4HEAA

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 33
structure length 117
sequence length 117
chains with identical sequence P
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4heaA00
4HEAA 5LNKA 4HE8A 3RKOA
chains in the Genus database with same CATH superfamily
3RF1A 2WDQA 1D1BA 2WM9A 4PJJA 4GYRA 3UUMA 2ES0A 2LKGA 5F5WA 3ZSSA 4QKNA 4LFBT 3KINB 4IIJE 1HG5A 4IDOA 1WR0A 2CCQA 3Q5EA 5EZYE 2K5BB 5HAXA 3I0QA 2FUPA 2A3DA 2HN2A 1ZOYA 2EHOB 2OV9A 2V7JA 3HI2A 3ZN1B 4BAYB 2VWAA 1UX5A 4CI2B 2VKJA 1XMOT 2FBWA 2A2FX 3Q5DA 3PUQA 4CZZB 1W0BA 2IUBA 3N9PA 2W61A 3RIAA 4CI1B 2VK9A 4KHZF 3AE8A 1IBLT 4AKGA 2VQFT 2OA5A 2QVAA 5FY0A 4ZS3A 4BJMA 4U2YA 2KT9A 3FZKB 1H7CA 2CEAA 2LM2A 4YLHA 5FXVA 2E9XD 3ZMUB 1FEWA 3NZPA 3QK6A 5HEHA 5HYAA 1OEDE 2E9XA 2DHRA 4QXBB 4AKHA 1HNZT 1KK7A 3T1YT 2J47A 5CGMA 3EABA 3ETVA 3F31A 3FZLB 3OYZA 4A56A 1XNQT 3EI0A 3JC6C 4X1IE 2JQKA 3C98B 4H9PC 4UIGA 2DLRA 3UUXB 2LHRA 1I94T 3UU8A 2NR4A 1X9BA 5C3JA 4TWDA 4WBOA 4DNDA 1KEYA 1HG2A 4F6RC 5HXEA 3C4WA 3RQUA 5HWXA 1D0XA 3EHZA 2SPCA 4OFZA 1N36T 5HCMA 4B3MT 4O4HE 2WQYA 3NRYA 4AQFA 4N78D 4X20E 3DTOA 1NEKA 2WZHA 2CXFA 2UXDT 2V7KA 3H37A 4PAGA 3ZMTB 5DABA 2JPFA 2RP4A 2X0YA 3QB5A 4YHJA 2YEVC 5FVKA 3RIUC 2A9UA 2JQQA 5BR8T 5ABFB 4I43B 1N34T 4OYJA 2XAGB 3NBXX 5FY7A 3O9XA 3KV6A 2LT3A 4U7IA 2XQAA 1MMDA 4AQFC 3RIFA 2LLYA 2FJBA 2X9YA 3OVUA 3RQWA 2XQ7A 4GOUA 3ZMVB 4KMCA 2BBHA 2BS2A 3AE9A 3I0OA 4P09A 3P4PA 3ZCJA 3TLUA 5M4YA 1U5PA 4IE4A 3ANWA 5DQVA 4H9NC 2G0UA 5L3CB 4I50E 2ZMAA 2E2AA 5HXRA 3FBZA 1J1JA 2H7VC 2KLQA 4H9OC 3S4UA 4L5GA 4P0BA 2YDSA 2I0MA 4TNVA 4KHPT 3EAMA 3HL6A 3O1IA 2CLYB 4IE0A 5AQVB 4QXHB 3I9WA 2WB5A 3KV4A 4QX7B 4WW0A 4NXMT 2WU2A 2ACXA 4UR9A 4DR1T 4YXDA 2LKHA 4X64T 1KNZA 2W66A 1SUMB 4JI8T 2WY2A 5LG4A 2I6HA 2JQ9A 4QH5A 1W9RA 2Z6EA 2BG9E 1IZNB 3FHNA 4A97A 2X66A 1D1CA 4LF9T 2XSAA 3O1HA 1D1AA 5CA1E 5HCJA 2CLYC 4HFBA 3GN5A 2DNXA 2DI4A 2V5CA 3UUBA 2LJLA 1US7B 2NTXA 1HR0T 2K48A 3CX6B 5KMGP 2I59A 2UXNB 4KP3C 5ETWA 4JI7T 2P9BA 2PG8A 4ZS2A 2IC9A 2HPLA 4I0UA 2BKNA 4IDQA 3AVRA 1O3XA 2FJAA 2X67A 4PFOA 2X9XA 2XAJB 2V8SV 4H63V 2BG9A 2B76A 2LE8A 4LF7T 4HWHA 2VKOA 4LFAT 1UK5A 1QSDA 2ZM6T 1X79A 4UVAB 2BS4A 4DBRA 4EZ4A 4DV4T 1YQ3A 2LSGA 3CIRA 2CHNA 2WSSV 3ONXA 5AQKB 5TAOA 4V1Av 4PJNA 4JI2T 1N33T 3EVYA 2ZM2A 5AQQB 3RYIE 2XY8B 1XWMA 2CWOA 2E9XC 2XQYA 3OBVE 4GYSA 5L3EB 4JV5T 5L3BB 3JAFA 4L0RA 2IIUA 3AE5A 1E7PA 2LEHA 3JC6D 3AAIA 4LMJA 2WDRA 2VB6A 4QH1A 4IDPA 1HX1B 5FYMA 3TLSA 5ADXL 5JDHA 3W15B 4CN4A 1XZYA 2N1GA 4WNKA 5FVLA 2VVNA 4ZI7E 5H6QB 3RKOA 2Y8DA 2BVLA 4MFRA 4CI3B 4OYKA 1MNDA 3LG7A 3RH3A 5AQFB 4G2AA 4AKLA 3MK7C 3MZKB 4YSYA 4Q25A 4YFSA 3VRBA 3PUVF 3PUYF 3N2GE 1LVFA 4UVCB 3ZT7A 5CFBA 3AA7B 4MBQA 2WDVA 3NWIA 4HTEA 5AQMB 2X51A 1Y64B 1UUSA 1B7TA 3F57A 4U2ZA 3RRWA 4ZI2D 4ILUA 2E5VA 2XQ6A 4X62T 3P4WA 3PUAA 5JREA 4U72A 2HN1A 5LBQB 4ASKA 4EYYR 3T1HT 2LRLA 2MPKA 2V7MA 3PTRB 1HNWT 1CHUA 2JMHA 2X9WA 3KBTA 4J2CA 4YTNA 1N32T 1HS7A 3UTKA 3VR9A 3CMLA 3PUZF 4DV7T 1IBMT 2UU9T 4DV1T 4XZCA 4U33A 1MIYA 4NUVA 3B57A 4YTPA 2FJDA 2XSBA 3FXEB 2LSIA 1YKHB 3CPZA 3MXZA 5JR9A 4OX9T 2E9XB 4YY3T 2VVSA 3ZC1A 3X1DA 3PUXF 2LOSA 2YN6A 2J4GA 3K1SA 3MKDA 4JBWF 3GMIA 4NIQA 4K0KT 1ZV4X 2VL0A 2WBLA 3UQ4A 5LG3A 1BR0A 5JDGA 5AQLB 5JDQA 3AEGA 1LVKA 1BR1A 3RGLA 2YKSA 3RYFE 1FIOA 4UELA 3UU6A 2XZEA 3ETUA 4GK0E 5KDMC 1SE7A 1CUNA 4DR3T 3PUGA 5IYZE 3LFMA 2WMOA 2V26A 2WP9A 3CWZB 4I55E 3ZLIA 1Y01A 2D9DA 5LP6E 1HX8A 1WRDA 1JNRA 5HEUA 1W09A 5J2TE 4DR7T 4AXPA 3LK2B 4EGWA 2ACZA 3LBXA 1E1HB 2BZBA 2YK0A 3VHLA 2LM9A 3ZT5A 4I4TE 4DV3T 3AEEA 3K3NA 2CWYA 3HA4A 4TWHA 4Z90A 3UFEA 4IL4A 4F8HA 3AEAA 5AQOB 2YDQA 4PJLA 1VCSA 3UULA 4Z91A 3ZT6A 2JJ9A 5JH7E 2CPTA 2CBJA 3AAEB 3E08A 3KFWX 3N2KE 3NVOA 4UV9B 3WAKA 2H7OA 3PJAA 2XTLA 2KSRA 3V5UA 1VRBA 5FL1A 5LJNA 2EHOC 4NXNT 4HFEA 2L9QA 3NZQA 1XDOA 1G73A 2XUEA 3LDQB 3P7IA 5EK3A 4YJ3E 5L4EA 3M3ZB 3KVAA 5AQJB 3GN5B 2ZLYA 2KWHA 4X66T 3U78A 4HKAA 1IJ5A 3O4XE 5IUXA 3C50A 2R6GF 3CVRA 3LK42 3ZJ2A 5C2TA 1OEDA 2F4VT 3JADA 2BDEA 3AE1A 4IHJE 4HWCA 4IE6A 4HWFA 3ZEFB 5JVDE 5LMNT 3Q9DA 5AQUB 2W63A 2Q9QC 3BQIA 3GA8A 3C4ZA 4H9SE 4M1PA 4TNWA 3UU5A 3A8YC 5AQHB 1FJGT 2BKOA 2J1DG 3E0ZA 3RX6A 2VKHA 3RC3A 3OKQA 1MIWA 2XJ7A 2CM0A 2MOZA 3AA1B 