4HEAA

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 33
structure length 117
sequence length 117
chains with identical sequence P
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4heaA00
4HEAA 4HE8A 5LNKA 3RKOA
chains in the Genus database with same CATH superfamily
2V7IA 2CBIA 4ZS2A 1YKEB 2K48A 1KNRA 3M3ZB 1D1CA 2J47A 5HEUA 3KVAA 3GMIA 1E2AA 1OEDE 5DQWA 3AEFA 4OFZA 2LEHA 2YDSA 4I55E 3X1DA 2CM0A 3E0ZA 4EAHA 4YT0A 2VASA 4YJ2E 2BG9B 3AE8A 5AFUL 1N33T 4DBQA 2NW9A 4ASKA 3KV9A 5L3GB 4HTEA 2C5IT 2X0HA 1G8XA 3RGLA 3F31A 3FZHB 3JC6D 4EXTA 3AECA 5F5WA 4E7ZA 4CQIA 2E5VA 4PJJA 4MLKA 4AKHA 4WBOA 1HG2A 3EHZA 3AE2A 5TAOA 3QB5A 5HXCA 2WB5A 2BKPA 5CA0E 1OWAA 5HXRA 2KT9A 5C8YE 2N2NA 2XQAA 2LSIA 4IE7A 5JVDE 3L8RA 3AAEB 3VU7H 4YSZA 3BK9A 4ZI2C 3PJAA 2RPAA 1OEDA 3NZQA 3P4PA 3QB5K 1WR0A 2FBWA 3K8PC 3RX6A 2WU5A 2LSKA 1KNZA 2IIUA 4AI6A 4IDNA 4IL9A 4AKGA 2M6BA 3PE0A 3UULA 4F6RC 4GK5E 3I9YA 4TZ4C 4PFPA 1LVKA 4X5TA 5BMVE 5M4YA 2YKSA 2DL1A 5ABFB 2VQET 2G0UA 1I94T 1HNWT 3ETUA 5C2TA 3AVSA 3B57A 1S35A 2ODUA 4PFOA 4U33A 2KXPB 4UV8B 5EK4A 1HS7A 2R6GF 1UCUA 3UTKA 1V9DA 4DVDA 4YJ3E 2W67A 2HPJA 3ZN0B 2W0GA 1KK7A 4ADZA 5JDFA 2VKOA 1HX8A 3NRXA 1MNEA 1NWMX 2IMLA 3ZN1B 1YQ4A 2ACZA 4X64T 4UELA 3O1JA 3SWHA 4CXXA 2B76A 2V5DA 5JDHA 4I4TE 2CCQA 2WS3A 4YFSA 2XSBA 3C64A 3KVBA 5ABHA 2VB6A 2ZM2A 4U3CA 1LKXA 4U2YA 4H9RC 1HTJF 2MBGA 3FZKB 3FB2A 1WCRA 5LCYA 4WNKA 4DV6T 3RC8A 2V7JA 3RQWA 4HFBA 2I6HA 2XZEA 3C98B 4NXNT 3GWHA 3KBTA 2X9WA 3OBVE 1E1HB 3ZYMA 2IC6A 5LOVE 2YDRA 3RLFF 4H9NC 3ZMTB 4Z91A 4TNWA 1H7CA 2XPKA 5HXHA 2NR4A 2JMHA 3AE5A 3HR0A 4DV7T 4NXMT 1XNRT 4ZS3A 4XZCA 1QUUA 2LKGA 2DWKA 3K3NA 4LF9T 5F3JA 4ZI7E 3J7Yq 3VKHA 4OK0A 4IE0A 4O4JE 3ZPOA 3KFWX 3RYFE 3ZLIA 3LFMA 4TNVA 3R6NA 2RP4A 3P4WA 3RHWA 4O4LE 4LFCT 5DABA 3N2KE 2UUBT 4A5XA 4JBWF 4UR9A 2UXXB 4CN4A 3C51A 4DBRA 5DJQC 3I0OA 3SFDA 4JI1T 3QOFA 4O4HE 3HKBE 4L9IA 4DV5T 5J1GA 3QNUA 1WR6A 4CI3B 3TLUA 3ABVA 2JRKA 2Y6XA 4O8SA 5FY0A 2Y48B 4O4IE 3AVRA 4LF7T 3ZEFB 3K3QC 4X66T 2WWVA 3N9NA 3ONLC 2QGSA 3RIAA 1J5ET 4JI3T 4K0KT 1O3XA 3BQLA 5ETWA 4AQFC 1MMAA 2D2SA 3AXJA 3AEDA 5LG4A 2H7OA 4JI6T 3DTOA 3ZMZB 5HCMA 1SUMB 2DNXA 3PUYF 3VKGA 3UU4A 2JJ9A 3EDUA 4X20E 3BQKA 3AE1A 4O2BE 4WZXA 2BDEA 2E9XC 1N34T 2H7VC 1KEYA 1YKHB 2VK9A 4PNIA 2XQ8A 4TX5A 3TLWA 4DR4T 3FZLB 4DV4T 1UGOA 2E5LT 3LK3B 4ZOLE 2F4VT 5FY1A 4HFEA 1XWMA 2EHOD 3EI0A 3OYZA 5AQHB 2JQKA 4EEBA 3OPCA 5JDMA 2ZLYA 3C50A 4QH4A 2LLYA 3WAKA 5LYJE 2W4XA 2JQHA 4YHJA 1US7B 3PURA 1WFDA 5HEHA 3AXJB 3AEAA 2ZM0A 2YDQA 2BKOA 3EUHA 3RI5A 1D1BA 1T98A 2NTXA 5JDLA 3AE7A 3Q5XA 3T8OA 2WWUA 1IBMT 2LRLA 2PBIA 4EEDA 5JR9B 5J2UE 1BR4A 2D0TA 1KNPA 3LK42 4HWDA 1X79A 4M1PA 4Z8XA 4ZZBA 5LJNA 2A9UA 5JRCA 4OHFA 2CLYC 4IGUA 4HFIA 1ZOYA 4WW0A 2LSGA 4JEUB 1KF6A 3KV4A 1Z8UA 2DHRA 1X9BA 4U72A 2LHNA 3EAMA 3IA3A 3O4XE 1IJ5A 4QKNA 4UXNB 5H6QB 5HCJA 3TLVA 4XAXB 4ANJA 4JI2T 3ZCIA 5J2TE 1IBLT 4JYAT 2IW5B 4DV1T 1B7TA 4MALA 4FI5A 1MMNA 2XSAA 3PDYA 2YOEA 4BJMA 4AQGA 1M62A 2A3DA 3NVOA 4TWFA 5LGTB 2Q9QD 1ZEEA 3HKEE 5AQOB 2X51A 3WI3A 4KBMB 4UVAB 4TV9E 4YTMA 4YHHT 3OTOT 1MIWA 3N9PA 3PJAJ 4LFAT 4UEMA 5L3EB 3A5XA 5AQLB 2LRKA 3LG7A 4WYVA 3PUWF 1L0VA 4N78D 3UU6A 4H9OC 3SS1A 5ADXL 2HHHT 3E08A 4ILAA 3HL6A 5JR9A 3CPZA 3V5UA 2A2FX 2W61A 1VOMA 3N5LA 1G73A 3UUMA 2WCAA 2VWAA 3ZJ1A 1OEDC 2MAWA 4DNDA 3O1HA 3RYIE 3SOLA 4EGWA 4DR6T 1BR0A 4TN7B 2JMKA 3F57A 3RH3A 2BVMA 1D0YA 3AEBA 3ONJA 2CBJA 2MTQA 4EYYR 5KX5E 3F2EA 2BS4A 2JQQA 4HEAA 2CWOA 2X0LB 4HWFA 4IE4A 2ACXA 2VVNA 5E0OA 2QVAA 5AQPB 2H88A 2W62A 2WDRA 2WU2A 4IE5A 2SPCA 1J1JA 2V6XA 5JH7E 1UURA 1T8BA 2V7LA 2PJQA 4DMVA 2OV9A 2LJLA 2MOZA 3UU5A 5JDNA 5BR8T 2XY8B 4QWNB 2CPTA 3L09A 4IHJE 3RF1A 4ZZCA 3PTRB 4DMWA 4HFDA 5L3FB 3KV6A 2UXBT 4ZI3D 4GOUA 4HFCA 2KMFA 5AQTB 4DR3T 4B3MT 1XZYA 4TV8E 2K9AA 1W9RA 2E2AA 2ZM8A 2CLYB 2CRBA 2PTFA 3FZMB 3KDSE 4GIWA 3SRZA 4IIJE 3UUNA 2VQFT 2WDVA 5AQSB 3Q2MA 3I9WA 1FMWA 2BKNA 3NWIA 2W63A 3U78A 3HI2A 4DV3T 1YQ3A 1ZV4X 2CXDA 2X0YA 2X66A 4Q25A 3WAJA 5CFBA 4EYUA 1OXZA 4QH1A 4A97A 5LB7B 3ANWB 4QXHB 2J62A 3PV0F 4AIUA 1MMDA 2IUBA 3AA0B 5FY7A 3RIUC 2KSRA 2XAHB 5FXVA 3I0QA 3P4RA 3ESLA 2KZ7B 1YW0A 3PUXF 5IWAT 4AQFA 2XM1A 3M65A 2C0SA 2X67A 1IJ6A 3FHNA 2V1DB 3KINB 3TLSA 5JDGA 