4HEFA

Strcuture of avibactam bound to pseudomonas aeruginosa ampc
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
360
structure length
360
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKRDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural Insight into Potent Broad-Spectrum Inhibition with Reversible Recyclization Mechanism: Avibactam in Complex with CTX-M-15 and Pseudomonas aeruginosa AmpC beta-Lactamases
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 120
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4hefA00
3OPLA 5HFOA 5EVIC 1FCOA 4XXRA 1SDNA 5DF9A 4JPMA 1EI5A 1HVBA 3QNBA 3ITAA 1H8ZA 3PTEA 1NY0A 3D4FA 3CMZA 1BLHA 4LV0A 3VSKA 4Y0OA 4OQ0A 2Y55A 4S2NA 3S4XA 4OOYA 4P6BA 1YLZA 4S2JA 1CK3A 3MKEA 4ID4A 1JWVA 1NZUA 3G31A 3OPPA 4ZJ1A 4DKIA 1SCWA 5FI2A 2ZMAA 3O3VA 3VOYA 2XGNA 4P0MA 1S6RA 1U60A 3UY6A 2B5RA 4E3JA 3ZNYA 4WZ5A 1W79A 4X56A 1NYMA 5A91A 4UAAA 3S22A 4K0XA 1XA7A 5EPHA 4X55A 2Y2HA 2ZC7A 1BLSA 1GHPA 5FAQA 3C4OA 5EOEA 1MPLA 4E6WA 3SH7A 3ZCZA 3Q7VA 3VP3A 2ZC6B 5E43A 5CECA 1MWTA 1GCEA 3PBQA 4OLGA 1SDEA 3BFDA 5D3OA 3OCNA 3MFDA 3LY3A 5JYPA 4JF5A 4JXWA 1BTLA 2Y59A 4OONA 3B3XA 1CI9A 3PAGA 3Q07A 4FD8A 2RL3A 2WK0A 1O07A 3FWLA 3LCEA 4X6TA 4F94A 3SS3A 4DE3A 3GRJA 3M6BA 1TDLA 3S1YA 4OPQA 5KZHA 4CPKA 4R4RA 1ERQA 4D2OA 4R1GA 3MXSA 1K55C 4JBFA 1SKFA 5FDHA 1JTDA 2HDQA 3N6IA 3BECA 4KZ3A 1YMSA 3G4PA 2PU2A 3V50A 2EX9A 4EBLA 4GKUA 5CXWA 1GHMA 2ZM8A 1PZPA 4JF6A 4OQIA 4B4XA 4N9KA 1K4EA 1ES5A 1MWRA 3Q7ZA 3IWOA 5CTNA 3PBSA 2Z2MB 3NC8A 4P85A 4EUZA 1FOFA 1PZOA 4ZDXA 4EV4A 3PBOA 2G2WA 1IKGA 2P9VB 2OV5A 5F1GA 4KQRA 4NK3A 4R23A 2HP5A 1BZAA 4DDSA 2H10A 3VSLA 1KGGA 5FAPA 4EBNA 3G34A 3UDIA 2ZC4B 2QPNA 4P87A 3G2ZA 4E3MA 2WZZA 1RP5A 2WKIA 4Y7PA 5FATA 5A92A 4OPYA 1FSYA 2JCHA 4ZTKA 4NETA 1TVFA 3HBRA 3ZG8B 2XR0A 4OOLA 5GHXA 1PWCA 2Y2QA 3IXGA 2R9WA 2XEPA 4S2OA 3BEBA 4U0XA 5HARA 3AGFA 1PW8A 5KSHA 4WELA 3BLSA 5CHUA 1KVLA 4IBRA 3V5MA 1LHYA 1NXYA 1K54A 3NBLA 4MLLA 1YLYA 4WMCD 4X69A 5M1AA 1Q2PA 2EX8A 1K4FA 3IWIA 4E3LA 3IH9A 5TFQA 3WS2A 5HAQA 1J9MA 1ES3A 1SHVA 4PMAA 3RXXA 3V3RA 4BJPA 1NYYA 4Q8IA 1Q2QA 2XK1A 3BYDA 1JVJA 4S2PA 4QHCA 4BL3A 1MWSA 4OPZA 1E3UA 3QNCA 4GB7A 1ESIA 3SS5A 3UDFA 5EVLA 1Y54A 3RJUA 5DTKA 3UE1A 2C6WB 3A3JA 1W8YA 1XX2A 2PBYA 1MY8A 4K0WA 3VMAA 3M6HA 4GDNA 4U0TA 5FA7A 5BOHA 3W4PA 3N4IA 2DCFA 3A3EA 1O7EA 5HX9A 3ZG0A 1JWPA 2WZXA 4DE2A 2WAEA 4S2NC 1FR1A 1N9BA 2Y2PA 3LO7A 3WS1A 3V39A 1C3BA 5HAIA 2JE5A 5AQAA 2WGIA 5EE8A 5GLBA 4M3KA 5GLAA 4EQIA 1FCNA 1DJBA 1FSWA 2WKHA 3BFEA 5DVAA 2ZQAA 3G2YA 4BL2A 4E3NA 4R0QA 5FQQA 4N92A 3Q82A 4PM8A 5GHZA 5IHVA 5DF7A 5CGXA 5L2FA 5F1FA 2ZM2A 1JTGA 1KGEA 3EQUA 1KE3A 2Y2OA 4JXVA 5DTTA 1L0FA 1KGFA 4JKTA 4QY5A 2IWDA 4OKPA 2HP9A 2J7VA 4QD4A 2ZJ9A 2OLUA 3CJMA 3E2LA 4WYYA 4Z9QA 2X01A 4OH0A 4BD1A 4HBTA 1LLBA 2V2FF 4LCLA 5DF8A 2ZC5B 2H0TA 1I2SA 4IVKA 3FZCA 2V20A 3G32A 2WGWA 4PM5A 3MKFA 1ZG6A 3M2KA 3HLCA 3JYIA 3MZDA 1ONGA 3WS4A 3MXRA 1G68A 4PM6A 3UNWA 1BLPA 1CEGA 4O7DA 5FQMA 1IELA 1VQQA 3GQZA 3SS4A 1MBLA 3BM6A 3OCLA 4R3JA 3SH8A 3UPNA 1FQGA 3Q81A 3VP1A 1QMFA 4CJNA 1BSGA 4S2LA 2H0YA 4B4ZA 1HTZA 4ZAMA 1PYYA 1K38A 4DE1A 5J8XA 2Q9NA 3IF5A 4WEJA 3O87A 3G30A 2P74A 3Q1FA 2CC1A 1ES4A 4MBKA 3HLGA 4GDBA 4LENA 3TG9A 4KZBA 3BLMA 4XUZA 1FR6A 3NIAA 5F83A 4MBHA 1GHIA 1TDGA 3PAEA 1AXBA 3FV7A 2OSUA 3VOZA 1W5DA 2Y4AA 5E2HA 1EWZA 2ZQ9A 3NY4A 3EQVA 1Z6FA 2J9OA 1K25A 1PWDA 4KZ9A 1L0DA 1IKIA 1LL9A 3NDEA 4MEZA 4KG5A 2Q9MA 2X71A 1NZOA 3UE0A 5JYOA 2WAFA 3ZVTA 3OPRA 3NDGA 1ZC2A 4MNRA 4OP8A 1ALQA 4H8RA 2VGJA 2QMIA 3HREA 3C7UA 2I72A 4QU3A 3ZG9B 1K6SA 4RX2A 1K54C 3HLDA 4DDYA 1K56D 1M40A 2Y2KA 4KG2A 3UPOA 2WYXA 1BT5A 3ZVWA 1XKZA 4EBPA 1NRFA 1YLPA 2XF3A 3QHYA 3O88A 1DJAA 4PPRA 1DJCA 5CGSA 3BFFA 3DW0A 5EUAA 3WWXA 3CZDA 3VP0A 1RGYA 3FKWA 4WM9A 1IYOA 3A3FA 2WKEA 2EFXA 2A3UA 1CI8A 4OQGA 5FI7A 2HDUA 2Z2LB 4IVIA 4QB8A 1KVMA 3GSGA 1YM1A 1LL5A 2VGKA 3ITBA 3HLEA 4OVDA 2BG1A 4KZ8A 1E25A 4UA7A 3IH8A 4R4SA 5FQJA 5EECA 1KE0A 4S2IA 3LEZA 5M18A 4QY6A 4HEFA 2XFTA 1YQSA 3HLFA 5FSRA 3GMWA 3N8LA 5HL1A 5CHMA 5M19A 4KENB 2Y2NA 3Q7VB 2Y91A 2X02A 5A93A 4HBUA 4FSFA 1IYSA 2WGWB 3ZG5A 1ZG4A 5HAPA 2HDSA 4ZJ2A 3ZDJA 3UN7A 4KQOA 2XLNA 2Y2GA 3HLWA 3C4PA 5E2FA 5AQBA 4E3IA 1RCJA 4UA9A 5KMWA 2E8IA 1PWGA 1HD8A 3ZG7B 4JXSA 4GZBA 1K57A 4YFMA 4L0LA 2XFSA 1YMXA 1K6RA 1YLTA 2ZLYA 1BUEA 3DTMA 3IQAA 2DRWA 2WUQA 5FASA 2RCXA 2Y2MA 2R9XA 3SOIA 5FQKA 4ZJ3A 3WRTA 1XA1A 4WZ5C 5AQ7A 3UE3A 5FQIA 4GD8A 4E6XA 3IXHA 2BLSA 3C5AA 4FH4A 4C75A 4EWFA 1ERMA 2H5SA 4LV1A 1PI5A 5FAOA 1N4OA 3PBTA 5U47A 3MZFA 3C7VA 2XD5A 4N9LA 1IYQA 5CTMA 5E2EA 3OZHA 5GLDA 1XGJA 4OPRA 3UO9A 2FFFB 4KZ4A 4BENA 1PW1A 1ESUA 4WMCA 2EFUA 4QJGA 3I7JA 3GV9A 4MBFA 3IF6A 5EVIA 1YT4A 4Y0UA 4WBGA 3FKVA 4LV3A 4OOMA 1H5XA 3HLBA 5HW3A 3A3IA 1M6KA 1IEMA 4KZ7A 5I94A 3HL9A 2A49A 4HESA 5F82A 3LY4A 2HP6A 3WRZA 4OQHA 4IBXA 4GN2A 3TSGA 1L2SA 1L0EA 4WZ4A 1XP4A 4XUXA 2ZQCA 5CERA 4E3KA 1WYCA 3IHBA 1MWUA 1NJ4A 4PM7A 5EOOA 4BD0A 2WADA 4RX3A 4E3OA 4FH2A 3IHAA 5TGFA 3BFGA 4UA6A 4X53A 4RVAA 1BULA 3IT9A 3RXWA 1RGZA 4B88A 4BQMA 3AGEA 3E2KA 4RA7A 3ZFZA 1QMEA 1MXOA 4JF4A 3V3SA 1E3UD 4FCFA 5GLCA 3G35A 5G18A 4JLFA 4YINA 1TEMA 2JC7A 3IXBA 4C3QA 5CHJA 1WYBA 1GA0A 3GVBA 3P09A 3A3DA 1L0GA 2IWBA 2C5WB 5FQ9A 3UDXA 2XD1A 3HUOA 3WS5A 1FCMA 3NI9A 2ZQ7A 3DWKA 3FYZA 2UWXA 1EROA 1E4DA 1K55A 3HUMA 3PBNA 4ZBEA 3ZNTA 1MKIA 4RYEA 4K91A 5A90A 1W8QA 2ZD8A 3IXDA 4R3BA 1XXMA 3W4QA 3MBZA 3HVFA 1HZOA 5CEDA 1XGIA 1YLWA 2ZQDA 1OMEA 2EX2A 4GNUA 4IEDA 4S2KA 3W8KA 4DRTA 4GD6A 4OP5A 3W4OA 4DXBA 2XQZA 3NCKA 4KZ6A 4WEKA 1WE4A 2JBFA 4KQQA 4Y0TA 2FFYA 2PU4A 1JWZA 3WS0A 1CEFA 3IWQA 2XDMA 4JXGA 2J8YA 4PM9A 4N1XA 3O86A 3OPHA 2Y2JA 1ONHA 2EX6A 2EXAA 5AQ9A 4DE0A 1ES2A 1KDSA 3P98A 3TOIA 4BLMA 3VFFA 3N7WA 4UHUA 1YLJA 3BRMA 3VP4A 1LI9A 1DY6A 1ZKJA 2EXBA 3DWZA 5TR7A 3CG5A 4X68A 1K57C 2ZC3B 1S0WA 2IWCA 5CGWA 2Y2LA 3ISGA 2WGVA 3IF6B 4DXCA 3ZHHA 5EVIB 1I2WA 3ZGAB 5EVID 1I5QA 1W7FA 4U3TA 3GR2A 2ZM0A 1GA9A 1LI0A 2GDNA 5CRFA 3PBRA 3BFCA 3N8SA 2HDRA 4LCMA 5KSCA 2HPBA 2G2UA 5CEBA 4KG6A 4KZ5A 5GHYA 1VM1A 5DTSA 4A5RA 1XPBA 4DF6A 4GOGA 2P9VA 1KE4A 5E2GA 1PI4A 3AGDA 4N1HA 2Y2IA 4LV2A 3UPPA 1H8YA 4OLDA 3SH9A 3GTCA 3M2JA 2DNSA 2XH9A 3MZEA 4KZAA 2QZ6A 3OC2A 1PIOA 2ZQ8A 3N8RA 1G6AA 3VP2A 1KDWA 2J9PA 3HUNA 3VFHA 5FI6A 1K56A 4C6YA 4S2MA 5GL9A 1BLCA 2V1ZA 1IYPA 3IF6C 2OLVA
chains in the Genus database with same CATH superfamily