4GIWA 4YTMA 5H6RB 4BA9A 2UUAT 4JYAT 3CX7B 4HFVA 3QC9A 4X1KE 4ISSA 2D5UA 5HEGA 2H3RA 3FZFB 2XASB 2DCFA 3VRAA 2X9HA 2IW5B 3IA3A 5AQNB 4ANJA 1WYBA 4ILAA 4EYUA 4ZI2C 3TLWA 4ZXLA 3MJXA 2KMFA 4DBQA 3JAEA 3L09A 1FMVA 2WAUA 3OYXA 1KF6A 1YW0A 2M67A 2A72A 2NWBA 2AE9A 4K0UA 4NUUA 1D0ZA 1LRZA 2DWGA 5JDNA 4PNIA 1YKEB 4HE8A 5LGTB 2UUBT 4PK4A 5KXJA 2D0TA 3H3MA 3Q5WA 2WWUA 5DJQC 5L3FB 2FJEA 1KNPA 4IL9A 3ZKRA 1UCUA 4GKKT 4EAHA 5KX5E 1VCTA 5HWYA 4IT4A 5JR9C 2ZM8A 3VKHA 3HKEE 3N9QA 1M7KA 5LHHB 2C5IT 2JRKA 3MACA 4H9RC 4TV9E 3U3IA 4DV2T 3VU7H 5LGNB 4DV5T 4AIUA 2XQ4A 5JTGA 1GQEA 3RLFF 2IHR1 4COFA 4HWIB 3AEDA 4FI5A 5AQTB 2E5LT 3PV0F 2C5KT 3AA6B 2QA7A 4P1NA 2VASA 5ABFA 1ZHCA 2HHHT 2HPJA 2W62A 3O1JA 3FXDB 4HFHA 4LMLA 4MHCA 2M6IA 3ZMSB 4YSZA 1KNRA 2ODUA 3AE4A 5L3GB 3G06A 4X65T 4L9IA 3HKBE 3UUNA 2CA5A 3KDSE 1W0AA 5AQSB 4HN9A 4E7ZA 2M6BA 2VURA 2NP9A 2XHEB 2XM2A 3PURA 1T7SA 1BR4A 4ADZA 5F3JA 4P0AA 4WBNE 2BKPA 4HFDA 1MNEA 3VR8A 5A1LA 2E8IA 3GWHA 3BK9A 5L3DB 3P4RA 4ERRA 2N2NA 2KZ7B 4MLKA 3M65A 4ILCA 2W4XA 4OHFA 5JDFA 4LF8T 5J2UE 3V5SA 4JLEA 3ANWB 3B5MA 4AI6A 2AXDS 2UXXB 4LMKA 4WYVA 3SOLA 2WCAA 3N5LA 4ZZCA 5JR9B 3K3QC 4JI6T 2WWVA 3RYCE 2X68A 4PK5A 1OWAA 4C90A 1HF8A 5GONE 5AFUL 1MMAA 3AEBA 3D0TA 4U31A 3KVBA 1OEDC 4ZI3C 2IC6A 5LNKA 2PTFA 3PUSA 1YD8G 3CQCB 4IE7A 3OTOT 4DUYT 2CBIA 4JI4T 4LF4T 1SA0E 3TLTA 3B13A 3LJCA 2LOPA 5BMVE 4IDZA 1UX4A 4TZ4C 2ZM0A 4JI3T 4X1YE 3SRZA 2WMNA 2EHOA 2NW9A 1BR2A 3UFGA 1SHZC 2JMKA 2PFVA 2Q9QD 2X0HA 3FBLA 3IBPA 4WZXA 4QX8B 3P8CD 3MA9A 4MALA 5FXZA 3ZN0B 5ABEA 3ZC0A 5LMUT 3A5XA 2XQ8A 3BQLA 4B3ST 4ZI3D 1WFDA 2OLTA 2WS3A 5IWAT 3PJAJ 3AB3B 2CE7A 2L8KA 2QRXA 4TWFA 2XAQB 2WU5A 2YU1A 3ONLC 4NPPA 4IE5A 2Q9QB 2V6YA 3KV9A 2V5DA 4KBMB 5LB7B 4U7YA 4DVDA 1IJ6A 3QNUA 3ZSTA 5J0ZA 5LOVE 2L3LA 2WZIA 3J7Yq 2W00A 4UF0A 3AXJA 2K24A 2BS3A 3RRCA 3SFDA 5L47A 2IMLA 1MIVA 4O4JE 1WR6A 2Y48B 4H9QC 1T98A 5AQIB 3EDUA 4JI5T 4EOZB 1HFAA 5JRCA 2V1DB 5FKYA 1XMQT 3WI3A 1WLXA 4C91A 1YQ4A 2V6YB 4ZZBA 5CB4E 1T8BA 2XPKA 3CKDA 5CJ5A 5EK2A 3AAAB 4TX5A 5JRCB 3RKGA 1YXRA 3C4XA 3OJAA 3RPUA 2CXDA 2CRBA 1OEDB 3LBXB 4PW8A 3TKLB 4DV0T 2DL1A 4BJNA 5FXWA 5DQWA 5HXCA 4TN7B 3L3PA 2C0SA 2XQ9A 3P4QA 2H89A 1M62A 2CXLA 2NOXA 1ZKEA 4TUYE 3ZYMA 1HNXT 2VL8A 1L0VA 2V7LA 3PU3A 4TV8E 3ZPOA 4YHHT 5LGUB 1Z0PA 4CXXA 1WYCA 4CXYA 2UXBT 3AECA 4UF0B 4KI0F 4YT0A 3NKZA 4FJOA 2C5JA 4EB6E 4HWDA 3RYHE 1E2AA 1S35A 4AQGA 2CHOA 4O4LE 2Q9QA 4AKRB 2UXCT 5LJMA 2EHOD 2D0UA 2XQ5A 1NWMX 1V9DA 3ZJ1A 2LSJA 3NRXA 2QYWA 4OK0A 5HEJA 2NW8A 3L39A 3QUJA 4UV8B 4B3TT 2BVMA 2PBIA 2MBGA 4LF6T 2KWIB 4U3CA 5FMNA 3PDYA 4CN1A 3AXJB 4O4IE 1S94A 1ZP0A 3UT5E 4B6XA 2D2SA 3R84B 5ABHA 4B3RT 4JI0T 4XBFB 2LHNA 4XAXB 1UGOA 3RIUA 2DWKA 3IEEA 3N9MA 4KUMB 2IAKA 3T8OA 4O2BE 2CMRA 1T72A 1UURA 4IGUA 4X5TA 5C8YE 2ODVA 3HKDE 4GK5E 4PFPA 1HTJF 2MTQA 2X0LB 3AE2A 5AQGB 4ZHQE 3OPCA 2YINA 3KV5A 1FMWA 5JDLA 1EZ3A 4DR2T 1WCRA 2JIWA 3P50A 4EV6A 1J5ET 4LF5T 3CK6A 2W67A 4IDNA 2RA1A 3QOFA 2KNDA 3IHRA 5AQRB 3E22E 3K3OA 1MMGA 2BG9C 2MAWA 3C51A 3CQXC 3ONJA 2IDOB 3N9LA 1Z8UA 2W2UA 3I9YA 3ZYKA 2KINB 4EIWA 3DJBA 5LHIB 2V7IA 5FY1A 4DIDB 3EUHA 3RHWA 2VQET 3K8PC 4QXCB 2VKDA 2K3WA 3EDVA 3UU4A 4YJ2E 4HFCA 3ZYLA 4UVBB 2RPAA 3PUWF 3RI5A 1NAFA 4ILBA 5LXTE 3Q2MA 3LK3B 3C64A 3AE6A 4QWNB 3I1AA 3DP7A 2LRKA 2B1EA 4ISTA 2YU2A 3AE3A 1R8IA 4DR5T 2NW7A 1AJ3A 2N9DA 1D0YA 3BQKA 3H3AA 4H63H 5LCYA 1QLBA 2QGSA 3R6NA 5CA0E 4LFCT 3AVSA 3F2EA 4JEUB 2YDRA 4O8SA 5ABGA 3SFEA 1LKXA 3CQGB 5L2LA 3UU3A 4ZEYA 4Z8XA 2XAHB 3PU8A 1JNZA 3HR0A 4DR6T 1I6ZA 4U74A 3VKGA 5FXXA 4HEAA 4HGAA 5IHYA 3UQ7A 4DO0A 5EK4A 4KX6A 4PJMA 4CXWA 2XQ3A 4EXTA 4PK6A 4CQIA 4ZOLE 5FP3A 4JUYA 4AKIA 2Y6XA 4A98A 3ABVA 5FNVE 4UXNB 1HCIA 4UEMA 5AQPB 4CN6A 4AQYT 3N9NA 5HXHA 4DMVA 4JEHB 3AE7A 4E7SA 3FB2A 3TLVA 5LYJE 1KFYA 3J9X1 4HFIA 4A5XA 2YOEA 4EEBA 1IBKT 3P4SA 1MMNA 3SS1A 5J1GA 3SWHA 2BG9B 5JDMA 4JI1T 1DU2A 3ZMZB 5FL0A 2V6XA 2W0GA 3ESLA 1NENA 3HKCE 1VOMA 3AEFA 1IAPA 2J62A 3JCFA 3LSVA 3QB5K 5HEOA 4IREA 3WAJA 4YSXA 2HH7A 4DUZT 1ZEEA 2KXPB 3N9OA 2PJQA 4QH4A 4DV6T 5LA6E 3FZMB 4DMWA 5LHGB 3PE0A 3RC8A 4G63A 1XDPA 1J5WA 4AISA 2XAFB 2XM1A 3N2OA 5L4HA 3KBUA 5HXSA 2LSKA 2GK9A 2NTYA 2BBJA 5JQGE 2H88A 2JQHA 1G8XA 2LSYA 1QUUA 2UUCT 3CX8B 5F8PA 2MYSA 4O2AE 3L8RA 4QHOA 5LBMA 4EZHA 4DR4T 1OXZA 3AA0B 3FZHB 4EEDA 5E0OA 3Q5XA 3ZCIA 4GKJT 3IF8B 1XNRT 3A7MA 1U4QA 2K9AA