2LOSA 5AQJB 5HWYA 4CI2B 2ZMAA 2WSSV 5KXJA 4CXYA 2XJ7A 4KUMB 1Y64B 2V7KA 1U4QA 3O9XA 2UXNB 4CI1B 2W00A 2C5JA 2FJDA 3D0TA 4WBNE 3ZT5A 1DU2A 4PJNA 5FL1A 2J4GA 3UU8A 2WM9A 3RPUA 3JAEA 2Z6EA 3RRCA 3N2OA 4IREA 2V7MA 3BQIA 3TKLB 3OJAA 3ANWA 5DQVA 4U74A 5AQGB 2GK9A 3VRBA 5JRCB 1U5PA 4X65T 4E7SA 5HWXA 3UUXB 1SHZC 5EK2A 2FJAA 3IHRA 4GK0E 1CUNA 4IDZA 4J2CA 4CXWA 2XTLA 3PUAA 3ZMVB 4OX9T 3PUZF 1W0BA 4KI0F 2KLQA 5LJMA 5AQNB 5LNKA 1HNXT 3SFEA 4IL4A 2NP9A 2VVSA 1HX1B 4HN9A 1XMOT 4FJOA 2QA7A 1VCSA 1NAFA 4TWDA 4DV0T 4F8HA 2WMNA 3QUJA 2IC9A 5H6RB 5CJ5A 2XASB 5CGMA 2WY2A 3CK6A 3N9OA 4JI0T 3NBXX 2W2UA 1N32T 2NW8A 4DR1T 4JEHB 3ZYKA 3EABA 3Q5DA 4HGAA 5HYAA 5AQFB 3UUBA 4B3TT 3MXZA 4LMJA 4JI5T 3AEEA 5GONE 3VR8A 4YXDA 3A8YC 5LXTE 4G63A 5L3CB 4LF4T 2VL0A 3B13A 3JADA 4I0UA 4KHZF 3ONXA 2X68A 2IAKA 1IZNB 2H89A 2FJEA 1KFYA 3OVUA 5LBQB 2HN1A 3JAFA 2Q9QA 4UIGA 3ZMSB 3JC6C 4X62T 4CN1A 2NW7A 5HEOA 1FJGT 4LFBT 3CX6B 1FMVA 4IT4A 4KMCA 2D5UA 3ZKRA 3ZSTA 4COFA 5AQUB 4HWHA 1Z0PA 5JTGA 1QLBA 3N9MA 4H9SE 4X1IE 3OKQA 3CMLA 4PJLA 2L8KA 3LSVA 3N9LA 4YY3T 2CHOA 4B3ST 2J1DG 2LSYA 2WMOA 4LMKA 4PW8A 4AKRB 2X9HA 3HKCE 2LT3A 4JI8T 4V1Av 4AKIA 4HFVA 3RKOA 3MA9A 2D9DA 3T1YT 3AA1B 1GQEA 5HEGA 3AE9A 1N36T 2YEVC 2LE8A 3AB3B 4QX7B 4EZHA 5AQKB 4L0RA 2XHEB 2DCFA 5EK3A 4BA9A 2JIWA 3ZC0A 2Q9QC 3CIRA 4ZI2D 4YTPA 4PJMA 1D0ZA 4ZXLA 3RIUA 2XQ7A 2VKDA 4JV5T 4EV6A 5J0ZA 2BS2A 3Q5WA 4Z90A 4I50E 3UT5E 3C4ZA 4IDOA 2CA5A 1HG5A 2ES0A 4K0UA 1WRDA 3CQXC 4B6XA 4GKKT 3RYHE 2BG9A 3V5SA 5LA6E 4PK6A 2LM2A 1UX4A 1E7PA 5IHYA 3ZSSA 2UUCT 3MK7C 4U2ZA 3C4WA 2WQYA 4H63V 4P0BA 5LP6E 5HXEA 3UFEA 2UUAT 4P1NA 4JLEA 3FBZA 4MBQA 4KHPT 4IE6A 2VL8A 2HH7A 2K3WA 4H63H 2YU1A 4U31A 3ZMUB 4EIWA 5C3JA 2KINB 5FP3A 3CKDA 3CQCB 3VR9A 4NUVA 4DO0A 3PU8A 3AE4A 2YN6A 4GYRA 3UU3A 4DUYT 3T1HT 2YK0A 1WLXA 5AQMB 3AE3A 3VHLA 1ZKEA 2E8IA 4QH5A 3U3IA 4MHCA 1BR2A 2MPKA 5ABFA 3AE6A 2LM9A 3UQ7A 3ZJ2A 2XQ4A 4TWHA 2B1EA 4JUYA 1HCIA 3E22E 1JNZA 3GN5B 2EHOA 4KX6A 1S94A 2LKHA 4P0AA 4OYKA 2XQ9A 1FIOA 2P9BA 5FXZA 5JQGE 4QX8B 4QHOA 2E9XD 2E9XA 2VKHA 1EZ3A 4ILCA 4QXCB 1LVFA 5FXWA 2M6IA 2AE9A 5L4HA 1ZP0A 5KDMC 1HF8A 1NEKA 1R8IA 2BZBA 2QRXA 5FYMA 3RYCE 2WZIA 2XAGB 3P8CD 4DR5T 2JPFA 4U7YA 1XMQT 2D0UA 1FEWA 3Q5EA 5FVLA 4H9QC 5CB4E 2UU9T 2WDQA 5IYZE 2N1GA 2LHRA 4KP3C 1OEDB 5FXXA 3ZC1A 1NENA 1SE7A 2K5BB 1MNDA 4IDQA 3JCFA 5LGUB 5ABGA 2NOXA 4HE8A 4ZHQE 2BS3A 5FNVE 3ZT7A 1M7KA 2V26A 5LHIB 2VKJA 1W0AA 2NTYA 4HFHA 1HNZT 3NRYA 5HAXA 3RRWA 1MIYA 4DUZT 3EVYA 3PUSA 5IUXA 5JDQA 2VURA 4I43B 4ERRA 1LRZA 2X9YA 3KV5A 3QK6A 3HA4A 3Q9DA 4LF5T 3I1AA 3P4SA 3DJBA 3ZT6A 1HFAA 1I6ZA 2M67A 3QC9A 3R84B 1WYCA 3RQUA 3B5MA 1SA0E 4AXPA 4LF6T 4ISTA 3CQGB 2YINA 2L3LA 3GA8A 3GN5A 3FXEB 3OYXA 5AQVB 4C90A 1D0XA 3NZPA 1HR0T 3P7IA 5AQIB 1D1AA 4EZ4A 5FKYA 4AISA 4UV9B 1UX5A 3CWZB 4NUUA 2V6YA 4LF8T 1VRBA 4EOZB 5L4EA 5LHHB 5L47A 3J9X1 4ILUA 4UVBB 2V6YB 2XAFB 3L39A 2IDOB 1Y01A 2K24A 2XQ5A 3AA7B 4H9PC 2KNDA 4BJNA 5HXSA 4QXBB 4MFRA 5LMUT 1UK5A 4L5GA 2OLTA 4YLHA 5FVKA 4ZI3C 4U7IA 1IAPA 3EDVA 3H3MA 4HWCA 2RA1A 4B3RT 2UXDT 4XBFB 1MIVA 4YSXA 3O1IA 4HWIB 1JNRA 1YXRA 1CHUA 4ILBA 5F8PA 2ZM6T 2HN2A 2KWHA 3CX7B 4GKJT 2FJBA 4A98A 2WP9A 3LBXA 3A7MA 3ETVA 3PUVF 4CN6A 2I0MA 2WAUA 4UVCB 3MACA 4NIQA 2DI4A 3G06A 2C5KT 2YU2A 4UF0A 4X1KE 5EZYE 3RKGA 4YSYA 5AQQB 3W15B 3PUGA 3FBLA 2NWBA 2MYSA 4AQYT 2V5CA 2W66A 3UFGA 1YD8G 2I59A 3P4QA 4PAGA 3PUQA 2ODVA 5JREA 1J5WA 2PG8A 3MKDA 3TLTA 3LK2B 5L2LA 4G2AA 5LMNT 2HPLA 3VRAA 3MJXA 3K1SA 2BG9E 3FZFB 3H3AA 3HKDE 2OA5A 3DP7A 4O2AE 3CVRA 4DV2T 1XDPA 2WBLA 5HEJA 2XUEA 2CEAA 3IEEA 4PK5A 1ZHCA 1UUSA 5A1LA 3IF8B 2H3RA 3KBUA 2XAJB 3CX8B 4UF0B 2KWIB 3N9QA 4A56A 1VCTA 2BBHA 2DLRA 2EHOB 4BAYB 2FUPA 5FMNA 1MMGA 4GYSA 3S4UA 4DR2T 3K3OA 3MZKB 3C4XA 4YTNA 2X9XA 2DWGA 2PFVA 2XAQB 3AA6B 5LG3A 4LMLA 2LSJA 4JI7T 3AEGA 3P50A 2WZHA 4IDPA 4AKLA 2CMRA 1WYBA 2QYWA 1T7SA 2Q9QB 5AQRB 2LOPA 4P09A 4PK4A 5FL0A 5LBMA 3UQ4A 4CZZB 5ABEA 2XQYA 5L3BB 1QSDA 2CHNA 2E9XB 3PU3A 3RIFA 3ZCJA 2BG9C 4EB6E 5CA1E 2UXCT 2XM2A 2XQ3A 2N9DA 2BBJA 1AJ3A 2IHR1 2AXDS 1XDOA 2Y8DA 3LBXB 4HKAA 4TUYE 5KMGP 4NPPA 4JI4T 1IBKT 1BR1A 2CE7A 3ZYLA 4C91A 3LJCA 3LDQB 2A72A 2L9QA 3AAAB 3IBPA 3L3PA 4OYJA 3RC3A 4ZEYA 5L3DB 4DR7T 3AAIA 2JQ9A 2BVLA 3FXDB 5LGNB 2CWYA 2V8SV 4ISSA 2CXFA 3NKZA 2XQ6A 3N2GE 4DIDB 1XNQT 1W09A 2CXLA 5LHGB 4X1YE 5JR9C 2EHOC 1T72A 3H37A
