4HEQA

The crystal structure of flavodoxin from desulfovibrio gigas
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
PKALIVYGSTTGNTEGVAEAIAKTLNSEGMETTVVNVADVTAPGLAEGYDVVLLGCSTWGDDEIELQEDFVPLYEDLDRAGLKDKKVGVFGCGDSSYTYFCGAVDVIEKKAEELGATLVASSLKIDGEPDSAEVLDWAREVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Dimeric Flavodoxin from Desulfovibrio gigas Suggests a Potential Binding Region for the Electron-Transferring Partner
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Flavodoxin
total genus 49
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4heqA00
4ZVMA 4N9QA 2HNBA 4BMPB 5B3LA 2FCRA 3F6RA 3FX2A 1TIKA 4LA4A 1YKGA 2V9CA 3B6MA 3EYWA 3B6IA 3QFCA 2BPOA 1AHNA 5LJIA 3QE2A 2QX8A 2MOKA 4QOFA 3FW1A 3ES9A 3W78A 3OWXA 3NHYA 3EDOA 4ZVNA 5LBUA 3B6JA 3UXEA 1H69A 4C76A 1YCHA 4DIKA 4U7GA 1V4BA 3O2NA 1T0IA 4PTYA 3K1YA 4Y9RA 5FUQA 1OBOA 4CF6A 4NULA 2QWXA 2QX6A 5BUCA 3OJXA 5EMNA 1DX9A 2N1MA 3LCMA 2QX9A 1CZOA 2MT9A 3ESZA 4YAUA 4YALA 4DY4A 2X2OA 3NHRA 5EAIA 3S2YA 4HEQA 1I1OA 3TZBA 1BVYF 1F4PA 1FTGA 4LTNA 1C7FA 4QODA 1VMEA 3UXHA 4ZVLA 3W79A 4ZVKA 3FVWA 2BMVA 3F90A 3K20A 3KEGA 2GSWA 3KLBA 1CZNA 4LTMA 2Q9UA 2R97A 4H2DA 1AMOA 1XYYA 3G5MA 1DXOA 2FX2A 3O73A 3P0RA 4GQIA 3U7RA 4BMOB 2KLBA 4PTZA 3NHKA 1YCGA 2MTBA 1CZLA 3JSXA 3KAPA 1CZRA 2XODA 3OX3A 5F4BA 2KQUA 1B1CA 1J8QA 4C0XA 4FGJA 1AKTA 1AKQA 5FX2A 1ZWLA 3GFSA 1JA0A 1FVXA 1FLDA 1T5BA 1XT6A 1WSBA 2R96A 1TLLA 5LVAA 4N82A 1YCFA 5F51A 2FVXA 1RLJA 1RLIA 2BF4A 2V5VA 5A4KA 1QRDA 4FX2A 1X77A 2QR2A 1AKWA 2Z9DA 3R6WA 2D5IA 1AKVA 1JA1A 3B6KA 1RTTA 3N3AC 2Z9CA 3NHPA 3L9XA 3OJWA 3TEMA 3W7AA 1OFVA 1FX1A 1CZHA 2FLVA 5FA6A 4H6PA 4J8PA 1RCFA 5F12A 3ZHOA 1J9ZA 4C14A 3ESYA 4FGKA 2M6RA 1FUEA 2OYSA 5TGZA 5B3KA 2M6SA 2HNAA 5JROA 1C7EA 3OX2A 1J9GA 2XOEA 3HR4A 1YDGA 2V5UA 4Y7CA 3NHUA 1QR2A 1H66A 4N65A 5NLLA 1QHEA 1WSWA 1SG0A 2HPVA 3FNIA 3GFQA 3NHSA 4QOEA 3U7IA 5LMCA 2QX4A 2A5LA 2BN4A 1NNI1 2WC1A 4GI5A 1XI2A 3NHLA 3OWHA 4LAFA 4QOGA 4XDGA 5ULLA 4D02A 2F1OA 2RG1A 4QOIA 6NULA 2OHIA 2QMYA 1AZLA 3GAMA 3ESXA 2Z9BA 3TE7A 4U7HA 1CZKA 1DXQA 1FLNA 1D03A 2FOXA 2MWMA 4M0CA 3OVMA 4QOHA 4ICIA 5EA2A 3N3BC 4NLLA 4LTDA 1D04A 1FLAA 3HLYA 2FZ5A 4YAWA 2W5UA 2Z98A 5NULA 1J9EA 1AKUA 1FLVA 4C0WA 3SVLA 3FJOA 3OX1A 3HA2A 5LBTA 4F8YA 3NHFA 1XYVA 2ARKA 3D7NA 4YQEA 3NFRA 1CZUA 3NHWA 1SQSA 2FAXA 2OHHA 2Q62A 3L9WA 3QFRA 4QOJA 3N39C 5LLDA 1AG9A 1AKRA 4YAOA 1KBOA 2QMZA 4CETA 3RPEA 2AMJA 4U7FA 4HS4A 3LT5A 1E5DA 1GG5A 1ZX1A 3KAQA 2ZKIA 2FZVA 4R81A 1KBQA 2X2PA 1OBVA 3NHJA 4GR9A 4OXXA 3GFRA 1D4AA 4PU0A 4ESEA 3F6SA 4YAFA 3NLLA 4FGLA 4S24A 2BZSA 1ZWKA 1BU5A 2FDXA 2OHJA 1YOBA 4Y9UA 4DILA 5LJLA 4XDHA 3F2VA 1QBGA 3W77A 1YRHA 2B3DA
chains in the Genus database with same CATH superfamily
2VHTA 2XXAB 3Q9LA 4C2TA 1X1CA 4X8LA 1DWQA 3E2IA 4FHGA 4QUHA 1QS0B 3OOWA 1TUGA 2HBYA 2JC3A 2Q1TA 3MN1A 4HLUC 4LNHA 5JNSA 2X15A 2WLSA 2P2DA 3IDFA 5ITVA 3S1AA 4EX6A 3HC7A 1D2EA 5C81A 2H1VA 1JR2A 2TMGA 3I2HA 1JEQB 5GV8A 3U6BA 1DJPA 4KQHA 2XWSA 1ZC3A 3T1OA 1BEUB 2I7VA 1KO1A 1LX6A 1ODSA 3I53A 1XEWY 1KH3A 1M74A 5DHAA 3GGOA 2FSVA 4O1HA 1F2DA 1VA4A 1TGYA 2QTNA 4YALA 3G9QA 3ZY6A 1BDJA 5SY4A 4EL5A 1R0LA 1XBTA 2Q2OA 3OTWA 4RTRA 4LF7B 1CDZA 1CJVC 3K31A 3RTDA 1CUEA 3FHOA 5CVDA 3T1TA 4AF7A 3Q4GA 1JSZA 2B94A 3SC2B 5LZ2A 3ZE6A 2WQ6A 4A0FA 4LPSA 4MP3A 4OL9A 3FWHA 4W7HA 1RJGA 1LS6A 2JFWA 4IAOA 4NCKA 3MJHA 4O2BF 1U7XA 3KOXA 4ZT7A 5J63A 5LXTF 3KHUA 3RB8A 6REQB 3KTAB 2QTVB 4JGIA 4G5SA 2D1QA 1FFAA 4YCSA 2Q3DA 1UT8A 2Q8PA 3VH2A 1N5RA 1XCMA 3P8ZA 1FP6A 1URPA 1VA5A 1KY4A 3NH9A 3Q1KA 1UT6A 2COUA 3KX2A 2J3QA 2I6UA 3BMCA 1P7VA 3H1GA 221PA 5ER6A 5AHOA 4U2CA 1JDBC 3Q2OA 1KEZA 2LV8A 5K0EA 1Y33E 3OKPA 2BH9A 2NTJA 3T1VA 1FVOA 1RADA 4CMEA 5KPDA 3D3NA 3LECA 4Q3DA 3FOZA 3RUIA 3WK4A 3WQBA 2O8FA 2P5YA 1ESNA 1P2UA 2XUAA 3HJBA 3OZAA 4OBEA 1U28C 2B30A 3AHFA 3PL1A 1HQKA 1J9GA 1A71A 1EVKA 1NJ1A 1P6QA 1QF9A 1X3SA 1M2WA 2D3WA 2WFMA 3I2FA 2B37A 4GWGA 5J23A 2PKRA 3GJ7A 2CFIA 4I1UA 3O8NA 5EIXA 1VJDA 2PH1A 2PUFA 3PL5A 4JC8A 3KKPA 4MB6A 3QEBZ 3WQRA 1U9IC 3CSDA 3IHLA 3U16A 4JCOA 1EZZA 4JLVA 2QTRA 4AT1A 1QK5A 1XK6A 1VYHA 3KJNA 1KEWA 3OZDA 5TARA 4WDQA 1FL9A 1AU9A 2V3WA 5BWLA 4JUBA 4Z3OA 4FMBB 2R8PA 3OU6A 2IUSA 1M2NA 1VRCA 3CG0A 1C2TA 3CB2A 3P9YA 3PNVA 2O5VA 3AKYA 4GMXA 3VU9B 4IHJB 2IU4A 3AI1A 4OH7A 4Z5XA 3DDUA 2GPAA 4Z99A 4OQQA 1OZAA 4FE4A 3A26A 1TX4B 3OEWA 4C0SA 1SCIA 3B5IA 2NN3C 1IDOA 2C3MA 3E48A 1HQYE 4CRWB 3GLKA 4R9NA 4AN0A 3HA3A 3KLOA 1Z5WA 1E7RA 4K86A 5F5LA 5JS8A 3A4MA 3KPWA 2NVBA 1N34B 1Z0SA 5MN6A 3ONNA 2IHUA 1V2HE 2G04A 3S1SA 1NKTA 1M2GA 4R2IA 1WXDA 2QRGA 3O03A 4YHBA 5F1YA 4Q4AB 3HMQA 3OT5A 3ZUPA 2I9KA 2ZU6A 3FIUA 4ZZ1A 3SSOA 2CXSA 4GWKA 4F60A 3NV9A 1SHTX 4UAJA 2DRIA 3X2FA 5DMXA 3WB9A 4LJ7A 4HDOB 2CJPA 1P17A 3RRZA 2X9QA 3X1MA 5FOVA 2YVQA 1DIOB 4TYQA 5ESDA 3QWBA 4INPA 4RVNA 4NZPA 4LS3A 4DV0B 3LPLA 3ABOB 4K9PA 4LMPA 4ZCPA 2Q4BA 2H1OA 5JJIA 3DEFA 4QBIA 2O8CA 1WMDA 1WW8A 3N7UA 3A1VA 2GSDA 4Y1FA 4X66B 1ZUWA 2GHIA 3TR0A 2QG6A 4W5JA 1OH7A 4TUYF 3NHZA 4TTSA 2JLXA 1Y6JA 1FCJA 3R6TA 1VIDA 4OHZA 3TGWA 3GFOA 2R86A 3VC3A 4BU1A 5BN5A 