4HEQA

The crystal structure of flavodoxin from desulfovibrio gigas
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
PKALIVYGSTTGNTEGVAEAIAKTLNSEGMETTVVNVADVTAPGLAEGYDVVLLGCSTWGDDEIELQEDFVPLYEDLDRAGLKDKKVGVFGCGDSSYTYFCGAVDVIEKKAEELGATLVASSLKIDGEPDSAEVLDWAREVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Crystal Structure of Dimeric Flavodoxin from Desulfovibrio gigas Suggests a Potential Binding Region for the Electron-Transferring Partner
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4heqA00
4DILA 2OYSA 5LMCA 4QOIA 3U7RA 2ARKA 1RCFA 4ESEA 3FW1A 4QOJA 4DIKA 3NHRA 3UXHA 3GFQA 2OHJA 4YAUA 4CF6A 1KBOA 3OJWA 1FVXA 3S2YA 1SQSA 1OFVA 4QODA 5EA2A 4M0CA 2QMYA 1ZX1A 4OXXA 3NHLA 5FA6A 1QR2A 5F51A 2QR2A 1D04A 4N82A 1JA1A 3OVMA 4Y9UA 3ESXA 1YCGA 4N65A 3N3AC 1AG9A 1TIKA 4QOEA 3OX1A 4YAOA 2BF4A 2A5LA 1CZOA 1YOBA 3NFRA 3F6RA 3KAPA 2BPOA 3N3BC 3OJXA 1B1CA 2FVXA 2XODA 3JSXA 2WC1A 3W7AA 3KAQA 4ZVMA 4ICIA 5LJLA 3LCMA 4DY4A 4CETA 1DXQA 1DX9A 3L9XA 1FLVA 3QFRA 4QOFA 2AMJA 2V5UA 2Q9UA 2FLVA 3N39C 4GR9A 5ULLA 1C7FA 4U7GA 2FX2A 4C0XA 1TLLA 2Z9DA 4HS4A 4XDGA 2KLBA 2FCRA 2QX4A 1J9EA 1E5DA 4BMPB 3OWHA 3B6KA 1WSWA 3F6SA 3NHSA 3W78A 4YQEA 2ZKIA 4H6PA 4HEQA 3B6JA 1T0IA 5F12A 3UXEA 1ZWKA 3RPEA 3OX3A 2XOEA 2HPVA 1CZRA 3QFCA 1YCFA 1NNI1 3ESYA 3L9WA 2QX6A 3NHYA 2MWMA 2R96A 4F8YA 4U7HA 1X77A 2FZ5A 2MOKA 1KBQA 4QOGA 2FAXA 6NULA 2F1OA 4LTMA 1AKRA 3NHKA 5BUCA 4FX2A 4FGJA 4FGKA 2R97A 5FUQA 1V4BA 1CZHA 4GI5A 4PTYA 1BVYF 4PU0A 3OX2A 2X2PA 5A4KA 1SG0A 4C0WA 1YKGA 5NULA 3K20A 2V5VA 1CZNA 2QX9A 3NHPA 1XI2A 1BU5A 1AKVA 1CZLA 4C76A 3O2NA 3FNIA 5JROA 4ZVNA 5LJIA 5LBTA 4FGLA 3GAMA 3HA2A 3QE2A 5B3LA 1QHEA 2HNAA 1FX1A 2W5UA 5F4BA 1CZKA 3D7NA 4N9QA 1CZUA 2M6SA 3KLBA 2M6RA 2HNBA 4J8PA 1J8QA 1QBGA 4U7FA 2MTBA 4ZVKA 3KEGA 1RLJA 3B6IA 3EDOA 3EYWA 3W79A 3ESZA 1QRDA 5TGZA 2KQUA 1AHNA 1OBVA 1DXOA 1JA0A 2FDXA 1FUEA 4BMOB 1AZLA 1XYYA 1AKQA 2QWXA 4Y9RA 3HR4A 1AKTA 1FLNA 4YALA 1T5BA 5LVAA 2B3DA 2RG1A 4ZVLA 3O73A 4LTDA 3TE7A 2OHIA 3ES9A 3ZHOA 5LLDA 3NHFA 1RLIA 2GSWA 3G5MA 4PTZA 3R6WA 1WSBA 4R81A 3TEMA 5NLLA 4GQIA 1F4PA 5EAIA 1D4AA 1YRHA 4YAFA 4QOHA 3LT5A 2FOXA 1AMOA 4H2DA 3F90A 2MT9A 2OHHA 5FX2A 2Z9CA 3U7IA 1C7EA 2N1MA 3NHUA 4C14A 3OWXA 4LAFA 1XT6A 1H69A 1YDGA 3FX2A 1XYVA 5EMNA 1H66A 4YAWA 3NHWA 4NULA 1YCHA 3W77A 3SVLA 4LA4A 3TZBA 1I1OA 2D5IA 1GG5A 2Z98A 3F2VA 4NLLA 1RTTA 1AKUA 1FLAA 2BN4A 3HLYA 1AKWA 2QMZA 5LBUA 2QX8A 3FJOA 2FZVA 5B3KA 4LTNA 1J9ZA 2X2OA 1OBOA 4XDHA 2BMVA 2BZSA 3FVWA 1FLDA 3B6MA 3NHJA 1D03A 1ZWLA 3P0RA 2V9CA 2Q62A 1J9GA 2Z9BA 1FTGA 3GFSA 4S24A 3K1YA 4D02A 3NLLA 3GFRA 1VMEA 4Y7CA