chains in the Genus database with same CATH topology
2V7IA 4ZS2A 1YKEB 2K48A 1D1CA 3KVAA 3GMIA 5DQWA 4OFZA 2LEHA 4I55E 2CM0A 3E0ZA 4EAHA 2VASA 4YJ2E 5AFUL 4DBQA 2NW9A 4ASKA 3KV9A 5L3GB 4HTEA 2C5IT 1G8XA 3F31A 3JC6D 4EXTA 4E7ZA 4CQIA 4PJJA 4MLKA 4AKHA 4WBOA 1HG2A 5TAOA 5HXCA 5CA0E 1OWAA 5HXRA 2KT9A 5C8YE 2N2NA 2LSIA 4IE7A 5JVDE 3AAEB 3VU7H 3BK9A 4ZI2C 3NZQA 3RX6A 1KNZA 3K8PC 2LSKA 4AI6A 4AKGA 3PE0A 3UULA 4F6RC 4GK5E 3I9YA 4TZ4C 4PFPA 1LVKA 5BMVE 5M4YA 2G0UA 3ETUA 3AVSA 3B57A 1S35A 2ODUA 4PFOA 4UV8B 2KXPB 5EK4A 1HS7A 1UCUA 3UTKA 1V9DA 4DVDA 4YJ3E 2HPJA 3ZN0B 2W0GA 1KK7A 4ADZA 5JDFA 2VKOA 1HX8A 3NRXA 1MNEA 1NWMX 3ZN1B 4UELA 3O1JA 3SWHA 4CXXA 5JDHA 4I4TE 2CCQA 4YFSA 3C64A 3KVBA 2VB6A 2ZM2A 1LKXA 4H9RC 1HTJF 2MBGA 3FB2A 5LCYA 4WNKA 3RC8A 2V7JA 3C98B 3GWHA 3KBTA 2X9WA 3OBVE 1E1HB 3ZYMA 2IC6A 5LOVE 4H9NC 3ZMTB 1H7CA 5HXHA 2JMHA 3HR0A 4ZS3A 4XZCA 1QUUA 2DWKA 3K3NA 3J7Yq 4ZI7E 3VKHA 4OK0A 4IE0A 4O4JE 3ZPOA 3KFWX 3RYFE 3ZLIA 3LFMA 3R6NA 2RP4A 4O4LE 5DABA 3N2KE 2UXXB 3C51A 4DBRA 5DJQC 3I0OA 4O4HE 3HKBE 4L9IA 5J1GA 1WR6A 4CI3B 5FY0A 2JRKA 2Y6XA 4O8SA 2Y48B 4O4IE 3AVRA 3ZEFB 3K3QC 3N9NA 2QGSA 1O3XA 3BQLA 5ETWA 4AQFC 1MMAA 2D2SA 5LG4A 2H7OA 3DTOA 3ZMZB 2DNXA 3VKGA 2JJ9A 3EDUA 4X20E 3BQKA 4O2BE 2BDEA 2E9XC 2H7VC 1YKHB 2VK9A 4PNIA 4TX5A 3LK3B 4ZOLE 5FY1A 2EHOD 3OYZA 5JDMA 2ZLYA 3C50A 3WAKA 5LYJE 4YHJA 1US7B 3PURA 2ZM0A 3EUHA 5JDLA 1D1BA 1T98A 2NTXA 3Q5XA 3T8OA 2WWUA 2PBIA 5JR9B 5J2UE 1BR4A 2D0TA 3LK42 4Z8XA 1X79A 4M1PA 5LJNA 5JRCA 4OHFA 2CLYC 4IGUA 4WW0A 2LSGA 4JEUB 3KV4A 2DHRA 5HYAA 4U72A 2LHNA 3O4XE 5H6QB 1IJ5A 4QKNA 4UXNB 5J2TE 4XAXB 4ANJA 3ZCIA 2IW5B 1B7TA 4MALA 4FI5A 1MMNA 3PDYA 4BJMA 4AQGA 2A3DA 5LGTB 2Q9QD 1ZEEA 3HKEE 2X51A 3WI3A 4KBMB 4UVAB 4TV9E 1MIWA 3N9PA 4UEMA 5L3EB 3A5XA 3LG7A 4N78D 5ADXL 4H9OC 3SS1A 3E08A 5JR9A 3HL6A 3CPZA 3V5UA 2A2FX 2W61A 1VOMA 3N5LA 1G73A 3UUMA 3ZJ1A 2VWAA 4DNDA 3O1HA 3RYIE 3SOLA 1BR0A 4TN7B 2JMKA 3F57A 3RH3A 2BVMA 1D0YA 5KX5E 2MTQA 4EYYR 3F2EA 2JQQA 4HEAA 2CWOA 2X0LB 4IE4A 2ACXA 5E0OA 2W62A 4IE5A 2SPCA 5JH7E 2V7LA 2PJQA 4DMVA 2LJLA 2MOZA 4QWNB 3L09A 4IHJE 3PTRB 4DMWA 5L3FB 3KV6A 4ZI3D 4GOUA 2KMFA 4TV8E 2K9AA 2ZM8A 3KDSE 5HWXA 2CLYB 3SRZA 3UUNA 4GIWA 4IIJE 3Q2MA 3I9WA 1FMWA 2W63A 3U78A 3HI2A 1ZV4X 2CXDA 2X66A 3WAJA 4EYUA 1OXZA 3ANWB 4QXHB 1MMDA 3AA0B 5FY7A 2XAHB 5FXVA 3I0QA 3ESLA 2KZ7B 1YW0A 4AQFA 3M65A 2C0SA 2X67A 1IJ6A 3FHNA 2V1DB 3KINB 5JDGA 2LOSA 5HWYA 4CI2B 2ZMAA 2WSSV 4CXYA 4KUMB 1Y64B 2V7KA 1U4QA 3O9XA 2UXNB 4CI1B 2W00A 2C5JA 3D0TA 4WBNE 4PJNA 2WM9A 3RPUA 3RRCA 2Z6EA 3N2OA 2V7MA 3BQIA 3TKLB 3OJAA 3ANWA 5DQVA 4U74A 2GK9A 5JRCB 1U5PA 4E7SA 3UUXB 1SHZC 5EK2A 4IDZA 3IHRA 4GK0E 1CUNA 4J2CA 4CXWA 2XTLA 3PUAA 3ZMVB 2KLQA 5LJMA 5LNKA 2NP9A 4HN9A 4FJOA 2QA7A 1NAFA 2WMNA 3QUJA 2IC9A 5H6RB 2XASB 3N9OA 3NBXX 2NW8A 4JEHB 3ZYKA 4HGAA 3MXZA 5GONE 5LXTE 4G63A 5L3CB 3B13A 5HXSA 3ONXA 2X68A 2IAKA 1IZNB 5LBQB 3ZMSB 4UIGA 2Q9QA 3JC6C 2NW7A 3CX6B 1FMVA 4KMCA 2D5UA 1Z0PA 3N9MA 4H9SE 4X1IE 3OKQA 3CMLA 4PJLA 2L8KA 3N9LA 2J1DG 2LSYA 2WMOA 4PW8A 4AKIA 4AKRB 2X9HA 3HKCE 2LT3A 4V1Av 4HFVA 3RKOA 3MA9A 3AA1B 2YEVC 2LE8A 3AB3B 4QX7B 4EZHA 4L0RA 2XHEB 2DCFA 5EK3A 4BA9A 3ZC0A 2Q9QC 4ZI2D 4PJMA 1D0ZA 2VKDA 3Q5WA 4I50E 3UT5E 3C4ZA 2CA5A 1HG5A 2ES0A 4K0UA 1WRDA 3CQXC 4B6XA 3RYHE 3V5SA 5LA6E 4PK6A 1UX4A 5IHYA 3MK7C 3C4WA 4H63V 4P0BA 5LP6E 5HXEA 3UFEA 4JLEA 3FBZA 4MBQA 4IE6A 2VL8A 2HH7A 4H63H 2YU1A 3ZMUB 4EIWA 2KINB 5FP3A 3CKDA 3CQCB 4DO0A 4NUVA 3PU8A 4GYRA 2YK0A 1WLXA 3VHLA 1ZKEA 2E8IA 3U3IA 4MHCA 1BR2A 2LM9A 3ZJ2A 2B1EA 4JUYA 1HCIA 3E22E 3GN5B 2EHOA 1S94A 4P0AA 4OYKA 1FIOA 2P9BA 5FXZA 5JQGE 4QX8B 4QHOA 2E9XD 2E9XA 2VKHA 1EZ3A 4QXCB 1LVFA 5FXWA 5KDMC 1HF8A 2BZBA 5FYMA 3RYCE 2XAGB 3P8CD 2JPFA 2D0UA 1FEWA 5CB4E 4H9QC 5IYZE 2N1GA 2LHRA 4KP3C 5FXXA 3ZC1A 2K5BB 1MNDA 5LGUB 2NOXA 4HE8A 4ZHQE 5FNVE 5LHIB 2V26A 2VKJA 2NTYA 3NRYA 5HAXA 3RRWA 1MIYA 3EVYA 3PUSA 5JDQA 4I43B 4ERRA 1LRZA 2X9YA 3KV5A 3QK6A 3HA4A 3Q9DA 3I1AA 3DJBA 1HFAA 2M67A 3QC9A 3R84B 1WYCA 1SA0E 4AXPA 4ISTA 3CQGB 2YINA 2L3LA 3GA8A 3GN5A 3FXEB 3OYXA 1D0XA 3NZPA 3P7IA 1D1AA 4EZ4A 