4OGFA 5DYWA 5JZVA 3AOEA 2AMFA 4QNRA 3P9PA 3IP6A 3FFWA 2HI0A 3G0OA 4L9AA 4NV3A 3SQDA 4Z1OA 3GLGA 4LY6A 3H42B 1PTKA 4E2XA 5HRUA 4L85A 1IQRA 1Y5IA 1YR7A 2P9HA 1FFSA 4K40A 1SBYA 3F6YA 1LBQA 3WGVA 5ERXA 2UZIR 3HM9A 3ETNA 3B6EA 3EA4A 3BHJA 1Z06A 1I4DD 3CV3A 1KJYA 1NPDA 1UAGA 3EWAA 3EGDA 1M7GA 1JNXX 4F3CA 2CJWA 1ISRA 1UPXA 3PGXA 2A3RA 3PDIA 2YUTA 4TROA 4MV5A 1LWOA 5LZ4A 2VPZA 2WG2A 3LH5A 2EFHB 3N59A 4MR7B 2PZJA 1J06A 2XVZA 4B6FA 4JXKA 3TINA 3PDCA 4MVYA 4HNAB 4AJNA 4EVSA 4YRDA 5KYTA 1KETA 1PFKA 1XG5A 3AP2A 3UFBA 4AKHA 4EG8A 4C4OA 1D0IA 1P3DA 3JQRA 2F67A 2WUWE 4BFTA 1X77A 1BAPA 8AT1A 5JD3A 2GA8A 2ZS8A 3DUFB 3IVMA 5LZ9A 1H3NA 5F9HA 3ICVA 3OZFA 3PG5A 4JR2A 1DUSA 3CNEA 4OAQA 3F8TA 4D2IA 2IITA 2Q2VA 3PYXA 2X1MA 3OIWA 4V2IA 1L6IA 4JJEA 5DMHA 3AEQB 2ZIGA 4IKOA 5ADVA 5F78A 2R3SA 1P5FA 4RACA 4LJ9A 5LMCA 3ZDCA 1XL0A 1FXWF 3JR7A 4ZYWA 1KOJA 2B4QA 1X7HA 1QB8A 3L82B 3NHLA 4EA6A 2JGFA 3OLCX 4DWVA 4F6CA 1U0RA 3ZU3A 3HE3A 2IBTA 3R8XA 2C8JA 4GC5A 5IH7A 4AO6A 5HTOA 2GKSA 1QPZA 3WLTA 4AVYA 2REBA 1ULTA 1OF1A 2V98A 3ZDFA 3ISJA 3I9FA 3ZX5A 4P0QB 5F2NA 3A1NA 2IS4A 2VNJA 3KYIB 1JIKA 4KIFA 2REQA 1U9YA 2ZULA 4P32A 4YI3A 3TNFA 4EJ0A 3TOSA 2NU8A 3ZWMA 4WOKA 1G6KA 5BN3B 5CBKA 1GZDA 4LXHA 4GDMA 3TEFA 3KJEA 3EF1A 1NWHA 4JGBA 4JBNA 5E9JA 4X00A 1YC5A 3HYTA 5BMVB 1SULA 1FJ2A 4F2WA 5LYYA 5EE3A 4H1TA 3MD0A 1BU8A 4R7GA 1WCIA 1W47A 2GZ3A 1GN8A 2JF0A 3FSRA 1L0BA 4OYHA 3EW9A 4UE3S 4GD3Q 4G97A 4EUNA 2PVPA 4DB4A 2GXSA 4P53A 4BO6A 5AXAA 2FSGA 1TM5E 2FW1A 4KYTA 3LP6A 2ONJA 1PRYA 2LD4A 1JG3A 2PWBA 1L7OA 2JK0A 4GOND 1YZLA 2C9ZA 1P72A 5DHUA 3S5UA 3SKVA 4QNMA 4D3SA 2WIGA 1Q0QA 1WXXA 3F2VA 1KEKA 1D1TA 2DY1A 4XWWA 1L7RA 5F35A 2CEKA 3MD9A 1K75A 4YV2A 2MJLA 1LW6E 2VT6A 1LY1A 3EGDB 2HXSA 3BIXA 3OPYI 3W8EA 3ON5A 4BQFA 3LXUX 5TB5A 1GGEA 1J5XA 3SKXA 2HCJB 4KLRA 1EK6A 4W8OA 3R5JA 1T2AA 3DMTA 1RKBA 4I3FA 4P93A 5JCXA 5P8WA 3ZY2A 4ALNA 5F98A 1W5AA 3B51X 1EQ2A 3ZG6A 1NOIA 2G9RA 3KKMA 1X1QA 2CXHA 3PDHA 3JYPA 2OGTA 2BI7A 4HWOA 5EJGA 3I28A 4FFMA 3ROXA 3T3DA 2F59A 2VJNA 3INRA 5F21A 1SCUB 1U28A 3D64A 4K9LA 4KLCA 2CK3D 2WJ4A 3TBHA 3MAGA 4ER3A 4YMUA 3QX3A 2O8EB 4BTEA 3UWDA 3C6MA 1ZD4A 4XM1A 2ZI7A 4YACA 5M5BA 3U7QB 1Z28A 1PG2A 3EE6A 3W34A 1U1DA 3FYUB 5A03A 5C3MA 4B1FA 1ONPA 3LL4A 3R0JA 3LCRA 3AIOA 5ARDA 3T1HB 4P98A 1Q84A 1U31A 3MHTA 3P2KA 4MS3A 4Y0VA 1DHTA 1UPUA 2PAAA 1E3IA 2CLKB 2VSQA 3RQSA 3K6SA 1QH8B 5SYAA 3EG9B 4BO2A 3C8UA 1JR3D 4HMOA 3V9AA 1X7YA 1T5HX 2H0RA 1FVXA 3W1EA 2UUAB 5CP8A 3AUTA 4TTQA 5EHIA 1DQYA 5FQNA 3SBXA 2V5VA 4IZ6A 3LBNA 1ULHA 2A86A 1ZLXA 4POAA 3FKSA 3O3MB 4ZGBA 3JQAD 2Z3ZA 4J1NA 2OB2A 4ZAZA 3V80A 5LMZA 1GG2A 3HJUA 1SN7A 4FFBA 4F4FA 1NVVQ 1UZUA 1RWWA 2FMIA 2JA2A 4MPTA 5FBWB 4C0KA 3R9IA 2VA9A 4LV5B 1VKRA 3L0BA 5FBKA 4MW6A 5C9ZA 4OB7A 1OA0A 4RPJA 5JPIA 3BD6A 3A9UA 1J56A 1WKVA 2FJPA 2ODEA 5JNWA 1MOZA 2I7CA 3E5RA 2QTVA 2H3EA 5IDWA 2GM4A 5IXJA 3DMTC 4X9XA 1X1DA 1ZOPA 3D1JA 5BQOA 3UOAB 4C4TA 1MOSA 2OCGA 1H3EA 2QMHA 3MF4A 1TM1E 1DC3A 1QV9A 3BPSA 3AVWA 4ZT5A 2IY9A 5IHXA 3WL3A 4Q1FA 4X71A 3RUCA 1D04A 2AJ8A 3IQIX 1AUXA 3QNWA 2VEDA 1CS0B 4I4TB 4J90A 1QHGA 4K8OA 4UDOA 1ZCBA 3EG9A 4ARIA 4DMFA 4IH1A 4J2HA 4JYPA 3I4CA 2MYUA 9MHTA 2DULA 2RFLA 5EKDA 3EZXA 3UWKA 4MGHA 3ZLVA 1CZUA 1SUEA 3FFAA 5T4BA 1Y7IA 4AUKA 5BN3A 1RE1A 1NBAA 2D0DA 3O92A 2RJ3A 2B8EA 2O54A 3CTPA 1NBOA 1P8JA 5ICFA 2QUIA 5T41A 3UHAA 1YRAA 2VG8A 4GLBA 3RAGA 2IUTA 2P69A 1R0XA 1KU0A 2FTKE 2PX4A 1K7YA 4LHEA 2OV8A 5JATA 3B3AA 1D7AA 2DHCA 1T6NA 4GKVA 4P4LA 5BVGA 3UCXA 1XZLA 3BIWA 4MP8A 1C9JA 3GJQA 4MQMA 3VU0A 2FWNA 2X7JA 2TMYA 3B85A 2QZ9A 3M3HA 2P1ZA 3G7NA 1C1HA 1H3FA 3NYQA 4H3SA 3MEQA 2G17A 2WIJA 4G4SO 3WNZA 2Y2VA 1H4TA 1CQIA 4ZMRA 2PQ2A 1RXSA 3JS5A 2RB4A 1NOJA 4ZVQA 4X62B 1VHJA 3WL7A 4E5KA 4KYVA 1OIVA 2WEKA 3CLUD 2OC9A 4LA4A 2JJ1A 4LSGA 4BO7A 1JAZA 5JO9A 3RGWS 3JATB 2N75A 1LDEA 1SB8A 2VUUA 3DDOA 5CH5A 4PTYA 1U2GC 4GWLA 1W2GA 2WU3A 1F3LA 2PGDA 2YWDA 2NO1A 1FOEB 3OWOA 4H18A 2HPHA 4HX5A 2I2WA 3I6MA 1LI5A 3MS2A 1PFQA 3FNEA 4RYLA 4U9HS 3TPFA 4C3OB 2N3ZA 4CUJA 5JJ5A 5IMSA 1A97A 1F2VA 1LPSA 2CXRA 3SYNA 4DM4A 2YQ5A 1G2OA 2BT4A 4TVBA 5EXSA 3KOOA 4COKA 4YUVA 1JT9A 4PO8A 1G19A 1W46A 3BXZA 4KGVA 4RHEA 3WWOA 4FDTA 4V03A 3T7SA 1MC8A 2X6QA 1RYFA 2BBWA 4N0EA 5HS4A 1XDSA 2B2NA 1E6MA 1ODKA 3I39X 4G3XA 1IATA 2C5AA 1E8DA 1KAGA 1IEVA 1Y3FE 1N8NA 1ZI9A 2HN9A 2VTVA 3A6FA 3CJQA 3LT4A 4FZVA 4GW3A 2DPGA 4HQNA 5C18A 3FPLA 1GD1O 2FJ0A 4FZRA 2IS1A 1DBWA 1Z7WA 1B2RA 3PYMA 4PX9A 4RKQA 4ONEA 1P2FA 1OLOA 3QKWA 3SQMA 2I1QA 3B9RA 1YONA 5B4UA 4G5OA 2NO6A 1E5VA 1GNSA 2W2MA 2I3BA 4LDPA 3TLEA 5THXA 1NNLA 3HYCA 4G86A 4A2CA 2Q1UA 1PEYA 2HQ1A 2IZ5A 3FZEA 1IY1A 4DXAA 3U7HB 2APJA 2GWHA 3KZXA 3MAAC 3RNLA 3VC2A 1PR5A 5HBGA 1ZIOA 4EVRA 1QORA 3DR3A 5A3QA 5B1HA 4CKXA 5HKKD 2V7GA 3FTQA 3BBPA 1IHUA 3PX3A 3HVRA 4DG9A 1UEIA 3DNMA 4FFWA 1US8B 2DTDA 4GXQA 2IXAA 4TQUS 4UBMA 1YIOA 1LFAA 3GZTB 2FR8C 5E9AA 5HVNA 1ZGBA 2JKVA 2Q7OE 3TE7A 1GUBA 1G8KA 3K53A 3ZNOA 3NYRA 4D0RA 2O52A 3JZDA 3WJ2A 3DF9A 3SBDA 4CIBA 3NM4A 3PYLA 1OYOA 1RBYA 5I7FA 1FSPA 2OOKA 4TV8F 1WO8A 3R75A 3KS9A 1M2VA 4S0XA 2Q3JA 3T38A 5C4IA 1FMJA 