chains in the Genus database with same CATH topology
1D1BA 2WM9A 4PJJA 4GYRA 2ES0A 4QKNA 3KINB 4IIJE 1HG5A 2CCQA 5EZYE 2K5BB 5HAXA 3I0QA 2A3DA 4BAYB 3ZN1B 2EHOB 2V7JA 3HI2A 5L3EB 2VWAA 1UX5A 2VKJA 2A2FX 3PUQA 4CZZB 3N9PA 2W61A 4CI1B 2VK9A 4AKGA 2OA5A 5FY0A 4ZS3A 4BJMA 2KT9A 1H7CA 2CEAA 5FXVA 4YLHA 3ZMUB 2E9XD 1FEWA 3NZPA 3QK6A 5HYAA 4QXBB 2E9XA 2DHRA 4AKHA 1KK7A 3F31A 3ETVA 3OYZA 4A56A 3JC6C 4X1IE 3C98B 4H9PC 4UIGA 3UUXB 2DLRA 2LHRA 4WBOA 4DNDA 5HXEA 1HG2A 4F6RC 3C4WA 5HWXA 1D0XA 4OFZA 2SPCA 4O4HE 3NRYA 4AQFA 4N78D 4X20E 3DTOA 2CXFA 2V7KA 3H37A 4PAGA 3ZMTB 5DABA 2JPFA 2RP4A 4YHJA 2YEVC 2JQQA 4I43B 4OYJA 2XAGB 3NBXX 5FY7A 3O9XA 3KV6A 2LT3A 1MMDA 4AQFC 2X9YA 4GOUA 3ZMVB 4KMCA 3I0OA 4P09A 3ZCJA 5M4YA 1U5PA 4IE4A 3ANWA 5DQVA 4H9NC 2G0UA 5L3CB 4I50E 2ZMAA 5HXRA 3FBZA 2H7VC 4H9OC 2KLQA 3S4UA 4L5GA 4P0BA 3HL6A 3O1IA 2CLYB 4IE0A 4QXHB 3I9WA 3KV4A 4QX7B 2ACXA 1KNZA 5LG4A 3FHNA 2Z6EA 1IZNB 2X66A 1D1CA 3O1HA 5CA1E 1D1AA 2CLYC 3GN5A 2DNXA 2DI4A 2LJLA 1US7B 2NTXA 2K48A 3CX6B 5KMGP 2I59A 2UXNB 4KP3C 5ETWA 2P9BA 2PG8A 4ZS2A 2IC9A 2HPLA 3AVRA 1O3XA 2X67A 4PFOA 2X9XA 2XAJB 4H63V 2LE8A 2VKOA 1QSDA 1X79A 4UVAB 4DBRA 4EZ4A 2LSGA 5TAOA 3ONXA 2WSSV 4V1Av 4PJNA 3EVYA 2ZM2A 3RYIE 2CWOA 2E9XC 2XQYA 3OBVE 4GYSA 5L3BB 4L0RA 4WW0A 3UUMA 2LEHA 3JC6D 3AAIA 5FYMA 2VB6A 5ADXL 5JDHA 3W15B 4WNKA 2N1GA 4ZI7E 5H6QB 3RKOA 2Y8DA 2BVLA 4MFRA 4CI3B 4OYKA 1MNDA 3LG7A 3RH3A 4G2AA 4AKLA 3MK7C 3MZKB 4AI6A 4YFSA 3N2GE 1LVFA 4UVCB 3AA7B 4MBQA 4HTEA 2X51A 1Y64B 4ZI2D 1B7TA 3F57A 3RRWA 4ILUA 3PUAA 5JREA 4U72A 4ASKA 5LBQB 4EYYR 2V7MA 3PTRB 2JMHA 2X9WA 3KBTA 4J2CA 1HS7A 3UTKA 3CMLA 4XZCA 1MIYA 4NUVA 3B57A 3FXEB 2LSIA 1YKHB 3CPZA 3MXZA 5JR9A 2E9XB 3ZC1A 2LOSA 3MKDA 1BR0A 3GMIA 1ZV4X 2WBLA 5JDGA 5JDQA 1LVKA 1BR1A 3RYFE 1FIOA 4UELA 4GK0E 3ETUA 5KDMC 1CUNA 3PUGA 5IYZE 3LFMA 2WMOA 2V26A 3CWZB 4I55E 3ZLIA 5LP6E 5J2TE 1WRDA 1HX8A 4AXPA 3LK2B 3LBXA 1E1HB 2YK0A 2BZBA 3VHLA 2LM9A 4I4TE 3K3NA 2CWYA 3HA4A 3UFEA 3UULA 4PJLA 2JJ9A 5JH7E 3KFWX 3AAEB 3E08A 3N2KE 4UV9B 4ERRA 5JRCB 3WAKA 2H7OA 2XTLA 5LJNA 3V5UA 1VRBA 2EHOC 2L9QA 3NZQA 2XUEA 1G73A 3P7IA 5EK3A 4YJ3E 3KVAA 3GN5B 2ZLYA 2KWHA 3U78A 4HKAA 1IJ5A 3O4XE 3C50A 3LK42 3CVRA 2BDEA 4IHJE 4IE6A 3ZEFB 5JVDE 3Q9DA 3GA8A 2W63A 2Q9QC 3BQIA 3C4ZA 4H9SE 4M1PA 2J1DG 3E0ZA 3RX6A 2VKHA 3RC3A 3OKQA 1MIWA 4XBFB 2CM0A 2MOZA 3AA1B 4GIWA 5H6RB 4BA9A 3CX7B 4HFVA 3QC9A 4X1KE 4ISSA 2D5UA 2H3RA 2XASB 2DCFA 2X9HA 2IW5B 4ANJA 1WYBA 4EYUA 4ZI2C 3MJXA 2KMFA 4DBQA 3L09A 1FMVA 2WAUA 3OYXA 1YW0A 2M67A 2A72A 2NWBA 4K0UA 4NUUA 5JDNA 1D0ZA 1LRZA 2DWGA 4PNIA 1YKEB 4HE8A 5LGTB 4PK4A 2D0TA 3Q5WA 5L3FB 2WWUA 5DJQC 1UCUA 4EAHA 5KX5E 5HWYA 5JR9C 3VKHA 2ZM8A 3HKEE 3N9QA 5LHHB 2C5IT 2JRKA 3MACA 4H9RC 4TV9E 3U3IA 3VU7H 5LGNB 4FI5A 2C5KT 3AA6B 2QA7A 2VASA 1ZHCA 2HPJA 2W62A 3O1JA 3FXDB 4MHCA 3ZMSB 5L3GB 2ODUA 4L9IA 3HKBE 3UUNA 2CA5A 3KDSE 4HN9A 4E7ZA 2NP9A 2XHEB 3PURA 4ADZA 1BR4A 5F3JA 4P0AA 4WBNE 1MNEA 5A1LA 2E8IA 3GWHA 3BK9A 5L3DB 2N2NA 2KZ7B 4MLKA 3M65A 5JDFA 4OHFA 5J2UE 3V5SA 4JLEA 3ANWB 2UXXB 3SOLA 5JR9B 3N5LA 3K3QC 3RYCE 2X68A 4PK5A 1OWAA 4C90A 1HF8A 5GONE 5AFUL 1MMAA 3D0TA 3KVBA 5LNKA 4ZI3C 2IC6A 3PUSA 4IE7A 1YD8G 3CQCB 1SA0E 3B13A 3LJCA 2LOPA 5BMVE 4IDZA 1UX4A 4TZ4C 2ZM0A 4X1YE 3SRZA 2WMNA 2EHOA 2NW9A 1BR2A 1SHZC 2JMKA 2PFVA 2Q9QD 3FBLA 3IBPA 5FXZA 5IHYA 4QX8B 3P8CD 3MA9A 4MALA 3ZN0B 3ZC0A 3A5XA 3BQLA 4ZI3D 3AB3B 2CE7A 2L8KA 2XAQB 2YU1A 4IE5A 2Q9QB 4KBMB 3KV9A 4DVDA 1IJ6A 5LOVE 2L3LA 3J7Yq 2W00A 4UF0A 2K24A 3RRCA 1MIVA 4O4JE 1WR6A 2Y48B 4H9QC 1T98A 3EDUA 4EOZB 1HFAA 5JRCA 2V1DB 3WI3A 1WLXA 4C91A 5CB4E 5EK2A 3CKDA 3AAAB 4TX5A 3C4XA 3OJAA 3RPUA 2CXDA 4PW8A 3LBXB 3TKLB 4BJNA 5FXWA 5DQWA 5HXCA 4TN7B 3L3PA 2C0SA 4TUYE 2CXLA 2NOXA 1ZKEA 3ZYMA 2VL8A 2V7LA 3PU3A 4TV8E 3ZPOA 5LGUB 1Z0PA 4CXXA 1WYCA 4CXYA 4UF0B 4FJOA 4EB6E 2C5JA 3RYHE 1S35A 4AQGA 4O4LE 4AKRB 2Q9QA 5LJMA 2EHOD 2D0UA 1NWMX 1V9DA 3ZJ1A 2LSJA 3NRXA 4OK0A 3RC8A 2NW8A 3QUJA 4UV8B 2BVMA 2PBIA 2MBGA 2KWIB 5FMNA 3PDYA 4O4IE 3UT5E 1S94A 4B6XA 2D2SA 3R84B 2LHNA 4XAXB 2DWKA 3IEEA 3N9MA 4KUMB 2IAKA 3T8OA 4O2BE 2CMRA 4IGUA 