4UV9B 1UX5A 3CWZB 4NUUA 4EOZB 1VRBA 5LHHB 3J9X1 4ILUA 4UVBB 2XAFB 2K24A 4H9PC 3AA7B 4BJNA 2KNDA 4QXBB 4MFRA 4L5GA 4YLHA 4ZI3C 1IAPA 3EDVA 2RA1A 4XBFB 1MIVA 3O1IA 5F8PA 2KWHA 3CX7B 3LBXA 3ETVA 2WAUA 4UVCB 3MACA 4X1KE 2DI4A 5EZYE 2C5KT 2YU2A 4UF0A 3W15B 3PUGA 3FBLA 2NWBA 2MYSA 1YD8G 2I59A 4PAGA 3PUQA 2ODVA 5JREA 3MKDA 2PG8A 3LK2B 5L2LA 4G2AA 2HPLA 3MJXA 3HKDE 3H3AA 2OA5A 3DP7A 4O2AE 3CVRA 2WBLA 2XUEA 2CEAA 3IEEA 4PK5A 1ZHCA 5A1LA 3IF8B 2H3RA 3KBUA 2XAJB 3CX8B 4UF0B 2KWIB 3N9QA 4A56A 2DLRA 4BAYB 2EHOB 5FMNA 1MMGA 4GYSA 3S4UA 3K3OA 3MZKB 3C4XA 2X9XA 3AA6B 2DWGA 2PFVA 2XAQB 2LSJA 4AKLA 2CMRA 1WYBA 4C90A 2Q9QB 5LBMA 4CZZB 2LOPA 4P09A 4PK4A 5F3JA 2XQYA 5L3BB 1QSDA 2E9XB 3PU3A 3ZCJA 5CA1E 4EB6E 2N9DA 1AJ3A 2Y8DA 3LBXB 4HKAA 4TUYE 5KMGP 1BR1A 2CE7A 3ZYLA 4C91A 3LJCA 3RC3A 2A72A 2L9QA 3AAAB 3IBPA 3L3PA 4OYJA 5JDNA 5L3DB 3AAIA 2BVLA 3FXDB 5LGNB 2CWYA 4ISSA 2CXFA 3N2GE 5LHGB 2CXLA 4X1YE 5JR9C 2EHOC 3H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HEA A;  4HE8 A;  5LNK A;  3RKO A; 
#chains in the Genus database with same CATH topology
 2V7I A;  2CBI A;  4ZS2 A;  1YKE B;  2K48 A;  1KNR A;  3M3Z B;  1D1C A;  2J47 A;  5HEU A;  3KVA A;  3GMI A;  1E2A A;  1OED E;  5DQW A;  3AEF A;  4OFZ A;  2LEH A;  2YDS A;  4I55 E;  3X1D A;  2CM0 A;  3E0Z A;  4EAH A;  4YT0 A;  2VAS A;  4YJ2 E;  2BG9 B;  3AE8 A;  5AFU L;  1N33 T;  4DBQ A;  2NW9 A;  4ASK A;  3KV9 A;  5L3G B;  4HTE A;  2C5I T;  2X0H A;  1G8X A;  3RGL A;  3F31 A;  3FZH B;  3JC6 D;  4EXT A;  3AEC A;  5F5W A;  4E7Z A;  4CQI A;  2E5V A;  4PJJ A;  4MLK A;  4AKH A;  4WBO A;  1HG2 A;  3EHZ A;  3AE2 A;  5TAO A;  3QB5 A;  5HXC A;  2WB5 A;  2BKP A;  5CA0 E;  1OWA A;  5HXR A;  2KT9 A;  5C8Y E;  2N2N A;  2XQA A;  2LSI A;  4IE7 A;  5JVD E;  3L8R A;  3AAE B;  3VU7 H;  4YSZ A;  3BK9 A;  4ZI2 C;  3PJA A;  2RPA A;  1OED A;  3NZQ A;  3P4P A;  3QB5 K;  1WR0 A;  2FBW A;  3K8P C;  3RX6 A;  2WU5 A;  2LSK A;  1KNZ A;  2IIU A;  4AI6 A;  4IDN A;  4IL9 A;  4AKG A;  2M6B A;  3PE0 A;  3UUL A;  4F6R C;  4GK5 E;  3I9Y A;  4TZ4 C;  4PFP A;  1LVK A;  4X5T A;  5BMV E;  5M4Y A;  2YKS A;  2DL1 A;  5ABF B;  2VQE T;  2G0U A;  1I94 T;  1HNW T;  3ETU A;  5C2T A;  3AVS A;  3B57 A;  1S35 A;  2ODU A;  4PFO A;  4U33 A;  2KXP B;  4UV8 B;  5EK4 A;  1HS7 A;  2R6G F;  1UCU A;  3UTK A;  1V9D A;  4DVD A;  4YJ3 E;  2W67 A;  2HPJ A;  3ZN0 B;  2W0G A;  1KK7 A;  4ADZ A;  5JDF A;  2VKO A;  1HX8 A;  3NRX A;  1MNE A;  1NWM X;  2IML A;  3ZN1 B;  1YQ4 A;  2ACZ A;  4X64 T;  4UEL A;  3O1J A;  3SWH A;  4CXX A;  2B76 A;  2V5D A;  5JDH A;  4I4T E;  2CCQ A;  2WS3 A;  4YFS A;  2XSB A;  3C64 A;  3KVB A;  5ABH A;  2VB6 A;  2ZM2 A;  4U3C A;  1LKX A;  4U2Y A;  4H9R C;  1HTJ F;  2MBG A;  3FZK B;  3FB2 A;  1WCR A;  5LCY A;  4WNK A;  4DV6 T;  3RC8 A;  2V7J A;  3RQW A;  4HFB A;  2I6H A;  2XZE A;  3C98 B;  4NXN T;  3GWH A;  3KBT A;  2X9W A;  3OBV E;  1E1H B;  3ZYM A;  2IC6 A;  5LOV E;  2YDR A;  3RLF F;  4H9N C;  3ZMT B;  4Z91 A;  4TNW A;  1H7C A;  2XPK A;  5HXH A;  2NR4 A;  2JMH A;  3AE5 A;  3HR0 A;  4DV7 T;  4NXM T;  1XNR T;  4ZS3 A;  4XZC A;  1QUU A;  2LKG A;  2DWK A;  3K3N A;  4LF9 T;  5F3J A;  4ZI7 E;  3J7Y q;  3VKH A;  4OK0 A;  4IE0 A;  4O4J E;  3ZPO A;  3KFW X;  3RYF E;  3ZLI A;  3LFM A;  4TNV A;  3R6N A;  2RP4 A;  3P4W A;  3RHW A;  4O4L E;  4LFC T;  5DAB A;  3N2K E;  2UUB T;  4A5X A;  4JBW F;  4UR9 A;  2UXX B;  4CN4 A;  3C51 A;  4DBR A;  5DJQ C;  3I0O A;  3SFD A;  4JI1 T;  3QOF A;  4O4H E;  3HKB E;  4L9I A;  4DV5 T;  5J1G A;  3QNU A;  1WR6 A;  4CI3 B;  3TLU A;  3ABV A;  2JRK A;  2Y6X A;  4O8S A;  5FY0 A;  2Y48 B;  4O4I E;  3AVR A;  4LF7 T;  3ZEF B;  3K3Q C;  4X66 T;  2WWV A;  3N9N A;  3ONL C;  2QGS A;  3RIA A;  1J5E T;  4JI3 T;  4K0K T;  1O3X A;  3BQL A;  5ETW A;  4AQF C;  1MMA A;  2D2S A;  3AXJ A;  3AED A;  5LG4 A;  2H7O A;  4JI6 T;  3DTO A;  3ZMZ B;  5HCM A;  1SUM B;  2DNX A;  3PUY F;  3VKG A;  3UU4 A;  2JJ9 A;  3EDU A;  4X20 E;  3BQK A;  3AE1 A;  4O2B E;  4WZX A;  2BDE A;  2E9X C;  1N34 T;  2H7V C;  1KEY A;  1YKH B;  2VK9 A;  4PNI A;  2XQ8 A;  4TX5 A;  3TLW A;  4DR4 T;  3FZL B;  4DV4 T;  1UGO A;  2E5L T;  3LK3 B;  4ZOL E;  2F4V T;  5FY1 A;  4HFE A;  1XWM A;  2EHO