2IK8A 1NJSA 2WTXA 1XALA 4J7CA 4DCOA 3KL4A 3F0TA 4RVCA 2I2AA 1RYDA 5KYWB 1TAGA 3KB6A 3WTCA 4ZAXA 4Z6KA 1HMYA 2EZUA 2VF4X 1O57A 2BOVA 3OESA 2AF4C 1N9ZA 3CR3C 1F14A 3C6KA 3S7TA 1BN7A 2BDEA 2HGZA 2BKVA 4G0YA 4PHGA 1OWOA 2BZ0A 3O4JA 4GMHA 1AH2A 3KT8A 3E7FA 2JH3A 4E0BA 4K6MA 3IBGA 1CFJA 4P1ZA 3OLZA 4M87A 5K0JA 3W2FA 1V4BA 4G0ZA 3IRVA 5CD9A 2NNLD 3IEMA 3HV0A 2Z8ZA 2A2ZA 3E4CA 3O4RA 1GDTA 2I3GA 1WG8A 3AOEC 4AKEA 4UFPA 3ED1A 4WK4B 1Z0UA 2X2EA 4RIEA 3U7GA 4KGXA 2RG7A 4P7JA 5CVJA 1WDMA 1ZA1A 3U3KA 4B7UA 3H5NA 1VB5A 3HU2A 4B85A 1YJAA 1H8EA 1XZFA 3TNLA 3GLFE 2JIRA 3OTOB 3KQTA 1P7ZA 4G0VA 4D57A 1YMUA 2PLNA 2R4TA 5K3DA 1T9BA 4WL0A 3TZHA 3ZK7A 2QGZA 5KSWB 1VMIA 3Q2KA 3ZE9A 3BGIA 5KNCA 1MC4A 2WF6A 4XB1A 1G1AA 1ZD8A 4HEA6 3QUBA 3GGSA 1COWA 1S8AA 4R9RA 1UANA 2XYGA 1T2EA 3VTZA 3BS4A 1P91A 4BVAA 4BVEA 1F4VA 3PPIA 3GLFA 1W93A 1RQNA 1YZFA 2W4QA 1FMCA 3GNSA 3USES 1P0QA 3BWVA 4UBIA 4FHFA 3TN7A 2D0IA 3ASZA 1KY5A 3JALB 3VNAA 4NMLA 1IPEA 4EPRA 3HDYA 4TL8A 3BA1A 1KJQA 3IOYA 5I5GA 4WK6A 1Z4QA 1ZNYA 3B48A 1J2RA 3GBVA 2AKYA 2SBTA 1R3DA 2QD3A 3N53A 1AKQA 2JD0A 1R8YA 1GKLA 3P45A 4JI1B 1VYVA 3CZ9A 1GIAA 1NAIA 4HUQA 5FNZA 1P19A 2QHXA 4AKIA 2VCEA 1EU1A 1RYEA 3TZQA 3V1KA 4B33A 1WUJS 1YR3A 3JSAA 3KHKA 3R6WA 4JC0A 2P27A 4RIGA 4EG5A 1RMTA 2RHDA 1NGSA 4CCYA 5TF0A 2F4NA 2XMPA 3R1IA 4J8PA 1JU9A 1T26A 4K9QA 3GCWA 2H1RA 1IB6A 5I7EA 4NPAA 3VOTA 1CY0A 4AZ3A 1HLPA 3WGHA 4EA9A 3KSZO 1DIAA 4IS2A 2HMYB 5AJWA 2VNKA 3TK1A 5LIPA 4EAQA 4UHBA 2NZ2A 3V1YA 4LHZA 5D3KA 1L1EA 4X94A 3PRKE 3VNQA 4D02A 4QSMA 5DB4A 5DHPA 3DW3X 2DFTA 2BZ1A 4YJ2B 4C6TB 4ZTUB 1RQ2A 1CF4A 3AR3A 4B8YA 1V6CA 4C7XA 1JX6A 3QE0A 5BW8A 1HE1C 4XQEA 3TDNA 2WPDD 3FOEC 3HXOA 5G0UA 4MYTA 1UAYA 4ZCIA 4WAUA 1SZDA 2EDAA 2O2GA 1KI1A 3TOVA 4NOMA 2XMSA 3NT4A 4PS1A 4Y0NA 1YZYA 1JYSA 2VAWA 4DWJA 4IY1A 3QPBA 1W4LA 3KFVA 3OOYA 5B3AA 5YASA 1E2LA 3W6PA 5MGBA 5DSZA 5B6JA 5K8LA 4LZZA 2RGAA 1G2QA 1IB0A 1NJ6A 1PW7A 2JHGA 3R5XA 2C2YA 5IF9A 2I7DA 4CV1A 3MJSA 1PAUA 4OGWA 1ID1A 5CYPA 1P5RA 1BRTA 1KH2A 5GVSA 2JATA 4NU5A 2ROQA 4NZZA 1C9NA 1XDDA 2VJKA 3F4KA 1U3DA 4GOJA 2JD1A 4NP6A 4N39A 1Z0KA 1W59A 1N6LA 1XKQA 4O4IA 1SIWA 2C54A 1K8ZB 2GZ2A 3WXBA 3HJNA 5IJ9B 3O2QB 3ID6C 1GPYA 4IL5A 4JJAA 4NE9A 3N58A 4HN2A 1IHXA 2IS6A 2OZLA 3UPTA 2IYQA 1NMEA 3C15C 2JAXA 2WJGA 3IURA 3MCTA 3IUEA 4N49A 5BMOA 3A31A 3K0FB 1PYGA 2J6HA 4UUNA 3RYHB 4HVCA 2D8MA 1P1CA 2UU9B 1WCV1 1JEQA 2F00A 2NSYA 1GGVA 2XYVA 5EP1A 3AR6A 1A2QA 3QK7A 5JLAA 2R8XA 4RA9B 4E5YA 2P6OA 1JEDA 3FFBA 3ZWQA 5F5NA 4IZOA 4C7KA 4ZZ3A 1Q91A 4DLYA 5C7IO 5B4VA 3TRDA 4P7GA 4IQ0A 2V6BA 1YIAA 4D9BA 1YVPA 3DT9A 4BXOA 1GV0A 4HXFB 1AQLA 3UG7A 2GAJA 1AF7A 1VQ1A 4FYJA 4BPRA 1T3TA 1NA5A 4TKVA 2X4LA 4G2NA 4EFLA 3NKVA 4ZMBA 2FWAA 1PJTA 4FW9A 1T8PA 4PAOA 2VJLA 3TSYA 4ZC8A 2IYAA 4RIFA 1JAHA 1FP1D 4C3VA 3PJGA 5IJ9A 3PTLA 3L18A 3QF4A 3G79A 4TS1A 4KQGA 5DJ5A 1UOOA 4DCGA 3H17A 1VKJA 3ONDA 5AK3A 1C81A 1LBHA 1N2CE 3EASA 4GAEA 4JT8A 4RCVA 1ORRA 2D1SA 2Q8QA 4B0OA 3GC6A 3BSSA 1MDBA 2PT7A 2R96A 4YJ2A 1XL1A 3VC7A 4G0XA 3GP5A 4MV0A 1NMSA 1WLYA 5DM70 1D5CA 3OCYA 3OEEA 4I4CA 3TRJA 5C8DA 4NSNA 4ZI2A 2W8BA 4FDVA 3PFFA 4Z7NB 3QOXA 4E7OA 3OZRA 2FSUA 3LUDA 4NNJA 1EA7A 5L3VA 4F7DA 2GYVA 2QT0A 1B76A 1BX0A 4ZCMA 1Q0UA 5H02A 3MMSA 3E7WA 3R0IA 4EGQA 1MO5A 3AF2A 3OOHA 1EG2A 2C88A 1CR4A 1TEVA 3OG9A 2A88A 4HK4A 4Q1EA 5LD2C 3VGPA 5A02A 4Q4LA 3FMOB 5HF9A 1SKAA 3DKRA 1Q14A 3U7QA 1IY2A 2ATCA 2PGAA 3EZFA 1ENOA 2VDRB 3AUXA 3EMVA 3HWSA 4YBRA 3UWPA 4DMRA 1XJCA 4YV7A 1EGHA 4CTMA 5BYAA 1WZCA 2AFIB 4K1LA 2J4DA 13PKA 4F4JA 4BP8A 1BWPA 1U1EA 1V5IA 2FF5A 2XRYA 3ITNA 3E9YA 2I99A 4Q9DA 4UE2A 5F3DA 5K3CA 1Y9ZA 3SMQA 4GFDA 4I50A 4NOLA 1WCIB 1VJ0A 3MOSA 5BY2A 3OPQA 3QEMB 3A3PA 2Y1KA 5CB6A 5B58C 5EZ5A 4JODA 4JT9A 1RYZA 2FZEA 5DYTA 3RAJA 2ZE5A 1BA3A 5T4EA 5KO2A 2FGKA 3G23A 1WVGA 4HGYA 4BNTA 1M5UA 2H1WA 1G4HA 4NE7A 4V02A 3TFWA 5HHTA 2C3PA 2WVAA 2XUZA 4QPNA 1Z6YA 3CZ4A 1M73E 3H05A 4ZYZA 3UBTA 1EFTA 1G8HA 1CKEA 2ZROA 1FFXA 4X6UA 3SJ7A 1U4OA 4JBLA 5DSTA 5H3HA 1KO4A 2ZM5A 2AWNA 1Z36A 1FFDA 5EL0A 4PG7A 1YU6A 3KTAA 3JD2A 3V8BA 5AVRA 3RFUA 4LF9B 1C4XA 5FULA 3PUXA 3H2YA 1IUNA 1UBLS 1GY8A 2J4FA 5H83A 3W77A 1CRPA 5HA5A 3SZUA 1NQUA 2G0NA 2NZYA 1N4AA 3RROA 4YASA 5DBFA 2ATIA 4P81A 5HE8A 3UAZA 3ZK8A 4ENUA 2FF7A 4DV7B 1RW4A 1UEJA 2QM0A 3LXMA 4V38A 1LSOA 4OTZA 4CR8A 3DO8A 3R3SA 3I4LA 3TE6A 4DA4A 1NKSA 3W3AD 2R1TA 5A3JA 1XDUA 2QRVB 3LK6A 5K6AA 3BMQA 5I47A 1UAAA 4X7RA 2XHZA 1TI7A 3BD8A 2QWXA 2O0KA 2WV7A 1Y6RA 3RRBA 3RSLA 3RYFA 2MT9A 1M6VB 1LLQA 4D3DA 4OJMX 3FYUA 4U5XA 1ZONA 4QULA 4BQOA 3IE1A 5IC4A 1W36C 4PTLA 1SCBA 1LI4A 2AXEA 4LIPD 2AN1A 1XRLA 3IIIA 1O6BA 3HXLA 3LQ4A 1E2EA 1ZUIA 2WUEA 3NTRA 2CWWA 3JAMA 1R8XA 2D74A 4H4DA 4DQLA 2QUAA 4JMLA 4L8FA 5K6RA 2EFDB 4MV9A 3S68A 2YIDA 2OO5C 3HUDA 4B2PA 2O8CB 4L3WA 1JV2B 1NC3A 1HTBA 2GBPA 3M4YA 3A6DA 5D87A 3F5MA 1VP3A 3IP1A 3U9SA 2QGFA 2R751 3WLOA 1B1CA 1J8QA 1E69A 1I6LA 2QJWA 3ITKA 4BZXA 5CFLA 1C3EA 1E1QA 1HDIA 2RGYA 3G7SA 1NHWA 1XEFA 4IXMA 1GILA 3DHVA 2DPHA 2EJTA 4GYKA 4CXMA 4PC3A 2XQFA 1P4HA 3DXYA 2R0QC 2NVWA 1DAGA 2VQDA 2QSYA 4LECA 1RMQA 1U0HC 4M8LA 