5EVIC 1FCOA 4XXRA 2CMNA 4H6JB 1MKMA 3QNBA 3ITAA 2WKQA 3PTEA 3D4FA 1BLHA 1OTEA 4S2NA 4I39A 2PAVP 4P6BA 4ARZA 3MKEA 1NZUA 3LYXA 4ZJ1A 1SCWA 1FIKA 2XGNA 2GX5A 3UY6A 1XJ3A 3T4JA 4Z1WA 3SH7A 2M7UA 1SDEA 3BFDA 5D3OA 3OCNA 4XT2A 1N9LA 3PAGA 4FD8A 2WK0A 1O07A 1A0KA 3LCEA 4DE3A 3UE6A 3GRJA 3M6BA 3DTIA 4JBFA 1JTDA 2HDQA 3PYPA 3N6IA 2M1CA 1YMSA 2VKSA 2EX9A 3V50A 5K5BA 5HWTA 1GHMA 1PZPA 4N9KA 2W27A 1MWRA 3SW1A 2UV0E 5J4EA 4NK3A 4ETZA 2V9AA 2HP5A 1BZAA 4DDSA 2I9VA 5FAPA 4IUKA 3G34A 4CLCE 2WZZA 1RP5A 2WKIA 3MQQA 4OPYA 3FG8A 4NETA 2XR0A 3QP2A 3IXGA 2R9WA 4S2OA 4U0XA 3AGFA 1PW8A 3MMHA 4WELA 3NOTC 1KOUA 4ARZB 3NBLA 2PD8A 5M1AA 1Q2PA 2EX8A 2YKHA 1T19A 3IH9A 4PMAA 3RXXA 3LR4A 1ZTUA 1JVJA 4OPZA 1G5UA 4GW9A 1ESIA 3CUEC 3UDFA 3A3JA 1XX2A 3OBFA 5G4YA 4LPZA 3W4PA 2DCFA 3A3EA 1N9BA 3LO7A 1C3BA 2JE5A 2GNXA 3E98A 5I5LA 5GLAA 4HP9A 4MN5A 1DJBA 1FSWA 5DVAA 3G2YA 5FQQA 5IHVA 1BYWA 2B18A 2GJ3A 3C2WA 2Y2OA 1KGFA 4QY5A 2PYRA 2HP9A 2J7VA 3CJMA 2X01A 1V9ZA 5DF8A 1F98A 2H0TA 1I2SA 4IVKA 3G32A 3D72A 4CLCD 1ZG6A 3HLCA 2B95A 3MZDA 4X25A 3A0SA 3UNWA 3GECA 3OCLA 1QMFA 4CJNA 4B4ZA 1XFNA 4JGRA 4DE1A 5J8XA 4WEJA 1D7EA 3B47A 4GDBA 3TG9A 4KZBA 3BLMA 1FR6A 3T1QB 3FV7A 5HWVA 3VOZA 1L0DA 1IKIA 3LICA 4HNBA 3NDEA 1MZUA 2X71A 2WAFA 4OP8A 2VGLM 4MNRA 2W3GA 5DKKA 3ZG9B 1N9NA 3NECA 1K54C 4RX2A 4DDYA 4NXGA 2J3WA 3ZVWA 4GLQA 4EBPA 5FEFA 1DJCA 4BBVA 1RGYA 5TBMA 1T1AA 3A3FA 4WN5A 2KX6A 3D3OA 4O0PA 4QB8A 2VGKA 3ITBA 4Y2FA 1E25A 4UA7A 3K2NA 4S2IA 4HEFA 4R6LA 1VEUA 5AVEA 2Y2NA 3Q7VB 4HBUA 4E04A 1ZG4A 5HAPA 3UN7A 2XLNA 3NJAA 5KMWA 5G4ZA 3IX8A 4YFMA 4L0LA 2XFSA 1K6RA 2ZLYA 1BUEA 2WUQA 2RCXA 5FQKA 3T4OA 2XRNA 4YNRA 5FQIA 4AFIA 2H5SA 3P01A 5U47A 3MZFA 3C7VA 3LFVA 1W63Q 3VOLA 2VLGA 4OPRA 4KZ4A 4NEED 3D9YA 2EFUA 4QJGA 3I7JA 3GV9A 3IF6A 5HW3A 4KZ7A 3CWFA 1YSPA 4HESA 3WRZA 4GN2A 2PR5A 4PM7A 3RTYA 1S4SA 1YAXA 4FH2A 5IS1A 4L9GA 1BULA 1LL8A 1RGZA 1NWZA 4EUVA 3B33A 4RA7A 3ZFZA 1MXOA 3EGXC 2VV6A 1T1BA 5GLCA 3G35A 2JKRM 5G18A 4YINA 3KSGA 3IXBA 1GA0A 4I3IA 2P7JA 3WS5A 4NKPA 2K2NA 3ZNTA 1UGUA 3PBNA 3LUQA 4K91A 1W8QA 5A90A 3IXDA 3MQ0A 2HJ9C 3C38A 5CEDA 4DRTA 4YWZA 4CLCA 4KQQA 1PNEA 2FFYA 3IWQA 3O86A 3OPHA 3VV4A 2Y2JA 3TOIA 1ZKJA 3EWKA 2Z6CA 2ZC3B 2IWCA 2L4RA 2Y2LA 3O5YA 3ISGA 2WGVA 3IF6B 3ZHHA 5EVID 3S7OA 1W7FA 2O99A 1GA9A 3MF0A 3BFCA 2Y8HA 3L7HA 3N8SA 4I38A 4LCMA 5KSCA 2G2UA 4KG6A 4KZ5A 2VK3A 1VM1A 5DTSA 2P9VA 3IBJA 3AGDA 4WL9A 1H8YA 3SH9A 3GTCA 3OC2A 2ZQ8A 1ACFA 2V1ZA 1SDNA 5EM1A 5DF9A 1HVBA 1H8ZA 3CMZA 1NRJA 2OAP1 3S4XA 2Y55A 2JKRI 1YLZA 1JWVA 3KSIA 5L8MA 2VJWA 3T50A 2ZMAA 2ZL1A 3O3VA 3VOYA 2P08A 4P0MA 1S6RA 4Y3IA 4E3JA 2B5RA 4WZ5A 4NXEA 4UAAA 3S22A 1XA7A 4O01A 1GHPA 5FAQA 3ZCZA 2BTFP 4EEPA 4CLCB 2ZC6B 4Q0IA 5CECA 1P9WA 3PBQA 4OLGA 4M4XA 4JF5A 4JXWA 4EESA 2Y59A 3B3XA 1CI9A 3T4KA 4IUHA 1TDLA 5FEGA 1S4RA 5KZHA 4GJ4A 1ERQA 4D2OA 1UWPX 2M7VA 2QJ5A 4WUJA 3GDIA 4IJGA 2VX8A 4EBLA 4OQIA 1K4EA 1ES5A 3IWOA 4I5SA 2WKPA 2Z2MB 3NC8A 4P85A 4EUZA 1FOFA 1PZOA 2G2WA 1IKGA 2W0NA 2P9VB 3KSHA 5J3WA 4KQRA 4R23A 1DP9A 3VSLA 4EBNA 3DBAA 2QPNA 4P87A 4DJ3A 4Y7PA 4ZTKA 2Y2QA 2MJ6A 3BEBA 5KSHA 3HJIA 5CHUA 1KVLA 3V5MA 4MLLA 3QP8A 3S7QA 4X69A 3BQAA 1HLUP 5TFQA 1J9MA 3V3RA 4BJPA 4S2PA 3BYDA 3KYQA 4QHCA 4BL3A 3U4LP 3SS5A 1CJFA 1Y54A 3RJUA 3UE1A 2C6WB 2J3TC 1W8YA 3CHWP 3VMAA 3M6HA 4U0TA 2HJEA 3L9KA 4S2NC 1FR1A 4MDZA 3WS1A 3MQOA 5EE8A 5GLBA 4EQIA 1FCNA 2ZQAA 4R3AA 4DN0A 2JKTM 4HY8A 4PM8A 1JTGA 1KGEA 1KE3A 2PYPA 2QKPA 2IWDA 1SKOB 4QD4A 2ZJ9A 4WYYA 3CPTA 4OH0A 2V2FF 2L1MA 3S7PA 5HDCA 3EEAA 2WGWA 1ONGA 3IBRA 1VETA 1G68A 1BLPA 4O7DA 1OJ5A 3LI8A 3BM6A 3DTKA 4WLAA 4LRXC 2H0YA 2W3EA 4O8GA 1K38A 2K31A 4PKYA 4B9OA 3E4OA 4BBUA 1OTIA 3G30A 2E8JA 1G28A 2CC1A 2FH5A 4MBHA 1GHIA 4Y15A 3PAEA 1AXBA 5F6AA 2ZBBA 2O9AA 1Z6FA 4KZ9A 3ZYTA 5JYOA 3NDGA 1ZC2A 4JGOA 4H8RA 2VGJA 4QU3A 1K6SA 1GSVA 3KYEA 1PFLA 1NRFA 4PPRA 5CGSA 3O88A 3DW0A 2D02A 3WWXA 3VP0A 2JKTI 2EFXA 1CI8A 4OQGA 4IVIA 1XJ4A 3JPUA 3CPTB 4EU0A 1YQSA 3HLFA 4X1LA 3N8LA 5HL1A 3DTEA 2Y91A 2X02A 2V1AA 3LIBA 1IYSA 2WGWB 2HDSA 3ZDJA 2OWJA 4KQOA 3HLWA 4XT2B 1VETB 4F3LA 4UA9A 4LLOB 1HD8A 3ZG7B 4JXSA 1K57A 1VHMA 3RFBA 2HF6A 1F5MA 3IQAA 2DRWA 4E6XA 4GD8A 3VE3A 5HDSA 4FH4A 3C5AA 4C75A 2W3DA 3OLOA 3T1RA 5EM0A 1N4OA 3PBTA 1OPXA 3BY9A 4MMNA 2GZAA 4ETXA 1ESUA 4HJ6A 4LV3A 4OOMA 4FTXA 3EOIA 2A49A 1TF1A 2HP6A 4OQHA 2V8FA 3TSGA 1L2SA 4E3KA 3IHBA 1NJ4A 4BD0A 5FL3A 5TGFA 1P0ZA 2ZOIA 4LGWA 4B88A 4BQMA 2V0UA 1QMEA 4BWIA 5F68A 1E3UD 2JHEA 2HZ5A 3P09A 2W1RA 3EGDC 2IWBA 1FILA 5FQ9A 4F3LB 2XD1A 3HUOA 2ZQ7A 3DWKA 2UWXA 1K55A 4ZBEA 4RYEA 4R3BA 4GS9A 1HZOA 2ZQDA 1OMEA 4S2KA 3W8KA 3W4OA 4WEKA 1WE4A 2JBFA 4L9FA 2DMWA 2PU4A 4RQ9A 1JWZA 2YKFA 4NXBA 1CEFA 3LEQA 3MJQA 2EXAA 3MR0A 5AQ9A 4DE0A 1ES2A 2ACGA 3UB8A 4UHUA 5EVEA 4X68A 5HSQA 4DXCA 3ZGAB 3H82A 2PHYA 3PBRA 3W2ZA 2EWVA 2V1BA 1KE4A 5E2GA 1PI4A 3B42A 4LV2A 3UPPA 3M2JA 2XH9A 4GHIA 2QZ6A 3N8RA 4Y17A 3VP2A 3HUNA 3IX4A 4G3VA 2XA7S 5FI6A 1BLCA 3QP4A 3IF6C 2OLVA 5HFOA 2VA0A 4LRZE 1STZA 4EXOA 4LV0A 3QP6A 4OOYA 1CK3A 4ID4A 3OPPA 4EEUA 4DKIA 1H3QA 4Y13A 5FI2A 5A91A 4K0XA 1XFQA 2Y2HA 2ZC7A 1BLSA 2PDRA 3C4OA 5EOEA 1MPLA 3VP3A 5TBMB 5E43A 5DKLA 1MWTA 1JNUA 3LY3A 1BTLA 4OONA 1TS8A 3PR6A 2RL3A 3FWLA 3NOPC 4X6TA 4F94A 3SS3A 5AVFA 1VEUB 4R4RA 2P04A 3G4PA 4QPRA 5CXWA 3H82B 3QP5A 4JF6A 5CTNA 2J80A 5HZHA 4CLCC 1DRMA 4ZDXA 4EV4A 3PBOA 5F1GA 3RH8B 4GHIB 2QHKA 1LSWA 3CAXA 3UDIA 2ZC4B 4Y5FA 4K08A 4E3MA 5DJUA 5FATA 2JCHA 1TVFA 2FZ0A 2J3TD 4OOLA 3MSHA 5HWWA 3BLSA 1LHYA 4BMWA 1YLYA 3IWIA 3WS2A 5HAQA 5TJJA 1ES3A 1SHVA 1NYYA 3T4QA 2XK1A 3T4SA 4IHQA 1E3UA 3BY8A 1S1ZA 1TD5A 3CITA 2BASA 3LIDA 5DTKA 4K0WA 5BOHA 3PXPA 1O7EA 1JWPA 2WZXA 2WAEA 2LB5A 2Y2PA 3T4LA 4JGPA 5HAIA 5AQAA 4M3KA 1N9OA 2WKHA 4BL2A 2JKGA 4R0QA 2VV7A 3C8CA 5GHZA 1T1CA 5DF7A 5CGXA 2IA2A 5L2FA 5F1FA 2ZM2A 5CX7A 4JKTA 1D06A 1SZVA 1YSQA 3E2LA 4Z9QA 4BD1A 1LLBA 2ZC5B 3FZCA 2V20A 4PM5A 3MKFA 3M2KA 3MXRA 2KLIA 3E0YA 1IELA 3GQZA 3SS4A 1MBLA 3KYZA 4R3JA 1FQGA 3VP1A 1BSGA 1HTZA 4ZAMA 5EV0A 3IF5A 3QP1A 2QYBA 2P74A 5L09A 1EW0A 1ES4A 4MBKA 3HLGA 4LENA 3NIAA 5HD3A 1TDGA 2OSUA 1W5DA 2ZQ9A 3NY4A 3EQVA 2O9BA 4UEYA 1D1JA 4KG5A 4KUOA 4HOIA 3UE0A 3ZVTA 3OPRA 3LIAA 1VB6A 2QMIA 4EW7A 3HREA 1M40A 3IS2A 3UPOA 2WYXA 1BT5A 4I3JA 1YLPA 4HI4A 3QHYA 3BFFA 5EUAA 3CZDA 4WM9A 1IYOA 1LSXA 3A0RA 2ZL1B 2Z2LB 3PHYA 1KVMA 1LL5A 2WKRA 4OVDA 2W3HA 3IH8A 5FQJA 3C30A 1KE0A 5EECA 3LEZA 4QY6A 1PRQA 2NUPC 4P6ZS 4FSFA 1DP8A 3F1PA 4ZJ2A 4NG2A 3JVVA 3EEHA 5E2FA 2PD7A 4E3IA 1RCJA 3K3CA 2E8IA 1PWGA 4G3KA 1IFQA 1ODVA 4HJ3A 3DTMA 3F1OA 2Y2MA 2R9XA 4ZJ3A 3VE4A 3WRTA 1XA1A 4UQIS 5HPIA 2HV1A 1G6OA 3IXHA 4EWFA 2Y79A 4LV1A 2EA9A 3FPVA 5IU1A 2XD5A 5DJTA 1IYQA 4PAUA 2QWSA 3UO9A 2FFFB 1PW1A 5EVIA 1YT4A 2H28A 2D01A 2ZMFA 1OT6A 3HLBA 1Z09A 3A3IA 1M6KA 3MFXA 3IS2B 1IEMA 5I94A 5F82A 3LY4A 1L0EA 4WZ4A 1XP4A 3ULFA 1IOUA 5HL6A 2V0WA 1MWUA 4EETB 4RX3A 4E3OA 2NUTC 1TS7A 3R4KA 1OJGA 4UA6A 1Y28A 4X53A 2K7SA 4ESPA 1T18A 5HD5A 3RXWA 5J7EA 3AGEA 3E2KA 4D60A 4JF4A 3E4PA 4JLFA 3H7WA 1TEMA 2JC7A 4HH2A 4KQDA 3F1PB 4C3QA 3UDXA 1FCMA 3NI9A 3FYZA 1LSVA 1XJ6A 4EQ1A 3W4QA 3UMDA 3F1OB 1L3LA 1XGIA 1YLWA 3OOVA 4DXBA 4OP5A 2XQZA 4KZ6A 3KX0X 1S66L 2PR6A 3WS0A 4JXGA 1W63M 4R70A 1OTDA 1ONHA 1GSWA 1S67L 1H8MA 1KDSA 4JGQA 3VFFA 1YLJA 5C5KA 5TR7A 3CG5A 1K57C 5CGWA 4B93A 5EVIB 3S7NA 5HPFA 1I5QA 