D;  3EI0 A;  3OYZ A;  5AQH B;  2JQK A;  4EEB A;  3OPC A;  5JDM A;  2ZLY A;  3C50 A;  4QH4 A;  2LLY A;  3WAK A;  5LYJ E;  2W4X A;  2JQH A;  4YHJ A;  1US7 B;  3PUR A;  1WFD A;  5HEH A;  3AXJ B;  3AEA A;  2ZM0 A;  2YDQ A;  2BKO A;  3EUH A;  3RI5 A;  1D1B A;  1T98 A;  2NTX A;  5JDL A;  3AE7 A;  3Q5X A;  3T8O A;  2WWU A;  1IBM T;  2LRL A;  2PBI A;  4EED A;  5JR9 B;  5J2U E;  1BR4 A;  2D0T A;  1KNP A;  3LK4 2;  4HWD A;  1X79 A;  4M1P A;  4Z8X A;  4ZZB A;  5LJN A;  2A9U A;  5JRC A;  4OHF A;  2CLY C;  4IGU A;  4HFI A;  1ZOY A;  4WW0 A;  2LSG A;  4JEU B;  1KF6 A;  3KV4 A;  1Z8U A;  2DHR A;  1X9B A;  4U72 A;  2LHN A;  3EAM A;  3IA3 A;  3O4X E;  1IJ5 A;  4QKN A;  4UXN B;  5H6Q B;  5HCJ A;  3TLV A;  4XAX B;  4ANJ A;  4JI2 T;  3ZCI A;  5J2T E;  1IBL T;  4JYA T;  2IW5 B;  4DV1 T;  1B7T A;  4MAL A;  4FI5 A;  1MMN A;  2XSA A;  3PDY A;  2YOE A;  4BJM A;  4AQG A;  1M62 A;  2A3D A;  3NVO A;  4TWF A;  5LGT B;  2Q9Q D;  1ZEE A;  3HKE E;  5AQO B;  2X51 A;  3WI3 A;  4KBM B;  4UVA B;  4TV9 E;  4YTM A;  4YHH T;  3OTO T;  1MIW A;  3N9P A;  3PJA J;  4LFA T;  4UEM A;  5L3E B;  3A5X A;  5AQL B;  2LRK A;  3LG7 A;  4WYV A;  3PUW F;  1L0V A;  4N78 D;  3UU6 A;  4H9O C;  3SS1 A;  5ADX L;  2HHH T;  3E08 A;  4ILA A;  3HL6 A;  5JR9 A;  3CPZ A;  3V5U A;  2A2F X;  2W61 A;  1VOM A;  3N5L A;  1G73 A;  3UUM A;  2WCA A;  2VWA A;  3ZJ1 A;  1OED C;  2MAW A;  4DND A;  3O1H A;  3RYI E;  3SOL A;  4EGW A;  4DR6 T;  1BR0 A;  4TN7 B;  2JMK A;  3F57 A;  3RH3 A;  2BVM A;  1D0Y A;  3AEB A;  3ONJ A;  2CBJ A;  2MTQ A;  4EYY R;  5KX5 E;  3F2E A;  2BS4 A;  2JQQ A;  4HEA A;  2CWO A;  2X0L B;  4HWF A;  4IE4 A;  2ACX A;  2VVN A;  5E0O A;  2QVA A;  5AQP B;  2H88 A;  2W62 A;  2WDR A;  2WU2 A;  4IE5 A;  2SPC A;  1J1J A;  2V6X A;  5JH7 E;  1UUR A;  1T8B A;  2V7L A;  2PJQ A;  4DMV A;  2OV9 A;  2LJL A;  2MOZ A;  3UU5 A;  5JDN A;  5BR8 T;  2XY8 B;  4QWN B;  2CPT A;  3L09 A;  4IHJ E;  3RF1 A;  4ZZC A;  3PTR B;  4DMW A;  4HFD A;  5L3F B;  3KV6 A;  2UXB T;  4ZI3 D;  4GOU A;  4HFC A;  2KMF A;  5AQT B;  4DR3 T;  4B3M T;  1XZY A;  4TV8 E;  2K9A A;  1W9R A;  2E2A A;  2ZM8 A;  2CLY B;  2CRB A;  2PTF A;  3FZM B;  3KDS E;  4GIW A;  3SRZ A;  4IIJ E;  3UUN A;  2VQF T;  2WDV A;  5AQS B;  3Q2M A;  3I9W A;  1FMW A;  2BKN A;  3NWI A;  2W63 A;  3U78 A;  3HI2 A;  4DV3 T;  1YQ3 A;  1ZV4 X;  2CXD A;  2X0Y A;  2X66 A;  4Q25 A;  3WAJ A;  5CFB A;  4EYU A;  1OXZ A;  4QH1 A;  4A97 A;  5LB7 B;  3ANW B;  4QXH B;  2J62 A;  3PV0 F;  4AIU A;  1MMD A;  2IUB A;  3AA0 B;  5FY7 A;  3RIU C;  2KSR A;  2XAH B;  5FXV A;  3I0Q A;  3P4R A;  3ESL A;  2KZ7 B;  1YW0 A;  3PUX F;  5IWA T;  4AQF A;  2XM1 A;  3M65 A;  2C0S A;  2X67 A;  1IJ6 A;  3FHN A;  2V1D B;  3KIN B;  3TLS A;  5JDG A;  2LOS A;  5AQJ B;  5HWY A;  4CI2 B;  2ZMA A;  2WSS V;  5KXJ A;  4CXY A;  2XJ7 A;  4KUM B;  1Y64 B;  2V7K A;  1U4Q A;  3O9X A;  2UXN B;  4CI1 B;  2W00 A;  2C5J A;  2FJD A;  3D0T A;  4WBN E;  3ZT5 A;  1DU2 A;  4PJN A;  5FL1 A;  2J4G A;  3UU8 A;  2WM9 A;  3RPU A;  3JAE A;  2Z6E A;  3RRC A;  3N2O A;  4IRE A;  2V7M A;  3BQI A;  3TKL B;  3OJA A;  3ANW A;  5DQV A;  4U74 A;  5AQG B;  2GK9 A;  3VRB A;  5JRC B;  1U5P A;  4X65 T;  4E7S A;  5HWX A;  3UUX B;  1SHZ C;  5EK2 A;  2FJA A;  3IHR A;  4GK0 E;  1CUN A;  4IDZ A;  4J2C A;  4CXW A;  2XTL A;  3PUA A;  3ZMV B;  4OX9 T;  3PUZ F;  1W0B A;  4KI0 F;  2KLQ A;  5LJM A;  5AQN B;  5LNK A;  1HNX T;  3SFE A;  4IL4 A;  2NP9 A;  2VVS A;  1HX1 B;  4HN9 A;  1XMO T;  4FJO A;  2QA7 A;  1VCS A;  1NAF A;  4TWD A;  4DV0 T;  4F8H A;  2WMN A;  3QUJ A;  2IC9 A;  5H6R B;  5CJ5 A;  2XAS B;  5CGM A;  2WY2 A;  3CK6 A;  3N9O A;  4JI0 T;  3NBX X;  2W2U A;  1N32 T;  2NW8 A;  4DR1 T;  4JEH B;  3ZYK A;  3EAB A;  3Q5D A;  4HGA A;  5HYA A;  5AQF B;  3UUB A;  4B3T T;  3MXZ A;  4LMJ A;  4JI5 T;  3AEE A;  5GON E;  3VR8 A;  4YXD A;  3A8Y C;  5LXT E;  4G63 A;  5L3C B;  4LF4 T;  2VL0 A;  3B13 A;  3JAD A;  4I0U A;  4KHZ F;  3ONX A;  2X68 A;  2IAK A;  1IZN B;  2H89 A;  2FJE A;  1KFY A;  3OVU A;  5LBQ B;  2HN1 A;  3JAF A;  2Q9Q A;  4UIG A;  3ZMS B;  3JC6 C;  4X62 T;  4CN1 A;  2NW7 A;  5HEO A;  1FJG T;  4LFB T;  3CX6 B;  1FMV A;  4IT4 A;  4KMC A;  2D5U A;  3ZKR