5C8YE 2ODVA 3HKDE 4GK5E 4PFPA 1HTJF 2MTQA 2X0LB 4ZHQE 2YINA 3KV5A 1FMWA 5JDLA 1EZ3A 2RA1A 2KNDA 3IHRA 3E22E 3K3OA 1MMGA 3C51A 3CQXC 4CI2B 3N9LA 3I9YA 3ZYKA 4EIWA 2KINB 3DJBA 5LHIB 2V7IA 5FY1A 3EUHA 3K8PC 4QXCB 2VKDA 3EDVA 4YJ2E 3ZYLA 4UVBB 1NAFA 5LXTE 3Q2MA 3LK3B 3C64A 4QWNB 3I1AA 3DP7A 4ISTA 2B1EA 1AJ3A 2YU2A 2NW7A 2N9DA 1D0YA 3BQKA 3H3AA 4H63H 5LCYA 2QGSA 3R6NA 5CA0E 3AVSA 3F2EA 4JEUB 4O8SA 5L2LA 3CQGB 1LKXA 4Z8XA 2XAHB 3PU8A 3HR0A 4U74A 3VKGA 5FXXA 4HEAA 4HGAA 4DO0A 5EK4A 4CXWA 4PJMA 4EXTA 4PK6A 4CQIA 4ZOLE 5FP3A 4JUYA 4AKIA 2Y6XA 5FNVE 4UXNB 1HCIA 4UEMA 3N9NA 5HXHA 4DMVA 4JEHB 4E7SA 3FB2A 5LYJE 3J9X1 1MMNA 3SS1A 5J1GA 3SWHA 5JDMA 3ZMZB 3ZJ2A 3HKCE 2W0GA 3ESLA 1VOMA 1IAPA 3WAJA 2HH7A 1ZEEA 2KXPB 3N9OA 2PJQA 5LA6E 4DMWA 5LHGB 3PE0A 4G63A 2XAFB 3N2OA 3KBUA 5HXSA 2LSKA 2GK9A 2NTYA 5JQGE 2LSYA 1G8XA 1QUUA 3CX8B 5F8PA 2MYSA 4O2AE 5LBMA 4QHOA 4EZHA 3AA0B 1OXZA 5E0OA 3Q5XA 3ZCIA 3IF8B 1U4QA 2K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HEA A;  5LNK A;  4HE8 A;  3RKO A; 
#chains in the Genus database with same CATH topology
 3RF1 A;  2WDQ A;  1D1B A;  2WM9 A;  4PJJ A;  4GYR A;  3UUM A;  2ES0 A;  2LKG A;  5F5W A;  3ZSS A;  4QKN A;  4LFB T;  3KIN B;  4IIJ E;  1HG5 A;  4IDO A;  1WR0 A;  2CCQ A;  3Q5E A;  5EZY E;  2K5B B;  5HAX A;  3I0Q A;  2FUP A;  2A3D A;  2HN2 A;  1ZOY A;  2EHO B;  2OV9 A;  2V7J A;  3HI2 A;  3ZN1 B;  4BAY B;  2VWA A;  1UX5 A;  4CI2 B;  2VKJ A;  1XMO T;  2FBW A;  2A2F X;  3Q5D A;  3PUQ A;  4CZZ B;  1W0B A;  2IUB A;  3N9P A;  2W61 A;  3RIA A;  4CI1 B;  2VK9 A;  4KHZ F;  3AE8 A;  1IBL T;  4AKG A;  2VQF T;  2OA5 A;  2QVA A;  5FY0 A;  4ZS3 A;  4BJM A;  4U2Y A;  2KT9 A;  3FZK B;  1H7C A;  2CEA A;  2LM2 A;  4YLH A;  5FXV A;  2E9X D;  3ZMU B;  1FEW A;  3NZP A;  3QK6 A;  5HEH A;  5HYA A;  1OED E;  2E9X A;  2DHR A;  4QXB B;  4AKH A;  1HNZ T;  1KK7 A;  3T1Y T;  2J47 A;  5CGM A;  3EAB A;  3ETV A;  3F31 A;  3FZL B;  3OYZ A;  4A56 A;  1XNQ T;  3EI0 A;  3JC6 C;  4X1I E;  2JQK A;  3C98 B;  4H9P C;  4UIG A;  2DLR A;  3UUX B;  2LHR A;  1I94 T;  3UU8 A;  2NR4 A;  1X9B A;  5C3J A;  4TWD A;  4WBO A;  4DND A;  1KEY A;  1HG2 A;  4F6R C;  5HXE A;  3C4W A;  3RQU A;  5HWX A;  1D0X A;  3EHZ A;  2SPC A;  4OFZ A;  1N36 T;  5HCM A;  4B3M T;  4O4H E;  2WQY A;  3NRY A;  4AQF A;  4N78 D;  4X20 E;  3DTO A;  1NEK A;  2WZH A;  2CXF A;  2UXD T;  2V7K A;  3H37 A;  4PAG A;  3ZMT B;  5DAB A;  2JPF A;  2RP4 A;  2X0Y A;  3QB5 A;  4YHJ A;  2YEV C;  5FVK A;  3RIU C;  2A9U A;  2JQQ A;  5BR8 T;  5ABF B;  4I43 B;  1N34 T;  4OYJ A;  2XAG B;  3NBX X;  5FY7 A;  3O9X A;  3KV6 A;  2LT3 A;  4U7I A;  2XQA A;  1MMD A;  4AQF C;  3RIF A;  2LLY A;  2FJB A;  2X9Y A;  3OVU A;  3RQW A;  2XQ7 A;  4GOU A;  3ZMV B;  4KMC A;  2BBH A;  2BS2 A;  3AE9 A;  3I0O A;  4P09 A;  3P4P A;  3ZCJ A;  3TLU A;  5M4Y A;  1U5P A;  4IE4 A;  3ANW A;  5DQV A;  4H9N C;  2G0U A;  5L3C B;  4I50 E;  2ZMA A;  2E2A A;  5HXR A;  3FBZ A;  1J1J A;  2H7V C;  2KLQ A;  4H9O C;  3S4U A;  4L5G A;  4P0B A;  2YDS A;  2I0M A;  4TNV A;  4KHP T;  3EAM A;  3HL6 A;  3O1I A;  2CLY B;  4IE0 A;  5AQV B;  4QXH B;  3I9W A;  2WB5 A;  3KV4 A;  4QX7 B;  4WW0 A;  4NXM T;  2WU2 A;  2ACX A;  4UR9 A;  4DR1 T;  4YXD A;  2LKH A;  4X64 T;  1KNZ A;  2W66 A;  1SUM B;  4JI8 T;  2WY2 A;  5LG4 A;  2I6H A;  2JQ9 A;  4QH5 A;  1W9R A;  2Z6E A;  2BG9 E;  1IZN B;  3FHN A;  4A97 A;  2X66 A;  1D1C A;  4LF9 T;  2XSA A;  3O1H A;  1D1A A;  5CA1 E;  5HCJ A;  2CLY C;  4HFB A;  3GN5 A;  2DNX A;  2DI4 A;  2V5C A;  3UUB A;  2LJL A;  1US7 B;  2NTX A;  1HR0 T;  2K48 A;  3CX6 B;  5KMG P;  2I59 A;  2UXN B;  4KP3 C;  5ETW A;  4JI7 T;  2P9B A;  2PG8 A;  4ZS2 A;  2IC9 A;  2HPL A;  4I0U A;  2BKN A;  4IDQ A;  3AVR A;  1O3X A;  2FJA A;  2X67 A;  4PFO A;  2X9X A;  2XAJ B;  2V8S V;  4H63 V;  2BG9 A;  2B76 A;  2LE8 A;  4LF7 T;  4HWH A;  2VKO A;  4LFA T;  1UK5 A;  1QSD A;  2ZM6 T;  1X79 A;  4UVA B;  2BS4 A;  4DBR A;  4EZ4 A;  4DV4 T;  1YQ3 A;  2LSG A;  3CIR A;  2CHN A;  2WSS V;  3ONX A;  5AQK B;  5TAO A;  4V1A v;  4PJN A;  4JI2 T;  1N33 T;  3EVY A;  2ZM2 A;  5AQQ B;  3RYI E;  2XY8 B;  1XWM A;  2CWO A;  2E9X C;  2XQY A;  3OBV E;  4GYS A;  5L3E B;  4JV5 T;  5L3B B;  3JAF