1CQAA 4U3TA 2LB9A 2ZM0A 5DFYA 4HH3A 3KO6A 5CEBA 2XA7M 5GHYA 1XPBA 4DF6A 2A24A 2Y2IA 3TE8A 3MZEA 3LGOA 3E4QA 1G6AA 1KDWA 3CUEA 5F5YA 4C6YA 4S2MA 5GL9A 3OPLA 3MS6A 3BJNA 4JPMA 1EI5A 1YPRA 3KSFA 3H7WB 1NY0A 3VSKA 4Y0OA 2XROA 4OQ0A 1AWIA 4S2JA 2W1TA 3UMEA 3G31A 3BW6A 5A8BA 1U60A 4G3WA 3ZNYA 1W79A 3MXQA 1NYMA 4X56A 5EPHA 4X55A 3UB5P 4E6WA 4MCWA 3Q7VA 1GCEA 3MFDA 5JYPA 2V8CA 3Q07A 3BWLA 3A0VA 1X0OA 3S1YA 4OPQA 4QWOA 3UB6A 4CPKA 4R1GA 3MXSA 1K55C 3CI6A 1SKFA 5FDHA 3BECA 4KZ3A 2PU2A 3HCYA 2JN7A 4GKUA 2ZM8A 4B4XA 3T4TA 4LFUA 4NXFA 3Q7ZA 3PBSA 2OAQ1 2OWHA 3LIFA 2OV5A 2A24B 2VZWA 2H10A 1KGGA 3LI9A 4CQHA 1P97A 3G2ZA 2O0YA 1YKDA 5A92A 3LR3A 1FSYA 3HBRA 3ZG8B 2Q0OA 5GHXA 1PWCA 2XEPA 5HARA 4IBRA 2W1TB 1NXYA 1K54A 5HDDA 3TW8A 4WMCD 3LR5A 1K4FA 4E3LA 4I3AA 4Q8IA 1Q2QA 4ME4A 1MWSA 4GB7A 3QNCA 4YOFA 2EWWA 1V9YA 5EVLA 4BBTA 2PBYA 1MY8A 5FA7A 4GDNA 1H0MA 3N4IA 5HX9A 3ZG0A 4Q0JA 1F9IA 4MN6A 4DE2A 3P7NA 3V39A 2WGIA 3F1NA 2A2LA 2B02A 3BFEA 1Y4OA 4E3NA 1TS0A 4N92A 3Q82A 1ZHHB 3EQUA 3HJKA 4JXVA 5DTTA 1L0FA 4OKPA 5IT5A 4GS9B 2OLUA 4HJ4A 4HBTA 4LCLA 3BQ8A 3JYIA 3WS4A 2VV8A 3G6OA 4PM6A 3DAVA 5FQMA 1CEGA 3TJZC 2HGVA 1VQQA 3UPNA 3SH8A 3Q81A 1OTAA 4S2LA 1PYYA 3FC7A 2Q9NA 3V67A 3O87A 3Q1FA 4L9EA 4XUZA 5F83A 2Y4AA 5E2HA 2O9CA 1EWZA 2J9OA 1K25A 1PWDA 5DFXA 3R7WA 2VEAA 1TS6A 1LL9A 1XJ2A 4MEZA 2Q9MA 1NZOA 1K0KA 1WA9A 3IX3A 1ALQA 2PBDP 3C7UA 2I72A 3NULA 4PKYG 3HLDA 1K56D 2Y2KA 4KG2A 3F1NB 1CF0A 4HQAA 1XKZA 4DMZA 1J3WA 2XF3A 2VGLS 1DJAA 3T1SA 2L0WA 3FKWA 4PHTA 4ZRRA 1OT9A 2WKEA 4P6ZM 2A3UA 5F69A 5FI7A 2HDUA 5L10A 3GSGA 1UWNX 1YM1A 3ZQ5A 3HLEA 2BG1A 4KZ8A 4R4SA 5M18A 2XSSA 2XFTA 1P9RA 3FPWA 5FSRA 3GMWA 2ZMVA 5CHMA 5M19A 4KENB 5A93A 3ZG5A 5L07A 2Y2GA 3C4PA 5AQBA 4UQIM 3H9WA 1LT0A 3LIEA 2KOIA 4GZBA 1YMXA 4MN7A 1YLTA 5FASA 3SOIA 2G7UA 4WZ5C 5AQ7A 3UE3A 5FDSA 2BLSA 4II7A 1ERMA 5EFWA 1PI5A 5FAOA 3T1XA 4N9LA 4Q0HA 5CTMA 5E2EA 3OZHA 5GLDA 3R7WB 4FUWA 1XGJA 4BENA 3NHQA 4WMCA 3NOUC 4MBFA 4Y0UA 4WBGA 3T12B 3FKVA 1NLZA 1H5XA 1F2KA 3HL9A 4HIAA 3ICYA 3LR0A 4IBXA 4FOFA 4XUXA 2JKFA 2ZQCA 5CERA 1WYCA 4GCZA 5EOOA 2WADA 3IHAA 1GSXA 3UB9A 2INWA 3CLOA 3BFGA 5AJGA 4RVAA 3IT9A 2AVXA 3TRCA 3V3SA 5LBRA 4FCFA 4H6JA 3U2AA 5KIZA 5CHJA 1WYBA 3GVBA 3K3DA 3A3DA 3UB7A 1L0GA 2C5WB 4HP4A 2ZOHA 4EERA 1EROA 1E4DA 2PRFA 3HUMA 1MKIA 1SKOA 1NLYA 2ZD8A 4DJ2A 1XXMA 3MBZA 3HVFA 2EX2A 4GNUA 4IEDA 2OOLA 3SZTA 4GD6A 3NCKA 4WF0A 4Y0TA 1MC0A 2XDMA 2J8YA 4PM9A 4N1XA 2EX6A 4KUKA 3P98A 4BLMA 4R38A 1DP6A 2R78A 3N7WA 3BRMA 3VP4A 1LI9A 1DY6A 2EXBA 3DWZA 1S0WA 4LRYC 1I2WA 2QJ7A 2Z6DA 3GR2A 2PT7A 1S1YA 1LI0A 2GDNA 5CRFA 2HDRA 4HHDA 2HPBA 4X1MA 4A5RA 2W3FA 4GOGA 4N1HA 3JVUA 4OLDA 5MC7A 2DNSA 4KZAA 2KDKA 1PIOA 2J9PA 3VFHA 1OTBA 1K56A 1IYPA
chains in the Genus database with same CATH topology
3OPLA 5HFOA 5EVIC 1FCOA 4XXRA 1SDNA 5DF9A 4JPMA 1EI5A 1HVBA 3QNBA 3ITAA 1H8ZA 3PTEA 1NY0A 3D4FA 3CMZA 1BLHA 4LV0A 3VSKA 4Y0OA 4OQ0A 2Y55A 4S2NA 3S4XA 4OOYA 4P6BA 1YLZA 4S2JA 1CK3A 3MKEA 4ID4A 1JWVA 1NZUA 3G31A 3OPPA 4ZJ1A 4DKIA 1SCWA 5FI2A 2ZMAA 3O3VA 3VOYA 2XGNA 4P0MA 1S6RA 1U60A 3UY6A 2B5RA 4E3JA 3ZNYA 4WZ5A 1W79A 4X56A 1NYMA 5A91A 4UAAA 3S22A 4K0XA 1XA7A 5EPHA 4X55A 2Y2HA 2ZC7A 1BLSA 1GHPA 5FAQA 3C4OA 5EOEA 1MPLA 4E6WA 3SH7A 3ZCZA 3Q7VA 3VP3A 2ZC6B 5E43A 5CECA 1MWTA 1GCEA 3PBQA 4OLGA 1SDEA 3BFDA 5D3OA 3OCNA 3MFDA 3LY3A 5JYPA 4JF5A 4JXWA 1BTLA 2Y59A 4OONA 3B3XA 1CI9A 3PAGA 3Q07A 4FD8A 2RL3A 2WK0A 1O07A 3FWLA 3LCEA 4X6TA 4F94A 3SS3A 4DE3A 3GRJA 3M6BA 1TDLA 3S1YA 4OPQA 5KZHA 4CPKA 4R4RA 1ERQA 4D2OA 4R1GA 3MXSA 1K55C 4JBFA 1SKFA 5FDHA 1JTDA 2HDQA 3N6IA 3BECA 4KZ3A 1YMSA 3G4PA 2PU2A 3V50A 2EX9A 4EBLA 4GKUA 5CXWA 1GHMA 2ZM8A 1PZPA 4JF6A 4OQIA 4B4XA 4N9KA 1K4EA 1ES5A 1MWRA 3Q7ZA 3IWOA 5CTNA 3PBSA 2Z2MB 3NC8A 4P85A 4EUZA 1FOFA 1PZOA 4ZDXA 4EV4A 3PBOA 2G2WA 1IKGA 2P9VB 2OV5A 5F1GA 4KQRA 4NK3A 4R23A 2HP5A 1BZAA 4DDSA 2H10A 3VSLA 1KGGA 5FAPA 4EBNA 3G34A 3UDIA 2ZC4B 2QPNA 4P87A 3G2ZA 4E3MA 2WZZA 1RP5A 2WKIA 4Y7PA 5FATA 5A92A 4OPYA 1FSYA 2JCHA 4ZTKA 4NETA 1TVFA 3HBRA 3ZG8B 2XR0A 4OOLA 5GHXA 1PWCA 2Y2QA 3IXGA 2R9WA 2XEPA 4S2OA 3BEBA 4U0XA 5HARA 3AGFA 1PW8A 5KSHA 4WELA 3BLSA 5CHUA 1KVLA 4IBRA 3V5MA 1LHYA 1NXYA 1K54A 3NBLA 4MLLA 1YLYA 4WMCD 4X69A 5M1AA 1Q2PA 2EX8A 1K4FA 3IWIA 4E3LA 3IH9A 5TFQA 3WS2A 5HAQA 1J9MA 1ES3A 1SHVA 4PMAA 3RXXA 3V3RA 4BJPA 1NYYA 4Q8IA 1Q2QA 2XK1A 3BYDA 1JVJA 4S2PA 4QHCA 4BL3A 1MWSA 4OPZA 1E3UA 3QNCA 4GB7A 1ESIA 3SS5A 3UDFA 5EVLA 1Y54A 3RJUA 5DTKA 3UE1A 2C6WB 3A3JA 1W8YA 1XX2A 2PBYA 1MY8A 4K0WA 3VMAA 3M6HA 4GDNA 4U0TA 5FA7A 5BOHA 3W4PA 3N4IA 2DCFA 3A3EA 1O7EA 5HX9A 3ZG0A 1JWPA 2WZXA 4DE2A 2WAEA 4S2NC 1FR1A 1N9BA 2Y2PA 3LO7A 3WS1A 3V39A 1C3BA 5HAIA 2JE5A 5AQAA 2WGIA 5EE8A 5GLBA 4M3KA 5GLAA 4EQIA 1FCNA 1DJBA 1FSWA 2WKHA 3BFEA 5DVAA 2ZQAA 3G2YA 4BL2A 4E3NA 4R0QA 5FQQA 4N92A 3Q82A 4PM8A 5GHZA 5IHVA 5DF7A 5CGXA 5L2FA 5F1FA 2ZM2A 1JTGA 1KGEA 3EQUA 1KE3A 2Y2OA 4JXVA 5DTTA 1L0FA 1KGFA 4JKTA 4QY5A 2IWDA 4OKPA 2HP9A 2J7VA 4QD4A 2ZJ9A 2OLUA 3CJMA 3E2LA 4WYYA 4Z9QA 2X01A 4OH0A 4BD1A 4HBTA 1LLBA 2V2FF 4LCLA 5DF8A 2ZC5B 2H0TA 1I2SA 4IVKA 3FZCA 2V20A 3G32A 2WGWA 4PM5A 3MKFA 1ZG6A 3M2KA 3HLCA 3JYIA 3MZDA 1ONGA 3WS4A 3MXRA 1G68A 4PM6A 3UNWA 1BLPA 1CEGA 4O7DA 5FQMA 1IELA 1VQQA 3GQZA 3SS4A 1MBLA 3BM6A 3OCLA 4R3JA 3SH8A 3UPNA 1FQGA 3Q81A 3VP1A 1QMFA 4CJNA 1BSGA 4S2LA 2H0YA 4B4ZA 1HTZA 4ZAMA 1PYYA 1K38A 4DE1A 5J8XA 2Q9NA 3IF5A 4WEJA 3O87A 3G30A 2P74A 3Q1FA 2CC1A 1ES4A 4MBKA 3HLGA 4GDBA 4LENA 3TG9A 4KZBA 3BLMA 4XUZA 1FR6A 3NIAA 5F83A 4MBHA 1GHIA 1TDGA 3PAEA 1AXBA 3FV7A 2OSUA 3VOZA 1W5DA 2Y4AA 5E2HA 1EWZA 2ZQ9A 3NY4A 3EQVA 1Z6FA 2J9OA 1K25A 1PWDA 4KZ9A 1L0DA 1IKIA 1LL9A 3NDEA 4MEZA 4KG5A 2Q9MA 2X71A 1NZOA 3UE0A 5JYOA 2WAFA 3ZVTA 3OPRA 3NDGA 1ZC2A 4MNRA 4OP8A 1ALQA 4H8RA 2VGJA 2QMIA 3HREA 3C7UA 2I72A 4QU3A 3ZG9B 1K6SA 4RX2A 1K54C 3HLDA 4DDYA 1K56D 1M40A 2Y2KA 4KG2A 3UPOA 2WYXA 1BT5A 3ZVWA 1XKZA 4EBPA 1NRFA 1YLPA 2XF3A 3QHYA 3O88A 1DJAA 4PPRA 1DJCA 5CGSA 3BFFA 3DW0A 5EUAA 3WWXA 3CZDA 3VP0A 1RGYA 3FKWA 4WM9A 1IYOA 3A3FA 2WKEA 2EFXA 2A3UA 1CI8A 4OQGA 5FI7A 2HDUA 2Z2LB 4IVIA 4QB8A 1KVMA 3GSGA 1YM1A 1LL5A 2VGKA 3ITBA 3HLEA 4OVDA 2BG1A 4KZ8A 1E25A 4UA7A 3IH8A 4R4SA 5FQJA 5EECA 1KE0A 4S2IA 3LEZA 5M18A 4QY6A 4HEFA 2XFTA 1YQSA 3HLFA 5FSRA 3GMWA 3N8LA 5HL1A 5CHMA 5M19A 4KENB 2Y2NA 3Q7VB 2Y91A 2X02A 5A93A 4HBUA 4FSFA 1IYSA 2WGWB 3ZG5A 1ZG4A 5HAPA 2HDSA 4ZJ2A 3ZDJA 3UN7A 4KQOA 2XLNA 2Y2GA 3HLWA 3C4PA 5E2FA 5AQBA 4E3IA 1RCJA 4UA9A 5KMWA 2E8IA 1PWGA 1HD8A 3ZG7B 4JXSA 4GZBA 1K57A 4YFMA 4L0LA 2XFSA 1YMXA 1K6RA 1YLTA 2ZLYA 1BUEA 3DTMA 3IQAA 2DRWA 2WUQA 5FASA 2RCXA 2Y2MA 2R9XA 3SOIA 5FQKA 4ZJ3A 3WRTA 1XA1A 4WZ5C 5AQ7A 3UE3A 5FQIA 4GD8A 4E6XA 3IXHA 2BLSA 3C5AA 4FH4A 4C75A 4EWFA 1ERMA 2H5SA 4LV1A 1PI5A 5FAOA 1N4OA 3PBTA 5U47A 3MZFA 3C7VA 2XD5A 4N9LA 1IYQA 5CTMA 5E2EA 3OZHA 5GLDA 1XGJA 4OPRA 3UO9A 2FFFB 4KZ4A 