4RU1A 5AW2A 3ANMA 4KREA 1JHRA 4FNGA 2W6QA 1ULBA 4MGKR 4MV1A 4IEIA 2ANBA 3DZIA 1ORHA 3PI6A 3DXXA 2XHEA 1NVBA 3AEKA 4QVKA 1T3ZA 4CLOB 2QI9C 4C4AA 3TMYA 5FI3A 821PA 1OT5A 1PDOA 4CV2A 1VSUA 3OLWA 2C7GA 5FHRA 1J6UA 1MXFA 2W2KA 5KQLA 1KSGA 1QF6A 1OLXA 3VSCA 1VB3A 4LRXA 1X8LA 3KYJB 4W1PA 4YWHA 3GUVA 2P78A 3ZWVA 1TD9A 4EKEA 3D8HA 2JAPA 2C5SA 1QTIA 2Q50A 4HPWA 4MNTA 2LWIA 2GDZA 4UBNA 3WADA 1II0A 4M8NE 4R8MA 4AO7A 4D9CA 4CEHA 4PCUA 2CV0A 3WKEA 2YQ4A 4O0MA 2QDXA 1LPPA 2NU8B 1ZCZA 5CIWA 4XAQA 5MHTA 3QBJA 5DN9A 2ERYA 1SUWA 1ZJJA 4L7QA 3V5NA 1KO8A 4OLBA 2FAXA 1Q1EA 3KJGA 2P3SA 1JR6A 4CCWA 5BYKA 5FT9A 3OPYA 2Z6AA 3K3PA 1O89A 2VNAA 3GEHA 1G4UR 1MB4A 4RNDB 5EUMA 4CN9A 2O20A 4ZI7B 2VP6A 4ND1A 4ZALA 1GNPA 4CN8A 2ZTHA 3IP9A 3EGXA 1L1RA 1L1QA 5K8TA 4I9FA 2HZBA 4NU6A 1FYDA 4CBVA 1KFEB 1UMCB 3G2NA 4QDXA 1RHMA 3WGJA 3WL5A 5J4HA 4URXR 1W76A 3V4RA 3E1SA 5HG0A 4P84A 2QPAA 4HAYA 3R24A 4Q9NA 1RQRA 3IPYA 4H7HA 2FSFA 5D51S 3RVRA 1JEYA 4XDHA 2RGXA 2XOKA 3AUYA 4P22A 1LDYA 5FUYA 2C5GA 4A26A 5JI2E 3ETHA 3OO1A 1H5QA 4O6VA 4TWBA 3DFIA 4WCVA 5I7OA 5KI6A 5JD5A 1UMBA 3IAM1 2XOXA 1H1TA 2E87A 3CF6R 1XELA 5BOVA 2VYND 3OQ6A 2C3YA 1MZVA 1QE5A 2QTCA 3R77A 1Q6YA 4CTJA 2CJFA 1Q17A 1R12A 3F3SA 4OBBA 3PA8A 2YW9A 2QX6A 2R85A 2VJYA 2VR1A 3H1PA 4FHZA 2AMLA 1ULAA 4NKRA 2CKDA 2PFSA 3Q15C 4FINA 4YN3A 3NT2A 5IJXA 4YUZA 1N2GA 2GO1A 1STOA 2UZAA 2A1IA 1WV0A 3EQ2A 1I9CA 4Q00A 4TS4A 5AJTA 4YV0A 1X42A 2WTNA 4DIDA 4O4IB 4CMHA 4QDZA 2H6EA 4Q7LA 4CMBA 1JZSA 3FTPA 3W1WA 3MRXA 5C7YA 4GDFA 1W4CA 3GRRA 4N7RA 3AHJA 5L3ZA 4CLOA 2VDNB 3DQPA 1X14A 2DAPA 3IR5A 2AFVA 2ZJZA 3SXJA 4C6RA 1OCEA 5GMOA 1UPFA 1JDZA 2R7KA 4G65A 4ITVA 3NEAA 4KN8A 4XUDA 1FRNA 1D2RA 2ZRJA 1GRRA 5HGXA 3QYJA 4ZWNA 3O8OA 4RA9A 3KBOA 3HU1A 3L0ZA 1JKMA 4R98A 4N4AA 1IFXA 3DHYA 3UN1A 5LVAA 1P5HA 5I9TA 3AB7A 4AJ1A 1RLIA 1T5LA 1M2HA 3CYFA 4RC9A 1CY4A 4KN6A 1E7YA 1YZNA 4MUGA 3GGPA 3TEMA 4PYMA 5GVRA 3X2SA 1SCUA 1Z39A 2NVOA 4ZGGA 2GHQA 2ZAOA 4A6DA 1BYIA 1UADA 4W6ZA 5TGZA 3BZBA 4F4DA 2L19A 2C9DA 1R74A 1E0JA 1LVUA 2LBPA 1I3NA 4YT5A 2BUAA 3AEKB 1E6KA 1X1SA 3EISA 3VZRA 2I4TA 2FSSA 5JWRA 4LMRA 3NJRA 1WM1A 1WQ3A 2XT6A 3CZAA 5FUWA 4CIWA 4CKEB 4WVFA 4ARCA 2VN8A 3PQEA 3LQ2A 4CLDA 3U09A 2XCSB 2W4MA 1W4BA 1RR6A 5ULLA 3RV4A 3P94A 5B7NA 2QVBA 2PWZA 3G2PA 5CVEA 1DB3A 1ES9A 1HLDA 4NCXA 4M1OA 2Q5CA 4BMNA 5IM4A 4J49A 3RYHA 2HT1A 4K28A 3TQTA 1E0AA 2W6PA 1GSIA 4HQKA 5CXUA 4MROA 4II7A 3FSGA 1PZEA 2VXOA 3HB7A 5E4YA 1PNOA 4ITUA 4OB8A 4X1IB 1GZUA 3K35A 1KU6A 1VLMA 4DJTA 3MGAA 3VR3A 4QATA 4Z2AA 2VPPA 3KVNA 1SEVA 3JAWB 4Z7OB 3QG1A 3E9ZA 4NENA 4DMHA 5AI5A 3ZBUA 1Y63A 4QUAA 1QO7A 3RUPA 1B0ZA 1IBCA 1UFVA 1V41E 3M49A 2OORC 3IJRA 3LHIA 3FKJA 3NHJA 4GR9A 4JN6B 1JQDA 2Q5HA 4KX3A 2ZJFA 1KZGB 2KM1A 3CH4B 4HDNB 2LDBA 4A2QA 4ESEA 4RV4A 3SEAA 2VPWA 2C31A 1LWNA 2C8VA 1ZWKA 2B5VA 3QI2A 3VSDA 3E3NA 3D6TB 4N5HX 1Z37A 2QD4A 1NBME 3KUUA 4WZAA 4BFZA 1W35A 2WMDA 4OXKA 4HWRA 5BNFA 2W11A 3BJZA 4RFSB 2ZRMA 1J2EA 3NFYA 3T7DA 2QB5A 3O8QB 2DKFA 4MVXA 3UWOA 2MU1A 2YWJA 4UZFA 2ADFA 3ZV7A 1LBSA 2EJWA 3QVWA 4PZAA 4JZKA 4DR6B 4AP6A 2ID8A 1ZBDA 1QHYA 1X9HA 2EJBA 4EQZA 4J4HA 3GO4A 4LVUA 3IX7A 2OLKA 3LGAA 5A6SB 3TI7A 1TZMA 5EVCA 3WIUA 1FNDA 3KYDB 4LYEA 3NJ8A 3EPRA 1QJ4A 3ND9A 2VI5A 1MBZA 4B47A 2HL6A 3SR4A 1V1RB 4HEQA 4Y6SA 3N07A 4L6CA 1GTMA 2WWRA 4C7BA 4ENRA 3U60B 5JMTA 4CEIA 3VAYA 4DV2B 4RDXA 3UC9A 2AN3A 4F97A 3K9BA 3P0FA 1C4KA 4PZ0A 3W5CA 1THMA 4QC2A 2VSFA 3GEIA 3OCWA 1V71A 2GSWA 3WK9A 4B3JA 5A4DA 2Q9UA 4RS3A 3GR6A 2D2EA 1HL7A 1JLSA 2F3PA 4WLFA 5CHYA 5BVHA 4IFIA 4GPD1 4XFKA 2Q3CA 1EDBA 4Y67A 1T8WA 3G6KA 3IOMA 4BV3A 2JIMA 1AKTA 1S2NA 3W9BA 4B6EA 1UEXC 2XYQA 5ALVA 5I3ZA 1T36B 6YASA 3GLHE 1EE9A 1PNVA 1EI9A 1AKWA 1BDMA 2W0SA 2Z9DA 3IDAA 3NBMA 3Q3CA 5ESRA 5ABPA 3R7BA 4EDFA 2VA8A 3R3UA 3QXGA 3TRKA 4QIHA 4TYWA 2VJMA 3CLSD 4LSWA 2IX3A 3GN1A 1PBNA 3OOSA 2ZSDA 3T3IA 3EXG2 1DCTA 5I4CA 1YJQA 3K1JA 5FWXB 2GEFA 2KLHA 2VF7A 4A5OA 1WMEA 1R6VA 2ZE7A 1SK8A 3STWA 9LDTA 5LKRA 4JSRA 4NEGA 4U2FA 4ER0A 1GEEA 1LI7A 2PT5A 4HRYA 4JLAA 5F33A 1CQJB 2P1RA 2HIMA 4MUMA 1M10A 2QL9A 4CEIB 3M5CA 1JDNA 1PG5A 5AKEA 1IRIA 2PZEA 4CM7A 3D7LA 1RHQA 1W5BA 1ZVKA 3ZLTA 4UVIA 3K30A 3WSVA 1UPTA 2ZTLA 2OORA 2B6NA 1S2MA 3AY0A 1XQXA 5FBVB 2M9MA 1SBIA 3E82A 1ZU4A 5EIAA 1J2YA 3KFXA 5HZGA 1KQGA 1YB6A 2W5UA 3ETDA 1AZWA 3Q8KA 4TZ6A 3ANSA 2WSLA 4PXYA 2V7EA 3USZA 1R0YA 2ERXA 5LYJA 4F86A 4DCUA 3T7TA 3VBCA 2YXBA 4XGIA 3LT2A 2FFQA 5BURA 4MMXB 4RZ2A 5DW0A 2XX3A 3K7EA 3LHFA 4IDOA 5AXDA 2Z0MA 3A4IA 3U26A 1OHHD 1Q1AA 3SM9A 3KSBC 1WA5A 3WMXA 2VNHA 1Y8RB 1Z2PX 4CM3A 1N6RA 2COKA 2P2SA 3BFVA 4HNVA 2JGDB 1LC3A 4ZMSA 1GR1A 1W1IA 4TV9A 3R8CA 4B2IA 4RTOA 4A7PA 4AUMA 1SOMA 3PUKA 1F0NA 3IB6A 3OT1A 4HGNA 3I64A 4E33A 3S28A 4MWDA 1TCAA 2OFWA 3QVUA 4JD5A 3G2JA 1WTAA 1ZRMA 1Y1PA 4IIVA 1IZ9A 5IM5A 5JAPA 2OECA 1QLHA 3K9QO 4CF4A 4PLPA 2AMVA 2I2FA 3S2GA 1HNXB 2R68A 5JDCC 5KJ6A 3WOHA 3HJHA 1NHGA 4E4RA 1P75A 1EUCA 1MVNA 2J5RA 4RHXA 4DIKA 1KDTA 1Z63A 1EWYA 2W6OA 2CSXA 3BSWA 3WGQA 2Y0EA 3TQSA 4YRIA 1V6AA 3G2OA 3DBIA 4OHBA 5FXMA 1ZCJA 3OJXA 3DDCA 3LCMA 4NBLA 5BUZA 2ZM6B 2H5IA 3H18A 3DEZA 