chains in the Genus database with same CATH superfamily
2XMSA 4DILA 1XQ6A 4I1YA 3S1LA 1E4VA 3KB2A 1C9JA 3V48A 2YS7A 1I4TD 3BHNA 4U7JA 4WAUA 3VYWA 3PQEA 4NDZA 1DU4A 1V7CA 3MCWA 2HLPA 3EZ7A 3ZWXA 2XDQB 3GGDA 2ZQZA 4NU5A 5B4VA 3WFZA 1WSAA 3QFTA 5KNBA 4U6SA 1A7AA 2GHQA 1P9LA 4NBNA 2UAGA 4EG1A 1PLJA 1BEUB 4ZV4A 2Q0QA 3I37X 5H3CA 1NI3A 3C85A 2X23A 4DF3A 3CSDA 4LY0A 2OXCA 1A98A 4O08A 4MRSA 2WKWA 3O2QB 1U9CA 4E1AA 3I04M 4O2RA 3BIWA 4D56A 4N8DA 2FMHA 3NHAA 1QVWA 2WW8A 2IXAA 3QV1A 1W44A 4UHDA 1EX6A 4O4JA 3LS2A 4X66B 5EJ5A 3GNSA 1FFSA 3LF2A 5ALQA 3ZTYA 5HQ3B 3EAFA 2PD6A 3C1AA 1ZUNA 2XA9A 3H8SA 4HPXB 4M0CA 2KWIA 4KXWA 4C4YA 2EEPA 5IXSA 4RHXA 4AO8A 3NHLA 1QR2A 4GVPA 4OSEA 3RYIA 4MMYB 1FDUA 2JBWA 5A3QA 4PGAA 2XTMA 5DN9A 2RGBA 1LUAA 2R7KA 4J1TA 1DBVO 4F4JA 2WSIA 1DC3A 2P9HA 3DEZA 4K46A 3R7NA 1ODLA 1PN3A 4UM8B 5J43A 2BEWA 2P7HA 4K6CA 4AXXA 1YA8A 1NJ6A 1ZVQA 2Z5GA 3H4IA 2YXDA 3K30A 3ZU6A 1CUXA 3DJFA 4G26A 4HAOA 3O7MA 2AB0A 4BVJA 4YQFA 4GSKA 4JL6A 3A9VA 5DX8A 5K3SA 1YL6A 2GK3A 2HC9A 5EERA 4QPNA 5F7JA 4RD2A 1MZVA 5DLQC 3CV3A 1G55A 3CUSA 2BR5A 1LWOA 3CRZA 2V6MA 1TEHA 3F3YA 4KE8A 4NZPA 4Q1BA 2X8WA 5ESWA 5FI1B 1JFTA 4JR1A 3ULKA 3G2OA 3I9LA 2MU1A 1PWEA 1E3QA 3CUWA 4UE6A 1CZOA 1NUUA 2QNRA 2AJ8A 2G09A 1VBKA 3OZFA 5LA6A 5IFLA 1PR6A 2A3NA 1FFWA 3A1FA 4D44A 4ND8B 1DIGA 1VE6A 4X94A 1ZD3A 1W4LA 2JFYA 5LFAA 2GCGA 2GT1A 1I94B 4EA7A 1WABA 2QTVA 4ZI7B 4HAUA 1OXXK 3VHXB 3VJMA 1NBEA 4WEOA 1QKKA 2Z2IA 2ZR7A 1B6GA 1GFSA 5FNZA 3L41A 2DPMA 3E05A 1PD0A 1TCVA 3AEQB 5LOVF 2NU8B 4JLWA 3GI1A 4UAUA 1AO0A 1MB9A 1UT5A 2FPWA 1OJ7A 1U1DA 2E5WA 4KLRA 4OG2A 1IJKA 1O08A 2LTAA 2H17A 1Z2CA 3Q0TA 1BYIA 1VLZA 2ZIZA 1YDMA 3EIEA 3RNOA 3JQ8B 3AGQA 1LNSA 3QGMA 1N6PA 5IVHA 1NIPA 4UUAA 5JHGB 4K26A 1EVJA 4FIZA 1TJYA 3W9BA 1M1NA 6PFKA 1O03A 1W2GA 2CLLB 2O23A 3DMRA 4IJKA 1L7NA 1JP7A 2ZYTX 4IOJA 4D8UA 3GPCA 1C7FA 2C9CA 1E2FA 3G1UA 2WOJA 3EG9B 3GV0A 3VSAA 4EX7A 2DH6A 2Q7XA 3VYSB 3GGOA 3QJ5A 2ZRCA 3O84A 3INRA 2PSEA 4H18A 1NBHA 3GP8A 5B7GA 1GXSB 4CGYA 4ZDIA 4XWYA 1Z56C 5CIWA 4GNKA 3TQHA 3HBFA 1GL9B 3NQ41 3PA6A 5J2TB 1WUJS 1H4TA 2HRRA 5ADUS 1R0RE 1RYNA 3LHDA 3PXEA 1LI5A 5I7FA 1QC5A 5E3IA 1FS6A 2ORIA 3PYMA 3AF3A 3ZK7A 5AK0A 1XTZA 3WYEA 4HEQA 1R0XA 4URFA 3MPUA 1RQLA 1Q0QA 3H1FA 2BD0A 3E2PA 3MB5A 2OAQ1 1P77A 1UFRA 4WASA 2PDAA 3CUTA 1JQLB 3SYMA 1ZWKA 2GYUA 5ALZA 2BCJQ 1A9SA 1F0YA 1M1XB 3OX3A 5DK4A 5BR7A 5C9ZA 2HV9A 3TAUA 2EZ9A 1N5OX 2QPTA 3K09C 3KZMA 3SYKA 3RTAA 2BEKA 4H1UA 1NP3A 1XGKA 4O1IA 4FS3A 2JGAA 1HA3A 3AHGA 3IQHX 3E58A 3NPAA 3NC0C 1PV4A 4UEWA 2OCXA 1K63A 1ZD9A 1W0KD 1KEEA 2EDAA 3OHMA 3VTKA 1ZVVA 4HNAB 4EG0A 2J5XA 