4BENA 1PW1A 1ESUA 4WMCA 2EFUA 4QJGA 3I7JA 3GV9A 4MBFA 3IF6A 5EVIA 1YT4A 4Y0UA 4WBGA 3FKVA 4LV3A 4OOMA 1H5XA 3HLBA 5HW3A 3A3IA 1M6KA 1IEMA 4KZ7A 5I94A 3HL9A 2A49A 4HESA 5F82A 3LY4A 2HP6A 3WRZA 4OQHA 4IBXA 4GN2A 3TSGA 1L2SA 1L0EA 4WZ4A 1XP4A 4XUXA 2ZQCA 5CERA 4E3KA 1WYCA 3IHBA 1MWUA 1NJ4A 4PM7A 5EOOA 4BD0A 2WADA 4RX3A 4E3OA 4FH2A 3IHAA 5TGFA 3BFGA 4UA6A 4X53A 4RVAA 1BULA 3IT9A 3RXWA 1RGZA 4B88A 4BQMA 3AGEA 3E2KA 4RA7A 3ZFZA 1QMEA 1MXOA 4JF4A 3V3SA 1E3UD 4FCFA 5GLCA 3G35A 5G18A 4JLFA 4YINA 1TEMA 2JC7A 3IXBA 4C3QA 5CHJA 1WYBA 1GA0A 3GVBA 3P09A 3A3DA 1L0GA 2IWBA 2C5WB 5FQ9A 3UDXA 2XD1A 3HUOA 3WS5A 1FCMA 3NI9A 2ZQ7A 3DWKA 3FYZA 2UWXA 1EROA 1E4DA 1K55A 3HUMA 3PBNA 4ZBEA 3ZNTA 1MKIA 4RYEA 4K91A 5A90A 1W8QA 2ZD8A 3IXDA 4R3BA 1XXMA 3W4QA 3MBZA 3HVFA 1HZOA 5CEDA 1XGIA 1YLWA 2ZQDA 1OMEA 2EX2A 4GNUA 4IEDA 4S2KA 3W8KA 4DRTA 4GD6A 4OP5A 3W4OA 4DXBA 2XQZA 3NCKA 4KZ6A 4WEKA 1WE4A 2JBFA 4KQQA 4Y0TA 2FFYA 2PU4A 1JWZA 3WS0A 1CEFA 3IWQA 2XDMA 4JXGA 2J8YA 4PM9A 4N1XA 3O86A 3OPHA 2Y2JA 1ONHA 2EX6A 2EXAA 5AQ9A 4DE0A 1ES2A 1KDSA 3P98A 3TOIA 4BLMA 3VFFA 3N7WA 4UHUA 1YLJA 3BRMA 3VP4A 1LI9A 1DY6A 1ZKJA 2EXBA 3DWZA 5TR7A 3CG5A 4X68A 1K57C 2ZC3B 1S0WA 2IWCA 5CGWA 2Y2LA 3ISGA 2WGVA 3IF6B 4DXCA 3ZHHA 5EVIB 1I2WA 3ZGAB 5EVID 1I5QA 1W7FA 4U3TA 3GR2A 2ZM0A 1GA9A 1LI0A 2GDNA 5CRFA 3PBRA 3BFCA 3N8SA 2HDRA 4LCMA 5KSCA 2HPBA 2G2UA 5CEBA 4KG6A 4KZ5A 5GHYA 1VM1A 5DTSA 4A5RA 1XPBA 4DF6A 4GOGA 2P9VA 1KE4A 5E2GA 1PI4A 3AGDA 4N1HA 2Y2IA 4LV2A 3UPPA 1H8YA 4OLDA 3SH9A 3GTCA 3M2JA 2DNSA 2XH9A 3MZEA 4KZAA 2QZ6A 3OC2A 1PIOA 2ZQ8A 3N8RA 1G6AA 3VP2A 1KDWA 2J9PA 3HUNA 3VFHA 5FI6A 1K56A 4C6YA 4S2MA 5GL9A 1BLCA 2V1ZA 1IYPA 3IF6C 2OLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPL A;  5HFO A;  5EVI C;  1FCO A;  4XXR A;  1SDN A;  5DF9 A;  4JPM A;  1EI5 A;  1HVB A;  3QNB A;  3ITA A;  1H8Z A;  3PTE A;  1NY0 A;  3D4F A;  3CMZ A;  1BLH A;  4LV0 A;  3VSK A;  4Y0O A;  4OQ0 A;  2Y55 A;  4S2N A;  3S4X A;  4OOY A;  4P6B A;  1YLZ A;  4S2J A;  1CK3 A;  3MKE A;  4ID4 A;  1JWV A;  1NZU A;  3G31 A;  3OPP A;  4ZJ1 A;  4DKI A;  1SCW A;  5FI2 A;  2ZMA A;  3O3V A;  3VOY A;  2XGN A;  4P0M A;  1S6R A;  1U60 A;  3UY6 A;  2B5R A;  4E3J A;  3ZNY A;  4WZ5 A;  1W79 A;  4X56 A;  1NYM A;  5A91 A;  4UAA A;  3S22 A;  4K0X A;  1XA7 A;  5EPH A;  4X55 A;  2Y2H A;  2ZC7 A;  1BLS A;  1GHP A;  5FAQ A;  3C4O A;  5EOE A;  1MPL A;  4E6W A;  3SH7 A;  3ZCZ A;  3Q7V A;  3VP3 A;  2ZC6 B;  5E43 A;  5CEC A;  1MWT A;  1GCE A;  3PBQ A;  4OLG A;  1SDE A;  3BFD A;  5D3O A;  3OCN A;  3MFD A;  3LY3 A;  5JYP A;  4JF5 A;  4JXW A;  1BTL A;  2Y59 A;  4OON A;  3B3X A;  1CI9 A;  3PAG A;  3Q07 A;  4FD8 A;  2RL3 A;  2WK0 A;  1O07 A;  3FWL A;  3LCE A;  4X6T A;  4F94 A;  3SS3 A;  4DE3 A;  3GRJ A;  3M6B A;  1TDL A;  3S1Y A;  4OPQ A;  5KZH A;  4CPK A;  4R4R A;  1ERQ A;  4D2O A;  4R1G A;  3MXS A;  1K55 C;  4JBF A;  1SKF A;  5FDH A;  1JTD A;  2HDQ A;  3N6I A;  3BEC A;  4KZ3 A;  1YMS A;  3G4P A;  2PU2 A;  3V50 A;  2EX9 A;  4EBL A;  4GKU A;  5CXW A;  1GHM A;  2ZM8 A;  1PZP A;  4JF6 A;  4OQI A;  4B4X A;  4N9K A;  1K4E A;  1ES5 A;  1MWR A;  3Q7Z A;  3IWO A;  5CTN A;  3PBS A;  2Z2M B;  3NC8 A;  4P85 A;  4EUZ A;  1FOF A;  1PZO A;  4ZDX A;  4EV4 A;  3PBO A;  2G2W A;  1IKG A;  2P9V B;  2OV5 A;  5F1G A;  4KQR A;  4NK3 A;  4R23 A;  2HP5 A;  1BZA A;  4DDS A;  2H10 A;  3VSL A;  1KGG A;  5FAP A;  4EBN A;  3G34 A;  3UDI A;  2ZC4 B;  2QPN A;  4P87 A;  3G2Z A;  4E3M A;  2WZZ A;  1RP5 A;  2WKI A;  4Y7P A;  5FAT A;  5A92 A;  4OPY A;  1FSY A;  2JCH A;  4ZTK A;  4NET A;  1TVF A;  3HBR A;  3ZG8 B;  2XR0 A;  4OOL A;  5GHX A;  1PWC A;  2Y2Q A;  3IXG A;  2R9W A;  2XEP A;  4S2O A;  3BEB A;  4U0X A;  5HAR A;  3AGF A;  1PW8 A;  5KSH A;  4WEL A;  3BLS A;  5CHU A;  1KVL A;  4IBR A;  3V5M A;  1LHY A;  1NXY A;  1K54 A;  3NBL A;  4MLL A;  1YLY A;  4WMC D;  4X69 A;  5M1A A;  1Q2P A;  2EX8 A;  1K4F A;  3IWI A;  4E3L A;  3IH9 A;  5TFQ A;  3WS2 A;  5HAQ A;  1J9M A;  1ES3 A;  1SHV A;  4PMA A;  3RXX A;  3V3R A;  4BJP A;  1NYY A;  4Q8I A;  1Q2Q A;  2XK1 A;  3BYD A;  1JVJ A;  4S2P A;  4QHC A;  4BL3 A;  1MWS A;  4OPZ A;  1E3U A;  3QNC A;  4GB7 A;  1ESI A;  3SS5 A;  3UDF A;  5EVL A;  1Y54 A;  3RJU A;  5DTK A;  3UE1 A;  2C6W B;  3A3J A;  1W8Y A;  1XX2 A;  2PBY A;  1MY8 A;  4K0W A;  3VMA A;  3M6H A;  4GDN A;  4U0T A;  5FA7 A;  5BOH A;  3W4P A;  3N4I A;  2DCF A;  3A3E A;  1O7E A;  5HX9 A;  3ZG0 A;  1JWP A;  2WZX A;  4DE2 A;  2WAE A;  4S2N C;  1FR1 A;  1N9B A;  2Y2P A;  3LO7 A;  3WS1 A;  3V39 A;  1C3B A;  5HAI A;  2JE5 A;  5AQA A;  2WGI A;  5EE8 A;  5GLB A;  4M3K A;  5GLA A;  4EQI A;  1FCN A;  1DJB A;  1FSW A;  2WKH A;  3BFE A;  5DVA A;  2ZQA A;  3G2Y A;  4BL2 A;  4E3N A;  4R0Q A;  5FQQ A;  4N92 A;  3Q82 A;  4PM8 A;  5GHZ A;  5IHV A;  5DF7 A;  5CGX A;  5L2F A;  5F1F A;  2ZM2 A;  1JTG A;  1KGE A;  3EQU A;  1KE3 A;  2Y2O A;  4JXV A;  5DTT A;  1L0F A;  1KGF A;  4JKT A;  4QY5 A;  2IWD A;  4OKP A;  2HP9 A;  2J7V A;  4QD4 A;  2ZJ9 A;  2OLU A;  3CJM A;  3E2L A;  4WYY A;  4Z9Q A;  2X01 A;  4OH0 A;  4BD1 A;  4HBT A;  1LLB A;  2V2F F;  4LCL A;  5DF8 A;  2ZC5 B;  2H0T A;  1I2S A;  4IVK A;  3FZC A;  2V20 A;  3G32 A;  2WGW A;  4PM5 A;  3MKF A;  1ZG6 A;  3M2K A;  3HLC A;  3JYI A;  3MZD A;  1ONG A;  3WS4 A;  3MXR A;  1G68 A;  4PM6 A;  3UNW A;  1BLP A;  1CEG A;  4O7D A;  5FQM A;  1IEL A;  1VQQ A;  3GQZ A;  3SS4 A;  1MBL A;  3BM6 A;  3OCL A;  4R3J A;  3SH8 A;  3UPN A;  1FQG A;  3Q81 A;  3VP1 A;  1QMF A;  4CJN A;  1BSG A;  4S2L A;  2H0Y A;  4B4Z A;  1HTZ A;  4ZAM A;  1PYY A;  1K38 A;  4DE1 A;  5J8X A;  2Q9N A;  3IF5 A;  4WEJ A;  3O87 A;  3G30 A;  2P74 A;  3Q1F A;  2CC1 A;  1ES4 A;  4MBK A;  3HLG A;  4GDB A;  4LEN A;  3TG9 A;  4KZB A;  3BLM A;  4XUZ A;  1FR6 A;  3NIA A;  5F83 A;  4MBH A;  1GHI A;  1TDG A;  3PAE A;  1AXB A;  3FV7 A;  2OSU A;  3VOZ A;  1W5D A;  2Y4A A;  5E2H A;  1EWZ A;  2ZQ9 A;  3NY4 A;  3EQV A;  1Z6F A;  2J9O A;  1K25 A;  1PWD A;  4KZ9 A;  1L0D A;  1IKI A;  1LL9 A;  3NDE A;  4MEZ A;  4KG5 A;  2Q9M A;  2X71 A;  1NZO A;  3UE0 A;  5JYO A;  2WAF A;  3ZVT A;  3OPR A;  3NDG A;  1ZC2 A;  4MNR A;  4OP8 A;  1ALQ A;  4H8R A;  2VGJ A;  2QMI A;  3HRE A;  3C7U A;  2I72 A;  4QU3 A;  3ZG9 B;  1K6S A;  4RX2 A;  1K54 C;  3HLD A;  4DDY A;  1K56 D;  1M40 A;  2Y2K A;  4KG2 A;  3UPO A;  2WYX A;  1BT5 A;  3ZVW A;  1XKZ A;  4EBP A;  1NRF A;  1YLP A;  2XF3 A;  3QHY A;  3O88 A;  1DJA A;  4PPR A;  1DJC A;  5CGS A;  3BFF A;  3DW0 A;  5EUA A;  3WWX A;  3CZD A;  3VP0 A;  1RGY A;  3FKW A;  4WM9 A;  1IYO A;  3A3F A;  2WKE A;  2EFX A;  2A3U A;  1CI8 A;  4OQG A;  5FI7 A;  2HDU A;  2Z2L B;  4IVI A;  4QB8 A;  1KVM A;  3GSG A;  1YM1 A;  1LL5 A;  2VGK A;  3ITB A;  3HLE A;  4OVD A;  2BG1 A;  4KZ8 A;  1E25 A;  4UA7 A;  3IH8 A;  4R4S A;  5FQJ A;  5EEC A;  1KE0 A;  