A;  4L0R A;  2IIU A;  3AE5 A;  1E7P A;  2LEH A;  3JC6 D;  3AAI A;  4LMJ A;  2WDR A;  2VB6 A;  4QH1 A;  4IDP A;  1HX1 B;  5FYM A;  3TLS A;  5ADX L;  5JDH A;  3W15 B;  4CN4 A;  1XZY A;  2N1G A;  4WNK A;  5FVL A;  2VVN A;  4ZI7 E;  5H6Q B;  3RKO A;  2Y8D A;  2BVL A;  4MFR A;  4CI3 B;  4OYK A;  1MND A;  3LG7 A;  3RH3 A;  5AQF B;  4G2A A;  4AKL A;  3MK7 C;  3MZK B;  4YSY A;  4Q25 A;  4YFS A;  3VRB A;  3PUV F;  3PUY F;  3N2G E;  1LVF A;  4UVC B;  3ZT7 A;  5CFB A;  3AA7 B;  4MBQ A;  2WDV A;  3NWI A;  4HTE A;  5AQM B;  2X51 A;  1Y64 B;  1UUS A;  1B7T A;  3F57 A;  4U2Z A;  3RRW A;  4ZI2 D;  4ILU A;  2E5V A;  2XQ6 A;  4X62 T;  3P4W A;  3PUA A;  5JRE A;  4U72 A;  2HN1 A;  5LBQ B;  4ASK A;  4EYY R;  3T1H T;  2LRL A;  2MPK A;  2V7M A;  3PTR B;  1HNW T;  1CHU A;  2JMH A;  2X9W A;  3KBT A;  4J2C A;  4YTN A;  1N32 T;  1HS7 A;  3UTK A;  3VR9 A;  3CML A;  3PUZ F;  4DV7 T;  1IBM T;  2UU9 T;  4DV1 T;  4XZC A;  4U33 A;  1MIY A;  4NUV A;  3B57 A;  4YTP A;  2FJD A;  2XSB A;  3FXE B;  2LSI A;  1YKH B;  3CPZ A;  3MXZ A;  5JR9 A;  4OX9 T;  2E9X B;  4YY3 T;  2VVS A;  3ZC1 A;  3X1D A;  3PUX F;  2LOS A;  2YN6 A;  2J4G A;  3K1S A;  3MKD A;  4JBW F;  3GMI A;  4NIQ A;  4K0K T;  1ZV4 X;  2VL0 A;  2WBL A;  3UQ4 A;  5LG3 A;  1BR0 A;  5JDG A;  5AQL B;  5JDQ A;  3AEG A;  1LVK A;  1BR1 A;  3RGL A;  2YKS A;  3RYF E;  1FIO A;  4UEL A;  3UU6 A;  2XZE A;  3ETU A;  4GK0 E;  5KDM C;  1SE7 A;  1CUN A;  4DR3 T;  3PUG A;  5IYZ E;  3LFM A;  2WMO A;  2V26 A;  2WP9 A;  3CWZ B;  4I55 E;  3ZLI A;  1Y01 A;  2D9D A;  5LP6 E;  1HX8 A;  1WRD A;  1JNR A;  5HEU A;  1W09 A;  5J2T E;  4DR7 T;  4AXP A;  3LK2 B;  4EGW A;  2ACZ A;  3LBX A;  1E1H B;  2BZB A;  2YK0 A;  3VHL A;  2LM9 A;  3ZT5 A;  4I4T E;  4DV3 T;  3AEE A;  3K3N A;  2CWY A;  3HA4 A;  4TWH A;  4Z90 A;  3UFE A;  4IL4 A;  4F8H A;  3AEA A;  5AQO B;  2YDQ A;  4PJL A;  1VCS A;  3UUL A;  4Z91 A;  3ZT6 A;  2JJ9 A;  5JH7 E;  2CPT A;  2CBJ A;  3AAE B;  3E08 A;  3KFW X;  3N2K E;  3NVO A;  4UV9 B;  3WAK A;  2H7O A;  3PJA A;  2XTL A;  2KSR A;  3V5U A;  1VRB A;  5FL1 A;  5LJN A;  2EHO C;  4NXN T;  4HFE A;  2L9Q A;  3NZQ A;  1XDO A;  1G73 A;  2XUE A;  3LDQ B;  3P7I A;  5EK3 A;  4YJ3 E;  5L4E A;  3M3Z B;  3KVA A;  5AQJ B;  3GN5 B;  2ZLY A;  2KWH A;  4X66 T;  3U78 A;  4HKA A;  1IJ5 A;  3O4X E;  5IUX A;  3C50 A;  2R6G F;  3CVR A;  3LK4 2;  3ZJ2 A;  5C2T A;  1OED A;  2F4V T;  3JAD A;  2BDE A;  3AE1 A;  4IHJ E;  4HWC A;  4IE6 A;  4HWF A;  3ZEF B;  5JVD E;  5LMN T;  3Q9D A;  5AQU B;  2W63 A;  2Q9Q C;  3BQI A;  3GA8 A;  3C4Z A;  4H9S E;  4M1P A;  4TNW A;  3UU5 A;  3A8Y C;  5AQH B;  1FJG T;  2BKO A;  2J1D G;  3E0Z A;  3RX6 A;  2VKH A;  3RC3 A;  3OKQ A;  1MIW A;  2XJ7 A;  2CM0 A;  2MOZ A;  3AA1 B;  4GIW A;  4YTM A;  5H6R B;  4BA9 A;  2UUA T;  4JYA T;  3CX7 B;  4HFV A;  3QC9 A;  4X1K E;  4ISS A;  2D5U A;  5HEG A;  2H3R A;  3FZF B;  2XAS B;  2DCF A;  3VRA A;  2X9H A;  2IW5 B;  3IA3 A;  5AQN B;  4ANJ A;  1WYB A;  4ILA A;  4EYU A;  4ZI2 C;  3TLW A;  4ZXL A;  3MJX A;  2KMF A;  4DBQ A;  3JAE A;  3L09 A;  1FMV A;  2WAU A;  3OYX A;  1KF6 A;  1YW0 A;  2M67 A;  2A72 A;  2NWB A;  2AE9 A;  4K0U A;  4NUU A;  1D0Z A;  1LRZ A;  2DWG A;  5JDN A;  4PNI A;  1YKE B;  4HE8 A;  5LGT B;  2UUB T;  4PK4 A;  5KXJ A;  2D0T A;  3H3M A;  3Q5W A;  2WWU A;  5DJQ C;  5L3F B;  2FJE A;  1KNP A;  4IL9 A;  3ZKR A;  1UCU A;  4GKK T;  4EAH A;  5KX5 E;  1VCT A;  5HWY A;  4IT4 A;  5JR9 C;  2ZM8 A;  3VKH A;  3HKE E;  3N9Q A;  1M7K A;  5LHH B;  2C5I T;  2JRK A;  3MAC A;  4H9R C;  4TV9 E;  3U3I A;  4DV2 T;  3VU7 H;  5LGN B;  4DV5 T;  4AIU A;  2XQ4 A;  5JTG A;  1GQE A;  3RLF F;  2IHR 1;  4COF A;  4HWI B;  3AED A;  4FI5 A;  5AQT B;  2E5L T;  3PV0 F;  2C5K T;  3AA6 B;  2QA7 A;  4P1N A;  2VAS A;  5ABF A;  1ZHC A;  2HHH T;  2HPJ A;  2W62 A;  3O1J A;  3FXD B;  4HFH A;  4LML A;  4MHC A;  2M6I A;  3ZMS B;  4YSZ A;  1KNR A;  2ODU A;  3AE4 A;  5L3G B;  3G06 A;  4X65 T;  4L9I A;  3HKB E;  3UUN A;  2CA5 A;  3KDS E;  1W0A A;  5AQS B;  4HN9 A;  4E7Z A;  2M6B A;  2VUR A;  2NP9 A;  2XHE B;  2XM2 A;  3PUR A;  1T7S A;  1BR4 A;  4ADZ A;  5F3J A;  4P0A A;  4WBN E;  2BKP A;  4HFD A;  1MNE A;  3VR8 A;  5A1L A;  2E8I