4HEFA

Strcuture of avibactam bound to pseudomonas aeruginosa ampc
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
360
structure length
360
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKRDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural Insight into Potent Broad-Spectrum Inhibition with Reversible Recyclization Mechanism: Avibactam in Complex with CTX-M-15 and Pseudomonas aeruginosa AmpC beta-Lactamases
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 120
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4hefA00
2ZC6B 2ZQCA 4ZDXA 2HP9A 3UE1A 4CPKA 2P9VB 4BD0A 1G6AA 4H8RA 3FWLA 3CJMA 2XFTA 3O86A 4JBFA 4JXGA 1FCOA 3Q07A 1Z6FA 5DVAA 1IYOA 1PW8A 3CMZA 3PAGA 2ZJ9A 3GQZA 3IHAA 1FQGA 4KZ3A 1S6RA 4OLDA 3IQAA 4OKPA 4JXWA 2ZLYA 4E3NA 3A3EA 4WEJA 3BFGA 1K38A 4QU3A 5EVIA 5IHVA 3HLEA 3SH7A 3VOZA 4R1GA 3UE0A 4Z9QA 2DRWA 1YLJA 2BG1A 4IEDA 2WZZA 1BT5A 5CEDA 4FH4A 1NYYA 4P85A 4E6XA 3AGEA 1W7FA 4S2OA 5EPHA 3S22A 3VP3A 3IXHA 1HVBA 3WWXA 4WMCA 3GSGA 3ZFZA 3NC8A 1YQSA 4KZ8A 5CTMA 1W8QA 5GLAA 4ZJ3A 1PW1A 3GVBA 3N8RA 3FKWA 3FKVA 1YLYA 1K57C 4A5RA 4BENA 3BM6A 5GLDA 3C7UA 1YLTA 3BFDA 3GV9A 3JYIA 2PU4A 3Q7VA 3FYZA 5EVID 2XEPA 4PM8A 5CEBA 3TG9A 3VSLA 1PZPA 4Q8IA 5CECA 3PBOA 1MBLA 2ZC4B 4MEZA 4GN2A 2XD1A 5E43A 4U3TA 3WRTA 3PBRA 1FSYA 1ES3A 4RX2A 4B88A 5A93A 4X53A 1YLWA 1N9BA 4K0WA 2XGNA 4LV0A 4BL3A 2XD5A 3QHYA 4U0XA 4R0QA 3A3DA 3BLSA 4WMCD 4DRTA 3HLBA 4X68A 1J9MA 4EBNA 4OONA 1GCEA 1NJ4A 3IF6A 4S2NC 2WKEA 1K55C 2WGIA 1BSGA 4E6WA 5CERA 1PIOA 4EQIA 3WRZA 1WYCA 1EWZA 3A3IA 4R3JA 1FR1A 1E25A 4RVAA 1ZG6A 4OOYA 1XGJA 4B4ZA 1CI9A 3OPLA 1ES4A 3QNCA 4R23A 3ZG0A 2B5RA 3CG5A 1JTGA 1L0DA 1E4DA 2FFYA 2OLVA 1KE0A 1TDLA 2PBYA 3HLFA 2EX8A 1BZAA 3RJUA 1MWSA 2Q9NA 3UDIA 2J8YA 1PWGA 3NCKA 1RGZA 2Y2PA 1K4FA 5KZHA 5FAQA 1QMEA 4WELA 3VSKA 2G2WA 4S2KA 5L2FA 3CZDA 4OPQA 5CTNA 1E3UA 3ZG8B 2HPBA 1SCWA 3UPPA 5AQAA 3P09A 4XUZA 3ZG9B 4C75A 2ZM2A 2EXBA 3N6IA 5EECA 3IXDA 4JLFA 1W79A 2WGWA 5G18A 1IELA 3DWZA 1IEMA 1XKZA 1SDNA 3ITAA 1HZOA 3HLGA 5CHMA 2HDUA 5DTKA 3SS4A 4GOGA 3OPHA 2ZQ9A 1YMSA 2XFSA 2EX9A 5FQIA 3Q7ZA 1KDSA 2PU2A 3VP0A 4EUZA 2IWDA 2XQZA 4IVIA 4OPYA 3UPOA 3NDGA 3N4IA 4LCMA 3SOIA 3A3JA 1PYYA 4LV3A 3WS2A 4YINA 4MBFA 5HARA 3HBRA 1W5DA 3C4OA 4BQMA 4X56A 1L0GA 1E3UD 2WYXA 2XF3A 2X01A 3GMWA 1BLHA 2RL3A 5A91A 5GHZA 4Y7PA 1H8ZA 1KGGA 3BFEA 3M2JA 3PBNA 3PBTA 2EX2A 2Q9MA 3IF6C 2J9OA 2VGKA 4LENA 2P74A 2Y2IA 4X55A 3ZNYA 4KG2A 2Z2LB 5A90A 5GLBA 4UA6A 1M40A 1U60A 3RXXA 4EV4A 4N1XA 5I94A 1ALQA 1PWDA 5FI2A 2RCXA 5M19A 4JXVA 3PTEA 4KZ4A 1GA9A 5JYPA 1NZUA 2HP5A 4ZJ1A 3LO7A 2WK0A 1QMFA 4HEFA 3BEBA 4KZBA 3ZG5A 5HL1A 3IH9A 4E3MA 3UDXA 4PM6A 2OSUA 4LV2A 4WYYA 1LL5A 3ISGA 5FQQA 2EX6A 3IWOA 5AQ9A 1BLSA 4S2PA 4EBLA 3WS4A 3WS5A 1IYQA 1RP5A 3IHBA 4PMAA 3GTCA 4S2MA 1JTDA 4RA7A 4BJPA 1K4EA 1NRFA 2Y4AA 2QPNA 2H5SA 5FASA 1XPBA 2Y2OA 3HL9A 3G34A 3WS0A 3A3FA 1LL9A 4JXSA 5E2EA 5FDHA 3G2ZA 2Y2MA 1ES2A 1L0EA 4OH0A 5FSRA 3HUOA 2Y2NA 4GDNA 2J9PA 4GB7A 5E2HA 3OCLA 4OP8A 3Q81A 4K0XA 5TFQA 3AGFA 5CGXA 3HLDA 4ZAMA 4DE3A 4O7DA 5GL9A 2EXAA 3UDFA 3HREA 3Q82A 2ZC5B 4JF6A 5TR7A 5F82A 1BTLA 3MKFA 4IBXA 4MNRA 4WZ5A 1NZOA 5FI6A 5FAOA 3GR2A 3DWKA 2WUQA 1ESUA 3I7JA 2Y55A 5CXWA 1AXBA 1M6KA 3PAEA 1BULA 1RGYA 5JYOA 2XR0A 3PBSA 1ERQA 4N9KA 1ZG4A 1I2SA 4QB8A 1LHYA 1NY0A 2Y2KA 3M2KA 3O88A 3PBQA 1FCMA 5HX9A 3ZGAB 4GNUA 3DW0A 2C5WB 3NDEA 1S0WA 1L2SA 3B3XA 2WADA 3NIAA 1KVLA 4KZAA 5EVIB 5DF9A 4Y0OA 2I72A 2V20A 2IWBA 3EQUA 3OZHA 4UHUA 5EVIC 4Y0TA 4LCLA 4RYEA 2HDRA 2ZQ7A 5A92A 3C4PA 2XH9A 4QY5A 2V2FF 5E2FA 3SH8A 3O87A 1KE3A 1PI4A 2BLSA 1BLCA 2ZQ8A 4HESA 5KSCA 5F1FA 3EQVA 4GKUA 1MWRA 3WS1A 1I5QA 5TGFA 1YMXA 2WKIA 4FH2A 5HAPA 5D3OA 2OV5A 3VMAA 4OQGA 4OPZA 2P9VA 4C6YA 1YT4A 1FSWA 4L0LA 1CI8A 4WM9A 1CEGA 1O07A 3IXGA 1GA0A 4OOLA 2C6WB 5FQMA 3LEZA 3HUMA 2XLNA 4DDSA 3OC2A 5BOHA 1Y54A 4M3KA 3Q1FA 1G68A 3Q7VB 4N1HA 3NY4A 4BLMA 2ZC7A 3N8SA 1EROA 3IWIA 3MFDA 5CHJA 4PPRA 1XX2A 3G32A 4KQOA 2JC7A 4KENB 2WAFA 2HDQA 2Y91A 3IT9A 4QD4A 5CRFA 5EOEA 1MPLA 3OCNA 1FR6A 2CC1A 5GLCA 4E3IA 4E3OA 2ZD8A 4GZBA 1WE4A 3V3SA 4DKIA 1XGIA 4NK3A 2Z2MB 3BFFA 4WZ4A 4WZ5C 3W4PA 4JPMA 4EBPA 4KZ5A 1ONHA 1TEMA 1ERMA 4R4SA 4FCFA 4S2LA 4R3BA 3IF5A 1MY8A 4OOMA 3IF6B 1KVMA 5EE8A 5GHYA 3MZFA 2XDMA 4OVDA 1EI5A 2Y2HA 2QMIA 4DE0A 4JKTA 3UO9A 5HAIA 4UAAA 3MKEA 3C7VA 5CGSA 1IYSA 4CJNA 4KG5A 4KZ9A 4OQIA 3OPPA 2XK1A 4DXCA 1ESIA 1PWCA 1MXOA 2J7VA 1L0FA 3ZVWA 1K56A 5FQ9A 3FZCA 3V3RA 1TVFA 5FQJA 5DF7A 4XUXA 4MBHA 5EVLA 1HD8A 1HTZA 4X69A 4QHCA 5FI7A 4PM5A 1TDGA 2R9WA 3V39A 3ZCZA 3UE3A 1CK3A 3M6HA 1VM1A 2OLUA 1OMEA 1DJAA 2UWXA 3LY4A 3VP2A 5CGWA 5GHXA 2A3UA 3SS3A 3AGDA 1BLPA 1GHPA 1JWVA 4N92A 2WGWB 1DY6A 2EFXA 1Q2PA 4S2NA 1K55A 2A49A 2V1ZA 4IBRA 4PM7A 2X02A 1MKIA 5HAQA 4OP5A 5M18A 1LLBA 4DXBA 1K54A 1NYMA 4OLGA 2ZM8A 3BRMA 5U47A 4P0MA 4E3LA 3E2KA 4LV1A 2Y59A 4B4XA 1K56D 3QNBA 5EOOA 1DJCA 3V5MA 3ZG7B 4UA9A 3SS5A 2H10A 3NBLA 3UNWA 4KQRA 3SH9A 1Q2QA 1SDEA 3BECA 4KZ6A 3UN7A 1H8YA 3M6BA 3W4QA 1XA7A 3DTMA 3W8KA 3C5AA 5M1AA 1JVJA 4QJGA 4ZTKA 1H5XA 1XA1A 4FD8A 3G4PA 1I2WA 4EWFA 4WBGA 2ZQDA 3IXBA 3GRJA 1ONGA 2X71A 4IVKA 1ZC2A 4E3JA 2IWCA 4DE1A 2R9XA 2WZXA 2WGVA 3MZDA 3N8LA 3LCEA 4JF4A 4P6BA 3VOYA 4OQ0A 4DF6A 4QY6A 1PI5A 1IYPA 2E8IA 5DTSA 1GHMA 4F94A 1SHVA 4UA7A 3MXRA 3N7WA 2HDSA 1ZKJA 1DJBA 3IWQA 3VFHA 2H0TA 3BYDA 4JF5A 4PM9A 5AQBA 2DNSA 4DE2A 3HUNA 3G2YA 4MBKA 1RCJA 2ZC3B 4WEKA 2QZ6A 4KQQA 4P87A 4XXRA 2WAEA 3HLWA 3TOIA 3P98A 3VP1A 3G35A 3MXSA 1BUEA 1N4OA 3IH8A 4K91A 1O7EA 2ZQAA 5KMWA 1K25A 1W8YA 4S2JA 1MWUA 2Y2QA 1ES5A 1XP4A 2HP6A 3O3VA 1LI0A 4GDBA 5J8XA 3NI9A 4HBUA 4ID4A 3MBZA 1KGEA 1K54C 4BL2A 3V50A 2G2UA 1K6RA 2Y2LA 1NXYA 2JBFA 2JCHA 4R4RA 3S1YA 4D2OA 3E2LA 3OPRA 5F83A 1CEFA 1GHIA 4E3KA 2GDNA 5HFOA 4GD6A 5E2GA 3TSGA 5DTTA 3VP4A 1K6SA 3ITBA 3ZHHA 1PZOA 3G31A 1C3BA 2VGJA 3BLMA 2H0YA 4N9LA 2Y2JA 2ZM0A 4ZBEA 4YFMA 1IKGA 4S2IA 3LY3A 5KSHA 5FA7A 3G30A 1VQQA 2DCFA 5FAPA 2WKHA 3UY6A 2FFFB 1JWPA 1YLPA 1SKFA 2Y2GA 3MZEA 3RXWA 4NETA 1MWTA 4RX3A 5FQKA 3ZDJA 1XXMA 1K57A 3D4FA 1LI9A 5FATA 1WYBA 4HBTA 5HW3A 4MLLA 3VFFA 1FCNA 3ZVTA 4GD8A 3W4OA 4ZJ2A 1KDWA 4BD1A 4DDYA 4KZ7A 4FSFA 1FOFA 3HVFA 3FV7A 4Y0UA 5EUAA 1YM1A 4OQHA 4OPRA 2EFUA 3S4XA 3ZNTA 1KE4A 3UPNA 1IKIA 2ZMAA 3BFCA 1YLZA 1KGFA 1JWZA 3HLCA 4X6TA 5AQ7A 4C3QA 5F1GA 4U0TA 5CHUA 4KG6A 5DF8A 2JE5A
chains in the Genus database with same CATH superfamily