A;  3ZST A;  4COF A;  5AQU B;  4HWH A;  1Z0P A;  5JTG A;  1QLB A;  3N9M A;  4H9S E;  4X1I E;  3OKQ A;  3CML A;  4PJL A;  2L8K A;  3LSV A;  3N9L A;  4YY3 T;  2CHO A;  4B3S T;  2J1D G;  2LSY A;  2WMO A;  4LMK A;  4PW8 A;  4AKR B;  2X9H A;  3HKC E;  2LT3 A;  4JI8 T;  4V1A v;  4AKI A;  4HFV A;  3RKO A;  3MA9 A;  2D9D A;  3T1Y T;  3AA1 B;  1GQE A;  5HEG A;  3AE9 A;  1N36 T;  2YEV C;  2LE8 A;  3AB3 B;  4QX7 B;  4EZH A;  5AQK B;  4L0R A;  2XHE B;  2DCF A;  5EK3 A;  4BA9 A;  2JIW A;  3ZC0 A;  2Q9Q C;  3CIR A;  4ZI2 D;  4YTP A;  4PJM A;  1D0Z A;  4ZXL A;  3RIU A;  2XQ7 A;  2VKD A;  4JV5 T;  4EV6 A;  5J0Z A;  2BS2 A;  3Q5W A;  4Z90 A;  4I50 E;  3UT5 E;  3C4Z A;  4IDO A;  2CA5 A;  1HG5 A;  2ES0 A;  4K0U A;  1WRD A;  3CQX C;  4B6X A;  4GKK T;  3RYH E;  2BG9 A;  3V5S A;  5LA6 E;  4PK6 A;  2LM2 A;  1UX4 A;  1E7P A;  5IHY A;  3ZSS A;  2UUC T;  3MK7 C;  4U2Z A;  3C4W A;  2WQY A;  4H63 V;  4P0B A;  5LP6 E;  5HXE A;  3UFE A;  2UUA T;  4P1N A;  4JLE A;  3FBZ A;  4MBQ A;  4KHP T;  4IE6 A;  2VL8 A;  2HH7 A;  2K3W A;  4H63 H;  2YU1 A;  4U31 A;  3ZMU B;  4EIW A;  5C3J A;  2KIN B;  5FP3 A;  3CKD A;  3CQC B;  3VR9 A;  4NUV A;  4DO0 A;  3PU8 A;  3AE4 A;  2YN6 A;  4GYR A;  3UU3 A;  4DUY T;  3T1H T;  2YK0 A;  1WLX A;  5AQM B;  3AE3 A;  3VHL A;  1ZKE A;  2E8I A;  4QH5 A;  3U3I A;  4MHC A;  1BR2 A;  2MPK A;  5ABF A;  3AE6 A;  2LM9 A;  3UQ7 A;  3ZJ2 A;  2XQ4 A;  4TWH A;  2B1E A;  4JUY A;  1HCI A;  3E22 E;  1JNZ A;  3GN5 B;  2EHO A;  4KX6 A;  1S94 A;  2LKH A;  4P0A A;  4OYK A;  2XQ9 A;  1FIO A;  2P9B A;  5FXZ A;  5JQG E;  4QX8 B;  4QHO A;  2E9X D;  2E9X A;  2VKH A;  1EZ3 A;  4ILC A;  4QXC B;  1LVF A;  5FXW A;  2M6I A;  2AE9 A;  5L4H A;  1ZP0 A;  5KDM C;  1HF8 A;  1NEK A;  1R8I A;  2BZB A;  2QRX A;  5FYM A;  3RYC E;  2WZI A;  2XAG B;  3P8C D;  4DR5 T;  2JPF A;  4U7Y A;  1XMQ T;  2D0U A;  1FEW A;  3Q5E A;  5FVL A;  4H9Q C;  5CB4 E;  2UU9 T;  2WDQ A;  5IYZ E;  2N1G A;  2LHR A;  4KP3 C;  1OED B;  5FXX A;  3ZC1 A;  1NEN A;  1SE7 A;  2K5B B;  1MND A;  4IDQ A;  3JCF A;  5LGU B;  5ABG A;  2NOX A;  4HE8 A;  4ZHQ E;  2BS3 A;  5FNV E;  3ZT7 A;  1M7K A;  2V26 A;  5LHI B;  2VKJ A;  1W0A A;  2NTY A;  4HFH A;  1HNZ T;  3NRY A;  5HAX A;  3RRW A;  1MIY A;  4DUZ T;  3EVY A;  3PUS A;  5IUX A;  5JDQ A;  2VUR A;  4I43 B;  4ERR A;  1LRZ A;  2X9Y A;  3KV5 A;  3QK6 A;  3HA4 A;  3Q9D A;  4LF5 T;  3I1A A;  3P4S A;  3DJB A;  3ZT6 A;  1HFA A;  1I6Z A;  2M67 A;  3QC9 A;  3R84 B;  1WYC A;  3RQU A;  3B5M A;  1SA0 E;  4AXP A;  4LF6 T;  4IST A;  3CQG B;  2YIN A;  2L3L A;  3GA8 A;  3GN5 A;  3FXE B;  3OYX A;  5AQV B;  4C90 A;  1D0X A;  3NZP A;  1HR0 T;  3P7I A;  5AQI B;  1D1A A;  4EZ4 A;  5FKY A;  4AIS A;  4UV9 B;  1UX5 A;  3CWZ B;  4NUU A;  2V6Y A;  4LF8 T;  1VRB A;  4EOZ B;  5L4E A;  5LHH B;  5L47 A;  3J9X 1;  4ILU A;  4UVB B;  2V6Y B;  2XAF B;  3L39 A;  2IDO B;  1Y01 A;  2K24 A;  2XQ5 A;  3AA7 B;  4H9P C;  2KND A;  4BJN A;  5HXS A;  4QXB B;  4MFR A;  5LMU T;  1UK5 A;  4L5G A;  2OLT A;  4YLH A;  5FVK A;  4ZI3 C;  4U7I A;  1IAP A;  3EDV A;  3H3M A;  4HWC A;  2RA1 A;  4B3R T;  2UXD T;  4XBF B;  1MIV A;  4YSX A;  3O1I A;  4HWI B;  1JNR A;  1YXR A;  1CHU A;  4ILB A;  5F8P A;  2ZM6 T;  2HN2 A;  2KWH A;  3CX7 B;  4GKJ T;  2FJB A;  4A98 A;  2WP9 A;  3LBX A;  3A7M A;  3ETV A;  3PUV F;  4CN6 A;  2I0M A;  2WAU A;  4UVC B;  3MAC A;  4NIQ A;  2DI4 A;  3G06 A;  2C5K T;  2YU2 A;  4UF0 A;  4X1K E;  5EZY E;  3RKG A;  4YSY A;  5AQQ B;  3W15 B;  3PUG A;  3FBL A;  2NWB A;  2MYS A;  4AQY T;  2V5C A;  2W66 A;  3UFG A;  1YD8 G;  2I59 A;  3P4Q A;  4PAG A;  3PUQ A;  2ODV A;  5JRE A;  1J5W A;  2PG8 A;  3MKD A;  3TLT A;  3LK2 B;  5L2L A;  4G2A A;  5LMN T;  2HPL A;  3VRA A;  3MJX A;  3K1S A;  2BG9 E;  3FZF B;  3H3A A;  3HKD E;  2OA5 A;  3DP7 A;  4O2A E;  3CVR A;  4DV2 T;  1XDP A;  2WBL A;  5HEJ A;  2XUE A;  2CEA A;  3IEE A;  4PK5 A;  1ZHC A;  1UUS A;  5A1L A;  3IF8 B;  2H3R A;  3KBU A;  2XAJ B;  3CX8 B;  4UF0 B;  2KWI B;  3N9Q A;  4A56 A;  1VCT A;  2BBH A;  2DLR A;  2EHO B;  4BAY B;  2FUP A;  5FMN A;  1MMG A;  4GYS A;  3S4U A;  4DR2 T;  3K3O A;  3MZK B;  3C4X A;  4YTN A;  2X9X A;  2DWG A;  2PFV A;  2XAQ B;  3AA6 B;  5LG3 A;  