5IHPA 4DR7B 3L6BA 1KFKB 5D3QA 3UJ7A 3VOAA 1YQGA 4DSUA 3BHJA 2XTJA 4BKMA 3LPMA 1AN0A 1OPRA 3EFEA 4Z7NB 3K6KA 3HVRA 4UTOA 3B89A 1ENPA 2P9BA 5AMXA 3LUFA 2AUNA 3KYJB 4Q4HB 3I2GA 1VKNA 5EPOA 1ZIYA 3LUGA 3OQHA 4XWOA 4W9RA 4A1FA 2C7RA 1YE8A 4CIYA 4Y18A 4AICA 2AR9A 3IDQA 1IIBA 1UC4B 1YWGO 1ZNYA 2PRZA 2QJTA 4HH1A 5KTKA 1X19A 3JU3A 1PUIA 2WSMA 5AK3A 2PLWA 5TDHA 5K3CA 2HY7A 3NATA 5T4FA 1OE0A 2ZBEA 1GPMA 2HD4A 1RW4A 2YJGA 2G67A 3KZKA 1ODKA 2P3QA 2A58A 4P0PB 5CVEA 2N9UA 4OXRA 3PPYA 4A15A 4F3YA 3S2GA 4RTLA 5M04A 1W85B 5B36A 3GZJA 1IZ9A 3LP8A 3IS3A 4HWPA 3IMKA 5E2IA 5I7SA 1JPNA 2BGKA 3AR5A 1G41A 2DC1A 2LV8A 3L18A 4WLUA 3U3OA 2VDKB 1MV8A 3G89A 3QVOA 1XRQA 3VVMA 4B8ZA 2HNKA 4ENWA 1CQIB 4CG2A 2R1VA 5HIMA 4CN8A 3DL0A 2X0RA 1D09A 1FNNA 4KOAA 4REQB 3GVHA 3HXLA 4WQMA 3GELA 2AC2A 2LCFA 3GO4A 5FAXA 1KDRA 2O3JA 1Q19A 1U1EA 4N18A 4HAZA 4K0RA 2ACEA 2SCUB 2P2SA 2ONCA 2W7TA 1BVYF 1NV8A 4MP6A 3EXEB 1Y37A 2X7JA 3DMTA 4CLOA 4PG8A 2PANA 4X7MA 2GNOA 3CLHA 1N2CA 2IU3A 4FYYA 2F55A 1M74A 1U2PA 3R8FA 3NHPA 3PZRA 1VBNA 5YASA 1JZSA 2ETXA 2GUWA 3HM2A 3D54D 1XYGA 4UTPA 2E85A 1SA0B 4MQUA 3O2NA 1TZCA 4UQOA 4E6PA 1EJ2A 4TGLA 1P1RA 1U2RA 5CT4A 1J2RA 2FQ1A 5JCPA 4BFXA 5L3SB 5E38A 2Q2NA 1UXJA 3JX9A 1ND5A 3U3XA 4DIMA 1WB5A 1KWKA 2BI7A 4R0VA 1ESEA 4IWNA 2F1JA 1GN8A 3W8NA 5JDCC 1NAIA 3GA0A 4DVJA 1FTSA 1ZUHA 1N0WA 4NATA 5FA8A 4YUVA 3UWKA 4AN1A 2R00C 3CLUD 2YVLA 1N2BA 3RTBA 3TVDA 3H3JA 1N2IA 1PJTA 3SEAA 1UKZA 3OX4A 3V9AA 2LPMA 5H82A 1UCFA 1MTZA 3NEPX 1TO6A 3NNSA 4OQYA 1DWPA 3V46A 3NCTA 4L8WB 3LQQA 3U19A 2GFIA 4Q1FA 5ECDA 2M6SA 4H15A 3LOQA 1L7MA 4LZNA 3F46A 2IHTA 1PNRA 2B34A 4DOMA 5L3QA 3EYAA 4P54A 1TW3A 1GCIA 4U7FA 4MR7B 1G8SA 3CCBA 3KTDA 4ZI2A 2AQKA 3AOGA 3JZMA 1KFCB 2HH9A 4MUFA 1P0MA 1TQ4A 2WBLC 2P75A 4HHEA 5BMVF 3SZMA 3U9SA 3ST7A 4AF7A 3PWSA 4OHOA 4YAGA 3EXHB 3DAFA 5H3LA 2NO1A 2P69A 2WFLA 2A9JA 2EDCA 5KYYB 3EPKA 2X3FA 3H04A 2AEFA 4EVQA 1QH8A 3WNCA 3T61A 1HDZA 4G2TA 3IMCA 4JL8A 1SBIA 2KQUA 4BFSA 4D9JA 3TTUA 2L82A 1VSTA 2P91A 2ZUWA 1P2VA 4RWZA 4ZO4A 5I7HA 5J2UA 3IQDB 1NXQA 4KI7A 4GUDA 1BHSA 1Q22A 4X3PA 3ZY6A 4NU0A 4PSKA 1WV1A 3TO5A 2UYHA 4MQMA 1TA4A 2A35A 4G0XA 1QHHB 2OXFA 2WEKA 3L04A 5COAA 3HR4A 3WLRA 3WX0A 3ZU3A 4CTJA 1AQJA 1R27A 5FHRA 2Z5VA 2RAFA 4X00A 2M6KA 3R24A 1ODTC 1WEHA 3MWEB 3T5CA 3VVLA 4W8HA 3OLYA 4JBNA 2FPMA 2PVSA 4OK3A 1UC9A 1J42A 2GPNA 2V9ZA 2Z58A 4CLDA 5LM3A 2YV2A 3NASA 1GLVA 1T4DA 5BN4B 2HU7A 4PYMA 1P9NA 2GCOB 1TNDA 4QWWA 4QM7A 2VTEA 3GLFA 3EY9A 4NJMA 6AT1A 4JWKA 5KCZA 1Q12A 4XPIB 4JI4B 2GLXA 2Y68A 2JI4A 3HXTA 4LV6A 5T8KC 4B45A 1DKPA 3DPIA 2UZ1A 4DLNA 4GP7A 5JJIA 2I29A 2I87A 4EVRA 4DIUA 