3CPTA 2P9VB 1G6AA 4DMZA 3O86A 2XFTA 5EM1A 5HL6A 5DVAA 3PAGA 1D06A 1V9ZA 2ZLYA 3T1QB 4NXEA 2P08A 1GSXA 4HP9A 2B95A 2OOLA 1BT5A 1SZVA 4FH4A 4P85A 4E6XA 3AGEA 4S2OA 5EPHA 2V8CA 3IXHA 1VEUA 3GSGA 3NC8A 1YQSA 5CTMA 4ZJ3A 3JVUA 4HH3A 2PU4A 3T4LA 3Q7VA 3TG9A 1PZPA 3PBOA 1MBLA 4GN2A 3WRTA 1AWIA 1ES3A 3LIBA 1N9BA 4LV0A 4M4XA 3A0RA 4U0XA 2GJ3A 4WMCD 4DRTA 3HLBA 1N9NA 4EBNA 4OONA 3IF6A 1BSGA 4CQHA 2VX8A 4XT2A 3A3IA 4R3JA 4RVAA 3OPLA 3QNCA 4R23A 3ZG0A 2V0UA 1OT9A 2B5RA 3CG5A 2PBYA 2EX8A 1PWGA 2PR5A 2XA7M 4S2KA 5CTNA 1SCWA 4C75A 2ZM2A 3IXDA 5HSQA 1HZOA 4GOGA 1OPXA 3EGDC 3OPHA 2XFSA 5J3WA 3VP0A 3SZTA 4IVIA 2XRNA 3NDGA 3MQOA 2J3WA 3SOIA 1PYYA 1H8MA 4YINA 3PR6A 4K08A 2WYXA 2X01A 1BLHA 2VGLS 2J9OA 2OWHA 3BY8A 2P74A 4MN7A 5AVEA 4UA6A 4DJ3A 2YKHA 2INWA 1PWDA 4UEYA 4HOIA 4HP4A 1GSVA 4HJ3A 4KZBA 4E3MA 5AVFA 4WYYA 2W27A 3WS4A 3KX0X 3IHBA 4S2MA 5F69A 4H6JB 3DTEA 4RA7A 2ZMFA 1CQAA 3HCYA 5J4EA 4NKPA 5E2EA 2Y2MA 4ZRRA 3QP1A 4Y15A 2A24A 2JKRI 4X1LA 5E2HA 3OCLA 3CUEA 4MN5A 3S7NA 5CGXA 3HLDA 4DE3A 4O7DA 2EXAA 3T4OA 2ZC5B 2M7UA 5TR7A 1BTLA 4WZ5A 2QHKA 5FAOA 3GR2A 2WUQA 3PAEA 2FZ0A 5JYOA 3PBSA 5L8MA 1I2SA 2O9AA 2Y2KA 1NY0A 3M2KA 4GNUA 3EEHA 3DW0A 1S0WA 5EVIB 1KVLA 4MDZA 1BLCA 5KSCA 4EERA 4GKUA 3WS1A 3CLOA 2WKIA 5D3OA 1ODVA 2WKQA 2PR6A 3LEQA 1ZHHB 1UWNX 4OPZA 1CEGA 1O07A 2C6WB 3G6OA 2VJWA 4EUVA 3Q1FA 1STZA 3NY4A 4HHDA 2ZC7A 3MFDA 2JC7A 4KENB 2WAFA 5EOEA 1OTIA 4E3OA 4Q0JA 3W2ZA 4WZ4A 1A0KA 4L9FA 3CWFA 5HWWA 4FCFA 1MY8A 1EI5A 3NJAA 3MKEA 5CGSA 1IYSA 2XK1A 1L0FA 4JGOA 5FQ9A 3R7WB 4XUXA 1HD8A 4X69A 5FI7A 4PM5A 2OLUA 4EEPA 2J80A 1K0KA 4Y13A 1OJ5A 2DMWA 1DY6A 4GHIA 1K55A 2V1ZA 4IBRA 2X02A 1MKIA 4DXBA 4OLGA 2ZM8A 2YKFA 3E4QA 3T1SA 3D72A 4ARZB 3LIDA 3EGXC 1SDEA 3M6BA 2GX5A 3C8CA 1XA7A 3DTMA 3W8KA 3C5AA 3T4JA 2W1TB 4ZTKA 1XA1A 3G4PA 1I2WA 3K3CA 3VE4A 3MF0A 4IVKA 2WGVA 3RTYA 4OQ0A 3LGOA 2OAP1 3LIFA 2PD7A 4WEKA 2QZ6A 4Q0IA 2Y79A 2WAEA 3HLWA 4CLCA 1N4OA 4S2JA 2V0WA 1XP4A 4GDBA 3KSIA 3NI9A 4HBUA 3MBZA 1K54C 4BL2A 3MJQA 2JBFA 1H0MA 3BQAA 3S1YA 4D2OA 2NUPC 2PD8A 3FG8A 2GDNA 3CUEC 5HFOA 3CITA 4FOFA 2O99A 4Y5FA 1C3BA 4WL9A 2H0YA 4GS9B 4WLAA 4ZBEA 4YFMA 1TS8A 4RQ9A 3LY3A 1J3WA 5FA7A 1VB6A 1TS7A 1X0OA 2WKHA 4ETXA 2FFFB 1SKOB 1YSPA 2HJEA 3RXWA 4NETA 1MWTA 4RX3A 3ZDJA 1D7EA 4HBTA 4MLLA 1FCNA 3W4OA 4KZ7A 2W3GA 3E4PA 3FV7A 2L4RA 1KE4A 3T1XA 3H82B 1KGFA 1JWZA 5F1GA 3G31A 2JE5A 2ZQCA 4ZDXA 2HP9A 1T18A 4BD0A 4JXGA 4JBFA 2OAQ1 4FUWA 1Z6FA 4WN5A 1PW8A 3CMZA 2ZJ9A 1FQGA 3IQAA 4JXWA 3BFGA 5IHVA 3HLEA 3SH7A 2HF6A 3UE0A 1PNEA 1YLJA 5CEDA 3LI8A 1NYYA 3JVVA 1L3LA 3S22A 3VP3A 1PFLA 3WWXA 3ZFZA 2JKTM 4HJ6A 4KZ8A 5HD5A 3N8RA 1K57C 3BM6A 5GLDA 3C7UA 3BFDA 3IBJA 3JYIA 3FYZA 2UV0E 2ZC4B 4MEZA 5E43A 3K2NA 4RX2A 4B88A 4K0WA 4BL3A 3QHYA 3ZQ5A 3CHWP 1XFNA 3A3DA 3BLSA 1EW0A 1K55C 2WGIA 1ACFA 4E6WA 4OOYA 4G3WA 3PXPA 1TDLA 2FFYA 1BZAA 1MWSA 2J8YA 2Y2PA 5KZHA 5FAQA 4HQAA 2O9BA 2G2WA 2J3TC 3CZDA 1YPRA 1E3UA 2P04A 3ZG8B 3MS6A 5AQAA 2PBDP 5EECA 1W79A 5C5KA 3GDIA 1SDNA 5CHMA 3HLGA 2NUTC 3IS2B 5FQIA 1KDSA 2PU2A 2GZAA 4OPYA 3N4IA 4LCMA 4Q0HA 2P7JA 4LV3A 3WS2A 2EWVA 5DKLA 4CLCC 4R70A 1L0GA 3GMWA 5TJJA 2LB5A 1XFQA 5A91A 1H8ZA 3TE8A 1T19A 1M40A 3F1PA 4EV4A 4IHQA 4I3IA 4JXVA 1NZUA 2ACGA 1QMFA 4HEFA 3LYXA 3BEBA 1T1AA 3IH9A 5FL3A 3UDXA 1P0ZA 2V1BA 3OBFA 1MZUA 2D02A 2EX6A 4EBLA 3WS5A 3NULA 2LB9A 5HPFA 5EV0A 1WA9A 3UB7A 1K4EA 1NRFA 2QPNA 2H5SA 2Y2OA 3HL9A 3WS0A 3A3FA 5FSRA 3T50A 4FTXA 2ZBBA 4GDNA 4QPRA 4OP8A 2W0NA 4BBUA 4NXFA 3Q82A 4JF6A 4AFIA 3MKFA 4IBXA 1NZOA 5F68A 2EWWA 4P6ZM 4ETZA 1ESUA 2G7UA 2Y55A 1AXBA 1OTBA 1BULA 5F5YA 1RGYA 4N9KA 4QB8A 3ZGAB 3PBQA 3NDEA 4MCWA 2WADA 5DF9A 2I72A 3EQUA 4UHUA 4Y0TA 3MSHA 4GJ4A 3SH8A 3O87A 3LR3A 3H9WA 5F1FA 3DBAA 3B47A 2O9CA 5TGFA 4KUOA 2OV5A 3D9YA 3VMAA 3GECA 2P9VA 4C6YA 1FSWA 4L0LA 3IXGA 4OOLA 1GA0A 5FQMA 5HZHA 3LEZA 4DDSA 4F3LB 3VV4A 3DTKA 3KO6A 4N1HA 3N8SA 4PPRA 3G32A 4KQOA 2WKPA 4QD4A 1MPLA 3L9KA 5GLCA 2ZD8A 4GZBA 2Z2MB 3BFFA 1XJ6A 2EA9A 4KZ5A 1ONHA 4S2LA 5I5LA 3U4LP 4R3BA 3V67A 3QP2A 1KVMA 3MMHA 3MZFA 3BJNA 4DE0A 3TW8A 4KZ9A 3OPPA 3PHYA 1MXOA 2Q0OA 3MFXA 1S4RA 3V3RA 4D60A 3O5YA 4LFUA 3LI9A 3UB8A 2KX6A 3LR5A 3NOTC 2PYRA 3F1OB 1LL8A 3LICA 3LY4A 5CGWA 1DRMA 1BLPA 1GHPA 1BYWA 4N92A 2WGWB 1Q2PA 4S2NA 2A49A 2VK3A 1N9OA 3QP5A 1LLBA 1K54A 5U47A 3E2KA 2Y59A 3KYQA 1S67L 4UA9A 3SS5A 2H10A 4G3VA 3BWLA 3UNWA 3SH9A 5AJGA 4X25A 1Q2QA 3BECA 2K7SA 2W3HA 3U2AA 1JVJA 1XJ2A 4QJGA 4JGRA 4FD8A 3DAVA 3IXBA 3GRJA 1ONGA 3L7HA 4DN0A 3LIEA 2IWCA 2R9XA 2WZXA 2XROA 3N8LA 4P6BA 3VOYA 3OOVA 4QY6A 1GHMA 5HWVA 3MXRA 5F6AA 1DJBA 3IWQA 4E04A 4HIAA 4PM9A 2DNSA 3T4KA 1IOUA 3G2YA 4MBKA 3S7PA 2ZC3B 1H3QA 4KQQA 4P87A 3TOIA 3MXSA 4O0PA 3IH8A 5KMWA 1S1ZA 1W8YA 2HP6A 5J8XA 4KUKA 4ID4A 3OLOA 2JCHA 3R4KA 3E2LA 3OPRA 3LUQA 2W3DA 1CEFA 2HJ9C 3F1NB 4CLCD 5DTTA 1K6SA 3ITBA 3BLMA 2ZL1B 2Y2JA 5IT5A 1LSVA 1YKDA 3LR4A 5KSHA 3G30A 4H6JA 3PYPA 2DCFA 5FAPA 3UY6A 2W3EA 1YLPA 2Y2GA 5DJTA 1LT0A 1K57A 3D4FA 1WYBA 5HW3A 3ZVTA 3D3OA 1KDWA 1IFQA 3JPUA 3RFBA 1FOFA 4NXBA 1MKMA 2KOIA 2B18A 5EUAA 2EFUA 4BWIA 1IKIA 1OJGA 4X6TA 1YLZA 3BFCA 4C3QA 3ULFA 3UE1A 4CPKA 3FWLA 1CJFA 3CJMA 4YOFA 1FCOA 3Q07A 1TS6A 3IHAA 3GQZA 2JKGA 4OLDA 4OKPA 4E3NA 1V9YA 4QU3A 3KYZA 5EVIA 3VOZA 4R1GA 4Z9QA 2DRWA 1FILA 2VV6A 4B93A 1HVBA 3BQ8A 3S7QA 3FKWA 3FKVA 1YLYA 3ICYA 4A5RA 3GV9A 1LSXA 2XEPA 5CEBA 4NXGA 4Q8IA 2XD1A 5MC7A 3T4TA 3PBRA 1VETB 1FSYA 4X53A 3IX3A 2XGNA 5DFYA 4R38A 5FEFA 1OTDA 4X68A 4PKYG 3UMDA 1W63M 1NJ4A 5G4YA 4S2NC 2WKEA 3T4QA 3WRZA 1EWZA 1FR1A 1E25A 3NECA 1XGJA 2JHEA 4I5SA 1L0DA 1E4DA 2OLVA 3HLFA 5TBMB 3R7WA 1F9IA 3UDIA 3NCKA 2V1AA 1S66L 3VSKA 4R3AA 5L2FA 3P09A 1ZTUA 2EXBA 1DP8A 1IELA 3DWZA 1XKZA 3ITAA 4KQDA 2HDUA 2ZQ9A 1YMSA 4I38A 3A0VA 4ARZA 4LRXC 4GLQA 2XQZA 4LRYC 3UPOA 2JKRM 3KSFA 4YWZA 5HARA 5KIZA 3HBRA 3C4OA 2W1TA 4X56A 1E3UD 2K2NA 2V9AA 2RL3A 2Z6DA 3PBNA 3PBTA 2Q9MA 4LENA 1P9RA 4X55A 3ZNYA 4KG2A 2Z2LB 5A90A 1ALQA 2AVXA 2RCXA 5JYPA 4ZJ1A 2HP5A 3H7WB 2ZOHA 2E8JA 3LO7A 2B02A 5HL1A 2QJ7A 4PM6A 4LV2A 1LL5A 5FQQA 5AQ9A 1Z09A 3IWOA 1BLSA 4S2PA 2PDRA 3QP4A 1RP5A 4MMNA 3KSHA 4EW7A 2Y4AA 5FASA 2VV7A 4G3KA 3G34A 5G4ZA 4OH0A 3HUOA 2Y2NA 4GB7A 4GCZA 2R78A 4K0XA 2KLIA 5GL9A 3MXQA 3ZYTA 5F82A 2PT7A 4GS9A 5FI6A 2GNXA 3DWKA 3CPTB 3I7JA 1HLUP 2XR0A 1SKOA 1LHYA 5HX9A 4YNRA 5LBRA 1L2SA 3FPWA 3NIAA 4NEED 4Y0OA 2V20A 3OZHA 5EVIC 2KDKA 4Y17A 4B9OA 4LCLA 2HDRA 5E2FA 2V2FF 1PI4A 2BLSA 2ZQ8A 2A2LA 2MJ6A 3EQVA 5HD3A 3H82A 1VEUB 4CLCE 1YT4A 1CI8A 2XLNA 2I9VA 3OC2A 1Y54A 2XA7S 1G68A 3Q7VB 3VE3A 3TRCA 3UB9A 3IWIA 5CHJA 5CRFA 2HDQA 2Y91A 2HZ5A 1XJ4A 3OCNA 1FR6A 2CC1A 3B33A 3V3SA 4DKIA 1XGIA 2V8FA 4JPMA 3LFVA 1TEMA 3EWKA 1ERMA 3LIAA 4OOMA 3IF6B 1N9LA 4LPZA 2Y2HA 3C2WA 4XT2B 2QMIA 3KSGA 4UAAA 2W1RA 3C7VA 4CJNA 4KG5A 1PWCA 2J7VA 3ZVWA 1K56A 3FZCA 3P01A 5FQJA 5DF7A 5EVLA 4EU0A 2QYBA 4BMWA 2R9WA 3V39A 1CK3A 3M6HA 2Z6CA 3DTIA 1DJAA 4LRZE 2UWXA 1OTAA 5GHXA 2A3UA 3SS3A 1JWVA 4PM7A 4OP5A 1NYMA 3BY9A 2VKSA 3BRMA 4LV1A 4B4XA 4GW9A 5EOOA 3V5MA 3ZG7B 1YSQA 1XJ3A 4KZ6A 1MC0A 3W4QA 2M1CA 1H5XA 4JGPA 2ZQDA 4BBVA 2XSSA 3BW6A 4I3AA 4DE1A 3MZDA 4DF6A 1IYPA 2E8IA 4F94A 4UA7A 2HDSA 1ZKJA 4UQIM 2QWSA 3IS2A 1LSWA 3VFHA 4JF5A 5DKKA 5AQBA 4DE2A 3HUNA 1RCJA 4XXRA 3FC7A 2K31A 1OT6A 3P98A 1BUEA 1O7EA 1K25A 4O01A 1MWUA 3O3VA 3E0YA 4MN6A 2JN7A 3V50A 1K6RA 2Y2LA 1NXYA 