4LML A;  2LSJ A;  4JI7 T;  3AEG A;  3P50 A;  2WZH A;  4IDP A;  4AKL A;  2CMR A;  1WYB A;  2QYW A;  1T7S A;  2Q9Q B;  5AQR B;  2LOP A;  4P09 A;  4PK4 A;  5FL0 A;  5LBM A;  3UQ4 A;  4CZZ B;  5ABE A;  2XQY A;  5L3B B;  1QSD A;  2CHN A;  2E9X B;  3PU3 A;  3RIF A;  3ZCJ A;  2BG9 C;  4EB6 E;  5CA1 E;  2UXC T;  2XM2 A;  2XQ3 A;  2N9D A;  2BBJ A;  1AJ3 A;  2IHR 1;  2AXD S;  1XDO A;  2Y8D A;  3LBX B;  4HKA A;  4TUY E;  5KMG P;  4NPP A;  4JI4 T;  1IBK T;  1BR1 A;  2CE7 A;  3ZYL A;  4C91 A;  3LJC A;  3LDQ B;  2A72 A;  2L9Q A;  3AAA B;  3IBP A;  3L3P A;  4OYJ A;  3RC3 A;  4ZEY A;  5L3D B;  4DR7 T;  3AAI A;  2JQ9 A;  2BVL A;  3FXD B;  5LGN B;  2CWY A;  2V8S V;  4ISS A;  2CXF A;  3NKZ A;  2XQ6 A;  3N2G E;  4DID B;  1XNQ T;  1W09 A;  2CXL A;  5LHG B;  4X1Y E;  5JR9 C;  2EHO C;  1T72 A;  3H37 A; 
#chains in the Genus database with same CATH homology
 2V7I A;  4ZS2 A;  1YKE B;  2K48 A;  1D1C A;  3KVA A;  3GMI A;  5DQW A;  4OFZ A;  2LEH A;  4I55 E;  2CM0 A;  3E0Z A;  4EAH A;  2VAS A;  4YJ2 E;  5AFU L;  4DBQ A;  2NW9 A;  4ASK A;  3KV9 A;  5L3G B;  4HTE A;  2C5I T;  1G8X A;  3F31 A;  3JC6 D;  4EXT A;  4E7Z A;  4CQI A;  4PJJ A;  4MLK A;  4AKH A;  4WBO A;  1HG2 A;  5TAO A;  5HXC A;  5CA0 E;  1OWA A;  5HXR A;  2KT9 A;  5C8Y E;  2N2N A;  2LSI A;  4IE7 A;  5JVD E;  3AAE B;  3VU7 H;  3BK9 A;  4ZI2 C;  3NZQ A;  3RX6 A;  1KNZ A;  3K8P C;  2LSK A;  4AI6 A;  4AKG A;  3PE0 A;  3UUL A;  4F6R C;  4GK5 E;  3I9Y A;  4TZ4 C;  4PFP A;  1LVK A;  5BMV E;  5M4Y A;  2G0U A;  3ETU A;  3AVS A;  3B57 A;  1S35 A;  2ODU A;  4PFO A;  4UV8 B;  2KXP B;  5EK4 A;  1HS7 A;  1UCU A;  3UTK A;  1V9D A;  4DVD A;  4YJ3 E;  2HPJ A;  3ZN0 B;  2W0G A;  1KK7 A;  4ADZ A;  5JDF A;  2VKO A;  1HX8 A;  3NRX A;  1MNE A;  1NWM X;  3ZN1 B;  4UEL A;  3O1J A;  3SWH A;  4CXX A;  5JDH A;  4I4T E;  2CCQ A;  4YFS A;  3C64 A;  3KVB A;  2VB6 A;  2ZM2 A;  1LKX A;  4H9R C;  1HTJ F;  2MBG A;  3FB2 A;  5LCY A;  4WNK A;  3RC8 A;  2V7J A;  3C98 B;  3GWH A;  3KBT A;  2X9W A;  3OBV E;  1E1H B;  3ZYM A;  2IC6 A;  5LOV E;  4H9N C;  3ZMT B;  1H7C A;  5HXH A;  2JMH A;  3HR0 A;  4ZS3 A;  4XZC A;  1QUU A;  2DWK A;  3K3N A;  3J7Y q;  4ZI7 E;  3VKH A;  4OK0 A;  4IE0 A;  4O4J E;  3ZPO A;  3KFW X;  3RYF E;  3ZLI A;  3LFM A;  3R6N A;  2RP4 A;  4O4L E;  5DAB A;  3N2K E;  2UXX B;  3C51 A;  4DBR A;  5DJQ C;  3I0O A;  4O4H E;  3HKB E;  4L9I A;  5J1G A;  1WR6 A;  4CI3 B;  5FY0 A;  2JRK A;  2Y6X A;  4O8S A;  2Y48 B;  4O4I E;  3AVR A;  3ZEF B;  3K3Q C;  3N9N A;  2QGS A;  1O3X A;  3BQL A;  5ETW A;  4AQF C;  1MMA A;  2D2S A;  5LG4 A;  2H7O A;  3DTO A;  3ZMZ B;  2DNX A;  3VKG A;  2JJ9 A;  3EDU A;  4X20 E;  3BQK A;  4O2B E;  2BDE A;  2E9X C;  2H7V C;  1YKH B;  2VK9 A;  4PNI A;  4TX5 A;  3LK3 B;  4ZOL E;  5FY1 A;  2EHO D;  3OYZ A;  5JDM A;  2ZLY A;  3C50 A;  3WAK A;  5LYJ E;  4YHJ A;  1US7 B;  3PUR A;  2ZM0 A;  3EUH A;  5JDL A;  1D1B A;  1T98 A;  2NTX A;  3Q5X A;  3T8O A;  2WWU A;  2PBI A;  5JR9 B;  5J2U E;  1BR4 A;  2D0T A;  3LK4 2;  4Z8X A;  1X79 A;  4M1P A;  5LJN A;  5JRC A;  4OHF A;  2CLY C;  4IGU A;  4WW0 A;  2LSG A;  4JEU B;  3KV4 A;  2DHR A;  5HYA A;  4U72 A;  2LHN A;  3O4X E;  5H6Q B;  1IJ5 A;  4QKN A;  4UXN B;  5J2T E;  4XAX B;  4ANJ A;  3ZCI A;  2IW5 B;  1B7T A;  4MAL A;  4FI5 A;  1MMN A;  3PDY A;  4BJM A;  4AQG A;  2A3D A;  5LGT B;  2Q9Q D;  1ZEE A;  3HKE E;  2X51 A;  3WI3 A;  4KBM B;  4UVA B;  4TV9 E;  1MIW A;  3N9P A;  4UEM A;  5L3E B;  3A5X A;  3LG7 A;  4N78 D;  5ADX L;  4H9O C;  3SS1 A;  3E08 A;  5JR9 A;  3HL6 A;  3CPZ A;  3V5U A;  2A2F X;  2W61 A;  1VOM A;  3N5L A;  1G73 A;  3UUM A;  3ZJ1 A;  2VWA A;  4DND A;  3O1H A;  3RYI E;  3SOL A;  1BR0 A;  4TN7 B;  2JMK A;  3F57 A;  3RH3 A;  2BVM A;  1D0Y A;  5KX5 E;  2MTQ A;  4EYY R;  3F2E A;  2JQQ A;  4HEA A;  2CWO A;  2X0L B;  4IE4 A;  2ACX A;  5E0O A;  2W62 A;  4IE5 A;  2SPC A;  5JH7 E;  2V7L A;  2PJQ A;  4DMV A;  2LJL A;  2MOZ A;  4QWN B;  3L09 A;  4IHJ E;  3PTR B;  4DMW A;  5L3F B;  3KV6 A;  4ZI3 D;  4GOU A;  2KMF A;  4TV8 E;  2K9A A;  2ZM8 A;  3KDS E;  5HWX A;  2CLY B;  3SRZ A;  3UUN A;  4GIW A;  4IIJ E;  3Q2M A;  3I9W A;  1FMW A;  2W63 A;  3U78 A;  3HI2 A;  1ZV4 X;  2CXD A;  