A;  3GWH A;  3BK9 A;  5L3D B;  3P4R A;  4ERR A;  2N2N A;  2KZ7 B;  4MLK A;  3M65 A;  4ILC A;  2W4X A;  4OHF A;  5JDF A;  4LF8 T;  5J2U E;  3V5S A;  4JLE A;  3ANW B;  3B5M A;  4AI6 A;  2AXD S;  2UXX B;  4LMK A;  4WYV A;  3SOL A;  2WCA A;  3N5L A;  4ZZC A;  5JR9 B;  3K3Q C;  4JI6 T;  2WWV A;  3RYC E;  2X68 A;  4PK5 A;  1OWA A;  4C90 A;  1HF8 A;  5GON E;  5AFU L;  1MMA A;  3AEB A;  3D0T A;  4U31 A;  3KVB A;  1OED C;  4ZI3 C;  2IC6 A;  5LNK A;  2PTF A;  3PUS A;  1YD8 G;  3CQC B;  4IE7 A;  3OTO T;  4DUY T;  2CBI A;  4JI4 T;  4LF4 T;  1SA0 E;  3TLT A;  3B13 A;  3LJC A;  2LOP A;  5BMV E;  4IDZ A;  1UX4 A;  4TZ4 C;  2ZM0 A;  4JI3 T;  4X1Y E;  3SRZ A;  2WMN A;  2EHO A;  2NW9 A;  1BR2 A;  3UFG A;  1SHZ C;  2JMK A;  2PFV A;  2Q9Q D;  2X0H A;  3FBL A;  3IBP A;  4WZX A;  4QX8 B;  3P8C D;  3MA9 A;  4MAL A;  5FXZ A;  3ZN0 B;  5ABE A;  3ZC0 A;  5LMU T;  3A5X A;  2XQ8 A;  3BQL A;  4B3S T;  4ZI3 D;  1WFD A;  2OLT A;  2WS3 A;  5IWA T;  3PJA J;  3AB3 B;  2CE7 A;  2L8K A;  2QRX A;  4TWF A;  2XAQ B;  2WU5 A;  2YU1 A;  3ONL C;  4NPP A;  4IE5 A;  2Q9Q B;  2V6Y A;  3KV9 A;  2V5D A;  4KBM B;  5LB7 B;  4U7Y A;  4DVD A;  1IJ6 A;  3QNU A;  3ZST A;  5J0Z A;  5LOV E;  2L3L A;  2WZI A;  3J7Y q;  2W00 A;  4UF0 A;  3AXJ A;  2K24 A;  2BS3 A;  3RRC A;  3SFD A;  5L47 A;  2IML A;  1MIV A;  4O4J E;  1WR6 A;  2Y48 B;  4H9Q C;  1T98 A;  5AQI B;  3EDU A;  4JI5 T;  4EOZ B;  1HFA A;  5JRC A;  2V1D B;  5FKY A;  1XMQ T;  3WI3 A;  1WLX A;  4C91 A;  1YQ4 A;  2V6Y B;  4ZZB A;  5CB4 E;  1T8B A;  2XPK A;  3CKD A;  5CJ5 A;  5EK2 A;  3AAA B;  4TX5 A;  5JRC B;  3RKG A;  1YXR A;  3C4X A;  3OJA A;  3RPU A;  2CXD A;  2CRB A;  1OED B;  3LBX B;  4PW8 A;  3TKL B;  4DV0 T;  2DL1 A;  4BJN A;  5FXW A;  5DQW A;  5HXC A;  4TN7 B;  3L3P A;  2C0S A;  2XQ9 A;  3P4Q A;  2H89 A;  1M62 A;  2CXL A;  2NOX A;  1ZKE A;  4TUY E;  3ZYM A;  1HNX T;  2VL8 A;  1L0V A;  2V7L A;  3PU3 A;  4TV8 E;  3ZPO A;  4YHH T;  5LGU B;  1Z0P A;  4CXX A;  1WYC A;  4CXY A;  2UXB T;  3AEC A;  4UF0 B;  4KI0 F;  4YT0 A;  3NKZ A;  4FJO A;  2C5J A;  4EB6 E;  4HWD A;  3RYH E;  1E2A A;  1S35 A;  4AQG A;  2CHO A;  4O4L E;  2Q9Q A;  4AKR B;  2UXC T;  5LJM A;  2EHO D;  2D0U A;  2XQ5 A;  1NWM X;  1V9D A;  3ZJ1 A;  2LSJ A;  3NRX A;  2QYW A;  4OK0 A;  5HEJ A;  2NW8 A;  3L39 A;  3QUJ A;  4UV8 B;  4B3T T;  2BVM A;  2PBI A;  2MBG A;  4LF6 T;  2KWI B;  4U3C A;  5FMN A;  3PDY A;  4CN1 A;  3AXJ B;  4O4I E;  1S94 A;  1ZP0 A;  3UT5 E;  4B6X A;  2D2S A;  3R84 B;  5ABH A;  4B3R T;  4JI0 T;  4XBF B;  2LHN A;  4XAX B;  1UGO A;  3RIU A;  2DWK A;  3IEE A;  3N9M A;  4KUM B;  2IAK A;  3T8O A;  4O2B E;  2CMR A;  1T72 A;  1UUR A;  4IGU A;  4X5T A;  5C8Y E;  2ODV A;  3HKD E;  4GK5 E;  4PFP A;  1HTJ F;  2MTQ A;  2X0L B;  3AE2 A;  5AQG B;  4ZHQ E;  3OPC A;  2YIN A;  3KV5 A;  1FMW A;  5JDL A;  1EZ3 A;  4DR2 T;  1WCR A;  2JIW A;  3P50 A;  4EV6 A;  1J5E T;  4LF5 T;  3CK6 A;  2W67 A;  4IDN A;  2RA1 A;  3QOF A;  2KND A;  3IHR A;  5AQR B;  3E22 E;  3K3O A;  1MMG A;  2BG9 C;  2MAW A;  3C51 A;  3CQX C;  3ONJ A;  2IDO B;  3N9L A;  1Z8U A;  2W2U A;  3I9Y A;  3ZYK A;  2KIN B;  4EIW A;  3DJB A;  5LHI B;  2V7I A;  5FY1 A;  4DID B;  3EUH A;  3RHW A;  2VQE T;  3K8P C;  4QXC B;  2VKD A;  2K3W A;  3EDV A;  3UU4 A;  4YJ2 E;  4HFC A;  3ZYL A;  4UVB B;  2RPA A;  3PUW F;  3RI5 A;  1NAF A;  4ILB A;  5LXT E;  3Q2M A;  3LK3 B;  3C64 A;  3AE6 A;  4QWN B;  3I1A A;  3DP7 A;  2LRK A;  2B1E A;  4IST A;  2YU2 A;  3AE3 A;  1R8I A;  4DR5 T;  2NW7 A;  1AJ3 A;  2N9D A;  1D0Y A;  3BQK A;  3H3A A;  4H63 H;  5LCY A;  1QLB A;  2QGS A;  3R6N A;  5CA0 E;  4LFC T;  3AVS A;  3F2E A;  4JEU B;  2YDR A;  4O8S A;  5ABG A;  3SFE A;  1LKX A;  3CQG B;  5L2L A;  3UU3 A;  4ZEY A;  4Z8X A;  2XAH B;  3PU8 A;  1JNZ A;  3HR0 A;  4DR6 T;  1I6Z A;  4U74 A;  3VKG A;  5FXX A;  4HEA A;  4HGA A;  5IHY A;  3UQ7 A;  4DO0 A;  5EK4 A;  4KX6 A;  4PJM A;  4CXW A;  2XQ3 A;  4EXT A;  4PK6 A;  4CQI A;  4ZOL E;  5FP3 A;  4JUY A;  4AKI A;  2Y6X A;  4A98 A;  3ABV A;  5FNV E;  4UXN B;  1HCI A;  4UEM A;  5AQP B;  4CN6 A;  4AQY T;  3N9N A;  5HXH A;  4DMV A;  4JEH B;  3AE7 A;  4E7S A;  3FB2 A;  3TLV A;  5LYJ E;  1KFY A;  3J9X 1;  4HFI A;  