3A0SA 2A24B 3NHQA 5F83A 4PAUA 2FH5A 4GD6A 2VV8A 5E2GA 3TSGA 3VP4A 1PZOA 2VGJA 2ZM0A 1IKGA 4IJGA 2PAVP 3MR0A 5DFXA 5HPIA 1JWPA 4BBTA 1SKFA 4ME4A 5J7EA 4EETB 4GD8A 3EOIA 4BD1A 4DDYA 4Y0UA 1YM1A 3T12B 4PKYA 3ZNTA 4O8GA 5AQ7A 3HLCA 4QWOA 5CHUA 2ZC6B 1F5MA 1T1CA 4H8RA 1G28A 1IYOA 1NLZA 4HJ4A 4KZ3A 1S6RA 2Y8HA 3A3EA 4WEJA 1K38A 2ZOIA 4ESPA 2BG1A 4IEDA 2WZZA 3C30A 1W7FA 4WMCA 3K3DA 1W8QA 5GLAA 1PW1A 3GVBA 5L09A 4BENA 1YLTA 4F3LA 5EVID 3QP6A 4PM8A 3VSLA 5DJUA 5CECA 4U3TA 1CF0A 5A93A 1YLWA 4I3JA 3B42A 2J3TD 5HDDA 5L07A 2XD5A 4R0QA 1P9WA 1J9MA 4GHIB 5L10A 3QP8A 1GCEA 5HWTA 5CERA 1PIOA 4EQIA 1WYCA 1DP6A 1ZG6A 4B4ZA 1CI9A 1ES4A 1G5UA 1JTGA 1KE0A 3CAXA 3RJUA 2Q9NA 2QKPA 1RGZA 1K4FA 1QMEA 4WELA 4HY8A 2JKTI 4OPQA 3F1OA 2PYPA 2HPBA 3UPPA 1TD5A 1NLYA 4XUZA 3ZG9B 3N6IA 4JLFA 2WGWA 5G18A 1IEMA 1F2KA 1YAXA 5DTKA 3SS4A 1JNUA 2EX9A 3Q7ZA 2M7VA 4EUZA 2IWDA 3UMEA 1OTEA 2BASA 3A3JA 3EEAA 4CLCB 2VGLM 4MBFA 1W5DA 4BQMA 1Y4OA 2XF3A 5GHZA 4Y7PA 1KGGA 1W63Q 3BFEA 3M2JA 2BTFP 2EX2A 2HGVA 3IF6C 2VGKA 2Y2IA 2ZMVA 5GLBA 1U60A 5I94A 3RXXA 4N1XA 5FI2A 5M19A 3PTEA 4KZ4A 1GA9A 2WK0A 3ZG5A 4EESA 2OSUA 5HDSA 3ISGA 4PHTA 3E4OA 1IYQA 4PMAA 3GTCA 1JTDA 3UB5P 4HNBA 4BJPA 2L1MA 1S1YA 4R6LA 3CI6A 1XPBA 3FPVA 1LL9A 2VA0A 4JXSA 5FDHA 3G2ZA 2JKFA 1ES2A 1L0EA 2PRFA 2J9PA 3VOLA 3Q81A 5TFQA 3AGFA 4ZAMA 3F1NA 3UDFA 3HREA 5IU1A 1F98A 5EM0A 2ZL1A 4MNRA 5CX7A 3RH8B 5CXWA 1M6KA 5FDSA 1UGUA 1ERQA 1ZG4A 3O88A 1FCMA 1DP9A 2C5WB 4Y2FA 3B3XA 4KZAA 4II7A 3SW1A 2IWBA 1S4SA 3UB6A 4RYEA 2ZQ7A 3IX4A 5A92A 3C4PA 2XH9A 4QY5A 1KE3A 3NOUC 2W3FA 4HESA 1TF1A 4WF0A 4WUJA 1MWRA 3IBRA 1I5QA 4EXOA 1YMXA 4FH2A 5HAPA 2O0YA 4OQGA 3P7NA 4LGWA 5EFWA 4WM9A 3HUMA 5BOHA 4M3KA 3UE6A 4BLMA 1EROA 1T1BA 2IA2A 1XX2A 3IT9A 5EVEA 4E3IA 4IUKA 1WE4A 4DJ2A 3KYEA 4NK3A 4WZ5C 3W4PA 3MQQA 4EBPA 1NWZA 4R4SA 2WKRA 4EEUA 3IF5A 5EE8A 5GHYA 2XDMA 4OVDA 2H28A 2VEAA 4L9EA 4JKTA 3UO9A 5HAIA 4EQ1A 4OQIA 4DXCA 1ESIA 1TVFA 1TS0A 1GSWA 4MBHA 1HTZA 4QHCA 1TDGA 1VETA 3ZCZA 3UE3A 1D1JA 1VM1A 1OMEA 3VP2A 3AGDA 3LR0A 3MQ0A 3IX8A 2EFXA 5IS1A 1NRJA 5HAQA 5M18A 2CMNA 4P0MA 4E3LA 1K56D 1Y28A 3QNBA 1DJCA 3NBLA 5A8BA 4KQRA 3UN7A 1H8YA 3HJKA 4LLOB 5TBMA 5M1AA 5FEGA 4EWFA 4WBGA 2X71A 1ZC2A 4E3JA 4JF4A 3LCEA 3NOPC 3TJZC 4IUHA 1PI5A 5DTSA 3F1PB 1SHVA 3N7WA 4Y3IA 2H0TA 3BYDA 4P6ZS 4JGQA 4UQIS 3T4SA 3VP1A 3G35A 3E98A 4K91A 2ZQAA 2Y2QA 1ES5A 1PRQA 1LI0A 1FIKA 2D01A 1G6OA 1KOUA 1KGEA 2G2UA 4R4RA 4X1MA 4HI4A 2OWJA 1GHIA 4E3KA 1VHMA 3H7WA 4I39A 1UWPX 1P97A 4NG2A 3ZHHA 2VZWA 3C38A 4N9LA 4S2IA 2VLGA 5K5BA 4HH2A 1VQQA 3MZEA 5FQKA 1XXMA 1LI9A 5FATA 5HDCA 3T1RA 3VFFA 4ZJ2A 2HV1A 4FSFA 2PHYA 3HVFA 4Z1WA 2QJ5A 3S7OA 4OQHA 4L9GA 4OPRA 3S4XA 3UPNA 2ZMAA 3HJIA 2L0WA 4U0TA 4KG6A 5DF8A
chains in the Genus database with same CATH topology
2ZC6B 2ZQCA 4ZDXA 2HP9A 3UE1A 4CPKA 2P9VB 4BD0A 1G6AA 4H8RA 3FWLA 3CJMA 2XFTA 3O86A 4JBFA 4JXGA 1FCOA 3Q07A 1Z6FA 5DVAA 1IYOA 1PW8A 3CMZA 3PAGA 2ZJ9A 3GQZA 3IHAA 1FQGA 4KZ3A 1S6RA 4OLDA 3IQAA 4OKPA 4JXWA 2ZLYA 4E3NA 3A3EA 4WEJA 3BFGA 1K38A 4QU3A 5EVIA 5IHVA 3HLEA 3SH7A 3VOZA 4R1GA 3UE0A 4Z9QA 2DRWA 1YLJA 2BG1A 4IEDA 2WZZA 1BT5A 5CEDA 4FH4A 1NYYA 4P85A 4E6XA 3AGEA 1W7FA 4S2OA 5EPHA 3S22A 3VP3A 3IXHA 1HVBA 3WWXA 4WMCA 3GSGA 3ZFZA 3NC8A 1YQSA 4KZ8A 5CTMA 1W8QA 5GLAA 4ZJ3A 1PW1A 3GVBA 3N8RA 3FKWA 3FKVA 1YLYA 1K57C 4A5RA 4BENA 3BM6A 5GLDA 3C7UA 1YLTA 3BFDA 3GV9A 3JYIA 2PU4A 3Q7VA 3FYZA 5EVID 2XEPA 4PM8A 5CEBA 3TG9A 3VSLA 1PZPA 4Q8IA 5CECA 3PBOA 1MBLA 2ZC4B 4MEZA 4GN2A 2XD1A 5E43A 4U3TA 3WRTA 3PBRA 1FSYA 1ES3A 4RX2A 4B88A 5A93A 4X53A 1YLWA 1N9BA 4K0WA 2XGNA 4LV0A 4BL3A 2XD5A 3QHYA 4U0XA 4R0QA 3A3DA 3BLSA 4WMCD 4DRTA 3HLBA 4X68A 1J9MA 4EBNA 4OONA 1GCEA 1NJ4A 3IF6A 4S2NC 2WKEA 1K55C 2WGIA 1BSGA 4E6WA 5CERA 1PIOA 4EQIA 3WRZA 1WYCA 1EWZA 3A3IA 4R3JA 1FR1A 1E25A 4RVAA 1ZG6A 4OOYA 1XGJA 4B4ZA 1CI9A 3OPLA 1ES4A 3QNCA 4R23A 3ZG0A 2B5RA 3CG5A 1JTGA 1L0DA 1E4DA 2FFYA 2OLVA 1KE0A 1TDLA 2PBYA 3HLFA 2EX8A 1BZAA 3RJUA 1MWSA 2Q9NA 3UDIA 2J8YA 1PWGA 3NCKA 1RGZA 2Y2PA 1K4FA 5KZHA 5FAQA 1QMEA 4WELA 3VSKA 2G2WA 4S2KA 5L2FA 3CZDA 4OPQA 5CTNA 1E3UA 3ZG8B 2HPBA 1SCWA 3UPPA 5AQAA 3P09A 4XUZA 3ZG9B 4C75A 2ZM2A 2EXBA 3N6IA 5EECA 3IXDA 4JLFA 1W79A 2WGWA 5G18A 1IELA 3DWZA 1IEMA 1XKZA 1SDNA 3ITAA 1HZOA 3HLGA 5CHMA 2HDUA 5DTKA 3SS4A 4GOGA 3OPHA 2ZQ9A 1YMSA 2XFSA 2EX9A 5FQIA 3Q7ZA 1KDSA 2PU2A 3VP0A 4EUZA 2IWDA 2XQZA 4IVIA 4OPYA 3UPOA 3NDGA 3N4IA 4LCMA 3SOIA 3A3JA 1PYYA 4LV3A 3WS2A 4YINA 4MBFA 5HARA 3HBRA 1W5DA 3C4OA 4BQMA 4X56A 1L0GA 1E3UD 2WYXA 2XF3A 2X01A 3GMWA 1BLHA 2RL3A 5A91A 5GHZA 4Y7PA 1H8ZA 1KGGA 3BFEA 3M2JA 3PBNA 3PBTA 2EX2A 2Q9MA 3IF6C 2J9OA 2VGKA 4LENA 2P74A 2Y2IA 4X55A 3ZNYA 4KG2A 2Z2LB 5A90A 5GLBA 4UA6A 1M40A 1U60A 3RXXA 4EV4A 4N1XA 5I94A 1ALQA 1PWDA 5FI2A 2RCXA 5M19A 4JXVA 3PTEA 4KZ4A 1GA9A 5JYPA 1NZUA 2HP5A 4ZJ1A 3LO7A 2WK0A 1QMFA 4HEFA 3BEBA 4KZBA 3ZG5A 5HL1A 3IH9A 4E3MA 3UDXA 4PM6A 2OSUA 4LV2A 4WYYA 1LL5A 3ISGA 5FQQA 2EX6A 3IWOA 5AQ9A 1BLSA 4S2PA 4EBLA 3WS4A 3WS5A 1IYQA 1RP5A 3IHBA 4PMAA 3GTCA 4S2MA 1JTDA 4RA7A 4BJPA 1K4EA 1NRFA 2Y4AA 2QPNA 2H5SA 5FASA 1XPBA 2Y2OA 3HL9A 3G34A 3WS0A 3A3FA 1LL9A 4JXSA 5E2EA 5FDHA 3G2ZA 2Y2MA 1ES2A 1L0EA 4OH0A 5FSRA 3HUOA 2Y2NA 4GDNA 2J9PA 4GB7A 5E2HA 3OCLA 4OP8A 3Q81A 4K0XA 5TFQA 3AGFA 5CGXA 3HLDA 4ZAMA 4DE3A 4O7DA 5GL9A 2EXAA 3UDFA 3HREA 3Q82A 2ZC5B 4JF6A 5TR7A 5F82A 1BTLA 3MKFA 4IBXA 4MNRA 4WZ5A 1NZOA 5FI6A 5FAOA 3GR2A 3DWKA 2WUQA 1ESUA 3I7JA 2Y55A 5CXWA 1AXBA 1M6KA 3PAEA 1BULA 1RGYA 5JYOA 2XR0A 3PBSA 1ERQA 4N9KA 1ZG4A 1I2SA 4QB8A 1LHYA 1NY0A 2Y2KA 3M2KA 3O88A 3PBQA 1FCMA 5HX9A 3ZGAB 4GNUA 3DW0A 2C5WB 3NDEA 1S0WA 1L2SA 3B3XA 2WADA 3NIAA 1KVLA 4KZAA 5EVIB 5DF9A 4Y0OA 2I72A 2V20A 2IWBA 3EQUA 3OZHA 4UHUA 5EVIC 4Y0TA 4LCLA 4RYEA 2HDRA 2ZQ7A 5A92A 3C4PA 2XH9A 4QY5A 2V2FF 5E2FA 3SH8A 3O87A 1KE3A 1PI4A 2BLSA 1BLCA 2ZQ8A 4HESA 5KSCA 5F1FA 3EQVA 4GKUA 1MWRA 3WS1A 1I5QA 5TGFA 1YMXA 2WKIA 4FH2A 5HAPA 5D3OA 2OV5A 3VMAA 4OQGA 4OPZA 2P9VA 4C6YA 1YT4A 1FSWA 4L0LA 1CI8A 4WM9A 1CEGA 1O07A 3IXGA 1GA0A 4OOLA 2C6WB 5FQMA 3LEZA 3HUMA 2XLNA 4DDSA 3OC2A 5BOHA 1Y54A 4M3KA 3Q1FA 1G68A 3Q7VB 4N1HA 3NY4A 4BLMA 2ZC7A 3N8SA 1EROA 3IWIA 3MFDA 5CHJA 4PPRA 1XX2A 3G32A 4KQOA 2JC7A 4KENB 2WAFA 2HDQA 2Y91A 3IT9A 4QD4A 5CRFA 5EOEA 1MPLA 3OCNA 1FR6A 2CC1A 5GLCA 4E3IA 4E3OA 2ZD8A 4GZBA 1WE4A 3V3SA 4DKIA 1XGIA 4NK3A 2Z2MB 3BFFA 4WZ4A 4WZ5C 3W4PA 4JPMA 4EBPA 4KZ5A 1ONHA 1TEMA 1ERMA 4R4SA 4FCFA 4S2LA 4R3BA 3IF5A 1MY8A 4OOMA 3IF6B 1KVMA 5EE8A 5GHYA 3MZFA 2XDMA 4OVDA 1EI5A 2Y2HA 2QMIA 4DE0A 4JKTA 3UO9A 5HAIA 4UAAA 3MKEA 3C7VA 5CGSA 1IYSA 4CJNA 4KG5A 4KZ9A 4OQIA 3OPPA 2XK1A 4DXCA 1ESIA 1PWCA 1MXOA 2J7VA 1L0FA 3ZVWA 1K56A 5FQ9A 3FZCA 3V3RA 1TVFA 5FQJA 5DF7A 4XUXA 4MBHA 5EVLA 1HD8A 1HTZA 4X69A 4QHCA 5FI7A 4PM5A 1TDGA 2R9WA 3V39A 3ZCZA 3UE3A 1CK3A 3M6HA 1VM1A 2OLUA 1OMEA 1DJAA 2UWXA 3LY4A 3VP2A 5CGWA 5GHXA 