4MJXA 2QTNA 4L5BA 1M2WA 2ZVPX 3EMKA 3OT5A 3ZXYA 4JIMA 4D4MA 5F23A 3KTAA 1Z0SA 4H35A 1Q0PA 1N1EA 4CHGA 2W70A 1MD9A 5C5DA 5DHRA 4L4SA 4RANA 2VNIA 4NMWA 3IT1A 1U9YA 4EKYA 3ZI4A 1M0TA 1WUIS 3AHDA 3EZFA 1EDDA 1TIBA 1VL0A 3HQ4O 4Q1EA 5JE8A 1I30A 5T67A 3HYTA 4G97A 4MA5A 2Y1KA 2W6OA 3QWAA 2R11A 3W9YA 5LSAA 5F7OA 3N9IA 5AM5A 2FPSA 3ZNNA 1UR5A 4K9MA 1FVHA 4LRXA 1OV4A 4WIAA 1Y3DE 5FX2A 4DADA 3IBGA 3E0XA 4EUFA 3P26A 2Z09A 4EDHA 4YUXA 2EFYA 3QX9A 5ALGA 1RPAA 4FT2A 1CG6A 3T54A 1X70A 5ILGA 3WFJA 1RKQA 5HRCA 1XT6A 1H69A 2E7ZA 2BHLA 3I3SR 3QVGB 4IHJA 2RGCA 4RHUA 1CPYA 2ZATA 4M1YA 4PLGA 4TWAA 5DCUA 5AI4A 3S29A 4F6RA 1CDDA 3F3KA 3D7MA 2NT4A 4LSMA 4EQ6B 1L5KA 3D4IA 2P2GA 3B82A 1ZIPA 3F5FA 4NU8X 4OOFA 1HTBA 1EWRA 2PX4A 2PMFA 1FC0A 2PVPA 3RODA 4YUZA 5BR8B 2Q6LA 4I50A 4QD3A 4UM5A 4MIYA 4DYDA 4N3AA 4EY7A 2IWRA 2W42A 4IMJB 3FWPA 3SKXA 3AIMA 3HZHA 3TNYA 1O8BA 4B3BA 4GKAA 1XZKA 4AULA 4WBNF 4L7QA 5KQLA 1A9TA 1N2HA 2FB9A 1E1DA 2MR6A 2Q3DA 1VCHA 3QUBA 4ND4A 2XUPA 4GOND 4P1ZA 1IVYA 3ZXXA 1BCRA 2JFVA 3LHSA 3DXXA 1Z88A 2J30A 4N5NA 4P34A 1KY2A 1E4YA 4UBJA 1JMYA 1QTIA 4W9NC 4NFHA 5TPZD 1VL8A 1T36A 2PLNA 4H77A 4TQAA 4BNYA 1J9ZA 1MRNA 3COYA 1PKEA 1OMOA 1QHFA 1VZ3A 2IYZA 2Y0DA 1OOEA 4FGUA 1DC7A 5ALVA 2RH8A 3IQGX 3K8QA 4BMVA 2PD4A 5CM2Z 1OBOA 5CG2A 4NX2A 1B4DA 2WIGA 4HYEA 1MVLA 4PG7A 3PXAA 4F4UA 4Y2JA 2D1SA 2QVXX 3PR1A 3ANYB 5FJJA 5JCOC 1G2QA 5P21A 5EJGA 4F4HA 1PUXA 2D62A 2RHGB 1NXOA 3EUFA 3UGKA 3A6PC 2EIXA 1PE0A 4C22A 1XSEA 1PZNA 2V3VA 3PPIA 4N7MA 4PLPA 2ZJ8A 1AGRA 5DHSA 3KUCA 4K9PA 5TXGA 3U4CA 4M4SA 3M6AA 3ZPXA 2JLBA 3E23A 3K94A 3U31A 4DIOA 2Z1NA 4DJTA 2GASA 1LV8A 3K71B 3QEOA 2Z8XA 3O4HA 1UMBA 4I9FA 3K0BA 3H1AA 3HU3A 5G02A 5BYAA 1LK0A 1M3SA 3DBOB 4DLSA 4K81B 5ILOA 3P9PA 1I01A 2F1RA 4Q47A 4GZLA 3RDPA 2OBMA 3RJ9A 2AK2A 2BRUA 4R2MA 4DCVA 4NENA 4QYMA 3AFHA 5C7YA 3HUTA 1GUZA 4N0PA 3SR0A 1P7CA 3F78A 4J6FA 5K6RA 1C7JA 3PUWA 2ID8A 4I3GA 4O3FA 3PTAA 2FQYA 1IUPA 4EL0A 4GI3A 3RWMB 1NXXA 3OAAD 4R8VA 4WOKA 5DGXA 1V6AA 2NUBA 4B76A 3IXLA 4U3JA 4F2PA 4YV0A 5CVDA 2GLUA 2VRBA 1BNCA 2WWFA 4OYRA 1N5IA 2C7QA 3KZNA 4KMRA 4NBKA 5BXQC 4XWAA 2Q2VA 5CLLA 1GPUA 1ZU5A 3PFKA 4DIKA 5BWBA 1LPAB 1RJWA 3O8QA 3NHRA 1J24A 2CMKA 2B4TO 3HA3A 3G2JA 5SYMA 4DV6B 5ALTA 4G9EA 1ETUA 1TKRA 1SQ6A 1XCMA 3FFTA 2UZ4A 4J4BA 2F64A 3FB4A 3OE7A 1OUMA 4NI5A 1K6JA 1RYMA 2OL4A 2WM3A 4ON9A 1NL3A 2HFJA 4DJ5X 3Q15C 4D6PA 3UT6A 2EFJA 2QMQA 1M66A 2CB0A 1E6CA 4J91A 2X0DA 3AM1A 2FN4A 1CUVA 2GBLA 5BV2P 2P6RA 2BSQA 1MO6A 4BUZA 2A78A 3TM4A 2PLAA 2RHTA 3QPCA 1DEOA 3FUTA 1EWVA 2Z5LA 3AJAA 3WQHA 2W98A 2FZKA 4ZYUA 1DBWA 2BTOA 1OFIA 3TIFA 3TZCA 2ZBGA 5BSEA 