4A5X A;  2YOE A;  4EEB A;  1IBK T;  3P4S A;  1MMN A;  3SS1 A;  5J1G A;  3SWH A;  2BG9 B;  5JDM A;  4JI1 T;  1DU2 A;  3ZMZ B;  5FL0 A;  2V6X A;  2W0G A;  3ESL A;  1NEN A;  3HKC E;  1VOM A;  3AEF A;  1IAP A;  2J62 A;  3JCF A;  3LSV A;  3QB5 K;  5HEO A;  4IRE A;  3WAJ A;  4YSX A;  2HH7 A;  4DUZ T;  1ZEE A;  2KXP B;  3N9O A;  2PJQ A;  4QH4 A;  4DV6 T;  5LA6 E;  3FZM B;  4DMW A;  5LHG B;  3PE0 A;  3RC8 A;  4G63 A;  1XDP A;  1J5W A;  4AIS A;  2XAF B;  2XM1 A;  3N2O A;  5L4H A;  3KBU A;  5HXS A;  2LSK A;  2GK9 A;  2NTY A;  2BBJ A;  5JQG E;  2H88 A;  2JQH A;  1G8X A;  2LSY A;  1QUU A;  2UUC T;  3CX8 B;  5F8P A;  2MYS A;  4O2A E;  3L8R A;  4QHO A;  5LBM A;  4EZH A;  4DR4 T;  1OXZ A;  3AA0 B;  3FZH B;  4EED A;  5E0O A;  3Q5X A;  3ZCI A;  4GKJ T;  3IF8 B;  1XNR T;  3A7M A;  1U4Q A;  2K9A A; 
#chains in the Genus database with same CATH homology
 1D1B A;  2WM9 A;  4PJJ A;  4GYR A;  2ES0 A;  4QKN A;  3KIN B;  4IIJ E;  1HG5 A;  2CCQ A;  5EZY E;  2K5B B;  5HAX A;  3I0Q A;  2A3D A;  4BAY B;  3ZN1 B;  2EHO B;  2V7J A;  3HI2 A;  5L3E B;  2VWA A;  1UX5 A;  2VKJ A;  2A2F X;  3PUQ A;  4CZZ B;  3N9P A;  2W61 A;  4CI1 B;  2VK9 A;  4AKG A;  2OA5 A;  5FY0 A;  4ZS3 A;  4BJM A;  2KT9 A;  1H7C A;  2CEA A;  5FXV A;  4YLH A;  3ZMU B;  2E9X D;  1FEW A;  3NZP A;  3QK6 A;  5HYA A;  4QXB B;  2E9X A;  2DHR A;  4AKH A;  1KK7 A;  3F31 A;  3ETV A;  3OYZ A;  4A56 A;  3JC6 C;  4X1I E;  3C98 B;  4H9P C;  4UIG A;  3UUX B;  2DLR A;  2LHR A;  4WBO A;  4DND A;  5HXE A;  1HG2 A;  4F6R C;  3C4W A;  5HWX A;  1D0X A;  4OFZ A;  2SPC A;  4O4H E;  3NRY A;  4AQF A;  4N78 D;  4X20 E;  3DTO A;  2CXF A;  2V7K A;  3H37 A;  4PAG A;  3ZMT B;  5DAB A;  2JPF A;  2RP4 A;  4YHJ A;  2YEV C;  2JQQ A;  4I43 B;  4OYJ A;  2XAG B;  3NBX X;  5FY7 A;  3O9X A;  3KV6 A;  2LT3 A;  1MMD A;  4AQF C;  2X9Y A;  4GOU A;  3ZMV B;  4KMC A;  3I0O A;  4P09 A;  3ZCJ A;  5M4Y A;  1U5P A;  4IE4 A;  3ANW A;  5DQV A;  4H9N C;  2G0U A;  5L3C B;  4I50 E;  2ZMA A;  5HXR A;  3FBZ A;  2H7V C;  4H9O C;  2KLQ A;  3S4U A;  4L5G A;  4P0B A;  3HL6 A;  3O1I A;  2CLY B;  4IE0 A;  4QXH B;  3I9W A;  3KV4 A;  4QX7 B;  2ACX A;  1KNZ A;  5LG4 A;  3FHN A;  2Z6E A;  1IZN B;  2X66 A;  1D1C A;  3O1H A;  5CA1 E;  1D1A A;  2CLY C;  3GN5 A;  2DNX A;  2DI4 A;  2LJL A;  1US7 B;  2NTX A;  2K48 A;  3CX6 B;  5KMG P;  2I59 A;  2UXN B;  4KP3 C;  5ETW A;  2P9B A;  2PG8 A;  4ZS2 A;  2IC9 A;  2HPL A;  3AVR A;  1O3X A;  2X67 A;  4PFO A;  2X9X A;  2XAJ B;  4H63 V;  2LE8 A;  2VKO A;  1QSD A;  1X79 A;  4UVA B;  4DBR A;  4EZ4 A;  2LSG A;  5TAO A;  3ONX A;  2WSS V;  4V1A v;  4PJN A;  3EVY A;  2ZM2 A;  3RYI E;  2CWO A;  2E9X C;  2XQY A;  3OBV E;  4GYS A;  5L3B B;  4L0R A;  4WW0 A;  3UUM A;  2LEH A;  3JC6 D;  3AAI A;  5FYM A;  2VB6 A;  5ADX L;  5JDH A;  3W15 B;  4WNK A;  2N1G A;  4ZI7 E;  5H6Q B;  3RKO A;  2Y8D A;  2BVL A;  4MFR A;  4CI3 B;  4OYK A;  1MND A;  3LG7 A;  3RH3 A;  4G2A A;  4AKL A;  3MK7 C;  3MZK B;  4AI6 A;  4YFS A;  3N2G E;  1LVF A;  4UVC B;  3AA7 B;  4MBQ A;  4HTE A;  2X51 A;  1Y64 B;  4ZI2 D;  1B7T A;  3F57 A;  3RRW A;  4ILU A;  3PUA A;  5JRE A;  4U72 A;  4ASK A;  5LBQ B;  4EYY R;  2V7M A;  3PTR B;  2JMH A;  2X9W A;  3KBT A;  4J2C A;  1HS7 A;  3UTK A;  3CML A;  4XZC A;  1MIY A;  4NUV A;  3B57 A;  3FXE B;  2LSI A;  1YKH B;  3CPZ A;  3MXZ A;  5JR9 A;  2E9X B;  3ZC1 A;  2LOS A;  3MKD A;  1BR0 A;  3GMI A;  1ZV4 X;  2WBL A;  5JDG A;  5JDQ A;  1LVK A;  1BR1 A;  3RYF E;  1FIO A;  4UEL A;  4GK0 E;  3ETU A;  5KDM C;  1CUN A;  3PUG A;  5IYZ E;  3LFM A;  2WMO A;  2V26 A;  3CWZ B;  4I55 E;  3ZLI A;  5LP6 E;  5J2T E;  1WRD A;  1HX8 A;  4AXP A;  3LK2 B;  3LBX A;  1E1H B;  2YK0 A;  2BZB A;  3VHL A;  2LM9 A;  4I4T E;  3K3N A;  2CWY A;  3HA4 A;  3UFE A;  3UUL A;  4PJL A;  2JJ9 A;  5JH7 E;  3KFW X;  3AAE B;  3E08 A;  3N2K E;  4UV9 B;  4ERR A;  5JRC B;  3WAK A;  2H7O A;  2XTL A;  5LJN A;  3V5U A;  1VRB A;  2EHO C;  2L9Q A;  3NZQ A;  2XUE A;  1G73 A;  3P7I A;  5EK3 A;  4YJ3 E;  3KVA A;  3GN5 B;  2ZLY A;  2KWH A;  3U78 A;  4HKA A;  1IJ5 A;  3O4X E;  3C50 A;  3LK4 2;  3CVR A;  2BDE A;  4IHJ E;  4IE6 A;  3ZEF B;  5JVD E;  3Q9D A;  3GA8 A;  2W63 A;  2Q9Q C;  3BQI A;  