1S35 A;  2NW7 A;  2UXN B;  4H9P C;  3D0T A;  1D0Z A;  1MMG A;  5L3C B;  3LG7 A;  2KWI B;  3NZQ A;  4ASK A;  2X9Y A;  3EDV A;  3F2E A;  2VKH A;  2E9X C;  4IE7 A;  4I43 B;  3ZLI A;  3DTO A;  1HCI A;  3N2K E;  5C8Y E;  3GN5 A;  4EZ4 A;  3H3A A;  3ZYL A;  3ZEF B;  3NBX X;  3BQK A;  2VWA A;  2Z6E A;  3HKE E;  3NZP A;  1HF8 A;  2WSS V;  5JR9 A;  3CWZ B;  3EUH A;  4QX7 B;  4TV9 E;  3ZC1 A;  3CQC B;  1HG5 A;  3HL6 A;  3PU8 A;  4L5G A;  4TV8 E;  2X9X A;  3I9Y A;  3E08 A;  2D0T A;  3Q2M A;  5HXC A;  3K3Q C;  4IIJ E;  4HN9 A;  4UVA B;  4AKG A;  2Y48 B;  4UIG A;  4JUY A;  3N2O A;  3O1J A;  3RC8 A;  2IW5 B;  4MFR A;  4AKR B;  1HTJ F;  2XQY A;  3MJX A;  4PW8 A;  4IE4 A;  3PU3 A;  1UX5 A;  5LP6 E;  3ZCJ A;  1QSD A;  1UCU A;  2BVL A;  1HX8 A;  1WYB A;  5HWY A;  2NTY A;  4C91 A;  4M1P A;  3ZJ1 A;  5F3J A;  2NP9 A;  4PK4 A;  5LGN B;  3RKO A;  4GOU A;  4DMV A;  1X79 A;  5KX5 E;  1QUU A;  1AJ3 A;  3L09 A;  2YIN A;  2MYS A;  4H63 H;  3HI2 A;  2D5U A;  5CA1 E;  5JDN A;  3UUL A;  2V26 A;  5A1L A;  4TZ4 C;  3UUX B;  3C4Z A;  2XAH B;  4CI2 B;  2CA5 A;  4UEM A;  1WYC A;  2NW9 A;  4KBM B;  2Y6X A;  5IHY A;  4ANJ A;  3FBZ A;  2MOZ A;  1O3X A;  3UFE A;  4IE0 A;  3KIN B;  2K5B B;  2VKD A;  2WMO A;  3ZCI A;  3M65 A;  4CXW A;  3ANW B;  3CPZ A;  4IE5 A;  4X1Y E;  4DO0 A;  5EK2 A;  3MZK B;  1NAF A;  3LK2 B;  3VKH A;  1FMW A;  1LVF A;  3ZN0 B;  4TX5 A;  5FXW A;  5LJM A;  4PFP A;  4UF0 B;  4X1K E;  3ZMS B;  4AI6 A;  1LVK A;  1MND A;  2JPF A;  2W0G A;  3CX8 B;  2DLR A;  5CB4 E;  3HKD E;  5LHH B;  2EHO A;  4HE8 A;  4QXB B;  4YFS A;  4ZI7 E;  3KV5 A;  1HS7 A;  2W61 A;  4O4J E;  5LBM A;  3R6N A;  3N9M A;  2P9B A;  2W62 A;  3O9X A;  4EOZ B;  4XBF B;  2M67 A;  4IST A;  5E0O A;  5FXX A;  3QUJ A;  3GMI A;  3IBP A;  2XAF B;  3EVY A;  2CE7 A;  2PFV A;  4EXT A;  5JDG A;  1WRD A;  4CXY A;  5LG4 A;  3B57 A;  5JVD E;  5FY7 A;  3UTK A;  3HR0 A;  1D0X A;  4BJM A;  2EHO C;  1FEW A;  5L3D B;  2PJQ A;  5JR9 B;  3VKG A;  1E1H B;  2V7I A;  3LFM A;  4GYS A;  4EZH A;  3ZYK A;  4G2A A;  4ISS A;  2VB6 A;  4HGA A;  1SA0 E;  4EAH A;  5DJQ C;  4GK5 E;  5LXT E;  2D0U A;  2ODU A;  3SRZ A;  2W00 A;  1D1B