4OHXA 3GLGB 2GNOA 3SX2A 3DOIA 3WSWA 4J2OA 2P8SA 4RCZA 1WPGA 4RQBA 3AMVA 3CXRA 4F71A 2CLHB 3GN2A 4G67A 5M2QA 4YJ3B 2BFFB 3O75A 1MV8A 5J1TB 1KZ6A 3UQZA 2FU5C 4G0WA 1KQNA 2YS7A 4PLTA 2VS1A 1UJ6A 4Q7QA 4I36A 1XYYA 4UU8A 4TYYA 1NUHA 3DO5A 3U49A 1XTBA 3SZ3A 3DVLA 2J9FB 3NHKA 3O91A 1G20B 1D2NA 1RHRA 1MJGA 3KR9A 3U31A 2KQUA 3HYRA 1PR3A 4QWWA 2G80A 4A8JA 4Z4EA 4XYBA 2BELA 4GT1A 1JA0A 3I34X 1BHSA 2JH8A 2WF5A 1F6DA 3UQYS 3DE1X 3K0EA 2GXQA 5JRZA 2RH8A 3CHYA 3F47A 2QKYA 1I51A 1C41A 4L6IA 4TLMB 2VRWA 1W0JD 2QTAA 3IUPA 4UU0A 3OZSA 3R7WB 2R9VA 1RCFA 4X64B 4H7IA 2OOSA 2YHBA 1U7DA 2VDJA 3EAGA 4YCAA 2VJMB 4XDZA 2XOEA 3ZDRA 3W6ZA 5IKPA 4M83A 1B0AA 2AJTA 3OCJA 4RVFA 1HBJA 2CC2A 2OQ2A 3OLVA 4TLAA 3TRFA 1OPXA 3QJYA 3QG5A 3R20A 1PX0A 2BGKA 3G9XA 3PHBE 3MW8A 5CRIA 4ZYXA 3HCBA 1HE8B 3FCOA 4KLNA 2C3UA 3T4EA 2ZANA 1MN6A 4ARZB 5JCJA 2EFJA 5FAKA 3A1FA 5B4TA 2R2GA 2PANA 2XQGA 3DV9A 2Q46A 5FKJA 2WSBA 4RSMA 2C5LA 2NACA 2P6NA 4YO8A 2V58A 3BKXA 3BGOS 3Q3VA 4G5GA 4WA8A 4DEYA 4MUFA 4UM5A 1X7WB 4XGQA 4IO1A 2BM1A 2PRSA 3L7JA 2XRZA 2LE0A 3KUDA 4H7KA 2FRDC 3AERB 4YS6A 1NURA 4A5SA 4CKYA 1JIJA 2FWIA 3CW2A 1ZLYA 4G41A 1T3HA 3KB2A 2GA9A 5K3EA 4IZIA 4KKXB 1R5OA 3W3AA 3IR7A 3SWWA 1FUKA 3EEYA 4D0NA 1K6XA 4NRDA 1C3OB 1OT3A 3BJEA 2XZTA 2G5GX 2A5DA 4BKOA 3T34A 4D4LA 4WINA 5KOJA 1AUQA 3N0VA 3PKJA 1RWXA 1D6SA 3EGIA 3KCQA 4S2UA 3IMFA 4JEHA 3DKIA 4BJHB 3VYWA 1DV1A 3EXEA 1TAUA 2HUPA 3K8YA 4H15A 2OCDA 1H93A 3Q12A 4S24A 3TUIC 2BC9A 2A94A 2N9UA 3ABQB 4ITRC 1NBHA 2EOAA 2Q99A 4L9SA 5REQB 1G8JA 1XZQA 3LUGA 4MKGA 3RBAA 4AYWA 5JAMA 4MRSA 5B1IA 1NULA 2E4ZA 2OK7A 4HGOA 1IDN1 1CC1S 1Y37A 1DBRA 4I99A 4NMWA 1EFPB 1XRMA 4M88A 3JQDA 1K66A 4URHA 1S7CA 2XUKA 4IGKA 2QR3A 2WT4A 5TMBA 1S2GA 5B6IA 3GARA 1RFGE 5LYJF 3SICE 1IWPB 4KWHA 3LUAA 4G37A 4ZRMA 3L7CA 1J0AA 1DIRA 4OHCA 1CY2A 2O2EA 2GPYA 2HD4A 3BF7A 3D3WB 1KIAA 1E7MA 3LVRE 3OHSX 4YMSA 5TC4A 3V1TC 2Q5OA 2ZRAA 3K2EA 4KAFA 3VKWA 1EWKA 5KOHA 1V3QE 5LKAA 3G0HA 4ZC1A 5HJ5A 1C0EA 1P0FA 1NMXA 1G8AA 2OV6A 3FG9A 3GLVA 5KYVA 3FR8A 2IIBA 4L16A 1U02A 3HL4A 3TLKA 3R74A 4EA8A 1JP7A 1ZM7A 1G9XA 3HVHA 4IX1A 3LUKA 4MQBA 3FPBA 2J09A 1JLHA 4K9OA 4WWHA 3DG9A 4XWOA 3H8JA 3JVIA 2QTZA 1E3WB 4MVJE 3MWYW 1KPIA 3ANYB 2IYUA 3OF5A 1UMCA 2QN9A 4MEBA 3HGQA 3F90A 4GI7A 1J42A 3JQGA 3E3OA 4HNHA 2FE4A 5KYXB 2MSKA 1FDWA 2QN1A 6ABPA 4XYMA 2EATA 1J2TA 4KAJA 3WI7A 4DLUA 2BR3A 2PL9A 3NBUA 1G7SA 3L3BA 1RNLA 3BCRA 5LDGA 2A30A 2HDOA 2HTEA 3EVNA 2C59A 4FGJA 1D5WA 1YULA 4HDRB 4IUDS 3WKCA 2UV8A 1XLVA 3MELA 4WOBA 2ZYUX 5B7GA 2WJZB 5FJJA 3TW8B 2HLDD 2JIZA 3WWDA 2Z8YM 3JQQA 4AJIA 4DR5B 3ZCPA 1IOZA 3BB4A 2Q0XA 2EG9A 4X84A 2QRMA 4HT3B 2NUAA 5A7HA 3D4OA 4GBJA 4WERA 4RY2A 3SZRA 1OLXB 5JZ9A 5DZSA 3M6AA 1IM8A 2ASEA 4WKOA 5TF4A 3ROGA 2WY2D 3QYPA 1SXPA 3IQWA 2HWYA 4D0LB 1EUZA 3O8BA 3C8DA 1CLEA 3IA7A 3NHUA 4QWMA 3VO9A 1DZ3A 1NI4B 3BRWD 3HA7A 2ZIZA 5EZSA 2P2YA 1WUKS 1FDRA 2IE0A 3UAYA 4HDSB 3AR2A 4OAOA 1DG3A 2XAUA 2RK3A 1JTFA 1AA6A 2F3RA 4KEAA 4EZBA 1KJZA 1N2IA 1T34A 2O2HA 1U1CA 1Z0DA 2ZIAA 4WH0A 1O8BA 1PEDA 3H2JA 5K1ZA 3KZVA 2GJ9A 3RUFA 5LQDA 4EUFA 5B57C 1S2IA 5EQDA 1D8AA 5AO9A 2BFCA 4QG7A 1GUAA 4AMBA 4B32A 3PUHA 4I55A 3TS1A 1FLVA 5LYJB 4IXTA 4MW2A 3QUSA 1IXSB 1YUBA 5GQSA 4QVIA 3GDFA 1UWLA 4MLZA 4C6HA 5A6SA 721PA 4AQDA 2NTNA 2QZPA 2W6JA 3F96A 4FMCF 4Y98A 4ZFNA 2VPIA 1QZTA 1FSFA 1N7HA 4QLOA 2NWQA 7REQA 5J3JA 4D9HA 4C4XA 4E6EA 3BK7A 1AY0A 3GEMA 1KK3A 2JZCA 4YLEA 2EC5A 3NTUA 3FPAA 3GRVA 3NLLA 2QUZA 3NVAA 1KZ9A 2J0UB 3ZHBA 1YZ3A 4N8EA 2EGGA 2AHOA 3AIMA 2BTQB 3Q5DA 3AF6A 2FG7C 1W0KD 4ZKDA 1DLIA 2JLCA 2ZIFA 4KLAA 5HFJA 4AY3A 4DCVA 1C4WA 2R1TB 3DDSA 4MEJA 2E1PA 3QX9A 4XRRA 1E8NA 3IMEA 3W5HA 4KHPB 1IJBA 1DBIA 1GRQA 2K5UA 3IPXA 2RHLA 3TAXA 4M1TA 1TMKA 1QIHA 1V7QA 3TQCA 3Q10A 5IUNC 1RABA 2PZ8A 1CZOA 3DP9A 3KUCA 4HQ0A 4ZTZB 4FYWA 1G6OA 5SV2A 4RK0A 4ZYVA 5EHGA 2WHPA 3NZEA 4COOA 1A9QA 3VYUB 1E89A 4IOMA 1PZNA 4LBZA 1NQVA 3F5FA 4A0QA 4BBJA 4D81A 4BWFB 5LXTA 1FEZA 2YY6A 3K0AB 2DH5A 4BRUA 1P1FA 3G02A 4PLVA 2XXJA 4DIFA 5CGZA 2XOKD 2EKPA 3CVJA 1H2AS 2MSWA 2OGUA 4QBFA 5TVKA 3W6NA 5GZ3A 1PQPA 4XOIA 5DNYB 2YC2C 4LDZA 2DPYA 1OWNA 1JIVA 2DVMA 5CJPA 5MFZA 3NPAA 3IUSA 5G0TA 4HG2A 1JHMA 1VL6A 3RTGA 2HSWA 3NBFA 5A2GA 1HURA 1TOAA 4Q0MA 4O4IF 3GFVA 1T9AA 3MHPA 3RWOA 3ST7A 1Q7RA 4GNKA 1XN1A 1C4OA 1CF2O 1UIMA 2PH5A 2ZRHA 3DV0A 1KMCA 1IAVA 1SRRA 2XECA 3NUGA 4IM7A 1N4DA 4TMYA 3FVVA 5EEHA 3SOPA 3UYLA 4YFVA 4FFNA 3WHPA 5L95A 3NH6A 5L8VA 3I3SR 2YWFA 4KE9A 4C14A 4HZGA 1N5LA 1K5PA 2PT9A 3WB1A 1N9GB 1HNZB 1Z07A 1FDTA 4ZOCA 2F1IA 4JFAA 1AUPA 2I7XA 5BV1A 2D7DA 1B6TA 4MCHA 3WBKA 2OVBA 1OHHA 4BFCA 4FR0A 3EHEA 1KQOA 1ZD3A 2FRXA 1ZK1A 2HPVA 2E5WA 3CLRC 1TUEA 4YJHA 4C07A 4A3SA 1J0CA 3KAKA 3R3JA 5AUNB 1RKUA 3BDIA 4FDAA 2RG1A 3QU9A 6NULA 1H4SA 2VP4A 3T1YB 3V8VA 4EO9A 4HZUB 1Z4NA 1ISPA 5A5VA 1L2TA 1QIMA 2P77A 2G5TA 3KQPA 4V0RA 5CX1A 3SYKA 3C6BA 3L7IA 3ITDA 1J9EA 3K32A 4REQA 2IHJA 3DEYX 4DLLA 3UMYA 1I4TD 1DU4A 4EMTA 1YB2A 1LV7A 3MWLA 4OLFA 1ECPA 1T36A 4PQEA 3REFA 1OI4A 4FQ5A 4IOKA 1JTVA 2OBMA 2FG5A 4M22A 1AG9A 2WRZA 4Y3UA 2IYPA 2HQSA 5DOVA 4ES6A 3DNPA 5F9FA 3P0EA 