4S2I A;  3LEZ A;  5M18 A;  4QY6 A;  4HEF A;  2XFT A;  1YQS A;  3HLF A;  5FSR A;  3GMW A;  3N8L A;  5HL1 A;  5CHM A;  5M19 A;  4KEN B;  2Y2N A;  3Q7V B;  2Y91 A;  2X02 A;  5A93 A;  4HBU A;  4FSF A;  1IYS A;  2WGW B;  3ZG5 A;  1ZG4 A;  5HAP A;  2HDS A;  4ZJ2 A;  3ZDJ A;  3UN7 A;  4KQO A;  2XLN A;  2Y2G A;  3HLW A;  3C4P A;  5E2F A;  5AQB A;  4E3I A;  1RCJ A;  4UA9 A;  5KMW A;  2E8I A;  1PWG A;  1HD8 A;  3ZG7 B;  4JXS A;  4GZB A;  1K57 A;  4YFM A;  4L0L A;  2XFS A;  1YMX A;  1K6R A;  1YLT A;  2ZLY A;  1BUE A;  3DTM A;  3IQA A;  2DRW A;  2WUQ A;  5FAS A;  2RCX A;  2Y2M A;  2R9X A;  3SOI A;  5FQK A;  4ZJ3 A;  3WRT A;  1XA1 A;  4WZ5 C;  5AQ7 A;  3UE3 A;  5FQI A;  4GD8 A;  4E6X A;  3IXH A;  2BLS A;  3C5A A;  4FH4 A;  4C75 A;  4EWF A;  1ERM A;  2H5S A;  4LV1 A;  1PI5 A;  5FAO A;  1N4O A;  3PBT A;  5U47 A;  3MZF A;  3C7V A;  2XD5 A;  4N9L A;  1IYQ A;  5CTM A;  5E2E A;  3OZH A;  5GLD A;  1XGJ A;  4OPR A;  3UO9 A;  2FFF B;  4KZ4 A;  4BEN A;  1PW1 A;  1ESU A;  4WMC A;  2EFU A;  4QJG A;  3I7J A;  3GV9 A;  4MBF A;  3IF6 A;  5EVI A;  1YT4 A;  4Y0U A;  4WBG A;  3FKV A;  4LV3 A;  4OOM A;  1H5X A;  3HLB A;  5HW3 A;  3A3I A;  1M6K A;  1IEM A;  4KZ7 A;  5I94 A;  3HL9 A;  2A49 A;  4HES A;  5F82 A;  3LY4 A;  2HP6 A;  3WRZ A;  4OQH A;  4IBX A;  4GN2 A;  3TSG A;  1L2S A;  1L0E A;  4WZ4 A;  1XP4 A;  4XUX A;  2ZQC A;  5CER A;  4E3K A;  1WYC A;  3IHB A;  1MWU A;  1NJ4 A;  4PM7 A;  5EOO A;  4BD0 A;  2WAD A;  4RX3 A;  4E3O A;  4FH2 A;  3IHA A;  5TGF A;  3BFG A;  4UA6 A;  4X53 A;  4RVA A;  1BUL A;  3IT9 A;  3RXW A;  1RGZ A;  4B88 A;  4BQM A;  3AGE A;  3E2K A;  4RA7 A;  3ZFZ A;  1QME A;  1MXO A;  4JF4 A;  3V3S A;  1E3U D;  4FCF A;  5GLC A;  3G35 A;  5G18 A;  4JLF A;  4YIN A;  1TEM A;  2JC7 A;  3IXB A;  4C3Q A;  5CHJ A;  1WYB A;  1GA0 A;  3GVB A;  3P09 A;  3A3D A;  1L0G A;  2IWB A;  2C5W B;  5FQ9 A;  3UDX A;  2XD1 A;  3HUO A;  3WS5 A;  1FCM A;  3NI9 A;  2ZQ7 A;  3DWK A;  3FYZ A;  2UWX A;  1ERO A;  1E4D A;  1K55 A;  3HUM A;  3PBN A;  4ZBE A;  3ZNT A;  1MKI A;  4RYE A;  4K91 A;  5A90 A;  1W8Q A;  2ZD8 A;  3IXD A;  4R3B A;  1XXM A;  3W4Q A;  3MBZ A;  3HVF A;  1HZO A;  5CED A;  1XGI A;  1YLW A;  2ZQD A;  1OME A;  2EX2 A;  4GNU A;  4IED A;  4S2K A;  3W8K A;  4DRT A;  4GD6 A;  4OP5 A;  3W4O A;  4DXB A;  2XQZ A;  3NCK A;  4KZ6 A;  4WEK A;  1WE4 A;  2JBF A;  4KQQ A;  4Y0T A;  2FFY A;  2PU4 A;  1JWZ A;  3WS0 A;  1CEF A;  3IWQ A;  2XDM A;  4JXG A;  2J8Y A;  4PM9 A;  4N1X A;  3O86 A;  3OPH A;  2Y2J A;  1ONH A;  2EX6 A;  2EXA A;  5AQ9 A;  4DE0 A;  1ES2 A;  1KDS A;  3P98 A;  3TOI A;  4BLM A;  3VFF A;  3N7W A;  4UHU A;  1YLJ A;  3BRM A;  3VP4 A;  1LI9 A;  1DY6 A;  1ZKJ A;  2EXB A;  3DWZ A;  5TR7 A;  3CG5 A;  4X68 A;  1K57 C;  2ZC3 B;  1S0W A;  2IWC A;  5CGW A;  2Y2L A;  3ISG A;  2WGV A;  3IF6 B;  4DXC A;  3ZHH A;  5EVI B;  1I2W A;  3ZGA B;  5EVI D;  1I5Q A;  1W7F A;  4U3T A;  3GR2 A;  2ZM0 A;  1GA9 A;  1LI0 A;  2GDN A;  5CRF A;  3PBR A;  3BFC A;  3N8S A;  2HDR A;  4LCM A;  5KSC A;  2HPB A;  2G2U A;  5CEB A;  4KG6 A;  4KZ5 A;  5GHY A;  1VM1 A;  5DTS A;  4A5R A;  1XPB A;  4DF6 A;  4GOG A;  2P9V A;  1KE4 A;  5E2G A;  1PI4 A;  3AGD A;  4N1H A;  2Y2I A;  4LV2 A;  3UPP A;  1H8Y A;  4OLD A;  3SH9 A;  3GTC A;  3M2J A;  2DNS A;  2XH9 A;  3MZE A;  4KZA A;  2QZ6 A;  3OC2 A;  1PIO A;  2ZQ8 A;  3N8R A;  1G6A A;  3VP2 A;  1KDW A;  2J9P A;  3HUN A;  3VFH A;  5FI6 A;  1K56 A;  4C6Y A;  4S2M A;  5GL9 A;  1BLC A;  2V1Z A;  1IYP A;  3IF6 C;  2OLV A; 
#chains in the Genus database with same CATH topology
 5EVI C;  1FCO A;  4XXR A;  2CMN A;  4H6J B;  1MKM A;  3QNB A;  3ITA A;  2WKQ A;  3PTE A;  3D4F A;  1BLH A;  1OTE A;  4S2N A;  4I39 A;  2PAV P;  4P6B A;  4ARZ A;  3MKE A;  1NZU A;  3LYX A;  4ZJ1 A;  1SCW A;  1FIK A;  2XGN A;  2GX5 A;  3UY6 A;  1XJ3 A;  3T4J A;  4Z1W A;  3SH7 A;  2M7U A;  1SDE A;  3BFD A;  5D3O A;  3OCN A;  4XT2 A;  1N9L A;  3PAG A;  4FD8 A;  2WK0 A;  1O07 A;  1A0K A;  3LCE A;  4DE3 A;  3UE6 A;  3GRJ A;  3M6B A;  3DTI A;  4JBF A;  1JTD A;  2HDQ A;  3PYP A;  3N6I A;  2M1C A;  1YMS A;  2VKS A;  2EX9 A;  3V50 A;  5K5B A;  5HWT A;  1GHM A;  1PZP A;  4N9K A;  2W27 A;  1MWR A;  3SW1 A;  2UV0 E;  5J4E A;  4NK3 A;  4ETZ A;  2V9A A;  2HP5 A;  1BZA A;  4DDS A;  2I9V A;  5FAP A;  4IUK A;  3G34 A;  4CLC E;  2WZZ A;  1RP5 A;  2WKI A;  3MQQ A;  4OPY A;  3FG8 A;  4NET A;  2XR0 A;  3QP2 A;  3IXG A;  2R9W A;  4S2O A;  4U0X A;  3AGF A;  1PW8 A;  3MMH A;  4WEL A;  3NOT C;  1KOU A;  4ARZ B;  3NBL A;  2PD8 A;  5M1A A;  1Q2P A;  2EX8 A;  2YKH A;  1T19 A;  3IH9 A;  4PMA A;  3RXX A;  3LR4 A;  1ZTU A;  1JVJ A;  4OPZ A;  1G5U A;  4GW9 A;  1ESI A;  3CUE C;  3UDF A;  3A3J A;  1XX2 A;  3OBF A;  5G4Y A;  4LPZ A;  3W4P A;  2DCF A;  3A3E A;  1N9B A;  3LO7 A;  1C3B A;  2JE5 A;  2GNX A;  3E98 A;  5I5L A;  5GLA A;  4HP9 A;  4MN5 A;  1DJB A;  1FSW A;  5DVA A;  3G2Y A;  5FQQ A;  5IHV A;  1BYW A;  2B18 A;  2GJ3 A;  3C2W A;  2Y2O A;  1KGF A;  4QY5 A;  2PYR A;  2HP9 A;  2J7V A;  3CJM A;  2X01 A;  1V9Z A;  5DF8 A;  1F98 A;  2H0T A;  1I2S A;  4IVK A;  3G32 A;  3D72 A;  4CLC D;  1ZG6 A;  3HLC A;  2B95 A;  3MZD A;  4X25 A;  3A0S A;  3UNW A;  3GEC A;  3OCL A;  1QMF A;  4CJN A;  4B4Z A;  1XFN A;  4JGR A;  4DE1 A;  5J8X A;  4WEJ A;  1D7E A;  3B47 A;  4GDB A;  3TG9 A;  4KZB A;  3BLM A;  1FR6 A;  3T1Q B;  3FV7 A;  5HWV A;  3VOZ A;  1L0D A;  1IKI A;  3LIC A;  4HNB A;  3NDE A;  1MZU A;  2X71 A;  2WAF A;  4OP8 A;  2VGL M;  4MNR A;  2W3G A;  5DKK A;  3ZG9 B;  1N9N A;  3NEC A;  1K54 C;  4RX2 A;  4DDY A;  4NXG A;  2J3W A;  3ZVW A;  4GLQ A;  4EBP A;  5FEF A;  1DJC A;  4BBV A;  1RGY A;  5TBM A;  1T1A A;  3A3F A;  4WN5 A;  2KX6 A;  3D3O A;  4O0P A;  4QB8 A;  2VGK A;  3ITB A;  4Y2F A;  1E25 A;  4UA7 A;  3K2N A;  4S2I A;  4HEF A;  4R6L A;  1VEU A;  5AVE A;  2Y2N A;  3Q7V B;  4HBU A;  4E04 A;  1ZG4 A;  5HAP A;  3UN7 A;  2XLN A;  3NJA A;  5KMW A;  5G4Z A;  3IX8 A;  4YFM A;  4L0L A;  2XFS A;  1K6R A;  2ZLY A;  1BUE A;  2WUQ A;  2RCX A;  5FQK A;  3T4O A;  2XRN A;  4YNR A;  5FQI A;  4AFI A;  2H5S A;  3P01 A;  5U47 A;  3MZF A;  3C7V A;  3LFV A;  1W63 Q;  3VOL A;  2VLG A;  4OPR A;  4KZ4 A;  4NEE D;  3D9Y A;  2EFU A;  4QJG A;  3I7J A;  3GV9 A;  3IF6 A;  5HW3 A;  4KZ7 A;  3CWF A;  1YSP A;  4HES A;  3WRZ A;  4GN2 A;  2PR5 A;  4PM7 A;  3RTY A;  1S4S A;  1YAX A;  4FH2 A;  5IS1 A;  4L9G A;  1BUL A;  1LL8 A;  1RGZ A;  1NWZ A;  4EUV A;  3B33 A;  4RA7 A;  3ZFZ A;  1MXO A;  3EGX C;  2VV6 A;  1T1B A;  5GLC A;  3G35 A;  2JKR M;  5G18 A;  4YIN A;  3KSG A;  3IXB A;  1GA0 A;  4I3I A;  2P7J A;  3WS5 A;  4NKP A;  2K2N A;  3ZNT A;  1UGU A;  3PBN A;  3LUQ A;  4K91 A;  1W8Q A;  5A90 A;  3IXD A;  3MQ0 A;  2HJ9 C;  3C38 A;  5CED A;  4DRT A;  4YWZ A;  4CLC A;  4KQQ A;  1PNE A;  2FFY A;  3IWQ A;  3O86 