2A3UA 3SS3A 3AGDA 1BLPA 1GHPA 1JWVA 4N92A 2WGWB 1DY6A 2EFXA 1Q2PA 4S2NA 1K55A 2A49A 2V1ZA 4IBRA 4PM7A 2X02A 1MKIA 5HAQA 4OP5A 5M18A 1LLBA 4DXBA 1K54A 1NYMA 4OLGA 2ZM8A 3BRMA 5U47A 4P0MA 4E3LA 3E2KA 4LV1A 2Y59A 4B4XA 1K56D 3QNBA 5EOOA 1DJCA 3V5MA 3ZG7B 4UA9A 3SS5A 2H10A 3NBLA 3UNWA 4KQRA 3SH9A 1Q2QA 1SDEA 3BECA 4KZ6A 3UN7A 1H8YA 3M6BA 3W4QA 1XA7A 3DTMA 3W8KA 3C5AA 5M1AA 1JVJA 4QJGA 4ZTKA 1H5XA 1XA1A 4FD8A 3G4PA 1I2WA 4EWFA 4WBGA 2ZQDA 3IXBA 3GRJA 1ONGA 2X71A 4IVKA 1ZC2A 4E3JA 2IWCA 4DE1A 2R9XA 2WZXA 2WGVA 3MZDA 3N8LA 3LCEA 4JF4A 4P6BA 3VOYA 4OQ0A 4DF6A 4QY6A 1PI5A 1IYPA 2E8IA 5DTSA 1GHMA 4F94A 1SHVA 4UA7A 3MXRA 3N7WA 2HDSA 1ZKJA 1DJBA 3IWQA 3VFHA 2H0TA 3BYDA 4JF5A 4PM9A 5AQBA 2DNSA 4DE2A 3HUNA 3G2YA 4MBKA 1RCJA 2ZC3B 4WEKA 2QZ6A 4KQQA 4P87A 4XXRA 2WAEA 3HLWA 3TOIA 3P98A 3VP1A 3G35A 3MXSA 1BUEA 1N4OA 3IH8A 4K91A 1O7EA 2ZQAA 5KMWA 1K25A 1W8YA 4S2JA 1MWUA 2Y2QA 1ES5A 1XP4A 2HP6A 3O3VA 1LI0A 4GDBA 5J8XA 3NI9A 4HBUA 4ID4A 3MBZA 1KGEA 1K54C 4BL2A 3V50A 2G2UA 1K6RA 2Y2LA 1NXYA 2JBFA 2JCHA 4R4RA 3S1YA 4D2OA 3E2LA 3OPRA 5F83A 1CEFA 1GHIA 4E3KA 2GDNA 5HFOA 4GD6A 5E2GA 3TSGA 5DTTA 3VP4A 1K6SA 3ITBA 3ZHHA 1PZOA 3G31A 1C3BA 2VGJA 3BLMA 2H0YA 4N9LA 2Y2JA 2ZM0A 4ZBEA 4YFMA 1IKGA 4S2IA 3LY3A 5KSHA 5FA7A 3G30A 1VQQA 2DCFA 5FAPA 2WKHA 3UY6A 2FFFB 1JWPA 1YLPA 1SKFA 2Y2GA 3MZEA 3RXWA 4NETA 1MWTA 4RX3A 5FQKA 3ZDJA 1XXMA 1K57A 3D4FA 1LI9A 5FATA 1WYBA 4HBTA 5HW3A 4MLLA 3VFFA 1FCNA 3ZVTA 4GD8A 3W4OA 4ZJ2A 1KDWA 4BD1A 4DDYA 4KZ7A 4FSFA 1FOFA 3HVFA 3FV7A 4Y0UA 5EUAA 1YM1A 4OQHA 4OPRA 2EFUA 3S4XA 3ZNTA 1KE4A 3UPNA 1IKIA 2ZMAA 3BFCA 1YLZA 1KGFA 1JWZA 3HLCA 4X6TA 5AQ7A 4C3QA 5F1GA 4U0TA 5CHUA 4KG6A 5DF8A 2JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZC6 B;  2ZQC A;  4ZDX A;  2HP9 A;  3UE1 A;  4CPK A;  2P9V B;  4BD0 A;  1G6A A;  4H8R A;  3FWL A;  3CJM A;  2XFT A;  3O86 A;  4JBF A;  4JXG A;  1FCO A;  3Q07 A;  1Z6F A;  5DVA A;  1IYO A;  1PW8 A;  3CMZ A;  3PAG A;  2ZJ9 A;  3GQZ A;  3IHA A;  1FQG A;  4KZ3 A;  1S6R A;  4OLD A;  3IQA A;  4OKP A;  4JXW A;  2ZLY A;  4E3N A;  3A3E A;  4WEJ A;  3BFG A;  1K38 A;  4QU3 A;  5EVI A;  5IHV A;  3HLE A;  3SH7 A;  3VOZ A;  4R1G A;  3UE0 A;  4Z9Q A;  2DRW A;  1YLJ A;  2BG1 A;  4IED A;  2WZZ A;  1BT5 A;  5CED A;  4FH4 A;  1NYY A;  4P85 A;  4E6X A;  3AGE A;  1W7F A;  4S2O A;  5EPH A;  3S22 A;  3VP3 A;  3IXH A;  1HVB A;  3WWX A;  4WMC A;  3GSG A;  3ZFZ A;  3NC8 A;  1YQS A;  4KZ8 A;  5CTM A;  1W8Q A;  5GLA A;  4ZJ3 A;  1PW1 A;  3GVB A;  3N8R A;  3FKW A;  3FKV A;  1YLY A;  1K57 C;  4A5R A;  4BEN A;  3BM6 A;  5GLD A;  3C7U A;  1YLT A;  3BFD A;  3GV9 A;  3JYI A;  2PU4 A;  3Q7V A;  3FYZ A;  5EVI D;  2XEP A;  4PM8 A;  5CEB A;  3TG9 A;  3VSL A;  1PZP A;  4Q8I A;  5CEC A;  3PBO A;  1MBL A;  2ZC4 B;  4MEZ A;  4GN2 A;  2XD1 A;  5E43 A;  4U3T A;  3WRT A;  3PBR A;  1FSY A;  1ES3 A;  4RX2 A;  4B88 A;  5A93 A;  4X53 A;  1YLW A;  1N9B A;  4K0W A;  2XGN A;  4LV0 A;  4BL3 A;  2XD5 A;  3QHY A;  4U0X A;  4R0Q A;  3A3D A;  3BLS A;  4WMC D;  4DRT A;  3HLB A;  4X68 A;  1J9M A;  4EBN A;  4OON A;  1GCE A;  1NJ4 A;  3IF6 A;  4S2N C;  2WKE A;  1K55 C;  2WGI A;  1BSG A;  4E6W A;  5CER A;  1PIO A;  4EQI A;  3WRZ A;  1WYC A;  1EWZ A;  3A3I A;  4R3J A;  1FR1 A;  1E25 A;  4RVA A;  1ZG6 A;  4OOY A;  1XGJ A;  4B4Z A;  1CI9 A;  3OPL A;  1ES4 A;  3QNC A;  4R23 A;  3ZG0 A;  2B5R A;  3CG5 A;  1JTG A;  1L0D A;  1E4D A;  2FFY A;  2OLV A;  1KE0 A;  1TDL A;  2PBY A;  3HLF A;  2EX8 A;  1BZA A;  3RJU A;  1MWS A;  2Q9N A;  3UDI A;  2J8Y A;  1PWG A;  3NCK A;  1RGZ A;  2Y2P A;  1K4F A;  5KZH A;  5FAQ A;  1QME A;  4WEL A;  3VSK A;  2G2W A;  4S2K A;  5L2F A;  3CZD A;  4OPQ A;  5CTN A;  1E3U A;  3ZG8 B;  2HPB A;  1SCW A;  3UPP A;  5AQA A;  3P09 A;  4XUZ A;  3ZG9 B;  4C75 A;  2ZM2 A;  2EXB A;  3N6I A;  5EEC A;  3IXD A;  4JLF A;  1W79 A;  2WGW A;  5G18 A;  1IEL A;  3DWZ A;  1IEM A;  1XKZ A;  1SDN A;  3ITA A;  1HZO A;  3HLG A;  5CHM A;  2HDU A;  5DTK A;  3SS4 A;  4GOG A;  3OPH A;  2ZQ9 A;  1YMS A;  2XFS A;  2EX9 A;  5FQI A;  3Q7Z A;  1KDS A;  2PU2 A;  3VP0 A;  4EUZ A;  2IWD A;  2XQZ A;  4IVI A;  4OPY A;  3UPO A;  3NDG A;  3N4I A;  4LCM A;  3SOI A;  3A3J A;  1PYY A;  4LV3 A;  3WS2 A;  4YIN A;  4MBF A;  5HAR A;  3HBR A;  1W5D A;  3C4O A;  4BQM A;  4X56 A;  1L0G A;  1E3U D;  2WYX A;  2XF3 A;  2X01 A;  3GMW A;  1BLH A;  2RL3 A;  5A91 A;  5GHZ A;  4Y7P A;  1H8Z A;  1KGG A;  3BFE A;  3M2J A;  3PBN A;  3PBT A;  2EX2 A;  2Q9M A;  3IF6 C;  2J9O A;  2VGK A;  4LEN A;  2P74 A;  2Y2I A;  4X55 A;  3ZNY A;  4KG2 A;  2Z2L B;  5A90 A;  5GLB A;  4UA6 A;  1M40 A;  1U60 A;  3RXX A;  4EV4 A;  4N1X A;  5I94 A;  1ALQ A;  1PWD A;  5FI2 A;  2RCX A;  5M19 A;  4JXV A;  3PTE A;  4KZ4 A;  1GA9 A;  5JYP A;  1NZU A;  2HP5 A;  4ZJ1 A;  3LO7 A;  2WK0 A;  1QMF A;  4HEF A;  3BEB A;  4KZB A;  3ZG5 A;  5HL1 A;  3IH9 A;  4E3M A;  3UDX A;  4PM6 A;  2OSU A;  4LV2 A;  4WYY A;  1LL5 A;  3ISG A;  5FQQ A;  2EX6 A;  3IWO A;  5AQ9 A;  1BLS A;  4S2P A;  4EBL A;  3WS4 A;  3WS5 A;  1IYQ A;  1RP5 A;  3IHB A;  4PMA A;  3GTC A;  4S2M A;  1JTD A;  4RA7 A;  4BJP A;  1K4E A;  1NRF A;  2Y4A A;  2QPN A;  2H5S A;  5FAS A;  1XPB A;  2Y2O A;  3HL9 A;  3G34 A;  3WS0 A;  3A3F A;  1LL9 A;  4JXS A;  5E2E A;  5FDH A;  3G2Z A;  2Y2M A;  1ES2 A;  1L0E A;  4OH0 A;  5FSR A;  3HUO A;  2Y2N A;  4GDN A;  2J9P A;  4GB7 A;  5E2H A;  3OCL A;  4OP8 A;  3Q81 A;  4K0X A;  5TFQ A;  3AGF A;  5CGX A;  3HLD A;  4ZAM A;  4DE3 A;  4O7D A;  5GL9 A;  2EXA A;  3UDF A;  3HRE A;  3Q82 A;  2ZC5 B;  4JF6 A;  5TR7 A;  5F82 A;  1BTL A;  3MKF A;  4IBX A;  4MNR A;  4WZ5 A;  1NZO A;  5FI6 A;  5FAO A;  3GR2 A;  3DWK A;  2WUQ A;  1ESU A;  3I7J A;  2Y55 A;  5CXW A;  1AXB A;  1M6K A;  3PAE A;  1BUL A;  1RGY A;  5JYO A;  2XR0 A;  3PBS A;  1ERQ A;  4N9K A;  1ZG4 A;  1I2S A;  4QB8 A;  1LHY A;  1NY0 A;  2Y2K A;  3M2K A;  3O88 A;  3PBQ A;  1FCM A;  5HX9 A;  3ZGA B;  4GNU A;  3DW0 A;  2C5W B;  3NDE A;  1S0W A;  1L2S A;  3B3X A;  2WAD A;  3NIA A;  1KVL A;  4KZA A;  5EVI B;  5DF9 A;  4Y0O A;  2I72 A;  2V20 A;  2IWB A;  3EQU A;  3OZH A;  4UHU A;  5EVI C;  4Y0T A;  4LCL A;  4RYE A;  2HDR A;  2ZQ7 A;  5A92 A;  3C4P A;  2XH9 A;  4QY5 A;  2V2F F;  5E2F A;  3SH8 A;  3O87 A;  1KE3 A;  1PI4 A;  2BLS A;  1BLC A;  2ZQ8 A;  4HES A;  5KSC A;  5F1F A;  3EQV A;  4GKU A;  1MWR A;  3WS1 A;  1I5Q A;  5TGF A;  1YMX A;  2WKI A;  4FH2 A;  5HAP A;  5D3O A;  2OV5 A;  3VMA A;  4OQG A;  4OPZ A;  2P9V A;  4C6Y A;  1YT4 A;  1FSW A;  4L0L A;  1CI8 A;  4WM9 A;  1CEG A;  1O07 A;  3IXG A;  1GA0 A;  4OOL A;  2C6W B;  5FQM A;  3LEZ A;  3HUM A;  2XLN A;  4DDS A;  3OC2 A;  5BOH A;  1Y54 A;  4M3K A;  3Q1F A;  1G68 A;  3Q7V B;  4N1H A;  3NY4 A;  4BLM A;  2ZC7 A;  3N8S A;  1ERO A;  3IWI A;  3MFD A;  5CHJ A;  4PPR A;  1XX2 A;  3G32 A;  4KQO A;  2JC7 