A;  5LYJ E;  3IEE A;  2X51 A;  1LKX A;  4U74 A;  4OHF A;  3C64 A;  3KDS E;  5ETW A;  2MBG A;  5FNV E;  4ILU A;  5FXZ A;  2CXL A;  4H9O C;  3OKQ A;  3NRX A;  4ERR A;  4XZC A;  4ZI3 C;  4PNI A;  4Z8X A;  4PFO A;  3AA6 B;  3GWH A;  3H37 A;  4O2B E;  3PTR B;  5JDL A;  3MAC A;  5L3E B;  3MXZ A;  4PAG A;  2WWU A;  2A3D A;  3P8C D;  4YJ3 E;  3KV9 A;  2A2F X;  2ZM2 A;  1FIO A;  4AKI A;  3CQG B;  1MMD A;  5JR9 C;  3NRY A;  2ZM0 A;  2G0U A;  5JRC B;  1D0Y A;  2DWK A;  3EDU A;  3PUG A;  4MLK A;  4WBN E;  4NUU A;  2CLY C;  4JEU B;  2K9A A;  4B6X A;  5JDQ A;  3WI3 A;  4O4I E;  3N9L A;  5F8P A;  3KV4 A;  3CKD A;  4E7Z A;  4EB6 E;  4HTE A;  2V7M A;  3LJC A;  2VKJ A;  2HPJ A;  3J7Y q;  3ZYM A;  4X1I E;  3KV6 A;  3OYZ A;  4PJN A;  3F31 A;  1HG2 A;  1G8X A;  4FJO A;  3AA0 B;  4PJJ A;  3VU7 H;  4CQI A;  1IJ5 A;  3GN5 B;  3JC6 C;  4G63 A;  2QA7 A;  4ZOL E;  2XAS B;  3ZJ2 A;  2CWO A;  4H9S E;  5EZY E;  4ZI2 C;  3UUM A;  3WAJ A;  2JJ9 A;  3IF8 B;  3U3I A;  3ZC0 A;  2C5K T;  2NWB A;  3CML A;  3FBL A;  3HKB E;  5LJN A;  4JEH B;  1US7 B;  2ES0 A;  3I0Q A;  4KP3 C;  4CI3 B;  5JDM A;  3T8O A;  3N2G E;  2YU1 A;  4OFZ A;  4QWN B;  2VAS A;  1T98 A;  4O4L E;  3S4U A;  3U78 A;  5TAO A;  3ZPO A;  3ONX A;  2CXD A;  2E9X D;  4EYU A;  1MNE A;  4NUV A;  3ZMZ B;  4H63 V;  1CUN A;  1OWA A;  1WR6 A;  2BVM A;  4H9N C;  2LSG A;  5L3B B;  1OXZ A;  4EYY R;  2L8K A;  3RYI E;  4ZI2 D;  5J2T E;  4I50 E;  4DND A;  2BDE A;  4KMC A;  2IC9 A;  3C4W A;  5LHG B;  2NOX A;  4IDZ A;  2A72 A;  3CVR A;  4DVD A;  4AKH A;  3C4X A;  2Q9Q A;  3L3P A;  3PUR A;  3I0O A;  3B13 A;  5LGU B;  3K8P C;  2LSK A;  5HWX A;  4MAL A;  3MKD A;  3ZMU B;  2HH7 A;  3PDY A;  2Y8D A;  2DHR A;  4ZHQ E;  4H9R C;  4I55 E;  5H6R B;  3N9N A;  1LRZ A;  5LHI B;  2L9Q A;  4WNK A;  4I4T E;  1Y64 B;  3UT5 E;  4P09 A;  2X9W A;  1KK7 A;  3PUQ A;  5JRE A;  5KDM C;  3N9Q A;  2RA1 A;  1UX4 A;  5HXS A;  1VOM A;  3RYH E;  2X66 A;  2LHN A;  2XAJ B;  2ACX A;  5DQW A;  2JMH A;  1V9D A;  1D1A A;  4ZS3 A;  2N1G A;  3AB3 B;  4OYJ A;  5JQG E;  4AXP A;  2VK9 A;  2LHR A;  3KBU A;  5AFU L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...