4CMJA 5CHEA 2CE7A 3RFVA 3FNHA 1GZ7A 1TM1E 1GSHA 4C3ZA 1E98A 1NVXQ 5JISA 1LPNA 1U3VA 3F47A 4KQMA 1VM6A 3I09A 1ISFA 1Y8RA 4WOPA 5E8RA 4RFLA 3SZRA 4DS3A 4YR7A 4S04A 2DWOA 4FWTA 2EQBA 1EX1A 4EI7A 3E48A 5DXFA 3EGDB 3NIDB 4P5DA 1RQPA 4GECA 2UUOA 4EGQA 3TW4A 4MYUA 4P84A 2AZ4A 5B57C 5D5HA 1DAKA 3AXSA 1J99A 3VZCA 2P41A 2IQ5A 4EI2A 2IYQA 2L17A 4Z6KA 2WSBA 1ZJWA 4A8JC 4RH1A 1YR9A 1AG9A 1FB5A 2ZSUA 4JX8A 5CJJA 5CIQA 1Y7HA 3TZKA 4F86A 3K0SA 1T9ZA 4OFWA 5CNJA 4RS3A 5HOEA 2VF7A 2K2WA 4G1FA 2ZSAA 4P31A 2QN2A 2HEIA 2HPAA 3L6DA 4IV0A 4H1TA 3KKQA 1RWKA 3DTVD 3I6MA 5JI2E 3SU8A 1NWCA 1W73A 4KLAA 4MPTA 4AN0A 2EW2A 1Q1AA 2F9FA 2PL5A 1RMQA 2OBXA 2XSZD 3PDUA 2JD1A 2AG6A 2F67A 2R5FA 2FJ0A 3BEDA 4X6LA 3W6NA 3WL7A 5EVCA 4XOUA 1ZBDA 3FMVA 3F49S 3PV0A 4WCDA 5AW0A 2YKGA 1I7PA 2HJSA 2WMDA 3KUXA 4FT4A 4HDSA 1XZJA 3CW8X 3W5VA 4GPEA 5A5GA 2B5OA 4JI2B 1CUHA 5DN6D 1X1AA 2GZMA 1YQ9A 1Q1ZA 1XIVA 4C7XA 5KTMA 4ALJA 4EJFA 4R9NA 3GJXC 3ET5A 4IV8A 5SY6A 5TR9A 4DGQA 3A26A 1WPRA 1W48A 1W19A 2VPXA 1T2UA 3Q1LA 4FI3F 4OQZA 4G2NA 2A0KA 1U90A 4RGVA 4YRCA 4Y3UA 4F6CA 1ELOA 1M75A 2GJSA 1E9DA 2AI3A 2KB0A 1E9FA 1HLFA 2PRKA 3O1LA 4GVLA 3VU9A 1R8SA 4TKVB 5CPFA 4HUTA 1J23A 2ORED 1GSIA 2BW0A 4L8FA 2OXRA 3R5HA 3C3DA 4RLQA 1QOZA 4X20A 4XYLA 1SU4A 2I4TA 2WF7A 3EOZA 3I52A 1FU7A 4KJZA 2E87A 3D5QA 2Q4OA 1RIFA 3X1WA 2GF0A 1LPPA 4FEYA 4MRRA 1D1SA 5FUYA 4C0XA 4E30A 3ZK9A 4L27A 5EQTA 4BQPA 3NETA 4HLUA 3GLUA 4HH0A 1QG6A 1VDZA 2GWHA 1PZHA 1V7PC 3JD2A 3SQXA 4DMGA 3UVEA 2PGAA 1HL3A 4BDSA 2XV1A 3E7WA 2JC3A 2WT8A 3GMSA 3KOOA 3MYRA 4I5EA 4ID3A 4TMVA 5HKLA 3RVKA 3BGWA 4IMRA 4AZ0A 4E5SA 4TUYA 6YASA 3AKCA 1IG3A 2C9DA 1EFDN 2Y0BA 4V2IA 2H0RA 4EMBA 1WTCA 1NT2A 4DNOA 1SKYB 3H1GA 4A8JB 3GEGA 4AI6A 3LX8A 1I3OA 3JR7A 2QROA 3ZZ0A 3R5SA 4BU1A 2OB1A 4YEDA 3PLNA 3U37A 4F2HA 1EE1A 5F12A 4YO7A 2OTCA 3GXBA 4P7JA 3ZE2B 4Z54A 1M0EA 3N2GA 3HU2A 1X42A 1EEXB 1PGOA 1RXCA 3JALA 1E3SA 5ED0A 1R9GA 3SEZA 1TM4E 1B2LA 3DBRA 4MUEA 4R1OA 4AP9A 3FSGA 1X0XA 2QMHA 4NS4A 5IH7A 3CUUA 3UHPA 1E8DA 2PFGA 3M9LA 2ZULA 5LMUB 3QE4A 3CB4A 1QO0D 4YP7A 1P2DA 2P2ZA 4JH0A 2HF8A 5G3ZA 3VPHA 3M4XA 2QP4A 3JD4A 4PLTA 5BNZA 4LDAA 3ZXIA 3H99A 5CBKA 4CV1A 3I32A 2GTHA 2PYZA 2RIRA 2VWGA 4RK6A 4AG6A 5BOSB 5LMZA 2ODNA 1RRGA 4YRLA 1QDUA 3S27A 4FI3C 3LG2A 1S5PA 4BP9A 2HXSA 5FDFA 3A2KA 4EY3A 1ZGBA 3LQKA 1QDLB 5ELMA 1XF1A 2Z4RA 3H4VA 3K1AB 1PV2A 4YBZA 2IV3A 1BWSA 1EQAA 1V25A 4DG5A 2O0JA 2WAAA 1BCSA 4RE6A 4GOLD 4D25A 1DRVA 4N40A 4TRNA 1E3EA 3KKPA 4KXFB 1U80A 5M5BA 1AQNA 5FLXA 4RZIA 2Q3MA 4DMMA 3REGA 4Q3AA 2CFCA 1DAGA 2AMVA 2GAJA 3DF7A 3HVJA 3LRXA 4GM4A 4YONB 4U7HA 5IT9A 4X24A 2DFKB 4MYRA 