A;  4KEN B;  2WAF A;  2HDQ A;  2Y91 A;  3IT9 A;  4QD4 A;  5CRF A;  5EOE A;  1MPL A;  3OCN A;  1FR6 A;  2CC1 A;  5GLC A;  4E3I A;  4E3O A;  2ZD8 A;  4GZB A;  1WE4 A;  3V3S A;  4DKI A;  1XGI A;  4NK3 A;  2Z2M B;  3BFF A;  4WZ4 A;  4WZ5 C;  3W4P A;  4JPM A;  4EBP A;  4KZ5 A;  1ONH A;  1TEM A;  1ERM A;  4R4S A;  4FCF A;  4S2L A;  4R3B A;  3IF5 A;  1MY8 A;  4OOM A;  3IF6 B;  1KVM A;  5EE8 A;  5GHY A;  3MZF A;  2XDM A;  4OVD A;  1EI5 A;  2Y2H A;  2QMI A;  4DE0 A;  4JKT A;  3UO9 A;  5HAI A;  4UAA A;  3MKE A;  3C7V A;  5CGS A;  1IYS A;  4CJN A;  4KG5 A;  4KZ9 A;  4OQI A;  3OPP A;  2XK1 A;  4DXC A;  1ESI A;  1PWC A;  1MXO A;  2J7V A;  1L0F A;  3ZVW A;  1K56 A;  5FQ9 A;  3FZC A;  3V3R A;  1TVF A;  5FQJ A;  5DF7 A;  4XUX A;  4MBH A;  5EVL A;  1HD8 A;  1HTZ A;  4X69 A;  4QHC A;  5FI7 A;  4PM5 A;  1TDG A;  2R9W A;  3V39 A;  3ZCZ A;  3UE3 A;  1CK3 A;  3M6H A;  1VM1 A;  2OLU A;  1OME A;  1DJA A;  2UWX A;  3LY4 A;  3VP2 A;  5CGW A;  5GHX A;  2A3U A;  3SS3 A;  3AGD A;  1BLP A;  1GHP A;  1JWV A;  4N92 A;  2WGW B;  1DY6 A;  2EFX A;  1Q2P A;  4S2N A;  1K55 A;  2A49 A;  2V1Z A;  4IBR A;  4PM7 A;  2X02 A;  1MKI A;  5HAQ A;  4OP5 A;  5M18 A;  1LLB A;  4DXB A;  1K54 A;  1NYM A;  4OLG A;  2ZM8 A;  3BRM A;  5U47 A;  4P0M A;  4E3L A;  3E2K A;  4LV1 A;  2Y59 A;  4B4X A;  1K56 D;  3QNB A;  5EOO A;  1DJC A;  3V5M A;  3ZG7 B;  4UA9 A;  3SS5 A;  2H10 A;  3NBL A;  3UNW A;  4KQR A;  3SH9 A;  1Q2Q A;  1SDE A;  3BEC A;  4KZ6 A;  3UN7 A;  1H8Y A;  3M6B A;  3W4Q A;  1XA7 A;  3DTM A;  3W8K A;  3C5A A;  5M1A A;  1JVJ A;  4QJG A;  4ZTK A;  1H5X A;  1XA1 A;  4FD8 A;  3G4P A;  1I2W A;  4EWF A;  4WBG A;  2ZQD A;  3IXB A;  3GRJ A;  1ONG A;  2X71 A;  4IVK A;  1ZC2 A;  4E3J A;  2IWC A;  4DE1 A;  2R9X A;  2WZX A;  2WGV A;  3MZD A;  3N8L A;  3LCE A;  4JF4 A;  4P6B A;  3VOY A;  4OQ0 A;  4DF6 A;  4QY6 A;  1PI5 A;  1IYP A;  2E8I A;  5DTS A;  1GHM A;  4F94 A;  1SHV A;  4UA7 A;  3MXR A;  3N7W A;  2HDS A;  1ZKJ A;  1DJB A;  3IWQ A;  3VFH A;  2H0T A;  3BYD A;  4JF5 A;  4PM9 A;  5AQB A;  2DNS A;  4DE2 A;  3HUN A;  3G2Y A;  4MBK A;  1RCJ A;  2ZC3 B;  4WEK A;  2QZ6 A;  4KQQ A;  4P87 A;  4XXR A;  2WAE A;  3HLW A;  3TOI A;  3P98 A;  3VP1 A;  3G35 A;  3MXS A;  1BUE A;  1N4O A;  3IH8 A;  4K91 A;  1O7E A;  2ZQA A;  5KMW A;  1K25 A;  1W8Y A;  4S2J A;  1MWU A;  2Y2Q A;  1ES5 A;  1XP4 A;  2HP6 A;  3O3V A;  1LI0 A;  4GDB A;  5J8X A;  3NI9 A;  4HBU A;  4ID4 A;  3MBZ A;  1KGE A;  1K54 C;  4BL2 A;  3V50 A;  2G2U A;  1K6R A;  2Y2L A;  1NXY A;  2JBF A;  2JCH A;  4R4R A;  3S1Y A;  4D2O A;  3E2L A;  3OPR A;  5F83 A;  1CEF A;  1GHI A;  4E3K A;  2GDN A;  5HFO A;  4GD6 A;  5E2G A;  3TSG A;  5DTT A;  3VP4 A;  1K6S A;  3ITB A;  3ZHH A;  1PZO A;  3G31 A;  1C3B A;  2VGJ A;  3BLM A;  2H0Y A;  4N9L A;  2Y2J A;  2ZM0 A;  4ZBE A;  4YFM A;  1IKG A;  4S2I A;  3LY3 A;  5KSH A;  5FA7 A;  3G30 A;  1VQQ A;  2DCF A;  5FAP A;  2WKH A;  3UY6 A;  2FFF B;  1JWP A;  1YLP A;  1SKF A;  2Y2G A;  3MZE A;  3RXW A;  4NET A;  1MWT A;  4RX3 A;  5FQK A;  3ZDJ A;  1XXM A;  1K57 A;  3D4F A;  1LI9 A;  5FAT A;  1WYB A;  4HBT A;  5HW3 A;  4MLL A;  3VFF A;  1FCN A;  3ZVT A;  4GD8 A;  3W4O A;  4ZJ2 A;  1KDW A;  4BD1 A;  4DDY A;  4KZ7 A;  4FSF A;  1FOF A;  3HVF A;  3FV7 A;  4Y0U A;  5EUA A;  1YM1 A;  4OQH A;  4OPR A;  2EFU A;  3S4X A;  3ZNT A;  1KE4 A;  3UPN A;  1IKI A;  2ZMA A;  3BFC A;  1YLZ A;  1KGF A;  1JWZ A;  3HLC A;  4X6T A;  5AQ7 A;  4C3Q A;  5F1G A;  4U0T A;  5CHU A;  4KG6 A;  5DF8 A;  2JE5 A; 
#chains in the Genus database with same CATH topology
 3CPT A;  2P9V B;  1G6A A;  4DMZ A;  3O86 A;  2XFT A;  5EM1 A;  5HL6 A;  5DVA A;  3PAG A;  1D06 A;  1V9Z A;  2ZLY A;  3T1Q B;  4NXE A;  2P08 A;  1GSX A;  4HP9 A;  2B95 A;  2OOL A;  1BT5 A;  1SZV A;  4FH4 A;  4P85 A;  4E6X A;  3AGE A;  4S2O A;  5EPH A;  2V8C A;  3IXH A;  1VEU A;  3GSG A;  3NC8 A;  1YQS A;  5CTM A;  4ZJ3 A;  3JVU A;  4HH3 A;  2PU4 A;  3T4L A;  3Q7V A;  3TG9 A;  1PZP A;  3PBO A;  1MBL A;  4GN2 A;  3WRT A;  1AWI A;  1ES3 A;  3LIB A;  1N9B A;  4LV0 A;  4M4X A;  3A0R A;  4U0X A;  2GJ3 A;  4WMC D;  4DRT A;  3HLB A;  1N9N A;  4EBN A;  4OON A;  3IF6 A;  1BSG A;  4CQH A;  2VX8 A;  4XT2 A;  3A3I A;  4R3J A;  4RVA A;  3OPL A;  3QNC A;  4R23 A;  3ZG0 A;  2V0U A;  1OT9 A;  2B5R A;  3CG5 A;  2PBY A;  2EX8 A;  1PWG A;  2PR5 A;  2XA7 M;  4S2K A;  5CTN A;  1SCW A;  4C75 A;  2ZM2 A;  3IXD A;  5HSQ A;  1HZO A;  4GOG A;  1OPX A;  3EGD C;  3OPH A;  2XFS A;  5J3W A;  3VP0 A;  3SZT A;  4IVI A;  2XRN A;  3NDG A;  3MQO A;  2J3W A;  3SOI A;  1PYY A;  1H8M A;  4YIN A;  3PR6 A;  4K08 A;  2WYX A;  2X01 A;  1BLH A;  2VGL S;  2J9O A;  2OWH A;  3BY8 A;  2P74 A;  4MN7 A;  5AVE A;  4UA6 A;  4DJ3 A;  2YKH A;  2INW A;  1PWD A;  4UEY A;  4HOI A;  4HP4 A;  1GSV A;  4HJ3 A;  4KZB A;  4E3M A;  5AVF A;  4WYY A;  2W27 A;  3WS4 A;  3KX0 X;  3IHB A;  4S2M A;  5F69 A;  4H6J B;  3DTE A;  4RA7 A;  2ZMF A;  1CQA A;  3HCY A;  5J4E A;  4NKP A;  5E2E A;  2Y2M A;  4ZRR A;  3QP1 A;  4Y15 A;  2A24 A;  2JKR I;  4X1L A;  5E2H A;  3OCL A;  3CUE A;  4MN5 A;  3S7N A;  5CGX A;  3HLD A;  4DE3 A;  4O7D A;  2EXA A;  3T4O A;  2ZC5 B;  2M7U A;  5TR7 A;  1BTL A;  4WZ5 A;  2QHK A;  5FAO A;  3GR2 A;  2WUQ A;  3PAE A;  2FZ0 A;  5JYO A;  3PBS A;  5L8M A;  1I2S A;  2O9A A;  2Y2K A;  1NY0 A;  3M2K A;  4GNU A;  3EEH A;  3DW0 A;  1S0W A;  5EVI B;  1KVL A;  4MDZ A;  1BLC A;  5KSC A;  4EER A;  4GKU A;  3WS1 A;  3CLO A;  2WKI A;  5D3O A;  1ODV A;  2WKQ A;  2PR6 A;  3LEQ A;  1ZHH B;  1UWN X;  4OPZ A;  1CEG A;  1O07 A;  2C6W B;  3G6O A;  2VJW A;  4EUV A;  3Q1F A;  1STZ A;  3NY4 A;  4HHD A;  2ZC7 A;  3MFD A;  2JC7 A;  4KEN B;  2WAF A;  5EOE A;  1OTI A;  4E3O A;  4Q0J A;  3W2Z A;  4WZ4 A;  1A0K A;  4L9F A;  3CWF A;  5HWW A;  4FCF A;  1MY8 A;  1EI5 A;  3NJA A;  3MKE A;  5CGS A;  1IYS A;  2XK1 A;  1L0F A;  4JGO A;  5FQ9 A;  3R7W B;  4XUX A;  1HD8 A;  4X69 A;  5FI7 A;  4PM5 A;  2OLU A;  4EEP A;  2J80 A;  1K0K A;  4Y13 A;  1OJ5 A;  2DMW A;  1DY6 A;  4GHI A;  1K55 A;  2V1Z A;  4IBR A;  2X02 A;  1MKI A;  4DXB A;  4OLG A;  2ZM8 A;  2YKF A;  3E4Q A;  3T1S A;  3D72 A;  4ARZ B;  3LID A;  3EGX C;  1SDE A;  3M6B A;  2GX5 A;  3C8C A;  1XA7 A;  3DTM A;  3W8K A;  3C5A A;  3T4J A;  2W1T B;  4ZTK A;  1XA1 A;  3G4P A;  1I2W A;  3K3C A;  3VE4 A;  3MF0 A;  4IVK A;  2WGV A;  3RTY A;  4OQ0 A;  3LGO A;  2OAP 1;  3LIF A;  2PD7 A;  4WEK A;  2QZ6 A;  4Q0I A;  2Y79 A;  2WAE A;  3HLW A;  4CLC A;  1N4O A;  4S2J A;  2V0W A;  1XP4 A;  4GDB A;  3KSI A;  3NI9 A;  4HBU A;  3MBZ A;  1K54 C;  4BL2 A;  3MJQ A;  2JBF A;  1H0M A;  3BQA A;  3S1Y A;  4D2O A;  2NUP C;  2PD8 A;  3FG8 A;  2GDN A;  3CUE C;  5HFO A;  3CIT A;  4FOF A;  2O99 A;  4Y5F A;  1C3B A;  4WL9 A;  2H0Y A;  4GS9 B;  4WLA A;  4ZBE A;  4YFM A;  1TS8 A;  4RQ9 A;  3LY3 