2X66 A;  3WAJ A;  4EYU A;  1OXZ A;  3ANW B;  4QXH B;  1MMD A;  3AA0 B;  5FY7 A;  2XAH B;  5FXV A;  3I0Q A;  3ESL A;  2KZ7 B;  1YW0 A;  4AQF A;  3M65 A;  2C0S A;  2X67 A;  1IJ6 A;  3FHN A;  2V1D B;  3KIN B;  5JDG A;  2LOS A;  5HWY A;  4CI2 B;  2ZMA A;  2WSS V;  4CXY A;  4KUM B;  1Y64 B;  2V7K A;  1U4Q A;  3O9X A;  2UXN B;  4CI1 B;  2W00 A;  2C5J A;  3D0T A;  4WBN E;  4PJN A;  2WM9 A;  3RPU A;  3RRC A;  2Z6E A;  3N2O A;  2V7M A;  3BQI A;  3TKL B;  3OJA A;  3ANW A;  5DQV A;  4U74 A;  2GK9 A;  5JRC B;  1U5P A;  4E7S A;  3UUX B;  1SHZ C;  5EK2 A;  4IDZ A;  3IHR A;  4GK0 E;  1CUN A;  4J2C A;  4CXW A;  2XTL A;  3PUA A;  3ZMV B;  2KLQ A;  5LJM A;  5LNK A;  2NP9 A;  4HN9 A;  4FJO A;  2QA7 A;  1NAF A;  2WMN A;  3QUJ A;  2IC9 A;  5H6R B;  2XAS B;  3N9O A;  3NBX X;  2NW8 A;  4JEH B;  3ZYK A;  4HGA A;  3MXZ A;  5GON E;  5LXT E;  4G63 A;  5L3C B;  3B13 A;  5HXS A;  3ONX A;  2X68 A;  2IAK A;  1IZN B;  5LBQ B;  3ZMS B;  4UIG A;  2Q9Q A;  3JC6 C;  2NW7 A;  3CX6 B;  1FMV A;  4KMC A;  2D5U A;  1Z0P A;  3N9M A;  4H9S E;  4X1I E;  3OKQ A;  3CML A;  4PJL A;  2L8K A;  3N9L A;  2J1D G;  2LSY A;  2WMO A;  4PW8 A;  4AKI A;  4AKR B;  2X9H A;  3HKC E;  2LT3 A;  4V1A v;  4HFV A;  3RKO A;  3MA9 A;  3AA1 B;  2YEV C;  2LE8 A;  3AB3 B;  4QX7 B;  4EZH A;  4L0R A;  2XHE B;  2DCF A;  5EK3 A;  4BA9 A;  3ZC0 A;  2Q9Q C;  4ZI2 D;  4PJM A;  1D0Z A;  2VKD A;  3Q5W A;  4I50 E;  3UT5 E;  3C4Z A;  2CA5 A;  1HG5 A;  2ES0 A;  4K0U A;  1WRD A;  3CQX C;  4B6X A;  3RYH E;  3V5S A;  5LA6 E;  4PK6 A;  1UX4 A;  5IHY A;  3MK7 C;  3C4W A;  4H63 V;  4P0B A;  5LP6 E;  5HXE A;  3UFE A;  4JLE A;  3FBZ A;  4MBQ A;  4IE6 A;  2VL8 A;  2HH7 A;  4H63 H;  2YU1 A;  3ZMU B;  4EIW A;  2KIN B;  5FP3 A;  3CKD A;  3CQC B;  4DO0 A;  4NUV A;  3PU8 A;  4GYR A;  2YK0 A;  1WLX A;  3VHL A;  1ZKE A;  2E8I A;  3U3I A;  4MHC A;  1BR2 A;  2LM9 A;  3ZJ2 A;  2B1E A;  4JUY A;  1HCI A;  3E22 E;  3GN5 B;  2EHO A;  1S94 A;  4P0A A;  4OYK A;  1FIO A;  2P9B A;  5FXZ A;  5JQG E;  4QX8 B;  4QHO A;  2E9X D;  2E9X A;  2VKH A;  1EZ3 A;  4QXC B;  1LVF A;  5FXW A;  5KDM C;  1HF8 A;  2BZB A;  5FYM A;  3RYC E;  2XAG B;  3P8C D;  2JPF A;  2D0U A;  1FEW A;  5CB4 E;  4H9Q C;  5IYZ E;  2N1G A;  2LHR A;  4KP3 C;  5FXX A;  3ZC1 A;  2K5B B;  1MND A;  5LGU B;  2NOX A;  4HE8 A;  4ZHQ E;  5FNV E;  5LHI B;  2V26 A;  2VKJ A;  2NTY A;  3NRY A;  5HAX A;  3RRW A;  1MIY A;  3EVY A;  3PUS A;  5JDQ A;  4I43 B;  4ERR A;  1LRZ A;  2X9Y A;  3KV5 A;  3QK6 A;  3HA4 A;  3Q9D A;  3I1A A;  3DJB A;  1HFA A;  2M67 A;  3QC9 A;  3R84 B;  1WYC A;  1SA0 E;  4AXP A;  4IST A;  3CQG B;  2YIN A;  2L3L A;  3GA8 A;  3GN5 A;  3FXE B;  3OYX A;  1D0X A;  3NZP A;  3P7I A;  1D1A A;  4EZ4 A;  4UV9 B;  1UX5 A;  3CWZ B;  4NUU A;  4EOZ B;  1VRB A;  5LHH B;  3J9X 1;  4ILU A;  4UVB B;  2XAF B;  2K24 A;  4H9P C;  3AA7 B;  4BJN A;  2KND A;  4QXB B;  4MFR A;  4L5G A;  4YLH A;  4ZI3 C;  1IAP A;  3EDV A;  2RA1 A;  4XBF B;  1MIV A;  3O1I A;  5F8P A;  2KWH A;  3CX7 B;  3LBX A;  3ETV A;  2WAU A;  4UVC B;  3MAC A;  4X1K E;  2DI4 A;  5EZY E;  2C5K T;  2YU2 A;  4UF0 A;  3W15 B;  3PUG A;  3FBL A;  2NWB A;  2MYS A;  1YD8 G;  2I59 A;  4PAG A;  3PUQ A;  2ODV A;  5JRE A;  3MKD A;  2PG8 A;  3LK2 B;  5L2L A;  4G2A A;  2HPL A;  3MJX A;  3HKD E;  3H3A A;  2OA5 A;  3DP7 A;  4O2A E;  3CVR A;  2WBL A;  2XUE A;  2CEA A;  3IEE A;  4PK5 A;  1ZHC A;  5A1L A;  3IF8 B;  2H3R A;  3KBU A;  2XAJ B;  3CX8 B;  4UF0 B;  2KWI B;  3N9Q A;  4A56 A;  2DLR A;  4BAY B;  2EHO B;  5FMN A;  1MMG A;  4GYS A;  3S4U A;  3K3O A;  3MZK B;  3C4X A;  2X9X A;  3AA6 B;  2DWG A;  2PFV A;  2XAQ B;  2LSJ A;  4AKL A;  2CMR A;  1WYB A;  4C90 A;  2Q9Q B;  5LBM A;  4CZZ B;  2LOP A;  4P09 A;  4PK4 A;  5F3J A;  2XQY A;  5L3B B;  1QSD A;  2E9X B;  3PU3 A;  3ZCJ A;  5CA1 E;  4EB6 E;  2N9D A;  1AJ3 A;  2Y8D A;  3LBX B;  4HKA A;  4TUY E;  5KMG P;  1BR1 A;  2CE7 A;  3ZYL A;  4C91 A;  3LJC A;  3RC3 A;  2A72 A;  2L9Q A;  3AAA B;  3IBP A;  3L3P A;  4OYJ A;  5JDN A;  5L3D B;  3AAI A;  2BVL A;  3FXD B;  5LGN B;  2CWY A;  4ISS A;  2CXF A;  3N2G E;  5LHG B;  2CXL A;  4X1Y E;  5JR9 C;  2EHO C;  3H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...