2Y93A 3G2LA 4GICA 1APBA 2FP4B 3OF3A 5CLIA 2G3YA 3VZPA 1D0VA 4R4JA 4RM2A 5CU7A 4BY9E 2BFFA 4V3CA 2QLBA 2XQIA 1JAYA 5K0GA 4IIJA 1D4AA 3NB0A 3RQIA 2WYUA 3TLYA 1SKYE 4ZDKA 4Z9BA 2BDUA 5G3ZA 2C7QA 3PEYA 2PSDA 3DE7X 1UK6A 2E1RA 1BKSB 2WSSA 1X7WA 3WK8A 4OMCA 3LYAA 2IHTA 4N9QA 1D1PA 2H51A 4C0QC 1TQDA 3L0DA 5D01A 1YHNA 3LRTA 2WJHA 4PFQA 3CO0S 4XXHA 3QQPA 4B84A 1ZJ4A 3KHSA 2AOXA 1NIJA 1RP1A 4I8XA 4BO8A 1ML3A 5EIWA 1EFUA 1R15A 4JX8A 5A04A 2CHEA 3M6VA 4Y0AA 3AONB 1DC6A 1OREA 1WNTA 4NPHA 4P08A 3DJYA 3ZHVA 3L1KA 3HYNA 3GMDA 4UDYX 4KOEC 3CVXA 4LZOA 5AKZA 5D84A 3ZJ4A 4LN1A 1M8JA 1Z4IA 2EWVA 3NJ4A 2CXPA 1M6WA 5IDVA 3W9UA 3WQHA 1F2UB 1ILEA 1SXQA 5CA1B 1AGYA 1V8FA 3HU3A 5BVHB 4UQLA 4WDRA 5JCPA 4Y6PA 10MHA 1VMAA 4HI0E 1GGNA 1W7AA 1BMQA 4JQCA 5AJVB 4R3UC 2JGKA 3EEQA 4IIJB 4MRVA 4NFSA 1GGFA 4K0KB 4DBLC 1EFPA 4EP1A 4C5AA 4KQWA 1J00A 1RIIA 1YBFA 4ZVRA 2QN2A 4KR3A 2GDJA 4V2UA 1S3IA 4YQFA 1REQB 1OUMA 4YR9A 2QG4A 3GYBA 4CGZA 3SGLA 3J81k 3FUXA 1ZR4A 2BGUA 2EARA 2ZIXA 4ESHA 4JVMA 4ZZIA 2Q4TA 2B34A 1E3LA 3D5EA 3ND8A 4IJUA 5TEWA 2ZDQA 2B78A 3AI3A 4UKDA 2OB1A 4IHKA 2QUHA 5FTWA 2AXPA 4ZD6A 3VHXB 2V59A 3GZJA 3HY4A 1RBMA 5K6AC 4NCAA 1MFPA 3EC2A 1N2CA 4BAGA 3C6XA 1MQSA 4OKSA 1E2BA 1G4AE 1QRAA 1OXKB 2Z95A 5LB2A 2IH2A 2F3SA 1IEXA 4U3JA 5IN4A 3ER9A 1JWAB 5LD2B 1QFSA 1OD6A 2MMCA 2P5SA 5LQMA 2YNMC 2DF8A 2HQRA 1ZHOA 4UASA 4AJJA 4HDKB 1F3OA 2BFDB 4L6AA 3FTFA 1IZ7A 1XI2A 2YVAA 3UUEA 2CDBA 5ER9A 4LY9A 1XHEA 2BFBB 3KJQA 4UPDA 1RVV1 1G18A 4TMFA 3GUZA 3KTDA 4Y2SA 3RC2A 1XXLA 2FMUA 1KHHA 2QXYA 3Q3EA 3PRHA 4HWTA 5JQGA 5LNK1 1XDZA 3VNVA 3RS9A 5FV7A 4KFCA 2FSHA 3TD2A 1IUOA 2FN3A 3FFTA 1MV5A 4Y1RB 5KVQA 3WLEA 3ZWDA 2FR1A 1NE2A 1MORA 5FUQA 3RVNA 5BW4A 2BUBA 3WRXC 2JGIA 5KB3A 2OC4A 4PG5A 4AX4A 1SUDA 4NESA 1J8DA 5AHKA 3VDNB 2JFOA 4DBLE 2FYTA 3C3JA 5FBHA 2C1XA 2L17A 1NRWA 5HMMA 1YJXA 1RJ9A 1VP9A 4ZT3A 3VPGA 1XJ5A 3SZLA 1A8PA 4YJKA 1C2YA 4N5LA 4P4SB 4OQLA 2H7VA 1NL3A 2ZT8A 4BVBA 3F74A 3H9QA 4B7ZA 3EVFA 3KNZA 4AG6A 2I6FA 1XU9A 4XIJA 3WA6A 4JBHA 3PV0A 2FR8A 1E3SA 2YCLA 2E4WA 1DG9A 1SRQA 1WBJB 2OHGA 2EP7A 1M5TA 4FYKA 4KV9A 2G1UA 2GEKA 2H2IA 1NLUA 2ILVA 2G5CA 2GHRA 1CUSA 3MWDA 4DRZA 4LF4B 2Z6QA 1JHYA 1NTOA 1WOYA 4D8WA 1VBNA 3FNGA 4F21A 1K7XB 4FIDA 3K92A 2BV3A 1MB9A 4JI2B 4KZKA 3JPWA 4B3RB 1QHNA 3PUZA 4DCTA 3TXXA 3GP3A 2BMFA 1DWUA 3G89A 1JF8A 2YJ5A 3OD1A 4J7AA 1I7NA 2D5AA 1GZ5A 4CF7A 1QK4A 3SF8A 4XCXA 4OBWA 4Z4QA 4I5DA 1QC5A 2QN8A 3H7AA 2XY4A 4NNOA 5FNVB 4BNXA 2G08A 3ORFA 1S8NA 2C2HA 4OYYA 1W36D 1EH5A 2X8WA 1C7FA 1DBVO 3E23A 3QKSB 1X2BA 2Q6VA 4ZEXA 1A8QA 1CRLA 4HDSA 4QO7A 1PJBA 2OCIA 1SD5A 2JFVA 4TL7A 5FA5A 1XF9A 2FQXA 4C9BA 4S05A 1K97A 4I81A 2BFMA 4TT3D 2AK3A 1D09A 1EDEA 4F1KA 4CLEA 4WCFA 1A8HA 1T9GR 1PSDA 2QNRA 3QVOA 3THRA 2WB2A 3OZVA 4LBWA 2XCUA 1GTG1 3K09C 5DRYA 5FDFA 5IEJA 5KBYA 3WYFA 4HATA 4OOEA 3ZU6A 1MNAA 1FMTA 2QTGA 3DT8A 3MMPA 1PJAA 2I5PO 4RXMA 4WD3A 2H18A 4YA6A 2HMWA 2X0NA 4WCDA 4U1RA 3HCAA 2P6UA 3ROFA 3OETA 1R9GA 4IJVA 1XTZA 5IYZF 1MX9A 3IPAA 4QTYA 3SF0A 1PDVA 1OKKD 3NQ41 4R68A 3SF8B 5KX5B 2WABA 4RWEA 5D00A 1D2MA 2IS2A 1ZMBA 2IXDA 1W96A 5DYYA 3EGWA 1S4MA 2O1WA 3NUZA 1M2KA 2GI4A 4N7BA 3DKVA 1JEOA 2O5CA 4XSVA 1KFJB 2G82A 4IVQA 1SXJC 3GFQA 3PHGA 1MU0A 1W1UA 4FZ5A 1HT3A 1P2BA 2HAEA 1DRJA 7MDHA 1A76A 1N75A 5AJXA 3H1TA 3TW0A 3KLNA 1R8JA 1ZZGA 5CLLA 4F38A 2C29D 3B9PA 4KDFA 4DDWA 2ZUEA 1FLNA 3ROMA 1R6TA 1E4EA 1EEHA 1T10A 3D8SA 3GWZA 4Q4HB 1RDFA 3DV0B 3OTIA 4TKMA 5FOTA 4BOYA 3V4LA 2FEAA 2OGWA 4WJKB 3Q8LA 5FA8A 3FZNA 1ZEMA 1YQWA 4O2AF 2A4KA 1YS6A 4ENWA 2YFYA 3GVXA 2VHQA 2ONKA 3TW8A 4DIBA 2DH6A 1V45E 1UXGA 2F1RA 3O9VA 3NXKA 1N7JA 4G0PA 4L8WB 3K4QA 4XQ0A 1T8SA 4Q4DA 1FJGB 2ORIA 4HS4A 1Z29A 2QJRA 3LT5A 3EN0A 5J40A 4KQMA 3NXSA 4DMGA 4K9RA 2F6RA 4D3YA 4BNHA 2I91A 3LRXA 3WGLA 2XWQA 1YZHA 1NSFA 4C05A 3LU1A 1ZICA 4NBKA 4YROA 4G8DA 1GFWA 1Z83A 4M9CA 1GYPA 4HXEB 5AXBA 4B6SA 2CT8A 1GKKA 1KRHA 5KSOA 3JQEA 3JQ9A 3D3KA 3LK7A 2OCPA 3ROZA 1ND6A 2OHVA 4I9NA 4E51A 5BV0A 2O8DB 4KL8S 4P4NA 5F3WB 3FBTA 2BFNA 4LWZA 1LSSA 2RHHA 2SKCA 3T3PB 1HI9A 4ENVA 2IY8A 1Q2UA 2C82A 2C2GA 1O95D 1J2UA 1TA4A 3DGEC 1FYXA 4JEIA 3B1ZA 3M4NA 4J9UE 4PRZA 4B09A 3RRFA 2O7SA 4ZI7F 3TSCA 2OXIA 2OY0A 4NR0A 2H7YA 3IKJA 2MSEB 3PRJA 5EAIA 3S2YA 1U7OA 4JC5A 5HKOA 1TUBA 2ZLBA 2FHPA 4H0FA 2XWJI 3PNYA 4Y6OA 4I66A 1NZJA 3T15A 4IYJA 4AQ7A 2EHDA 4FIZA 3WLPA 4ND6A 1YQQA 5KHOC 1RXWA 3X3HA 2ZE6A 2I87A 1FFWA 3VSAA 4E12A 4Z51A 2P0EA 1J09A 1FYEA 2ZSAA 4OEHA 1E7WA 3I9OA 1JNYA 3QIAA 5JHGB 4BCBA 1EFDN 2WW8A 4LZNA 3UXYA 5DXJA 4CDNA 1ZGGA 3CX7A 1NXQA 4EB6A 4EMSA 3MOIA 1OFHA 1QZ3A 3N8KA 1JJFA 2JIOA 1RAFA 3MWGA 5EVJA 4BNMA 3E1GA 1PKXA 2HQBA 3B1JA 4Q4HA 1G3IA 1OB5A 3NORA 1F2UA 4GYJA 2BJHA 2MHCA 3FNFA 1T3SA 4OUKX 1JKJB 3QXCA 3WMWA 3R8FA 5AH0A 3OEHA 2ZJOA 1EBUA 1RRPA 2OK8A 4PLZA 4PZEA 3VJLA 2WU1A 2P91A 3B7GA 3GA5A 3HJRA 3SZOA 1U04A 3TMKA 1IG3A 3VMFA 4C4PA 3T5CA 2CL5A 1UKCA 4V0OA 3HPQA 1LUAA 5HZMA 1XLTA 1V35A 4UUMA 1IL0A 4NNPA 4X24A 5ALHA 5M34A 3L1UA 1SQ0A 5FTKA 2GARA 5HRCA 4YCMA 1Q3KA 3NP7A 3UXMA 3IV6A 3F6BX 4B40A 3FF1A 4QFCA 2Y1LA 2A9QA 4IIHA 4INJA 1KK0A 1IQ0A 3PPXA 