A;  1J3W A;  5FA7 A;  1VB6 A;  1TS7 A;  1X0O A;  2WKH A;  4ETX A;  2FFF B;  1SKO B;  1YSP A;  2HJE A;  3RXW A;  4NET A;  1MWT A;  4RX3 A;  3ZDJ A;  1D7E A;  4HBT A;  4MLL A;  1FCN A;  3W4O A;  4KZ7 A;  2W3G A;  3E4P A;  3FV7 A;  2L4R A;  1KE4 A;  3T1X A;  3H82 B;  1KGF A;  1JWZ A;  5F1G A;  3G31 A;  2JE5 A;  2ZQC A;  4ZDX A;  2HP9 A;  1T18 A;  4BD0 A;  4JXG A;  4JBF A;  2OAQ 1;  4FUW A;  1Z6F A;  4WN5 A;  1PW8 A;  3CMZ A;  2ZJ9 A;  1FQG A;  3IQA A;  4JXW A;  3BFG A;  5IHV A;  3HLE A;  3SH7 A;  2HF6 A;  3UE0 A;  1PNE A;  1YLJ A;  5CED A;  3LI8 A;  1NYY A;  3JVV A;  1L3L A;  3S22 A;  3VP3 A;  1PFL A;  3WWX A;  3ZFZ A;  2JKT M;  4HJ6 A;  4KZ8 A;  5HD5 A;  3N8R A;  1K57 C;  3BM6 A;  5GLD A;  3C7U A;  3BFD A;  3IBJ A;  3JYI A;  3FYZ A;  2UV0 E;  2ZC4 B;  4MEZ A;  5E43 A;  3K2N A;  4RX2 A;  4B88 A;  4K0W A;  4BL3 A;  3QHY A;  3ZQ5 A;  3CHW P;  1XFN A;  3A3D A;  3BLS A;  1EW0 A;  1K55 C;  2WGI A;  1ACF A;  4E6W A;  4OOY A;  4G3W A;  3PXP A;  1TDL A;  2FFY A;  1BZA A;  1MWS A;  2J8Y A;  2Y2P A;  5KZH A;  5FAQ A;  4HQA A;  2O9B A;  2G2W A;  2J3T C;  3CZD A;  1YPR A;  1E3U A;  2P04 A;  3ZG8 B;  3MS6 A;  5AQA A;  2PBD P;  5EEC A;  1W79 A;  5C5K A;  3GDI A;  1SDN A;  5CHM A;  3HLG A;  2NUT C;  3IS2 B;  5FQI A;  1KDS A;  2PU2 A;  2GZA A;  4OPY A;  3N4I A;  4LCM A;  4Q0H A;  2P7J A;  4LV3 A;  3WS2 A;  2EWV A;  5DKL A;  4CLC C;  4R70 A;  1L0G A;  3GMW A;  5TJJ A;  2LB5 A;  1XFQ A;  5A91 A;  1H8Z A;  3TE8 A;  1T19 A;  1M40 A;  3F1P A;  4EV4 A;  4IHQ A;  4I3I A;  4JXV A;  1NZU A;  2ACG A;  1QMF A;  4HEF A;  3LYX A;  3BEB A;  1T1A A;  3IH9 A;  5FL3 A;  3UDX A;  1P0Z A;  2V1B A;  3OBF A;  1MZU A;  2D02 A;  2EX6 A;  4EBL A;  3WS5 A;  3NUL A;  2LB9 A;  5HPF A;  5EV0 A;  1WA9 A;  3UB7 A;  1K4E A;  1NRF A;  2QPN A;  2H5S A;  2Y2O A;  3HL9 A;  3WS0 A;  3A3F A;  5FSR A;  3T50 A;  4FTX A;  2ZBB A;  4GDN A;  4QPR A;  4OP8 A;  2W0N A;  4BBU A;  4NXF A;  3Q82 A;  4JF6 A;  4AFI A;  3MKF A;  4IBX A;  1NZO A;  5F68 A;  2EWW A;  4P6Z M;  4ETZ A;  1ESU A;  2G7U A;  2Y55 A;  1AXB A;  1OTB A;  1BUL A;  5F5Y A;  1RGY A;  4N9K A;  4QB8 A;  3ZGA B;  3PBQ A;  3NDE A;  4MCW A;  2WAD A;  5DF9 A;  2I72 A;  3EQU A;  4UHU A;  4Y0T A;  3MSH A;  4GJ4 A;  3SH8 A;  3O87 A;  3LR3 A;  3H9W A;  5F1F A;  3DBA A;  3B47 A;  2O9C A;  5TGF A;  4KUO A;  2OV5 A;  3D9Y A;  3VMA A;  3GEC A;  2P9V A;  4C6Y A;  1FSW A;  4L0L A;  3IXG A;  4OOL A;  1GA0 A;  5FQM A;  5HZH A;  3LEZ A;  4DDS A;  4F3L B;  3VV4 A;  3DTK A;  3KO6 A;  4N1H A;  3N8S A;  4PPR A;  3G32 A;  4KQO A;  2WKP A;  4QD4 A;  1MPL A;  3L9K A;  5GLC A;  2ZD8 A;  4GZB A;  2Z2M B;  3BFF A;  1XJ6 A;  2EA9 A;  4KZ5 A;  1ONH A;  4S2L A;  5I5L A;  3U4L P;  4R3B A;  3V67 A;  3QP2 A;  1KVM A;  3MMH A;  3MZF A;  3BJN A;  4DE0 A;  3TW8 A;  4KZ9 A;  3OPP A;  3PHY A;  1MXO A;  2Q0O A;  3MFX A;  1S4R A;  3V3R A;  4D60 A;  3O5Y A;  4LFU A;  3LI9 A;  3UB8 A;  2KX6 A;  3LR5 A;  3NOT C;  2PYR A;  3F1O B;  1LL8 A;  3LIC A;  3LY4 A;  5CGW A;  1DRM A;  1BLP A;  1GHP A;  1BYW A;  4N92 A;  2WGW B;  1Q2P A;  4S2N A;  2A49 A;  2VK3 A;  1N9O A;  3QP5 A;  1LLB A;  1K54 A;  5U47 A;  3E2K A;  2Y59 A;  3KYQ A;  1S67 L;  4UA9 A;  3SS5 A;  2H10 A;  4G3V A;  3BWL A;  3UNW A;  3SH9 A;  5AJG A;  4X25 A;  1Q2Q A;  3BEC A;  2K7S A;  2W3H A;  3U2A A;  1JVJ A;  1XJ2 A;  4QJG A;  4JGR A;  4FD8 A;  3DAV A;  3IXB A;  3GRJ A;  1ONG A;  3L7H A;  4DN0 A;  3LIE A;  2IWC A;  2R9X A;  2WZX A;  2XRO A;  3N8L A;  4P6B A;  3VOY A;  3OOV A;  4QY6 A;  1GHM A;  5HWV A;  3MXR A;  5F6A A;  1DJB A;  3IWQ A;  4E04 A;  4HIA A;  4PM9 A;  2DNS A;  3T4K A;  1IOU A;  3G2Y A;  4MBK A;  3S7P A;  2ZC3 B;  1H3Q A;  4KQQ A;  4P87 A;  3TOI A;  3MXS A;  4O0P A;  3IH8 A;  5KMW A;  1S1Z A;  1W8Y A;  2HP6 A;  5J8X A;  4KUK A;  4ID4 A;  3OLO A;  2JCH A;  3R4K A;  3E2L A;  3OPR A;  3LUQ A;  2W3D A;  1CEF A;  2HJ9 C;  3F1N B;  4CLC D;  5DTT A;  1K6S A;  3ITB A;  3BLM A;  2ZL1 B;  2Y2J A;  5IT5 A;  1LSV A;  1YKD A;  3LR4 A;  5KSH A;  3G30 A;  4H6J A;  3PYP A;  2DCF A;  5FAP A;  3UY6 A;  2W3E A;  1YLP A;  2Y2G A;  5DJT A;  1LT0 A;  1K57 A;  3D4F A;  1WYB A;  5HW3 A;  3ZVT A;  3D3O A;  1KDW A;  1IFQ A;  3JPU A;  3RFB A;  1FOF A;  4NXB A;  1MKM A;  2KOI A;  2B18 A;  5EUA A;  2EFU A;  4BWI A;  1IKI A;  1OJG A;  4X6T A;  1YLZ A;  3BFC A;  4C3Q A;  3ULF A;  3UE1 A;  4CPK A;  3FWL A;  1CJF A;  3CJM A;  4YOF A;  1FCO A;  3Q07 A;  1TS6 A;  3IHA A;  3GQZ A;  2JKG A;  4OLD A;  4OKP A;  4E3N A;  1V9Y A;  4QU3 A;  3KYZ A;  5EVI A;  3VOZ A;  4R1G A;  4Z9Q A;  2DRW A;  1FIL A;  2VV6 A;  4B93 A;  1HVB A;  3BQ8 A;  3S7Q A;  3FKW A;  3FKV A;  1YLY A;  3ICY A;  4A5R A;  3GV9 A;  1LSX A;  2XEP A;  5CEB A;  4NXG A;  4Q8I A;  2XD1 A;  5MC7 A;  3T4T A;  3PBR A;  1VET B;  1FSY A;  4X53 A;  3IX3 A;  2XGN A;  5DFY A;  4R38 A;  5FEF A;  1OTD A;  4X68 A;  4PKY G;  3UMD A;  1W63 M;  1NJ4 A;  5G4Y A;  4S2N C;  2WKE A;  3T4Q A;  3WRZ A;  1EWZ A;  1FR1 A;  1E25 A;  3NEC A;  1XGJ A;  2JHE A;  4I5S A;  1L0D A;  1E4D A;  2OLV A;  3HLF A;  5TBM B;  3R7W A;  1F9I A;  3UDI A;  3NCK A;  2V1A A;  1S66 L;  3VSK A;  4R3A A;  5L2F A;  3P09 A;  1ZTU A;  2EXB A;  1DP8 A;  1IEL A;  3DWZ A;  1XKZ A;  3ITA A;  4KQD A;  2HDU A;  2ZQ9 A;  1YMS A;  4I38 A;  3A0V A;  4ARZ A;  4LRX C;  4GLQ A;  2XQZ A;  4LRY C;  3UPO A;  2JKR M;  3KSF A;  4YWZ A;  5HAR A;  5KIZ A;  3HBR A;  3C4O A;  2W1T A;  4X56 A;  1E3U D;  2K2N A;  2V9A A;  2RL3 A;  2Z6D A;  3PBN A;  3PBT A;  2Q9M A;  4LEN A;  1P9R A;  4X55 A;  3ZNY A;  4KG2 A;  2Z2L B;  5A90 A;  1ALQ A;  2AVX A;  2RCX A;  5JYP A;  4ZJ1 A;  2HP5 A;  3H7W B;  2ZOH A;  2E8J A;  3LO7 A;  2B02 A;  5HL1 A;  2QJ7 A;  4PM6 A;  4LV2 A;  1LL5 A;  5FQQ A;  5AQ9 A;  1Z09 A;  3IWO A;  1BLS A;  4S2P A;  2PDR A;  3QP4 A;  1RP5 A;  4MMN A;  3KSH A;  4EW7 A;  2Y4A A;  5FAS A;  2VV7 A;  4G3K A;  3G34 A;  5G4Z A;  4OH0 A;  3HUO A;  2Y2N A;  4GB7 A;  4GCZ A;  2R78 A;  4K0X A;  2KLI A;  5GL9 A;  3MXQ A;  3ZYT A;  5F82 A;  2PT7 A;  4GS9 A;  5FI6 A;  2GNX A;  3DWK A;  3CPT B;  3I7J A;  1HLU P;  2XR0 A;  1SKO A;  1LHY A;  5HX9 A;  4YNR A;  5LBR A;  1L2S A;  3FPW A;  3NIA A;  4NEE D;  4Y0O A;  2V20 A;  3OZH A;  5EVI C;  2KDK A;  4Y17 A;  4B9O A;  4LCL A;  2HDR A;  5E2F A;  2V2F F;  1PI4 A;  2BLS A;  2ZQ8 A;  2A2L A;  2MJ6 A;  3EQV A;  5HD3 A;  3H82 A;  1VEU B;  4CLC E;  1YT4 A;  1CI8 A;  2XLN A;  2I9V A;  3OC2 A;  1Y54 A;  2XA7 S;  1G68 A;  3Q7V B;  3VE3 A;  3TRC A;  3UB9 A;  3IWI A;  5CHJ A;  5CRF A;  2HDQ A;  2Y91 A;  2HZ5 A;  1XJ4 A;  3OCN A;  1FR6 A;  2CC1 A;  3B33 A;  3V3S A;  4DKI A;  1XGI A;  2V8F A;  4JPM A;  3LFV A;  1TEM A;  3EWK A;  1ERM A;  3LIA A;  4OOM A;  3IF6 B;  1N9L A;  4LPZ A;  2Y2H A;  3C2W A;  4XT2 B;  2QMI A;  3KSG A;  4UAA A;  2W1R A;  3C7V A;  4CJN A;  4KG5 