4B44A 2Q5OA 2XNKA 4FGWA 1EDOA 4MR9B 3DNPA 5AVJA 3BBPA 3SHVA 3SYLA 4E5VA 5IDXA 2UUAB 4XZ3A 3LIPA 4FSXA 1A9XB 4RBNA 2J1LA 5AWFC 1SCJA 1CUJA 4FFBA 5T4EA 1YQTA 1GY8A 4ZEVA 5CK5A 4OX9Y 2UDPA 2A33A 3HP4A 3WK9A 4BFTA 5DGIA 5ABPA 1CERA 4C6HA 3U61B 2OBFA 1OC2A 3QVJA 1V6SA 3W6ZA 2Y6VA 4LY6A 2G1UA 3IUNA 1TEVA 1DRJA 3KL2A 3WTBA 5I4IA 3RVJA 1XNGA 3U7HB 3HFJA 3GT0A 3EN0A 4JLDA 1IQRA 3UMGA 2BTEA 3FWKA 2XDYA 1N7IA 4FUTA 4DUGA 1VGQA 1G5FA 1ZNXA 3OEWA 3GDGA 4X1OA 3ZLUA 4WJKB 4CMIB 4XIJA 3GH1A 3LUCA 3BDVA 4L4YA 4GI5A 4RTSA 1DNPA 2QTBA 3QENA 3KB1A 3VQTA 4CLRB 1PVDA 1AB5A 2CXQA 4C0WA 2MYTA 5A2GA 5HPYB 5MGNA 1C4XA 5EEHA 4GLBA 3THXA 4B34A 1CY8A 3PHJA 1J4AA 5KTPA 5JH7F 1NPDA 3EB9A 3TL2A 4BAZA 4CQMA 3DA8A 1XKTA 2FXVA 2D2XA 2GKGA 1GG8A 4Q9IA 2R84A 1SIWA 1S9HA 3T35A 4EM6A 2JD2A 1AMNA 5GIOE 1WUHS 3NC1C 4OEHA 2QLLA 2ZWPA 3LO8A 2BMDA 1PL8A 3AM3A 1HEUA 1XWWA 2XBUA 2Z3ZA 3K2EA 4ZJPA 5AVZA 5E8JA 1JQBA 5CLJA 4F3KA 3SS8A 1WB4A 2AN9A 3DHNA 5GADl 5B58C 4JSRA 2NZ2A 1PDVA 2OO7A 3OZXA 4QQFA 5AJWA 5LDGA 3N8DA 1RHMA 4ZO7A 2AJTA 4LF8B 8MHTA 3PUYA 1DADA 2HF2A 2IXFA 5L4LA 5B6IA 1OBFO 3JRNA 4RTQA 4D9HA 3Q0IA 5DGHA 1FFYA 5CXUA 1NKTA 3FYDA 1ETHA 2LUOA 3MTQA 3SXPA 3ND7A 3WS7A 2DKFA 2J9FA 1WM1A 4JOBA 5JS2A 4GRAA 2WYHA 5BWNA 4MZDA 1T4CA 2WD8A 1C7RA 2K87A 3L4BA 4Q4DA 4Q03A 1T1SA 3CWQA 2BFCB 1UPAA 3KLNA 3CUYA 1CZUA 1VYTA 2OCKA 3QLJA 5DBEX 5IN5A 5BUSA 1WO8A 3F98A 2BL4A 5TEWA 3GJ6A 4KTVE 1QBGA 5L51A 1VB5A 3FHOA 4ZVKA 4LBVA 2B20A 3P20A 4R9UC 1Y9AA 3N58A 4IS2A 3ZKWB 3HV2A 1DPFA 4YRJA 1Z18A 2O3QA 2H4YA 3FYSA 1OIVA 3H9UA 4UCXA 2HADA 5KVVA 1YIOA 2HIGA 1Z5WA 4LWOA 3C97A 1NRJB 3B52X 4TN1A 5DYIA 3V1KA 4S1VA 4P4UA 2FPUA 4B48A 4J49A 1ZOLA 4UKDA 1WXDA 4G0YA 4EHIA 3IAHA 1FFAA 2QVZX 3DV2A 3GCZA 4CLEA 3A1SA 5DFAA 1U5CA 2GX6A 1POWA 4M1MA 3ROGA 3LLVA 5AR1A 4FC6A 1W6RA 1OYYA 1XKQA 4H3HB 3RK4A 3WZLA 4DCNA 1CU1A 4U2FA 4L8LA 1MNAA 1Z0ZA 3BXEA 2QOEA 1NOKA 4P7BA 2HBZA 1EFLA 1C3VA 1XJ0A 3C1OA 4HDKA 2X8AA 4PSDA 2VJMA 3VO9A 2DPXA 4J0HA 2KS6A 4YMVA 2CFOA 4NY1A 4AZWA 4DLXA 3CRVA 3IV9A 4ZOLA 1P9OA 3A6EA 3MUEA 5BW5A 1SXPA 5DRTA 4OKSA 3RIHA 3ZHUA 3ETCA 3UK6A 1EUZA 3P45A 4ZAXA 1FA9A 3NBAA 4N3CA 3TLEA 1Q2UA 2E6UX 1O54A 3KXDA 4JHLA 5JZSA 4B0PA 4IFIA 5B37A 5ALOA 1DE0A 2ANBA 3BTOA 2J3HA 3S2SA 2IHJA 3JQ9C 1AV6A 1YB2A 4YJ2A 3WBJA 1Q16A 2QT1A 2ZRLA 1FY2A 4N49A 4RACA 2BI4A 4U2CA 5SICE 2PCLA 2GD0A 1JAXA 3OJEA 4QT4A 3V1LA 5IJ0A 4LV8B 4I4LA 1NJ5A 1VI6A 3AHCA 4U00A 3ZE6A 4CRWB 4D5GA 2C7BA 5IAAA 4GQIA 1ECBA 4UFPA 2ZZNA 3EVBA 1YULA 2AN1A 2OHFA 5EXSA 3KNZA 1U1IA 4M1ZA 1SVUA 4DJFC 4MPPA 5I4CA 1B0AA 2H00A 3B20A 4WK2B 1U0HC 3GEMA 4DXDA 3DC7A 1EFVA 