A;  3OPH A;  3VV4 A;  2Y2J A;  3TOI A;  1ZKJ A;  3EWK A;  2Z6C A;  2ZC3 B;  2IWC A;  2L4R A;  2Y2L A;  3O5Y A;  3ISG A;  2WGV A;  3IF6 B;  3ZHH A;  5EVI D;  3S7O A;  1W7F A;  2O99 A;  1GA9 A;  3MF0 A;  3BFC A;  2Y8H A;  3L7H A;  3N8S A;  4I38 A;  4LCM A;  5KSC A;  2G2U A;  4KG6 A;  4KZ5 A;  2VK3 A;  1VM1 A;  5DTS A;  2P9V A;  3IBJ A;  3AGD A;  4WL9 A;  1H8Y A;  3SH9 A;  3GTC A;  3OC2 A;  2ZQ8 A;  1ACF A;  2V1Z A;  1SDN A;  5EM1 A;  5DF9 A;  1HVB A;  1H8Z A;  3CMZ A;  1NRJ A;  2OAP 1;  3S4X A;  2Y55 A;  2JKR I;  1YLZ A;  1JWV A;  3KSI A;  5L8M A;  2VJW A;  3T50 A;  2ZMA A;  2ZL1 A;  3O3V A;  3VOY A;  2P08 A;  4P0M A;  1S6R A;  4Y3I A;  4E3J A;  2B5R A;  4WZ5 A;  4NXE A;  4UAA A;  3S22 A;  1XA7 A;  4O01 A;  1GHP A;  5FAQ A;  3ZCZ A;  2BTF P;  4EEP A;  4CLC B;  2ZC6 B;  4Q0I A;  5CEC A;  1P9W A;  3PBQ A;  4OLG A;  4M4X A;  4JF5 A;  4JXW A;  4EES A;  2Y59 A;  3B3X A;  1CI9 A;  3T4K A;  4IUH A;  1TDL A;  5FEG A;  1S4R A;  5KZH A;  4GJ4 A;  1ERQ A;  4D2O A;  1UWP X;  2M7V A;  2QJ5 A;  4WUJ A;  3GDI A;  4IJG A;  2VX8 A;  4EBL A;  4OQI A;  1K4E A;  1ES5 A;  3IWO A;  4I5S A;  2WKP A;  2Z2M B;  3NC8 A;  4P85 A;  4EUZ A;  1FOF A;  1PZO A;  2G2W A;  1IKG A;  2W0N A;  2P9V B;  3KSH A;  5J3W A;  4KQR A;  4R23 A;  1DP9 A;  3VSL A;  4EBN A;  3DBA A;  2QPN A;  4P87 A;  4DJ3 A;  4Y7P A;  4ZTK A;  2Y2Q A;  2MJ6 A;  3BEB A;  5KSH A;  3HJI A;  5CHU A;  1KVL A;  3V5M A;  4MLL A;  3QP8 A;  3S7Q A;  4X69 A;  3BQA A;  1HLU P;  5TFQ A;  1J9M A;  3V3R A;  4BJP A;  4S2P A;  3BYD A;  3KYQ A;  4QHC A;  4BL3 A;  3U4L P;  3SS5 A;  1CJF A;  1Y54 A;  3RJU A;  3UE1 A;  2C6W B;  2J3T C;  1W8Y A;  3CHW P;  3VMA A;  3M6H A;  4U0T A;  2HJE A;  3L9K A;  4S2N C;  1FR1 A;  4MDZ A;  3WS1 A;  3MQO A;  5EE8 A;  5GLB A;  4EQI A;  1FCN A;  2ZQA A;  4R3A A;  4DN0 A;  2JKT M;  4HY8 A;  4PM8 A;  1JTG A;  1KGE A;  1KE3 A;  2PYP A;  2QKP A;  2IWD A;  1SKO B;  4QD4 A;  2ZJ9 A;  4WYY A;  3CPT A;  4OH0 A;  2V2F F;  2L1M A;  3S7P A;  5HDC A;  3EEA A;  2WGW A;  1ONG A;  3IBR A;  1VET A;  1G68 A;  1BLP A;  4O7D A;  1OJ5 A;  3LI8 A;  3BM6 A;  3DTK A;  4WLA A;  4LRX C;  2H0Y A;  2W3E A;  4O8G A;  1K38 A;  2K31 A;  4PKY A;  4B9O A;  3E4O A;  4BBU A;  1OTI A;  3G30 A;  2E8J A;  1G28 A;  2CC1 A;  2FH5 A;  4MBH A;  1GHI A;  4Y15 A;  3PAE A;  1AXB A;  5F6A A;  2ZBB A;  2O9A A;  1Z6F A;  4KZ9 A;  3ZYT A;  5JYO A;  3NDG A;  1ZC2 A;  4JGO A;  4H8R A;  2VGJ A;  4QU3 A;  1K6S A;  1GSV A;  3KYE A;  1PFL A;  1NRF A;  4PPR A;  5CGS A;  3O88 A;  3DW0 A;  2D02 A;  3WWX A;  3VP0 A;  2JKT I;  2EFX A;  1CI8 A;  4OQG A;  4IVI A;  1XJ4 A;  3JPU A;  3CPT B;  4EU0 A;  1YQS A;  3HLF A;  4X1L A;  3N8L A;  5HL1 A;  3DTE A;  2Y91 A;  2X02 A;  2V1A A;  3LIB A;  1IYS A;  2WGW B;  2HDS A;  3ZDJ A;  2OWJ A;  4KQO A;  3HLW A;  4XT2 B;  1VET B;  4F3L A;  4UA9 A;  4LLO B;  1HD8 A;  3ZG7 B;  4JXS A;  1K57 A;  1VHM A;  3RFB A;  2HF6 A;  1F5M A;  3IQA A;  2DRW A;  4E6X A;  4GD8 A;  3VE3 A;  5HDS A;  4FH4 A;  3C5A A;  4C75 A;  2W3D A;  3OLO A;  3T1R A;  5EM0 A;  1N4O A;  3PBT A;  1OPX A;  3BY9 A;  4MMN A;  2GZA A;  4ETX A;  1ESU A;  4HJ6 A;  4LV3 A;  4OOM A;  4FTX A;  3EOI A;  2A49 A;  1TF1 A;  2HP6 A;  4OQH A;  2V8F A;  3TSG A;  1L2S A;  4E3K A;  3IHB A;  1NJ4 A;  4BD0 A;  5FL3 A;  5TGF A;  1P0Z A;  2ZOI A;  4LGW A;  4B88 A;  4BQM A;  2V0U A;  1QME A;  4BWI A;  5F68 A;  1E3U D;  2JHE A;  2HZ5 A;  3P09 A;  2W1R A;  3EGD C;  2IWB A;  1FIL A;  5FQ9 A;  4F3L B;  2XD1 A;  3HUO A;  2ZQ7 A;  3DWK A;  2UWX A;  1K55 A;  4ZBE A;  4RYE A;  4R3B A;  4GS9 A;  1HZO A;  2ZQD A;  1OME A;  4S2K A;  3W8K A;  3W4O A;  4WEK A;  1WE4 A;  2JBF A;  4L9F A;  2DMW A;  2PU4 A;  4RQ9 A;  1JWZ A;  2YKF A;  4NXB A;  1CEF A;  3LEQ A;  3MJQ A;  2EXA A;  3MR0 A;  5AQ9 A;  4DE0 A;  1ES2 A;  2ACG A;  3UB8 A;  4UHU A;  5EVE A;  4X68 A;  5HSQ A;  4DXC A;  3ZGA B;  3H82 A;  2PHY A;  3PBR A;  3W2Z A;  2EWV A;  2V1B A;  1KE4 A;  5E2G A;  1PI4 A;  3B42 A;  4LV2 A;  3UPP A;  3M2J A;  2XH9 A;  4GHI A;  2QZ6 A;  3N8R A;  4Y17 A;  3VP2 A;  3HUN A;  3IX4 A;  4G3V A;  2XA7 S;  5FI6 A;  1BLC A;  3QP4 A;  3IF6 C;  2OLV A;  5HFO A;  2VA0 A;  4LRZ E;  1STZ A;  4EXO A;  4LV0 A;  3QP6 A;  4OOY A;  1CK3 A;  4ID4 A;  3OPP A;  4EEU A;  4DKI A;  1H3Q A;  4Y13 A;  5FI2 A;  5A91 A;  4K0X A;  1XFQ A;  2Y2H A;  2ZC7 A;  1BLS A;  2PDR A;  3C4O A;  5EOE A;  1MPL A;  3VP3 A;  5TBM B;  5E43 A;  5DKL A;  1MWT A;  1JNU A;  3LY3 A;  1BTL A;  4OON A;  1TS8 A;  3PR6 A;  2RL3 A;  3FWL A;  3NOP C;  4X6T A;  4F94 A;  3SS3 A;  5AVF A;  1VEU B;  4R4R A;  2P04 A;  3G4P A;  4QPR A;  5CXW A;  3H82 B;  3QP5 A;  4JF6 A;  5CTN A;  2J80 A;  5HZH A;  4CLC C;  1DRM A;  4ZDX A;  4EV4 A;  3PBO A;  5F1G A;  3RH8 B;  4GHI B;  2QHK A;  1LSW A;  3CAX A;  3UDI A;  2ZC4 B;  4Y5F A;  4K08 A;  4E3M A;  5DJU A;  5FAT A;  2JCH A;  1TVF A;  2FZ0 A;  2J3T D;  4OOL A;  3MSH A;  5HWW A;  3BLS A;  1LHY A;  4BMW A;  1YLY A;  3IWI A;  3WS2 A;  5HAQ A;  5TJJ A;  1ES3 A;  1SHV A;  1NYY A;  3T4Q A;  2XK1 A;  3T4S A;  4IHQ A;  1E3U A;  3BY8 A;  1S1Z A;  1TD5 A;  3CIT A;  2BAS A;  3LID A;  5DTK A;  4K0W A;  5BOH A;  3PXP A;  1O7E A;  1JWP A;  2WZX A;  2WAE A;  2LB5 A;  2Y2P A;  3T4L A;  4JGP A;  5HAI A;  5AQA A;  4M3K A;  1N9O A;  2WKH A;  4BL2 A;  2JKG A;  4R0Q A;  2VV7 A;  3C8C A;  5GHZ A;  1T1C A;  5DF7 A;  5CGX A;  2IA2 A;  5L2F A;  5F1F A;  2ZM2 A;  5CX7 A;  4JKT A;  1D06 A;  1SZV A;  1YSQ A;  3E2L A;  4Z9Q A;  4BD1 A;  1LLB A;  2ZC5 B;  3FZC A;  2V20 A;  4PM5 A;  3MKF A;  3M2K A;  3MXR A;  2KLI A;  3E0Y A;  1IEL A;  3GQZ A;  3SS4 A;  1MBL A;  3KYZ A;  4R3J A;  1FQG A;  3VP1 A;  1BSG A;  1HTZ A;  4ZAM A;  5EV0 A;  3IF5 A;  3QP1 A;  2QYB A;  2P74 A;  5L09 A;  1EW0 A;  1ES4 A;  4MBK A;  3HLG A;  4LEN A;  3NIA A;  5HD3 A;  1TDG A;  2OSU A;  1W5D A;  2ZQ9 A;  3NY4 A;  3EQV A;  2O9B A;  4UEY A;  1D1J A;  4KG5 A;  4KUO A;  4HOI A;  3UE0 A;  3ZVT A;  3OPR A;  3LIA A;  1VB6 A;  2QMI A;  4EW7 A;  3HRE A;  1M40 A;  3IS2 A;  3UPO A;  2WYX A;  1BT5 A;  4I3J A;  1YLP A;  4HI4 A;  3QHY A;  3BFF A;  5EUA A;  3CZD A;  4WM9 A;  1IYO A;  1LSX A;  3A0R A;  2ZL1 B;  2Z2L B;  3PHY A;  1KVM A;  1LL5 A;  2WKR A;  4OVD A;  2W3H A;  3IH8 A;  5FQJ A;  3C30 A;  1KE0 A;  5EEC A;  3LEZ A;  4QY6 A;  1PRQ A;  2NUP C;  4P6Z S;  4FSF A;  1DP8 A;  3F1P A;  4ZJ2 A;  4NG2 A;  3JVV A;  3EEH A;  5E2F A;  2PD7 A;  4E3I A;  1RCJ A;  3K3C A;  2E8I A;  1PWG A;  4G3K A;  1IFQ A;  1ODV A;  4HJ3 A;  3DTM A;  3F1O A;  2Y2M A;  2R9X A;  4ZJ3 A;  3VE4 A;  3WRT A;  1XA1 A;  4UQI S;  5HPI A;  2HV1 A;  1G6O A;  3IXH A;  4EWF A;  2Y79 A;  4LV1 A;  2EA9 A;  3FPV A;  5IU1 A;  2XD5 A;  5DJT A;  1IYQ A;  4PAU A;  2QWS A;  3UO9 A;  2FFF B;  1PW1 A;  5EVI A;  1YT4 A;  2H28 A;  2D01 A;  2ZMF A;  1OT6 A;  3HLB A;  1Z09 