A;  1PWC A;  2J7V A;  3ZVW A;  1K56 A;  3FZC A;  3P01 A;  5FQJ A;  5DF7 A;  5EVL A;  4EU0 A;  2QYB A;  4BMW A;  2R9W A;  3V39 A;  1CK3 A;  3M6H A;  2Z6C A;  3DTI A;  1DJA A;  4LRZ E;  2UWX A;  1OTA A;  5GHX A;  2A3U A;  3SS3 A;  1JWV A;  4PM7 A;  4OP5 A;  1NYM A;  3BY9 A;  2VKS A;  3BRM A;  4LV1 A;  4B4X A;  4GW9 A;  5EOO A;  3V5M A;  3ZG7 B;  1YSQ A;  1XJ3 A;  4KZ6 A;  1MC0 A;  3W4Q A;  2M1C A;  1H5X A;  4JGP A;  2ZQD A;  4BBV A;  2XSS A;  3BW6 A;  4I3A A;  4DE1 A;  3MZD A;  4DF6 A;  1IYP A;  2E8I A;  4F94 A;  4UA7 A;  2HDS A;  1ZKJ A;  4UQI M;  2QWS A;  3IS2 A;  1LSW A;  3VFH A;  4JF5 A;  5DKK A;  5AQB A;  4DE2 A;  3HUN A;  1RCJ A;  4XXR A;  3FC7 A;  2K31 A;  1OT6 A;  3P98 A;  1BUE A;  1O7E A;  1K25 A;  4O01 A;  1MWU A;  3O3V A;  3E0Y A;  4MN6 A;  2JN7 A;  3V50 A;  1K6R A;  2Y2L A;  1NXY A;  3A0S A;  2A24 B;  3NHQ A;  5F83 A;  4PAU A;  2FH5 A;  4GD6 A;  2VV8 A;  5E2G A;  3TSG A;  3VP4 A;  1PZO A;  2VGJ A;  2ZM0 A;  1IKG A;  4IJG A;  2PAV P;  3MR0 A;  5DFX A;  5HPI A;  1JWP A;  4BBT A;  1SKF A;  4ME4 A;  5J7E A;  4EET B;  4GD8 A;  3EOI A;  4BD1 A;  4DDY A;  4Y0U A;  1YM1 A;  3T12 B;  4PKY A;  3ZNT A;  4O8G A;  5AQ7 A;  3HLC A;  4QWO A;  5CHU A;  2ZC6 B;  1F5M A;  1T1C A;  4H8R A;  1G28 A;  1IYO A;  1NLZ A;  4HJ4 A;  4KZ3 A;  1S6R A;  2Y8H A;  3A3E A;  4WEJ A;  1K38 A;  2ZOI A;  4ESP A;  2BG1 A;  4IED A;  2WZZ A;  3C30 A;  1W7F A;  4WMC A;  3K3D A;  1W8Q A;  5GLA A;  1PW1 A;  3GVB A;  5L09 A;  4BEN A;  1YLT A;  4F3L A;  5EVI D;  3QP6 A;  4PM8 A;  3VSL A;  5DJU A;  5CEC A;  4U3T A;  1CF0 A;  5A93 A;  1YLW A;  4I3J A;  3B42 A;  2J3T D;  5HDD A;  5L07 A;  2XD5 A;  4R0Q A;  1P9W A;  1J9M A;  4GHI B;  5L10 A;  3QP8 A;  1GCE A;  5HWT A;  5CER A;  1PIO A;  4EQI A;  1WYC A;  1DP6 A;  1ZG6 A;  4B4Z A;  1CI9 A;  1ES4 A;  1G5U A;  1JTG A;  1KE0 A;  3CAX A;  3RJU A;  2Q9N A;  2QKP A;  1RGZ A;  1K4F A;  1QME A;  4WEL A;  4HY8 A;  2JKT I;  4OPQ A;  3F1O A;  2PYP A;  2HPB A;  3UPP A;  1TD5 A;  1NLY A;  4XUZ A;  3ZG9 B;  3N6I A;  4JLF A;  2WGW A;  5G18 A;  1IEM A;  1F2K A;  1YAX A;  5DTK A;  3SS4 A;  1JNU A;  2EX9 A;  3Q7Z A;  2M7V A;  4EUZ A;  2IWD A;  3UME A;  1OTE A;  2BAS A;  3A3J A;  3EEA A;  4CLC B;  2VGL M;  4MBF A;  1W5D A;  4BQM A;  1Y4O A;  2XF3 A;  5GHZ A;  4Y7P A;  1KGG A;  1W63 Q;  3BFE A;  3M2J A;  2BTF P;  2EX2 A;  2HGV A;  3IF6 C;  2VGK A;  2Y2I A;  2ZMV A;  5GLB A;  1U60 A;  5I94 A;  3RXX A;  4N1X A;  5FI2 A;  5M19 A;  3PTE A;  4KZ4 A;  1GA9 A;  2WK0 A;  3ZG5 A;  4EES A;  2OSU A;  5HDS A;  3ISG A;  4PHT A;  3E4O A;  1IYQ A;  4PMA A;  3GTC A;  1JTD A;  3UB5 P;  4HNB A;  4BJP A;  2L1M A;  1S1Y A;  4R6L A;  3CI6 A;  1XPB A;  3FPV A;  1LL9 A;  2VA0 A;  4JXS A;  5FDH A;  3G2Z A;  2JKF A;  1ES2 A;  1L0E A;  2PRF A;  2J9P A;  3VOL A;  3Q81 A;  5TFQ A;  3AGF A;  4ZAM A;  3F1N A;  3UDF A;  3HRE A;  5IU1 A;  1F98 A;  5EM0 A;  2ZL1 A;  4MNR A;  5CX7 A;  3RH8 B;  5CXW A;  1M6K A;  5FDS A;  1UGU A;  1ERQ A;  1ZG4 A;  3O88 A;  1FCM A;  1DP9 A;  2C5W B;  4Y2F A;  3B3X A;  4KZA A;  4II7 A;  3SW1 A;  2IWB A;  1S4S A;  3UB6 A;  4RYE A;  2ZQ7 A;  3IX4 A;  5A92 A;  3C4P A;  2XH9 A;  4QY5 A;  1KE3 A;  3NOU C;  2W3F A;  4HES A;  1TF1 A;  4WF0 A;  4WUJ A;  1MWR A;  3IBR A;  1I5Q A;  4EXO A;  1YMX A;  4FH2 A;  5HAP A;  2O0Y A;  4OQG A;  3P7N A;  4LGW A;  5EFW A;  4WM9 A;  3HUM A;  5BOH A;  4M3K A;  3UE6 A;  4BLM A;  1ERO A;  1T1B A;  2IA2 A;  1XX2 A;  3IT9 A;  5EVE A;  4E3I A;  4IUK A;  1WE4 A;  4DJ2 A;  3KYE A;  4NK3 A;  4WZ5 C;  3W4P A;  3MQQ A;  4EBP A;  1NWZ A;  4R4S A;  2WKR A;  4EEU A;  3IF5 A;  5EE8 A;  5GHY A;  2XDM A;  4OVD A;  2H28 A;  2VEA A;  4L9E A;  4JKT A;  3UO9 A;  5HAI A;  4EQ1 A;  4OQI A;  4DXC A;  1ESI A;  1TVF A;  1TS0 A;  1GSW A;  4MBH A;  1HTZ A;  4QHC A;  1TDG A;  1VET A;  3ZCZ A;  3UE3 A;  1D1J A;  1VM1 A;  1OME A;  3VP2 A;  3AGD A;  3LR0 A;  3MQ0 A;  3IX8 A;  2EFX A;  5IS1 A;  1NRJ A;  5HAQ A;  5M18 A;  2CMN A;  4P0M A;  4E3L A;  1K56 D;  1Y28 A;  3QNB A;  1DJC A;  3NBL A;  5A8B A;  4KQR A;  3UN7 A;  1H8Y A;  3HJK A;  4LLO B;  5TBM A;  5M1A A;  5FEG A;  4EWF A;  4WBG A;  2X71 A;  1ZC2 A;  4E3J A;  4JF4 A;  3LCE A;  3NOP C;  3TJZ C;  4IUH A;  1PI5 A;  5DTS A;  3F1P B;  1SHV A;  3N7W A;  4Y3I A;  2H0T A;  3BYD A;  4P6Z S;  4JGQ A;  4UQI S;  3T4S A;  3VP1 A;  3G35 A;  3E98 A;  4K91 A;  2ZQA A;  2Y2Q A;  1ES5 A;  1PRQ A;  1LI0 A;  1FIK A;  2D01 A;  1G6O A;  1KOU A;  1KGE A;  2G2U A;  4R4R A;  4X1M A;  4HI4 A;  2OWJ A;  1GHI A;  4E3K A;  1VHM A;  3H7W A;  4I39 A;  1UWP X;  1P97 A;  4NG2 A;  3ZHH A;  2VZW A;  3C38 A;  4N9L A;  4S2I A;  2VLG A;  5K5B A;  4HH2 A;  1VQQ A;  3MZE A;  5FQK A;  1XXM A;  1LI9 A;  5FAT A;  5HDC A;  3T1R A;  3VFF A;  4ZJ2 A;  2HV1 A;  4FSF A;  2PHY A;  3HVF A;  4Z1W A;  2QJ5 A;  3S7O A;  4OQH A;  4L9G A;  4OPR A;  3S4X A;  3UPN A;  2ZMA A;  3HJI A;  2L0W A;  4U0T A;  4KG6 A;  5DF8 A; 
#chains in the Genus database with same CATH homology
 2ZC6 B;  2ZQC A;  4ZDX A;  2HP9 A;  3UE1 A;  4CPK A;  2P9V B;  4BD0 A;  1G6A A;  4H8R A;  3FWL A;  3CJM A;  2XFT A;  3O86 A;  4JBF A;  4JXG A;  1FCO A;  3Q07 A;  1Z6F A;  5DVA A;  1IYO A;  1PW8 A;  3CMZ A;  3PAG A;  2ZJ9 A;  3GQZ A;  3IHA A;  1FQG A;  4KZ3 A;  1S6R A;  4OLD A;  3IQA A;  4OKP A;  4JXW A;  2ZLY A;  4E3N A;  3A3E A;  4WEJ A;  3BFG A;  1K38 A;  4QU3 A;  5EVI A;  5IHV A;  3HLE A;  3SH7 A;  3VOZ A;  4R1G A;  3UE0 A;  4Z9Q A;  2DRW A;  1YLJ A;  2BG1 A;  4IED A;  2WZZ A;  1BT5 A;  5CED A;  4FH4 A;  1NYY A;  4P85 A;  4E6X A;  3AGE A;  1W7F A;  4S2O A;  5EPH A;  3S22 A;  3VP3 A;  3IXH A;  1HVB A;  3WWX A;  4WMC A;  3GSG A;  3ZFZ A;  3NC8 A;  1YQS A;  4KZ8 A;  5CTM A;  1W8Q A;  5GLA A;  4ZJ3 A;  1PW1 A;  3GVB A;  3N8R A;  3FKW A;  3FKV A;  1YLY A;  1K57 C;  4A5R A;  4BEN A;  3BM6 A;  5GLD A;  3C7U A;  1YLT A;  3BFD A;  3GV9 A;  3JYI A;  2PU4 A;  3Q7V A;  3FYZ A;  5EVI D;  2XEP A;  4PM8 A;  5CEB A;  3TG9 A;  3VSL A;  1PZP A;  4Q8I A;  5CEC A;  3PBO A;  1MBL A;  2ZC4 B;  4MEZ A;  4GN2 A;  2XD1 A;  5E43 A;  4U3T A;  3WRT A;  3PBR A;  1FSY A;  1ES3 A;  4RX2 A;  4B88 A;  5A93 A;  4X53 A;  1YLW A;  1N9B A;  4K0W A;  2XGN A;  4LV0 A;  4BL3 A;  2XD5 A;  3QHY A;  4U0X A;  4R0Q A;  3A3D A;  3BLS A;  4WMC D;  4DRT A;  3HLB A;  4X68 A;  1J9M A;  4EBN A;  4OON A;  1GCE A;  1NJ4 A;  3IF6 A;  4S2N C;  2WKE A;  1K55 C;  2WGI A;  1BSG A;  4E6W A;  5CER A;  1PIO A;  4EQI A;  3WRZ A;  1WYC A;  1EWZ A;  3A3I A;  4R3J A;  1FR1 A;  1E25 A;  4RVA A;  1ZG6 A;  4OOY A;  1XGJ A;  4B4Z A;  1CI9 A;  3OPL A;  1ES4 A;  3QNC A;  4R23 A;  3ZG0 A;  2B5R A;  3CG5 A;  1JTG A;  1L0D A;  1E4D A;  2FFY A;  2OLV A;  1KE0 A;  1TDL A;  2PBY A;  3HLF A;  2EX8 A;  1BZA A;  3RJU A;  1MWS A;  2Q9N A;  3UDI A;  2J8Y A;  1PWG A;  3NCK A;  1RGZ A;  2Y2P