5U4XA 1EQUA 1LRJA 2YYSA 1Y5MA 4P82A 1YVUA 3I2HA 4AXBA 4ZGBA 4QXOA 4TL6A 3KQVA 1WUYA 1FL9A 1RXUA 1DQYA 3SQOA 2DJIA 2P6MA 4QUIA 1UANA 1YUNA 2HX1A 1UPBA 4GPAA 3HCAA 4MCIA 3A32A 4PTLA 1CJMA 1H3FA 2Q5FA 3WGKA 3LPDA 4EHNA 3PUVA 4KNWA 5GINE 3GUCA 1U1GA 3A05A 3L43A 5EZQA 1Q74A 4BC1A 1R18A 1DKMA 5KTRA 5MN4A 1E1MA 5JH7B 3HB7A 3AOEA 4NJEB 1E0JA 4F12A 4Z86A 4CEIA 4Y1GA 2G9UA 5AVUA 3O3OB 3PC7A 4PX9A 3KT6A 1C50A 4M88A 4LYHA 4MQ6A 1O96A 2FUEA 4UD2A 1KOLA 4JT4A 2DY1A 3DVQX 1AQUA 1UXIA 1UFQA 1JU9A 1WCIA 3DDCA 1DXHA 4NEHB 3U80A 5FOTA 1B3RA 1UDAA 3FMGA 4UU8A 2XB9A 2HM7A 5AOVA 3WQSB 3KJEA 1JILA 3U7QB 4NLLA 3UJ9A 1IJEA 1QS0A 3KT8A 3F9CA 4P3OA 5KUTA 2ZETA 1XD2B 4DLWA 1T9GS 3KDPA 2QY6A 1PS9A 2PS1A 5E1DA 1Z63A 4FYMA 3CA8A 4BP1A 2WHQA 2G8LA 1LS1A 1I7LA 3PK0A 1I0IA 4Q1DA 2OK7A 4YACA 4AJOA 4D3ZA 5HUQA 2C61A 3QVSA 3W2EA 1DFGA 3BA1A 4TLBA 2V6GA 5D5QA 3SDZA 4YPOA 4PLCA 1ZJ4A 3D3NA 1MOPA 3ON5A 4PZYA 4E5MA 1TK3A 3CISA 1ZCJA 3DE3X 3QTBA 5HGJA 2OV3A 4H27A 3AIOA 4E5PA 1FTQA 1U28A 5CGQB 4KNYA 5BSTA 2E48A 1MPXA 1EU1A 3WWDA 1U02A 3O74A 4N6NA 1Y9DA 3RYHB 4CMGA 2P1ZA 4CUZA 1FLDA 1FSFA 2FOIA 1JAZA 3B6MA 3TD2A 1ZWLA 1E7QA 2ZCVA 1PR4A 4KB5A 3CLSC 3HCPA 4JV5B 5F35A 5G0WA 1TQ8A 4NPHA 2W2TA 3S2EA 2ZI3A 4RHTA 4ASUD 1FJXA 4KAXA 1R4MA 5EZ5A 3L2OB 4QECA 4FMDF 2YHSA 3V7WA 1RBMA 1WKCA 2ICAA 1UF9A 3KFLA 3MLEA 4WZBA 1JPUA 4JBLA 4Z4HA 3HJNA 1P72A 4KXMA 4WX2B 4D02A 2I4RA 1L4LA 1T35A 1WMSA 3IGFA 4JVLA 5BVHB 1E66A 1Y80A 2QRPA 2X8JA 2ZAMA 4N9WA 4O2BF 3ROTA 3SG0A 1KI9A 4D6XA 2V7BA 1C14A 2B4RO 5FLEX 5GVSA 2JJ1A 3DBLA 5P8WA 3V1UA 2QHXA 3ZCTA 4CV3A 4DXAA 4AURA 5HGXA 5JZMA 2FUG6 3UCEA 1FRNA 1M2OA 1AK9A 2Y77A 5FPHA 3EG5A 3ECSA 3Q88A 4XFJA 5CYFA 2NM0A 3HO6A 2QW0X 1KAHA 2WF8A 3QX7A 4HDQB 4QDJA 4H7JA 4MYCA 4QQ8A 4K9KA 3RFFA 1V47A 2UVDA 3L8GA 1JEAA 4C29A 4WKPA 4LZOA 1YB6A 2HIAA 4MQ5A 4TXJA 2C94A 2MSWA 3D6AA 2C2OA 4FKBA 4J0EA 3LCCA 4W4TA 2AG5A 1TJ4A 2Q6OA 1ANKA 3AF5A 4P3XA 3TXYA 4BB9A 1BKSB 3MXTA 2GF9A 1CV2A 3OQ1A 4HOYA 3R6DA 3EAGA 1K8ZB 4HFRA 2H9YA 4DDTA 5AW8A 2CMGA 2XMZA 2XGMA 3PX7A 3RVOA 4A16A 5JRZA 1Q84A 4M8NE 1YJQA 1SKAA 4JUDX 4YAUA 1ZSYA 1KY4A 4PR3A 1KBOA 1Y6ZA 2J67A 2CXSA 1L8QA 2E55A 2ZTSA 3ICWA 1WXQA 4EG5A 1XLUA 4YRRA 1LJ8A 2XVAA 4JWTA 3FPCA 2JKVA 1BN7A 4QL3A 3DCYA 4O3MA 1FRZA 3DT9A 1BDMA 1IUOA 5EJ9A 2WUGA 2YY7A 3VH3A 2P27A 3CZMA 2A92A 4N0MA 1SUWA 1B93A 2I9KA 2AE2A 1BW9B 3OD1A 1NQVA 4QODA 5KDDA 2ODEA 2QY9A 2VSXA 3W6PA 5FH9A 2PGDA 1ZIOA 1UBTS 1Z0JA 3KT0A 1BRTA 4JD5A 4PYIA 1GNRA 1HDIA 1V11A 1GNVA 2D74A 2X8BA 3GGSA 1JEQB 3B1YA 2IUFA 2XVYA 4FILA 1JG6A 3ETGA 2O8EA 4RKEA 3DHVA 3EA4A 4WA8A 2MCFA 3DQZA 4X3CA 2QU7A 5BSRA 