A;  3A3I A;  1M6K A;  3MFX A;  3IS2 B;  1IEM A;  5I94 A;  5F82 A;  3LY4 A;  1L0E A;  4WZ4 A;  1XP4 A;  3ULF A;  1IOU A;  5HL6 A;  2V0W A;  1MWU A;  4EET B;  4RX3 A;  4E3O A;  2NUT C;  1TS7 A;  3R4K A;  1OJG A;  4UA6 A;  1Y28 A;  4X53 A;  2K7S A;  4ESP A;  1T18 A;  5HD5 A;  3RXW A;  5J7E A;  3AGE A;  3E2K A;  4D60 A;  4JF4 A;  3E4P A;  4JLF A;  3H7W A;  1TEM A;  2JC7 A;  4HH2 A;  4KQD A;  3F1P B;  4C3Q A;  3UDX A;  1FCM A;  3NI9 A;  3FYZ A;  1LSV A;  1XJ6 A;  4EQ1 A;  3W4Q A;  3UMD A;  3F1O B;  1L3L A;  1XGI A;  1YLW A;  3OOV A;  4DXB A;  4OP5 A;  2XQZ A;  4KZ6 A;  3KX0 X;  1S66 L;  2PR6 A;  3WS0 A;  4JXG A;  1W63 M;  4R70 A;  1OTD A;  1ONH A;  1GSW A;  1S67 L;  1H8M A;  1KDS A;  4JGQ A;  3VFF A;  1YLJ A;  5C5K A;  5TR7 A;  3CG5 A;  1K57 C;  5CGW A;  4B93 A;  5EVI B;  3S7N A;  5HPF A;  1I5Q A;  1CQA A;  4U3T A;  2LB9 A;  2ZM0 A;  5DFY A;  4HH3 A;  3KO6 A;  5CEB A;  2XA7 M;  5GHY A;  1XPB A;  4DF6 A;  2A24 A;  2Y2I A;  3TE8 A;  3MZE A;  3LGO A;  3E4Q A;  1G6A A;  1KDW A;  3CUE A;  5F5Y A;  4C6Y A;  4S2M A;  5GL9 A;  3OPL A;  3MS6 A;  3BJN A;  4JPM A;  1EI5 A;  1YPR A;  3KSF A;  3H7W B;  1NY0 A;  3VSK A;  4Y0O A;  2XRO A;  4OQ0 A;  1AWI A;  4S2J A;  2W1T A;  3UME A;  3G31 A;  3BW6 A;  5A8B A;  1U60 A;  4G3W A;  3ZNY A;  1W79 A;  3MXQ A;  1NYM A;  4X56 A;  5EPH A;  4X55 A;  3UB5 P;  4E6W A;  4MCW A;  3Q7V A;  1GCE A;  3MFD A;  5JYP A;  2V8C A;  3Q07 A;  3BWL A;  3A0V A;  1X0O A;  3S1Y A;  4OPQ A;  4QWO A;  3UB6 A;  4CPK A;  4R1G A;  3MXS A;  1K55 C;  3CI6 A;  1SKF A;  5FDH A;  3BEC A;  4KZ3 A;  2PU2 A;  3HCY A;  2JN7 A;  4GKU A;  2ZM8 A;  4B4X A;  3T4T A;  4LFU A;  4NXF A;  3Q7Z A;  3PBS A;  2OAQ 1;  2OWH A;  3LIF A;  2OV5 A;  2A24 B;  2VZW A;  2H10 A;  1KGG A;  3LI9 A;  4CQH A;  1P97 A;  3G2Z A;  2O0Y A;  1YKD A;  5A92 A;  3LR3 A;  1FSY A;  3HBR A;  3ZG8 B;  2Q0O A;  5GHX A;  1PWC A;  2XEP A;  5HAR A;  4IBR A;  2W1T B;  1NXY A;  1K54 A;  5HDD A;  3TW8 A;  4WMC D;  3LR5 A;  1K4F A;  4E3L A;  4I3A A;  4Q8I A;  1Q2Q A;  4ME4 A;  1MWS A;  4GB7 A;  3QNC A;  4YOF A;  2EWW A;  1V9Y A;  5EVL A;  4BBT A;  2PBY A;  1MY8 A;  5FA7 A;  4GDN A;  1H0M A;  3N4I A;  5HX9 A;  3ZG0 A;  4Q0J A;  1F9I A;  4MN6 A;  4DE2 A;  3P7N A;  3V39 A;  2WGI A;  3F1N A;  2A2L A;  2B02 A;  3BFE A;  1Y4O A;  4E3N A;  1TS0 A;  4N92 A;  3Q82 A;  1ZHH B;  3EQU A;  3HJK A;  4JXV A;  5DTT A;  1L0F A;  4OKP A;  5IT5 A;  4GS9 B;  2OLU A;  4HJ4 A;  4HBT A;  4LCL A;  3BQ8 A;  3JYI A;  3WS4 A;  2VV8 A;  3G6O A;  4PM6 A;  3DAV A;  5FQM A;  1CEG A;  3TJZ C;  2HGV A;  1VQQ A;  3UPN A;  3SH8 A;  3Q81 A;  1OTA A;  4S2L A;  1PYY A;  3FC7 A;  2Q9N A;  3V67 A;  3O87 A;  3Q1F A;  4L9E A;  4XUZ A;  5F83 A;  2Y4A A;  5E2H A;  2O9C A;  1EWZ A;  2J9O A;  1K25 A;  1PWD A;  5DFX A;  3R7W A;  2VEA A;  1TS6 A;  1LL9 A;  1XJ2 A;  4MEZ A;  2Q9M A;  1NZO A;  1K0K A;  1WA9 A;  3IX3 A;  1ALQ A;  2PBD P;  3C7U A;  2I72 A;  3NUL A;  4PKY G;  3HLD A;  1K56 D;  2Y2K A;  4KG2 A;  3F1N B;  1CF0 A;  4HQA A;  1XKZ A;  4DMZ A;  1J3W A;  2XF3 A;  2VGL S;  1DJA A;  3T1S A;  2L0W A;  3FKW A;  4PHT A;  4ZRR A;  1OT9 A;  2WKE A;  4P6Z M;  2A3U A;  5F69 A;  5FI7 A;  2HDU A;  5L10 A;  3GSG A;  1UWN X;  1YM1 A;  3ZQ5 A;  3HLE A;  2BG1 A;  4KZ8 A;  4R4S A;  5M18 A;  2XSS A;  2XFT A;  1P9R A;  3FPW A;  5FSR A;  3GMW A;  2ZMV A;  5CHM A;  5M19 A;  4KEN B;  5A93 A;  3ZG5 A;  5L07 A;  2Y2G A;  3C4P A;  5AQB A;  4UQI M;  3H9W A;  1LT0 A;  3LIE A;  2KOI A;  4GZB A;  1YMX A;  4MN7 A;  1YLT A;  5FAS A;  3SOI A;  2G7U A;  4WZ5 C;  5AQ7 A;  3UE3 A;  5FDS A;  2BLS A;  4II7 A;  1ERM A;  5EFW A;  1PI5 A;  5FAO A;  3T1X A;  4N9L A;  4Q0H A;  5CTM A;  5E2E A;  3OZH A;  5GLD A;  3R7W B;  4FUW A;  1XGJ A;  4BEN A;  3NHQ A;  4WMC A;  3NOU C;  4MBF A;  4Y0U A;  4WBG A;  3T12 B;  3FKV A;  1NLZ A;  1H5X A;  1F2K A;  3HL9 A;  4HIA A;  3ICY A;  3LR0 A;  4IBX A;  4FOF A;  4XUX A;  2JKF A;  2ZQC A;  5CER A;  1WYC A;  4GCZ A;  5EOO A;  2WAD A;  3IHA A;  1GSX A;  3UB9 A;  2INW A;  3CLO A;  3BFG A;  5AJG A;  4RVA A;  3IT9 A;  2AVX A;  3TRC A;  3V3S A;  5LBR A;  4FCF A;  4H6J A;  3U2A A;  5KIZ A;  5CHJ A;  1WYB A;  3GVB A;  3K3D A;  3A3D A;  3UB7 A;  1L0G A;  2C5W B;  4HP4 A;  2ZOH A;  4EER A;  1ERO A;  1E4D A;  2PRF A;  3HUM A;  1MKI A;  1SKO A;  1NLY A;  2ZD8 A;  4DJ2 A;  1XXM A;  3MBZ A;  3HVF A;  2EX2 A;  4GNU A;  4IED A;  2OOL A;  3SZT A;  4GD6 A;  3NCK A;  4WF0 A;  4Y0T A;  1MC0 A;  2XDM A;  2J8Y A;  4PM9 A;  4N1X A;  2EX6 A;  4KUK A;  3P98 A;  4BLM A;  4R38 A;  1DP6 A;  2R78 A;  3N7W A;  3BRM A;  3VP4 A;  1LI9 A;  1DY6 A;  2EXB A;  3DWZ A;  1S0W A;  4LRY C;  1I2W A;  2QJ7 A;  2Z6D A;  3GR2 A;  2PT7 A;  1S1Y A;  1LI0 A;  2GDN A;  5CRF A;  2HDR A;  4HHD A;  2HPB A;  4X1M A;  4A5R A;  2W3F A;  4GOG A;  4N1H A;  3JVU A;  4OLD A;  5MC7 A;  2DNS A;  4KZA A;  2KDK A;  1PIO A;  2J9P A;  3VFH A;  1OTB A;  1K56 A;  1IYP A; 
#chains in the Genus database with same CATH homology
 3OPL A;  5HFO A;  5EVI C;  1FCO A;  4XXR A;  1SDN A;  5DF9 A;  4JPM A;  1EI5 A;  1HVB A;  3QNB A;  3ITA A;  1H8Z A;  3PTE A;  1NY0 A;  3D4F A;  3CMZ A;  1BLH A;  4LV0 A;  3VSK A;  4Y0O A;  4OQ0 A;  2Y55 A;  4S2N A;  3S4X A;  4OOY A;  4P6B A;  1YLZ A;  4S2J A;  1CK3 A;  3MKE A;  4ID4 A;  1JWV A;  1NZU A;  3G31 A;  3OPP A;  4ZJ1 A;  4DKI A;  1SCW A;  5FI2 A;  2ZMA A;  3O3V A;  3VOY A;  2XGN A;  4P0M A;  1S6R A;  1U60 A;  3UY6 A;  2B5R A;  4E3J A;  3ZNY A;  4WZ5 A;  1W79 A;  4X56 A;  1NYM A;  5A91 A;  4UAA A;  3S22 A;  4K0X A;  1XA7 A;  5EPH A;  4X55 A;  2Y2H A;  2ZC7 A;  1BLS A;  1GHP A;  5FAQ A;  3C4O A;  5EOE A;  1MPL A;  4E6W A;  3SH7 A;  3ZCZ A;  3Q7V A;  3VP3 A;  2ZC6 B;  5E43 A;  5CEC A;  1MWT A;  1GCE A;  3PBQ A;  4OLG A;  1SDE A;  3BFD A;  5D3O A;  3OCN A;  3MFD A;  3LY3 A;  5JYP A;  4JF5 A;  4JXW A;  1BTL A;  2Y59 A;  4OON A;  3B3X A;  1CI9 A;  3PAG A;  3Q07 A;  4FD8 A;  2RL3 A;  2WK0 A;  1O07 A;  3FWL A;  3LCE A;  4X6T A;  4F94 A;  3SS3 A;  4DE3 A;  3GRJ A;  3M6B A;  1TDL A;  3S1Y A;  4OPQ A;  5KZH A;  4CPK A;  4R4R A;  1ERQ A;  4D2O A;  4R1G A;  3MXS A;  1K55 C;  4JBF A;  1SKF A;  5FDH A;  1JTD A;  2HDQ A;  3N6I A;  3BEC A;  4KZ3 A;  1YMS A;  3G4P A;  2PU2 A;  3V50 A;  2EX9 A;  4EBL A;  4GKU A;  5CXW A;  1GHM A;  2ZM8 A;  1PZP A;  4JF6 A;  4OQI A;  4B4X A;  4N9K A;  1K4E A;  1ES5 A;  1MWR A;  3Q7Z A;  3IWO A;  5CTN A;  3PBS A;  2Z2M B;  3NC8 A;  4P85 A;  4EUZ A;  1FOF A;  1PZO A;  4ZDX A;  4EV4 A;  3PBO A;  2G2W A;  1IKG A;  2P9V B;  2OV5 A;  5F1G A;  4KQR A;  4NK3 A;  4R23 A;  2HP5 A;  1BZA A;  4DDS A;  2H10 A;  3VSL A;  1KGG A;  5FAP A;  4EBN A;  3G34 A;  3UDI A;  2ZC4 B;  2QPN A;  4P87 A;  3G2Z A;  4E3M A;  2WZZ A;  1RP5 A;  2WKI A;  4Y7P A;  5FAT A;  5A92 A;  4OPY A;  1FSY A;  2JCH A;  4ZTK A;  4NET