A;  1K4F A;  5KZH A;  5FAQ A;  1QME A;  4WEL A;  3VSK A;  2G2W A;  4S2K A;  5L2F A;  3CZD A;  4OPQ A;  5CTN A;  1E3U A;  3ZG8 B;  2HPB A;  1SCW A;  3UPP A;  5AQA A;  3P09 A;  4XUZ A;  3ZG9 B;  4C75 A;  2ZM2 A;  2EXB A;  3N6I A;  5EEC A;  3IXD A;  4JLF A;  1W79 A;  2WGW A;  5G18 A;  1IEL A;  3DWZ A;  1IEM A;  1XKZ A;  1SDN A;  3ITA A;  1HZO A;  3HLG A;  5CHM A;  2HDU A;  5DTK A;  3SS4 A;  4GOG A;  3OPH A;  2ZQ9 A;  1YMS A;  2XFS A;  2EX9 A;  5FQI A;  3Q7Z A;  1KDS A;  2PU2 A;  3VP0 A;  4EUZ A;  2IWD A;  2XQZ A;  4IVI A;  4OPY A;  3UPO A;  3NDG A;  3N4I A;  4LCM A;  3SOI A;  3A3J A;  1PYY A;  4LV3 A;  3WS2 A;  4YIN A;  4MBF A;  5HAR A;  3HBR A;  1W5D A;  3C4O A;  4BQM A;  4X56 A;  1L0G A;  1E3U D;  2WYX A;  2XF3 A;  2X01 A;  3GMW A;  1BLH A;  2RL3 A;  5A91 A;  5GHZ A;  4Y7P A;  1H8Z A;  1KGG A;  3BFE A;  3M2J A;  3PBN A;  3PBT A;  2EX2 A;  2Q9M A;  3IF6 C;  2J9O A;  2VGK A;  4LEN A;  2P74 A;  2Y2I A;  4X55 A;  3ZNY A;  4KG2 A;  2Z2L B;  5A90 A;  5GLB A;  4UA6 A;  1M40 A;  1U60 A;  3RXX A;  4EV4 A;  4N1X A;  5I94 A;  1ALQ A;  1PWD A;  5FI2 A;  2RCX A;  5M19 A;  4JXV A;  3PTE A;  4KZ4 A;  1GA9 A;  5JYP A;  1NZU A;  2HP5 A;  4ZJ1 A;  3LO7 A;  2WK0 A;  1QMF A;  4HEF A;  3BEB A;  4KZB A;  3ZG5 A;  5HL1 A;  3IH9 A;  4E3M A;  3UDX A;  4PM6 A;  2OSU A;  4LV2 A;  4WYY A;  1LL5 A;  3ISG A;  5FQQ A;  2EX6 A;  3IWO A;  5AQ9 A;  1BLS A;  4S2P A;  4EBL A;  3WS4 A;  3WS5 A;  1IYQ A;  1RP5 A;  3IHB A;  4PMA A;  3GTC A;  4S2M A;  1JTD A;  4RA7 A;  4BJP A;  1K4E A;  1NRF A;  2Y4A A;  2QPN A;  2H5S A;  5FAS A;  1XPB A;  2Y2O A;  3HL9 A;  3G34 A;  3WS0 A;  3A3F A;  1LL9 A;  4JXS A;  5E2E A;  5FDH A;  3G2Z A;  2Y2M A;  1ES2 A;  1L0E A;  4OH0 A;  5FSR A;  3HUO A;  2Y2N A;  4GDN A;  2J9P A;  4GB7 A;  5E2H A;  3OCL A;  4OP8 A;  3Q81 A;  4K0X A;  5TFQ A;  3AGF A;  5CGX A;  3HLD A;  4ZAM A;  4DE3 A;  4O7D A;  5GL9 A;  2EXA A;  3UDF A;  3HRE A;  3Q82 A;  2ZC5 B;  4JF6 A;  5TR7 A;  5F82 A;  1BTL A;  3MKF A;  4IBX A;  4MNR A;  4WZ5 A;  1NZO A;  5FI6 A;  5FAO A;  3GR2 A;  3DWK A;  2WUQ A;  1ESU A;  3I7J A;  2Y55 A;  5CXW A;  1AXB A;  1M6K A;  3PAE A;  1BUL A;  1RGY A;  5JYO A;  2XR0 A;  3PBS A;  1ERQ A;  4N9K A;  1ZG4 A;  1I2S A;  4QB8 A;  1LHY A;  1NY0 A;  2Y2K A;  3M2K A;  3O88 A;  3PBQ A;  1FCM A;  5HX9 A;  3ZGA B;  4GNU A;  3DW0 A;  2C5W B;  3NDE A;  1S0W A;  1L2S A;  3B3X A;  2WAD A;  3NIA A;  1KVL A;  4KZA A;  5EVI B;  5DF9 A;  4Y0O A;  2I72 A;  2V20 A;  2IWB A;  3EQU A;  3OZH A;  4UHU A;  5EVI C;  4Y0T A;  4LCL A;  4RYE A;  2HDR A;  2ZQ7 A;  5A92 A;  3C4P A;  2XH9 A;  4QY5 A;  2V2F F;  5E2F A;  3SH8 A;  3O87 A;  1KE3 A;  1PI4 A;  2BLS A;  1BLC A;  2ZQ8 A;  4HES A;  5KSC A;  5F1F A;  3EQV A;  4GKU A;  1MWR A;  3WS1 A;  1I5Q A;  5TGF A;  1YMX A;  2WKI A;  4FH2 A;  5HAP A;  5D3O A;  2OV5 A;  3VMA A;  4OQG A;  4OPZ A;  2P9V A;  4C6Y A;  1YT4 A;  1FSW A;  4L0L A;  1CI8 A;  4WM9 A;  1CEG A;  1O07 A;  3IXG A;  1GA0 A;  4OOL A;  2C6W B;  5FQM A;  3LEZ A;  3HUM A;  2XLN A;  4DDS A;  3OC2 A;  5BOH A;  1Y54 A;  4M3K A;  3Q1F A;  1G68 A;  3Q7V B;  4N1H A;  3NY4 A;  4BLM A;  2ZC7 A;  3N8S A;  1ERO A;  3IWI A;  3MFD A;  5CHJ A;  4PPR A;  1XX2 A;  3G32 A;  4KQO A;  2JC7 A;  4KEN B;  2WAF A;  2HDQ A;  2Y91 A;  3IT9 A;  4QD4 A;  5CRF A;  5EOE A;  1MPL A;  3OCN A;  1FR6 A;  2CC1 A;  5GLC A;  4E3I A;  4E3O A;  2ZD8 A;  4GZB A;  1WE4 A;  3V3S A;  4DKI A;  1XGI A;  4NK3 A;  2Z2M B;  3BFF A;  4WZ4 A;  4WZ5 C;  3W4P A;  4JPM A;  4EBP A;  4KZ5 A;  1ONH A;  1TEM A;  1ERM A;  4R4S A;  4FCF A;  4S2L A;  4R3B A;  3IF5 A;  1MY8 A;  4OOM A;  3IF6 B;  1KVM A;  5EE8 A;  5GHY A;  3MZF A;  2XDM A;  4OVD A;  1EI5 A;  2Y2H A;  2QMI A;  4DE0 A;  4JKT A;  3UO9 A;  5HAI A;  4UAA A;  3MKE A;  3C7V A;  5CGS A;  1IYS A;  4CJN A;  4KG5 A;  4KZ9 A;  4OQI A;  3OPP A;  2XK1 A;  4DXC A;  1ESI A;  1PWC A;  1MXO A;  2J7V A;  1L0F A;  3ZVW A;  1K56 A;  5FQ9 A;  3FZC A;  3V3R A;  1TVF A;  5FQJ A;  5DF7 A;  4XUX A;  4MBH A;  5EVL A;  1HD8 A;  1HTZ A;  4X69 A;  4QHC A;  5FI7 A;  4PM5 A;  1TDG A;  2R9W A;  3V39 A;  3ZCZ A;  3UE3 A;  1CK3 A;  3M6H A;  1VM1 A;  2OLU A;  1OME A;  1DJA A;  2UWX A;  3LY4 A;  3VP2 A;  5CGW A;  5GHX A;  2A3U A;  3SS3 A;  3AGD A;  1BLP A;  1GHP A;  1JWV A;  4N92 A;  2WGW B;  1DY6 A;  2EFX A;  1Q2P A;  4S2N A;  1K55 A;  2A49 A;  2V1Z A;  4IBR A;  4PM7 A;  2X02 A;  1MKI A;  5HAQ A;  4OP5 A;  5M18 A;  1LLB A;  4DXB A;  1K54 A;  1NYM A;  4OLG A;  2ZM8 A;  3BRM A;  5U47 A;  4P0M A;  4E3L A;  3E2K A;  4LV1 A;  2Y59 A;  4B4X A;  1K56 D;  3QNB A;  5EOO A;  1DJC A;  3V5M A;  3ZG7 B;  4UA9 A;  3SS5 A;  2H10 A;  3NBL A;  3UNW A;  4KQR A;  3SH9 A;  1Q2Q A;  1SDE A;  3BEC A;  4KZ6 A;  3UN7 A;  1H8Y A;  3M6B A;  3W4Q A;  1XA7 A;  3DTM A;  3W8K A;  3C5A A;  5M1A A;  1JVJ A;  4QJG A;  4ZTK A;  1H5X A;  1XA1 A;  4FD8 A;  3G4P A;  1I2W A;  4EWF A;  4WBG A;  2ZQD A;  3IXB A;  3GRJ A;  1ONG A;  2X71 A;  4IVK A;  1ZC2 A;  4E3J A;  2IWC A;  4DE1 A;  2R9X A;  2WZX A;  2WGV A;  3MZD A;  3N8L A;  3LCE A;  4JF4 A;  4P6B A;  3VOY A;  4OQ0 A;  4DF6 A;  4QY6 A;  1PI5 A;  1IYP A;  2E8I A;  5DTS A;  1GHM A;  4F94 A;  1SHV A;  4UA7 A;  3MXR A;  3N7W A;  2HDS A;  1ZKJ A;  1DJB A;  3IWQ A;  3VFH A;  2H0T A;  3BYD A;  4JF5 A;  4PM9 A;  5AQB A;  2DNS A;  4DE2 A;  3HUN A;  3G2Y A;  4MBK A;  1RCJ A;  2ZC3 B;  4WEK A;  2QZ6 A;  4KQQ A;  4P87 A;  4XXR A;  2WAE A;  3HLW A;  3TOI A;  3P98 A;  3VP1 A;  3G35 A;  3MXS A;  1BUE A;  1N4O A;  3IH8 A;  4K91 A;  1O7E A;  2ZQA A;  5KMW A;  1K25 A;  1W8Y A;  4S2J A;  1MWU A;  2Y2Q A;  1ES5 A;  1XP4 A;  2HP6 A;  3O3V A;  1LI0 A;  4GDB A;  5J8X A;  3NI9 A;  4HBU A;  4ID4 A;  3MBZ A;  1KGE A;  1K54 C;  4BL2 A;  3V50 A;  2G2U A;  1K6R A;  2Y2L A;  1NXY A;  2JBF A;  2JCH A;  4R4R A;  3S1Y A;  4D2O A;  3E2L A;  3OPR A;  5F83 A;  1CEF A;  1GHI A;  4E3K A;  2GDN A;  5HFO A;  4GD6 A;  5E2G A;  3TSG A;  5DTT A;  3VP4 A;  1K6S A;  3ITB A;  3ZHH A;  1PZO A;  3G31 A;  1C3B A;  2VGJ A;  3BLM A;  2H0Y A;  4N9L A;  2Y2J A;  2ZM0 A;  4ZBE A;  4YFM A;  1IKG A;  4S2I A;  3LY3 A;  5KSH A;  5FA7 A;  3G30 A;  1VQQ A;  2DCF A;  5FAP A;  2WKH A;  3UY6 A;  2FFF B;  1JWP A;  1YLP A;  1SKF A;  2Y2G A;  3MZE A;  3RXW A;  4NET A;  1MWT A;  4RX3 A;  5FQK A;  3ZDJ A;  1XXM A;  1K57 A;  3D4F A;  1LI9 A;  5FAT A;  1WYB A;  4HBT A;  5HW3 A;  4MLL A;  3VFF A;  1FCN A;  3ZVT A;  4GD8 A;  3W4O A;  4ZJ2 A;  1KDW A;  4BD1 A;  4DDY A;  4KZ7 A;  4FSF A;  1FOF A;  3HVF A;  3FV7 A;  4Y0U A;  5EUA A;  1YM1 A;  4OQH A;  4OPR A;  2EFU A;  3S4X A;  3ZNT A;  1KE4 A;  3UPN A;  1IKI A;  2ZMA A;  3BFC A;  1YLZ A;  1KGF A;  1JWZ A;  3HLC A;  4X6T A;  5AQ7 A;  4C3Q A;  5F1G A;  4U0T A;  5CHU A;  4KG6 A;  5DF8 A;  2JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...