3C4Z A;  4H9S E;  4M1P A;  2J1D G;  3E0Z A;  3RX6 A;  2VKH A;  3RC3 A;  3OKQ A;  1MIW A;  4XBF B;  2CM0 A;  2MOZ A;  3AA1 B;  4GIW A;  5H6R B;  4BA9 A;  3CX7 B;  4HFV A;  3QC9 A;  4X1K E;  4ISS A;  2D5U A;  2H3R A;  2XAS B;  2DCF A;  2X9H A;  2IW5 B;  4ANJ A;  1WYB A;  4EYU A;  4ZI2 C;  3MJX A;  2KMF A;  4DBQ A;  3L09 A;  1FMV A;  2WAU A;  3OYX A;  1YW0 A;  2M67 A;  2A72 A;  2NWB A;  4K0U A;  4NUU A;  5JDN A;  1D0Z A;  1LRZ A;  2DWG A;  4PNI A;  1YKE B;  4HE8 A;  5LGT B;  4PK4 A;  2D0T A;  3Q5W A;  5L3F B;  2WWU A;  5DJQ C;  1UCU A;  4EAH A;  5KX5 E;  5HWY A;  5JR9 C;  3VKH A;  2ZM8 A;  3HKE E;  3N9Q A;  5LHH B;  2C5I T;  2JRK A;  3MAC A;  4H9R C;  4TV9 E;  3U3I A;  3VU7 H;  5LGN B;  4FI5 A;  2C5K T;  3AA6 B;  2QA7 A;  2VAS A;  1ZHC A;  2HPJ A;  2W62 A;  3O1J A;  3FXD B;  4MHC A;  3ZMS B;  5L3G B;  2ODU A;  4L9I A;  3HKB E;  3UUN A;  2CA5 A;  3KDS E;  4HN9 A;  4E7Z A;  2NP9 A;  2XHE B;  3PUR A;  4ADZ A;  1BR4 A;  5F3J A;  4P0A A;  4WBN E;  1MNE A;  5A1L A;  2E8I A;  3GWH A;  3BK9 A;  5L3D B;  2N2N A;  2KZ7 B;  4MLK A;  3M65 A;  5JDF A;  4OHF A;  5J2U E;  3V5S A;  4JLE A;  3ANW B;  2UXX B;  3SOL A;  5JR9 B;  3N5L A;  3K3Q C;  3RYC E;  2X68 A;  4PK5 A;  1OWA A;  4C90 A;  1HF8 A;  5GON E;  5AFU L;  1MMA A;  3D0T A;  3KVB A;  5LNK A;  4ZI3 C;  2IC6 A;  3PUS A;  4IE7 A;  1YD8 G;  3CQC B;  1SA0 E;  3B13 A;  3LJC A;  2LOP A;  5BMV E;  4IDZ A;  1UX4 A;  4TZ4 C;  2ZM0 A;  4X1Y E;  3SRZ A;  2WMN A;  2EHO A;  2NW9 A;  1BR2 A;  1SHZ C;  2JMK A;  2PFV A;  2Q9Q D;  3FBL A;  3IBP A;  5FXZ A;  5IHY A;  4QX8 B;  3P8C D;  3MA9 A;  4MAL A;  3ZN0 B;  3ZC0 A;  3A5X A;  3BQL A;  4ZI3 D;  3AB3 B;  2CE7 A;  2L8K A;  2XAQ B;  2YU1 A;  4IE5 A;  2Q9Q B;  4KBM B;  3KV9 A;  4DVD A;  1IJ6 A;  5LOV E;  2L3L A;  3J7Y q;  2W00 A;  4UF0 A;  2K24 A;  3RRC A;  1MIV A;  4O4J E;  1WR6 A;  2Y48 B;  4H9Q C;  1T98 A;  3EDU A;  4EOZ B;  1HFA A;  5JRC A;  2V1D B;  3WI3 A;  1WLX A;  4C91 A;  5CB4 E;  5EK2 A;  3CKD A;  3AAA B;  4TX5 A;  3C4X A;  3OJA A;  3RPU A;  2CXD A;  4PW8 A;  3LBX B;  3TKL B;  4BJN A;  5FXW A;  5DQW A;  5HXC A;  4TN7 B;  3L3P A;  2C0S A;  4TUY E;  2CXL A;  2NOX A;  1ZKE A;  3ZYM A;  2VL8 A;  2V7L A;  3PU3 A;  4TV8 E;  3ZPO A;  5LGU B;  1Z0P A;  4CXX A;  1WYC A;  4CXY A;  4UF0 B;  4FJO A;  4EB6 E;  2C5J A;  3RYH E;  1S35 A;  4AQG A;  4O4L E;  4AKR B;  2Q9Q A;  5LJM A;  2EHO D;  2D0U A;  1NWM X;  1V9D A;  3ZJ1 A;  2LSJ A;  3NRX A;  4OK0 A;  3RC8 A;  2NW8 A;  3QUJ A;  4UV8 B;  2BVM A;  2PBI A;  2MBG A;  2KWI B;  5FMN A;  3PDY A;  4O4I E;  3UT5 E;  1S94 A;  4B6X A;  2D2S A;  3R84 B;  2LHN A;  4XAX B;  2DWK A;  3IEE A;  3N9M A;  4KUM B;  2IAK A;  3T8O A;  4O2B E;  2CMR A;  4IGU A;  5C8Y E;  2ODV A;  3HKD E;  4GK5 E;  4PFP A;  1HTJ F;  2MTQ A;  2X0L B;  4ZHQ E;  2YIN A;  3KV5 A;  1FMW A;  5JDL A;  1EZ3 A;  2RA1 A;  2KND A;  3IHR A;  3E22 E;  3K3O A;  1MMG A;  3C51 A;  3CQX C;  4CI2 B;  3N9L A;  3I9Y A;  3ZYK A;  4EIW A;  2KIN B;  3DJB A;  5LHI B;  2V7I A;  5FY1 A;  3EUH A;  3K8P C;  4QXC B;  2VKD A;  3EDV A;  4YJ2 E;  3ZYL A;  4UVB B;  1NAF A;  5LXT E;  3Q2M A;  3LK3 B;  3C64 A;  4QWN B;  3I1A A;  3DP7 A;  4IST A;  2B1E A;  1AJ3 A;  2YU2 A;  2NW7 A;  2N9D A;  1D0Y A;  3BQK A;  3H3A A;  4H63 H;  5LCY A;  2QGS A;  3R6N A;  5CA0 E;  3AVS A;  3F2E A;  4JEU B;  4O8S A;  5L2L A;  3CQG B;  1LKX A;  4Z8X A;  2XAH B;  3PU8 A;  3HR0 A;  4U74 A;  3VKG A;  5FXX A;  4HEA A;  4HGA A;  4DO0 A;  5EK4 A;  4CXW A;  4PJM A;  4EXT A;  4PK6 A;  4CQI A;  4ZOL E;  5FP3 A;  4JUY A;  4AKI A;  2Y6X A;  5FNV E;  4UXN B;  1HCI A;  4UEM A;  3N9N A;  5HXH A;  4DMV A;  4JEH B;  4E7S A;  3FB2 A;  5LYJ E;  3J9X 1;  1MMN A;  3SS1 A;  5J1G A;  3SWH A;  5JDM A;  3ZMZ B;  3ZJ2 A;  3HKC E;  2W0G A;  3ESL A;  1VOM A;  1IAP A;  3WAJ A;  2HH7 A;  1ZEE A;  2KXP B;  3N9O A;  2PJQ A;  5LA6 E;  4DMW A;  5LHG B;  3PE0 A;  4G63 A;  2XAF B;  3N2O A;  3KBU A;  5HXS A;  2LSK A;  2GK9 A;  2NTY A;  5JQG E;  2LSY A;  1G8X A;  1QUU A;  3CX8 B;  5F8P A;  2MYS A;  4O2A E;  5LBM A;  4QHO A;  4EZH A;  3AA0 B;  1OXZ A;  5E0O A;  3Q5X A;  3ZCI A;  3IF8 B;  1U4Q A;  2K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...