A;  1TVF A;  3HBR A;  3ZG8 B;  2XR0 A;  4OOL A;  5GHX A;  1PWC A;  2Y2Q A;  3IXG A;  2R9W A;  2XEP A;  4S2O A;  3BEB A;  4U0X A;  5HAR A;  3AGF A;  1PW8 A;  5KSH A;  4WEL A;  3BLS A;  5CHU A;  1KVL A;  4IBR A;  3V5M A;  1LHY A;  1NXY A;  1K54 A;  3NBL A;  4MLL A;  1YLY A;  4WMC D;  4X69 A;  5M1A A;  1Q2P A;  2EX8 A;  1K4F A;  3IWI A;  4E3L A;  3IH9 A;  5TFQ A;  3WS2 A;  5HAQ A;  1J9M A;  1ES3 A;  1SHV A;  4PMA A;  3RXX A;  3V3R A;  4BJP A;  1NYY A;  4Q8I A;  1Q2Q A;  2XK1 A;  3BYD A;  1JVJ A;  4S2P A;  4QHC A;  4BL3 A;  1MWS A;  4OPZ A;  1E3U A;  3QNC A;  4GB7 A;  1ESI A;  3SS5 A;  3UDF A;  5EVL A;  1Y54 A;  3RJU A;  5DTK A;  3UE1 A;  2C6W B;  3A3J A;  1W8Y A;  1XX2 A;  2PBY A;  1MY8 A;  4K0W A;  3VMA A;  3M6H A;  4GDN A;  4U0T A;  5FA7 A;  5BOH A;  3W4P A;  3N4I A;  2DCF A;  3A3E A;  1O7E A;  5HX9 A;  3ZG0 A;  1JWP A;  2WZX A;  4DE2 A;  2WAE A;  4S2N C;  1FR1 A;  1N9B A;  2Y2P A;  3LO7 A;  3WS1 A;  3V39 A;  1C3B A;  5HAI A;  2JE5 A;  5AQA A;  2WGI A;  5EE8 A;  5GLB A;  4M3K A;  5GLA A;  4EQI A;  1FCN A;  1DJB A;  1FSW A;  2WKH A;  3BFE A;  5DVA A;  2ZQA A;  3G2Y A;  4BL2 A;  4E3N A;  4R0Q A;  5FQQ A;  4N92 A;  3Q82 A;  4PM8 A;  5GHZ A;  5IHV A;  5DF7 A;  5CGX A;  5L2F A;  5F1F A;  2ZM2 A;  1JTG A;  1KGE A;  3EQU A;  1KE3 A;  2Y2O A;  4JXV A;  5DTT A;  1L0F A;  1KGF A;  4JKT A;  4QY5 A;  2IWD A;  4OKP A;  2HP9 A;  2J7V A;  4QD4 A;  2ZJ9 A;  2OLU A;  3CJM A;  3E2L A;  4WYY A;  4Z9Q A;  2X01 A;  4OH0 A;  4BD1 A;  4HBT A;  1LLB A;  2V2F F;  4LCL A;  5DF8 A;  2ZC5 B;  2H0T A;  1I2S A;  4IVK A;  3FZC A;  2V20 A;  3G32 A;  2WGW A;  4PM5 A;  3MKF A;  1ZG6 A;  3M2K A;  3HLC A;  3JYI A;  3MZD A;  1ONG A;  3WS4 A;  3MXR A;  1G68 A;  4PM6 A;  3UNW A;  1BLP A;  1CEG A;  4O7D A;  5FQM A;  1IEL A;  1VQQ A;  3GQZ A;  3SS4 A;  1MBL A;  3BM6 A;  3OCL A;  4R3J A;  3SH8 A;  3UPN A;  1FQG A;  3Q81 A;  3VP1 A;  1QMF A;  4CJN A;  1BSG A;  4S2L A;  2H0Y A;  4B4Z A;  1HTZ A;  4ZAM A;  1PYY A;  1K38 A;  4DE1 A;  5J8X A;  2Q9N A;  3IF5 A;  4WEJ A;  3O87 A;  3G30 A;  2P74 A;  3Q1F A;  2CC1 A;  1ES4 A;  4MBK A;  3HLG A;  4GDB A;  4LEN A;  3TG9 A;  4KZB A;  3BLM A;  4XUZ A;  1FR6 A;  3NIA A;  5F83 A;  4MBH A;  1GHI A;  1TDG A;  3PAE A;  1AXB A;  3FV7 A;  2OSU A;  3VOZ A;  1W5D A;  2Y4A A;  5E2H A;  1EWZ A;  2ZQ9 A;  3NY4 A;  3EQV A;  1Z6F A;  2J9O A;  1K25 A;  1PWD A;  4KZ9 A;  1L0D A;  1IKI A;  1LL9 A;  3NDE A;  4MEZ A;  4KG5 A;  2Q9M A;  2X71 A;  1NZO A;  3UE0 A;  5JYO A;  2WAF A;  3ZVT A;  3OPR A;  3NDG A;  1ZC2 A;  4MNR A;  4OP8 A;  1ALQ A;  4H8R A;  2VGJ A;  2QMI A;  3HRE A;  3C7U A;  2I72 A;  4QU3 A;  3ZG9 B;  1K6S A;  4RX2 A;  1K54 C;  3HLD A;  4DDY A;  1K56 D;  1M40 A;  2Y2K A;  4KG2 A;  3UPO A;  2WYX A;  1BT5 A;  3ZVW A;  1XKZ A;  4EBP A;  1NRF A;  1YLP A;  2XF3 A;  3QHY A;  3O88 A;  1DJA A;  4PPR A;  1DJC A;  5CGS A;  3BFF A;  3DW0 A;  5EUA A;  3WWX A;  3CZD A;  3VP0 A;  1RGY A;  3FKW A;  4WM9 A;  1IYO A;  3A3F A;  2WKE A;  2EFX A;  2A3U A;  1CI8 A;  4OQG A;  5FI7 A;  2HDU A;  2Z2L B;  4IVI A;  4QB8 A;  1KVM A;  3GSG A;  1YM1 A;  1LL5 A;  2VGK A;  3ITB A;  3HLE A;  4OVD A;  2BG1 A;  4KZ8 A;  1E25 A;  4UA7 A;  3IH8 A;  4R4S A;  5FQJ A;  5EEC A;  1KE0 A;  4S2I A;  3LEZ A;  5M18 A;  4QY6 A;  4HEF A;  2XFT A;  1YQS A;  3HLF A;  5FSR A;  3GMW A;  3N8L A;  5HL1 A;  5CHM A;  5M19 A;  4KEN B;  2Y2N A;  3Q7V B;  2Y91 A;  2X02 A;  5A93 A;  4HBU A;  4FSF A;  1IYS A;  2WGW B;  3ZG5 A;  1ZG4 A;  5HAP A;  2HDS A;  4ZJ2 A;  3ZDJ A;  3UN7 A;  4KQO A;  2XLN A;  2Y2G A;  3HLW A;  3C4P A;  5E2F A;  5AQB A;  4E3I A;  1RCJ A;  4UA9 A;  5KMW A;  2E8I A;  1PWG A;  1HD8 A;  3ZG7 B;  4JXS A;  4GZB A;  1K57 A;  4YFM A;  4L0L A;  2XFS A;  1YMX A;  1K6R A;  1YLT A;  2ZLY A;  1BUE A;  3DTM A;  3IQA A;  2DRW A;  2WUQ A;  5FAS A;  2RCX A;  2Y2M A;  2R9X A;  3SOI A;  5FQK A;  4ZJ3 A;  3WRT A;  1XA1 A;  4WZ5 C;  5AQ7 A;  3UE3 A;  5FQI A;  4GD8 A;  4E6X A;  3IXH A;  2BLS A;  3C5A A;  4FH4 A;  4C75 A;  4EWF A;  1ERM A;  2H5S A;  4LV1 A;  1PI5 A;  5FAO A;  1N4O A;  3PBT A;  5U47 A;  3MZF A;  3C7V A;  2XD5 A;  4N9L A;  1IYQ A;  5CTM A;  5E2E A;  3OZH A;  5GLD A;  1XGJ A;  4OPR A;  3UO9 A;  2FFF B;  4KZ4 A;  4BEN A;  1PW1 A;  1ESU A;  4WMC A;  2EFU A;  4QJG A;  3I7J A;  3GV9 A;  4MBF A;  3IF6 A;  5EVI A;  1YT4 A;  4Y0U A;  4WBG A;  3FKV A;  4LV3 A;  4OOM A;  1H5X A;  3HLB A;  5HW3 A;  3A3I A;  1M6K A;  1IEM A;  4KZ7 A;  5I94 A;  3HL9 A;  2A49 A;  4HES A;  5F82 A;  3LY4 A;  2HP6 A;  3WRZ A;  4OQH A;  4IBX A;  4GN2 A;  3TSG A;  1L2S A;  1L0E A;  4WZ4 A;  1XP4 A;  4XUX A;  2ZQC A;  5CER A;  4E3K A;  1WYC A;  3IHB A;  1MWU A;  1NJ4 A;  4PM7 A;  5EOO A;  4BD0 A;  2WAD A;  4RX3 A;  4E3O A;  4FH2 A;  3IHA A;  5TGF A;  3BFG A;  4UA6 A;  4X53 A;  4RVA A;  1BUL A;  3IT9 A;  3RXW A;  1RGZ A;  4B88 A;  4BQM A;  3AGE A;  3E2K A;  4RA7 A;  3ZFZ A;  1QME A;  1MXO A;  4JF4 A;  3V3S A;  1E3U D;  4FCF A;  5GLC A;  3G35 A;  5G18 A;  4JLF A;  4YIN A;  1TEM A;  2JC7 A;  3IXB A;  4C3Q A;  5CHJ A;  1WYB A;  1GA0 A;  3GVB A;  3P09 A;  3A3D A;  1L0G A;  2IWB A;  2C5W B;  5FQ9 A;  3UDX A;  2XD1 A;  3HUO A;  3WS5 A;  1FCM A;  3NI9 A;  2ZQ7 A;  3DWK A;  3FYZ A;  2UWX A;  1ERO A;  1E4D A;  1K55 A;  3HUM A;  3PBN A;  4ZBE A;  3ZNT A;  1MKI A;  4RYE A;  4K91 A;  5A90 A;  1W8Q A;  2ZD8 A;  3IXD A;  4R3B A;  1XXM A;  3W4Q A;  3MBZ A;  3HVF A;  1HZO A;  5CED A;  1XGI A;  1YLW A;  2ZQD A;  1OME A;  2EX2 A;  4GNU A;  4IED A;  4S2K A;  3W8K A;  4DRT A;  4GD6 A;  4OP5 A;  3W4O A;  4DXB A;  2XQZ A;  3NCK A;  4KZ6 A;  4WEK A;  1WE4 A;  2JBF A;  4KQQ A;  4Y0T A;  2FFY A;  2PU4 A;  1JWZ A;  3WS0 A;  1CEF A;  3IWQ A;  2XDM A;  4JXG A;  2J8Y A;  4PM9 A;  4N1X A;  3O86 A;  3OPH A;  2Y2J A;  1ONH A;  2EX6 A;  2EXA A;  5AQ9 A;  4DE0 A;  1ES2 A;  1KDS A;  3P98 A;  3TOI A;  4BLM A;  3VFF A;  3N7W A;  4UHU A;  1YLJ A;  3BRM A;  3VP4 A;  1LI9 A;  1DY6 A;  1ZKJ A;  2EXB A;  3DWZ A;  5TR7 A;  3CG5 A;  4X68 A;  1K57 C;  2ZC3 B;  1S0W A;  2IWC A;  5CGW A;  2Y2L A;  3ISG A;  2WGV A;  3IF6 B;  4DXC A;  3ZHH A;  5EVI B;  1I2W A;  3ZGA B;  5EVI D;  1I5Q A;  1W7F A;  4U3T A;  3GR2 A;  2ZM0 A;  1GA9 A;  1LI0 A;  2GDN A;  5CRF A;  3PBR A;  3BFC A;  3N8S A;  2HDR A;  4LCM A;  5KSC A;  2HPB A;  2G2U A;  5CEB A;  4KG6 A;  4KZ5 A;  5GHY A;  1VM1 A;  5DTS A;  4A5R A;  1XPB A;  4DF6 A;  4GOG A;  2P9V A;  1KE4 A;  5E2G A;  1PI4 A;  3AGD A;  4N1H A;  2Y2I A;  4LV2 A;  3UPP A;  1H8Y A;  4OLD A;  3SH9 A;  3GTC A;  3M2J A;  2DNS A;  2XH9 A;  3MZE A;  4KZA A;  2QZ6 A;  3OC2 A;  1PIO A;  2ZQ8 A;  3N8R A;  1G6A A;  3VP2 A;  1KDW A;  2J9P A;  3HUN A;  3VFH A;  5FI6 A;  1K56 A;  4C6Y A;  4S2M A;  5GL9 A;  1BLC A;  2V1Z A;  1IYP A;  3IF6 C;  2OLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...