4EJFA 1RC8A 1CXZA 2WD7A 2Y99A 4G5RA 4WY8A 2QRZA 3LCJA 2VKQA 3HO1A 1IZYA 1PP4A 2JRCA 2ZWMA 1MRNA 3TW4A 1ADBA 4B31A 4EYKA 3B2EA 2BJWA 3G5TA 3KVYA 5TY0A 2IKQA 5KNDH 2BRUC 2VUTA 3N0WA 3QPCA 4K46A 4LHSA 4P7KA 3BX1A 4WFIA 4Y2HA 4CFZA 1IBKB 4HNSA 1C9EA 1FFCA 2EAUA 4OGLA 1D8TA 1XMVA 2FFBA 3N2GB 2V7UA 4D79A 1JBKA 5DISB 3RFFA 1AKRA 2OTCA 3AUFA 3Q9SA 1NMYA 3RD5A 5JY1A 3M1AA 5KWJA 4N12A 1MHPA 1SPBS 1R0ZA 1NRXA 2QI9F 2IDZA 1YFZA 2WJJA 2OWDA 2CVQA 1BWRA 4G4IA 3PC8C 4Q82A 5AKIA 3I01M 4AIRA 3VV2A 1KJJA 1LTKA 2ZR0A 3IAUA 4B3SB 5J4VA 3F78A 1H6AA 4BMYA 2A9KA 3EUWA 4YRGA 4F5DA 4J9VA 5ALUA 3QBVA 2Z8YA 3DD5A 5L4NA 1R2QA 3DOEA 3ZE7A 1FIUA 4KN9S 1ORVA 4YRRA 1RWOA 2RARA 1AO0A 2PNJA 3W5JA 3WNQA 3O94A 4WTOA 2QP4A 3OA2A 3L7YA 4BO4A 4CEJA 3IELA 4YREA 4FI3C 5T57A 4YRTA 2PX6A 2HW8A 1ZH8A 1HSZA 3IAEA 2DWCA 1BTOA 2XLBA 3LYHA 3LG2A 3VZQA 1B41A 2B61A 3EDOA 1BHO1 3L7DA 3F9CA 2F4VB 1Z6AA 2WM3A 3P0HA 1L6RA 1PTJC 2RONA 5ICEA 1F8UA 4KP7A 4MAMA 4XUGB 5C31A 4BNKA 3T5AA 1HFJA 2PUJA 4XLZA 1XZPA 1NZFA 4D4KA 3V8QA 4D3FA 4HSGA 4MAAA 4KE6A 2SKEA 1K92A 3S29A 4O5AA 1AVTA 3DBLA 3PXXA 4UZEA 4J1TA 2AF3C 1PNQA 4B34A 3T3NA 4DPMA 2VOEA 4W5QA 1XTSA 4PAMA 3ZIDA 3SM3A 3HY3A 4BE4A 4EG0A 5B36A 1OU4A 1RKXA 3KC2A 1B6GA 4CMKA 3PUYA 1XO1A 5CR9A 1E1RA 2FPWA 5AI8A 5FYQA 3BDAA 4TM8A 4D98A 1DDGA 2ST1A 3K9NA 5DLYA 1BX3A 1QJCA 4BV9A 3WO1A 1DBPA 1TYBE 4BMOB 5I9NA 3W9SA 3EW7A 3DAFA 2XTAA 3OQHA 5JQGF 5CH3A 2H06A 1G60A 2P68A 2YYZA 2PV7A 1E9EA 4YK7A 4OD0A 2NV6A 3BRCA 1X38A 1QVZA 4J3NA 4DWOA 2W2QA 2C7OA 4CTOA 3QLVC 1RM5A 3I1FA 2X6TA 5T4HA 4A23A 1VLHA 2FPXA 4EW3A 3FSJX 3JVUA 2XGOA 2IC5A 4QJ4A 3RIMA 4R1QA 1I2DA 2GK3A 4LZLA 4RD6A 4GU5A 3BYZA 1CQZA 1NNUA 2YVLA 3G5AA 3Q8MA 3CRRA 4N65A 1DAKA 1GPJA 4XM0A 3FZQA 4RVHA 2Q4DA 2IIVA 2WC1A 5B55A 2AB0A 2ZPAA 1G8SA 2A5GA 2QYOA 1MH9A 4LK2A 1OFUX 4QUJA 3SR0A 1JH9A 1ZL0A 2IYSA 5CT4A 4QA9A 2X23A 1A4UA 3VR6A 4EFKA 2FOXA 3AYZB 1RRFA 2HK8A 2ZREA 1ORWA 3T5DA 4X6XA 4GI2A 3TLJA 3W4KA 3ZU2A 5A3VA 3ZCVA 4EFMA 1M1YE 3RAEC 4ZOLF 1V37A 1ABFA 4YAWA 5HRAA 3G3EA 4OREX 4ZO9A 3VKUA 1LV8A 4Q3KA 1X74A 3A4NA 1YJ5A 1Q6ZA 2BHSA 2YDXA 4FCWA 3W5BA 2BYTA 4UM7A 2QENA 3V4FA 3U61B 4RJJA 1KAOA 4PXAA 4J03A 1EX1A 4OV6B 2D3TA 1D2GA 3JQAA 1E3DA 4OQPA 1JIIA 1JKXA 4TN1A 4XGKA 4F1WA 4KPYA 3U56A 4JLNA 4YYZA 3QKSA 4M21A 1P9OA 1NJFA 3C0KA 2QRLA 5KDDA 2W0MA 4DUPA 1A96A 1XQ9A 3QTBA 4B79A 2BR4A 4QGSA 3EXHB 3MCAA 1KEVA 3P9SA 4ZQEA 4BVLA 4E2ZA 5CLGA 4EATA 3GCXA 2HF9A 3D4PA 2BE9A 3IXLA 4C03A 4Z1MD 1QQAA 2AZXA 4NYMQ 4X5OA 4MARA 1ZQ1A 1CJKC 3QKIA 4ECAA 3SDSA 2XV1A 1WDLA 3L0PA 4RTMA 2J3IA 2JJ1D 2O8DA 2H1SA 1RWPA 2C61A 1D0SA 2WJIA 3P2OA 3BMOB 4E03A 1WHSB 4RY0A 3OSZA 3JPYA 2VJQA 5JQGB 3V1NA 2QTHA 5CCBA 2M1ZA 3U62A 1F8GA 1AM4D 2W43A 1EA5A 2GF2A 1JHXA 2H4YA 3IPRA 3P4XA 1K2VN 4OKNA 2PGLA 1SOAA 2CMHA 3T41A 3TTYA 2VH1A 1GV1A 4QPPA 2MIIA 4V0LA 2ZWIA 4UUQA 1EK1A 1GAJA 5BQPA 2RMKA 3OICA 4QEZA 4KTTE 4R2HA 4BN0A 1G63A 1T5SA 2FGJA 5JAQA 621PA 4NXMB 3F3KA 1ZJZA 4O8CA 5C1OA 3HN7A 4KDCA 2ALJA 3PNSA 1NQWA 1UKAA 3H83A 1P5ZB 1RRMA 4M1MA 3TQIA 2X8JB 4ZI5A 3CC8A 3HL0A 4RPGA 4ZEWA 1XQ1A 3G88A 4L4YA 2WSSD 3FWPA 2PVSA 1A5AB 1GPUA 2DQYA 4JT2A 1E4EB 4UREA 4XB6B 1G8YA 4YT4A 4WLNA 4N48A 1JFRA 4HX2A 3WC4A 5E8RA 5FOQA 5FIUA 1RKQA 3RJ9A 1NP6A 3AVOA 3KQQA 4QVGA 4ZDWA 3I4FA 5DVZA 4F91B 1I7LA 2FEWB 1RLOA 1O94C 1XTRA 4QAJA 5GGXA 2BSQA 3GRYA 3PXUA 1JYFA 4KXLA 3FNRA 3G2KA 3WVNA 4D99A 3FYHA 5EINA 3HKEA 3AM5A 4DDHA 1O0BA 1GA1A 2ENWA 2B5WA 1ORDA 4QJBA 4KE7A 3IT3A 4M36A 5HCNA 4YXWA 4ARUA 5FWYA 4DFDA 3FLAA 3RRJA 3H16A 4AL4A 2O8NA 3ZJUA 1ZIPA 1K7EB 2VT2A 3NONA 1A72A 3IUJA 5I8WA 3E9MA 3SBOA 4BVGA 4IIFA 2OGSA 4ZVPA 1CQJA 3LWBA 4JLOA 4OHKA 1YQ9A 3TL2A 4JHXA 3B2QA 5AW0A 3B82A 2BW0A 2D8AA 2E4VA 3EDCA 2IXFA 2A5LA 2MCFA 3X2EA 2FR0A 4EPWA 3LE8A 4KNWA 1CR1A 4EJMA 1DXHA 3KKZA 4BQRA 2BH2A 2CHQA 1L5FA 1L7MA 3U9TA 9ATCA 2QW1A 4TV8A 1YF3A 1TZ2A 3G7UA 3RS2A 3QLVA 3N2KA 1AE1A 1Z4LA 2ZCUA 3GV0A 4Q1CA 1U6IA 4G1UC 5T5QA 4H7EA 1LNZA 2V6JA 2P3OA 2GN1A 3GQVA 3OZUA 1L4UA 1ENYA 5HIJA 2X3YA 3O2SB 4WCFC 4BLOA 1C9KA 4TSFA 4ND4A 3PGMA 4X6LA 1U0OC 1BCRA 2R44A 2J9YB 2FMHA 2PUDA 2QAGC 4CI9A 5L3QA 3UEOA 4E5DA 3AW9A 1TUBB 4D92A 2CLDX 2B92A 1LZLA 2W58A 3EC1A 1N36B 1TJ3A 1PR4A 4DJFC 3KAQA 3V4VB 1QYVA 3WJ7A 2H00A 4OXXA 2DJIA 3EZ6A 1DFIA 2DM6A 3PPWA 4DUGA 1KC1A 1ODFA 2ZI6A 4D6XA 2D1TA 4N6GA 3BUSA 3TDMA 3KDAA 1UK9A 1A9PA 2WUVA 1NRJB 5ILOA 1ZNQO 4L8VA 4B17A 1X7XA 1TTTA 1SVMA 3U3DA 1XCBA 4P58A 3COZA 1V7ZA 4Y9UA 3NU1A 2W93A 1CWUA 3PPVA 1F7UA 2B3DA 3A11A 3BSFA 3F1KA 4WLVA 3JWHA 1U0EA 4ZCSA 3M3DA 421PA 3QZUA 1UMDB 4M7OA 3FPFA 1Z22A 3EJ6A 3WGKA 1CJUC 1VTKA 3I72A 4IIBA 3O31A 4B6QA 5K0BA 1Z25A 2W2VA 3CNNA 3MK31 3RODA 4Q05A 1NUQA 3W78A 5AVUA 4HN4B 2GPSA 4M76B 3RRXA 2XMZA 2AG8A 4M38A 3HI6A 1PUIA 1IEWA 3MM4A 3O26A 4US0R 3SKYA 1O9GA 2EJCA 1NLZA 2BY4A 3QLJA 4PRKA 2PEZA 1ISHA 1CEXA 2NAFA 2HF2A 2P0AA 2R6AA 3PGKA 1UDBA 4J94A 5L53A 4JWTA 5B7PA 4B3MB 1COWD 2X2OA 3GNTA 3VR1A 3LUBA 4PPGA 1DAEA 1FTGA 1A9OA 4LRWA 1G20E 2J3JA 4YJHB 1TDJA 3DVSX 5E1OA 5F9MA 2IXBA 1VE9A 3BZUA 1UXHA 2JAUA 2WJYA 3ZGVA 1KY3A 3OPNA 3A4LA 2Q2QA 4MIOA 1NJ5A 3MJCA 5IDXA 1T9KA 5J1SB 1ZVVA 2QP9X 1R0WA 3OSUA 1JHOA 2J9FA 1W0JA 2O2SA 2V7PA 2Y27A 4G89A 2SKDA 3C70A 4TMXA 4CLRA 3EFEA 4Q39A 1QIIA 4X8MA 2CLLB 4I3HA 3RWMB 5K8JB 1PV2A 3JY6A 1ZWLA 3A9TA 3I1JA 5DP2A 3D81A 4Z53A 5AR1A 2I4RA 5JJKA 2BTOA 3CZMA 4OQEA 4OI2A 1NNSA 1G6Q1 4KTVE 3SP1A 2EWMA 3VNRA 4Z7JA 5CFMA 5EHZA 2ZYAA 4RJ2A 3AX6A 4L9WA 1CP3A 3INTA 2E4AA 1A9TA 2HRCA 2ZRIA 1MLDA 3RDPA 3IT1A 4BYGA 1FFYA 4D9EA 1L8OA 3EY9A 4TTTS 4WKGA 1QYXA 5JVDA 1H23A 1KXZA 3OTHA 1ZKMA 4GZ3A 5BNIA 1HYBA 3D1VA 1P2DA 2HJHA 1XRNA 3LAWA 1CIJA 1VIYA 1VPLA 4BLVA 4KKVA 1UPAA 5K0ZA 4YRLA 1LPNA 4JXZA 1MAUA 2BR5A 3R9XB 3ECAA 1U3GA 4ZCTA 2XE8A 3M82A 4PBSA 1OLUA 5EZYB 5AVXA 5TQ0B 2F3QA 3SVZA 5LQAA 1GTZA 4L78A 4MVJM 4DC0A 1V11A 1A8SA 1SUBA 2VLBA 3OVMA 3R0QA 4RO0A 1CIPA 5TVGA 3SI7A 3LV8A 3WBFA 4ZO6A 1ZK3A 2N42A 1BWQA 3CS3A 5AW4A 2WF8A 2BKEA 1LX7A 3H5AA 1PK7A 4ODIA 2IHKA 2CF5A 3KIPA 1UM8A 3OURA 4FOTA 4XJTA 3WAGA 3Q98A 3BFKA 2BFWA 3P52A 3VHLB 4CMAA 2H3HA 3B70A 2XDQA 2C95A 4W1SA 1CNMA 1I8TA 4KR0A 1JGTA 5K3BA 3M4JA 4OK5A 2BFOA 4KW7A 2JEZA 2BMWA 4WLOA 3KZCA 3CUWA 3I9V6 4L8GA 2BP7B 2GZDA 4CHTA 4CTNA 1U3VA 2C3OA 4B83A 3P26A 4TVOA 3OPXA 2H31A 3R3YA 4DZTA 2UUCB 3N2IA 2VHUA 4A0GA 5AVZA 1V7PC 1G5TA 4QTTB 2VUSA 4D8VA 4Z9XA 3QLUA 1VPDA 2P0YA 1ZK0A 4V24A 1PQUA 1R4NA 2QORA 1QIGA 2P9TA 1P7YA 3COYA 1YRHA 4UCFA 3VNBA 1U9ZA 3U3RA 3HKCA 1K6MA 2WM2A 3EBLA 3IODA 4KQ2A 4MA5A 4RZXA 3D6HA 2W2TA 3CNBA 3E3LA 4EFDA 2C4VA 1KDYA 4R5HA 4ZOQI 3ROTA 1PJ8A 1UQUA 3VR0A 5CAEA 3EFOA 4FQ7A 3UXEA 3WV4A 3B6JA 3JQPA 2QPOA 2FX3A 2WSYB 4A10A 3O2NA 1XR3A 3VJRA 1V0JA 1O9BA 3CUVA 2CNNA 4O4LB 4A92A 3C6QA 4IINA 5I5EA 1XAGA 4EKNB 3SCZA 1T2FA 4U2GA 5ALQA 4YP1A 3KALA 1ZIXA 1DJQA 3KSMA 5LMNB 1JHUA 1WKBA 4WI1A 5BWOA 1HGXA 3Q40A 4U5QA 1Q7GA 1I3MA 3HFRA 3ADCA 4LUCA 4L3OA 4DTIA 1S0UA 4NOKA 3VBEA 3WL6A 5DLDA 2J9XB 1CR0A 5CTAA 4CMEC 1TT5B 4OJKA 5EP2A 4YCBA 1V16A 2AOTA 4B3BA 2Q2WA 1PZMA 1SBTA 2G6TA 3PC8A 1DBQA 4YRMA 3H0CA 1VM6A 2I03A 2YV4A 3TEJA 4PHFA 3RJMA 1IYZA 1BDBA 1EFKA 3PFIA 5KWVA 1ZMRA 3HG7A 5TJHA 2ZJ1A 1TW3A 3DE2X 4J29A 4P2BA 3TWOA 2IYXA 4MWGA 5KOHB 3TR6A 1K98A 3COJA 5JMOA 4DM3A 1B8VA 4YMVA 1XNJA 4EHLA 3C7AA 1NDHA 1TA0A 2X4DA 3N86A 2O6HA 3P97A 4ZT6A 3WKBA 2EQBA 4CLXA 2HKIA 1T0PA 1E9SA 1BS1A 2PWAA 3VOAA 2YL2A 1CS4C 4LYYA 2WM9B 4NS1A 4RK4A 1ZGCA 1J7JA 2BKLA 3QVSA 3ZGXA 4BCDA 3RADC 1KP9A 1N2SA 2PGXA 1XZAA 3RC7A 1DPFA 3AXTA 4MVJD 4R9VA 4YY3B 5EXXA 4AURA 1HEUA 1EUQA 1RI1A 3JQGB 5KYXA 3BEDA 3KD2A 5T7BA 1Q19A 2CF6A 1RYBA 1TGVA 1YQXA 4MP6A 2JKYA 2ZRKA 3LWDA 4U6QA 5EE9A 5EMLA 5AESA 7GPBA 4YCCA 1UQTA 5K5EA 3W8NA 5HF8A 1KIFA 3IR6A 3WLLA 3WYNA 3QUAA 4TV8B 5EP3A 5JZMA 4C7VA 3GIDA 2OFXA 4MCIA 5H1YA 4PYKA 4BLQA 3B7WA 4MIYA 1KR2A 2YHIB 3ELDA 2OMEA 4HLUA 2QXTA 2PS0A 5HFNA 3ZKWA 4M7WA 3A3NA 2FZ5A 3PQ3A 5ALEA 2ZAMA 2G9UA 4N5MA 3QFFA 5DWQA 5KU1A 3IKTA 2C2MA 2LRHA 1D9XA 1GYQA 1YD7A 2V7QD 1M1ZA 1USIA 2ARKA 1BJRE 4IIGA 4TMKA 4GECA 4X92A 4ZVTA 2XMDA 1JEYB 3D8NA 3T12A 1S01A 2RJNA 4FJ2A 5DBEX 4P31A 3WTBA 4MUAA 1TADA 1VYUA 1Y4SA 3F67A 4JA0A 2YC4C 4ZIRA 1VMKA 4O3FA 3H6GA 5K8CA 4ZQFA 3VKHA 3F5QA 4EUSA 5TIIA 3C3WA 3EIOA 2X2PA 2V4ZA 1KMQA 2XF8A 2SICE 4K6GA 1QANA 3QSYA 4ZU3A 2NMVA 4N9WA 2C9MA 4A4DA 2PCLA 2GN0A 1M1NB 1NYLA 2ET6A 2F2TA 1PQWA 2IF0A 1X7XB 1CEEA 3M1YA 4MUNA 1RJWA 3E0QA 1Y1KE 1GQYA 1DADA 4LYAA 4YYEA 1YS9A 1TC2A 3IV7A 1BE8A 3BL6A 5AUQA 4ZEVA 4MOWA 5FYDA 1U80A 4LJ4A 2PKQP 3FTEA 3FZYA 4U7TB 2AUMA 3RLFA 1HL3A 3B13B 1L5QA 2WB4A 3B6IA 3KQVA 4B4UA 5AQEA 4C87A 1XPRA 2PY6A 4WASA 4JKYA 1Z7EA 3DMGA 3U44A 1P0MA 2XRMA 3ZNNA 4PNEA 2D00A 3WGUA 2QTBA 4U0JA 1PD1A 3A4YA 4TZKA 2PIAA 5JPCA 3ORYA 1KTVA 3S2IA 3ODPA 2FSPA 3DFKA 2GRAA 4EL0A 4R0MA 3VNSA 3SEQA 2C2KA 4R05A 2V7QA 2XNSA 3GBSA 4P80A 5BR1A 4HH4A 4Q7KA 1HTTA 2C4NA 4IXDA 2ZBPA 4TT8A 5DM2A 3ICCA 3VZBA 3ZOKA 2GBGA 3JQ9C 3RFTA 1JALA 2FOIA 2OXCA 3BGVA 5JYEA 1TEZA 1QH0A 1FDSA 4FGSA 4WE3A 2B3TA 3CX6A 2G06A 2DJ5A 1CUXA 4JYMA 2ZU0C 4OJTA 5TMDA 3K96A 1K4YA 4K6FA 4R3WA 1H65A 1TFUA 2PMFA 4D82A 4K81B 4M9XA 2P3LA 2QJOA 4KMMA 5ILQA 4D96A 1TJNA 3G1UA 3EIXA 3MSXA 1EQUA 3HWX1 3PX2A 5GP1A 4HAZA 3V7NA 1BN6A 2WILA 521PA 1A7AA 1RI3A 1U0LA 2IU0A 2XUHA 1EB9A 3GEPA 3RW9A 1M6EX 1CLUA 2WF7A 3UMSA 5GONB 1CUWA 3OQIA 2Y77A 1SD1A 2WAYA 3C97A 3GRCA 3HN6A 4Q19A 3FROA 4EGFA 3BCHA 1WX1A 1KQ3A 4WECA 3W5UA 1RTTA 1W581 2O7NA 1D7OA 1NUSA 3R44A 1OWLA 1XEWX 2A7XA 2AKAB 1FUYB 3DDHA 3IMKA 4RAQA 5CA1F 3C1UA 4YMTA 1E9RA 3C3PA 1USVA 1XNGA 2JI8A 3DDWA 3JCZA 3KEFA 4ARZA 4CM5A 2FW6A 1NG1A 5AVQA 5FI1B 4ZEOA 1VDMA 2CNWD 4DA9A 5FCDA 2DERA 1GUYA 4MKIA 4WV3A 1YWGO 3U5ZB 2Y9MB 1X15A 2DLDA 4PYIA 5FPHA 1LPMA 1AO3A 1EE1A 1VPEA 3A6ZA 3RVMA 3VO2A 5K03A 2B99A 4TLDA 2DQ4A 4R8RA 5B37A 2CZCA 4UU7A 2YN4A 1FB5A 1VE6A 2YYYA 2XBUA 3L8HA 4K2HA 4QUEA 3USCS 1Y4AE 1OAOC 2WHRA 3QLTA 4RPHA 1K88A 1S3GA 2A92A 2W9XA 4XJXA 2NSJA 3LT1A 1FX0A 4DLWA 3I5XA 2DU8A 1ZNWA 5THQA 5C34B 4D9JA 4F46A 1ZO8A 3CISA 2EGUA 4IFTA 1LQTA 1Y5RA 4W9RA 1EX6A 3V8RA 3EPJA 1GPDG 4ZV4A 3C74A 3QVJA 3HVUA 3NHFA 3UMRA 1O3YA 3RVQA 3HDJA 2G77B 3RRNA 4AM8A 3OAAA 3DPIA 2I4MA 3L0SA 2XT9A 3ZBPA 1YDFA 5H7XA 4JWKA 1ZD2P