3ZHXA 1T4BA 1DV1A 3KAKA 3V2UA 3WVNA 3ADBA 3OPNA 1H1LA 1K4KA 4HCJA 2EW1A 4GFDA 3B6EA 3G0HA 2OZKA 4AMUA 5IULC 3F5MA 4FHFA 4Q3OA 3IKTA 1W2WB 3PKZA 3D5EA 2AXNA 5BT9A 3C8MA 1ACLA 2XYQA 1KERA 2XWSA 1FFXA 4MVCA 4C87A 3ZHQA 1ENZA 3T9FA 1E1CA 2OBYA 5HJ7A 4BJ5A 4M86A 4Z5XA 2A5LA 3LQRA 2FR8C 4IGKA 4E3WA 5LR6A 4DA8A 1BMFD 1M5TA 2AN4A 1Y82A 3EXFA 3PDIB 3ABIA 5K0GA 1KOGA 3EIXA 4HDMA 3KOUA 5D3KA 2I7TA 1CHDA 3VDMA 4D42A 1V0JA 2ZB3A 3L0BA 3ZCPA 5LQJA 3BWDD 4CPDA 2II6A 1XXHE 2ASEA 3ZI0A 3JSXA 1L5FA 1OY1A 1U8CB 1X3SA 2DLNA 5AW6A 1W94A 2HMUA 1WBBA 1AKMA 2JATA 2V1UA 3ND9A 1H1DA 2ZEJA 1SCNE 4RMNA 3TRIA 2H2DA 1Z5VA 3OIUA 3AHEA 3G59A 4L5CA 4CMBA 4XTCS 4RK4A 1EUQA 1O5OA 2FKNA 4X62B 3TL6A 1P7WA 4V0RA 3DKPA 4MV6A 2WHRA 1ZM3A 2FX5A 3M3PA 1T25A 2ZXEA 4IFEA 4RJKA 4TYNA 1WB6A 2J4CA 1JHRA 3HXMA 5AJTA 5ISMA 4OK6A 4ENUA 3HEMA 3U3DA 3I9NA 2P79A 4CKCB 1HK7A 1QBKC 1PS0A 4CKEB 1PYOA 5I7AA 1E3WA 3MTAA 3E9EA 4IEEA 3QLEA 5EJ2A 3FF4A 3AZQA 5KC9A 4LRQA 1AK2A 4BRWA 4CR6A 4W9MC 4TYYA 2WABA 2YFKA 2ZYAA 3LD9A 1P7PA 3LYAA 4D3DA 1UMDB 1D2HA 2PT9A 2C5LA 4WXEA 5FBQB 2HMSA 5DIFA 3TRHA 3I9KA 5EGNA 2QRJA 3G7NA 5F3DA 1DEXA 1AX9A 1PL6A 2E4UA 2F2TA 2WAYA 4UTZA 4QICA 4NP6A 2Q5LA 5HSGA 1D6JA 1U04A 3JAWB 2XCQA 4BWGA 1AO3A 1VL6A 4HQFA 5ITWA 2JK1A 2ODBA 1FSGA 1N7JA 3UG6A 1DPGA 1WSWA 4GMFA 4KXYA 4LK3A 4ER3A 4KWTA 3JWIA 4M21A 4DMCA 5J23A 5CA0F 4JUIA 5E6SA 5T64A 1L5HB 2VYVA 1MEEA 1V1MB 3PPWA 1TMOA 3EW7A 2G0NA 4NCAA 5FOXA 1T1IA 1JKFA 1R66A 4FNGA 4RW0A 4Z7OB 3SFVA 5CVTA 1NNEA 2YV5A 3MGBA 3W5BA 3S70A 3W6OA 1JHZA 1TB4A 2CVHA 3QEMA 4IFTA 3KUKA 3MTEA 4PAGA 4RVUA 3JPWA 4KZPA 4QSHA 1LA2A 5MGBA 3N8GA 2VH1A 1JDZA 3IJPA 3NHMA 5ARCA 3N53A 4A27A 5J40A 4IDPA 2FZWA 4PPYA 4JI3B 1C7QA 5CT6A 5A0TA 2HU5A 3ZIAA 1G7CA 1X7ZB 5BQ5A 3DM9B 4D7AA 3E22A 2JW5A 2Q3JA 1BX0A 1XV5A 3R09A 4FDUA 1A8HA 1YNSA 3K0CC 4JLOA 3FRIA 1GUFA 3BXXA 4IIYA 4Q02A 4UMFA 4Y1EA 5IZ4A 3MBOA 2OAGA 2YNMD 1XELA 4G0MA 4QUEA 1RM4A 3Q1KA 4LDPA 5JT1A 4AC9A 2WB2A 1MQ9A 5IBRA 5C7IO 5DB4A 1LXCA 4JK3A 3E8MA 4EGAA 4CIBA 3RM3A 4RIGA 1KFJB 3HJBA 5G1OA 3BXOA 1UFVA 3QRWA 4FCTA 1CUAA 2WU1A 1MAWA 1VB3A 2PQ2A 4RF5A 1EVLA 3U5TA 2JFOA 2O0HA 3EGIA 3WKBA 4AIIA 4BQRA 2CSXA 1JAYA 4XX0B 1UL1X 3FI0A 4XQGA 2HTEA 5KYGA 1X77A 1ZISA 2GNAA 1CFJA 1DCFA 3P96A 1MZPA 1O97C 1OB5A 4FFRA 4NL4H 1HDXA 1SH7A 2FZ5A 2ZSBA 4V0LA 3UY4A 1SR8A 3QKWA 5BSWA 3U1TA 1RYBA 3UB4A 1NUPA 3WAGA 2QPLA 4KVFA 1NVDA 4YXFA 3O8BA 3G9XA 3ZBQA 5C81A 5THXA 1GL7A 2C59A 3LRPA 5EHZA 3NP7A 3UT5A 4GF5A 1ZZEA 3V9PA 4GOOD 3HXOA 4MWTA 2HFKA 2XKBA 3CG4A 4JUAA 4XD7A 1GZ6A 1I1NA 1WY5A 3E5RA 1S7GA 1M7BA 1V37A 1H6CA 2I55A 1CFZA 1WETA 5KNCA 1PDWA 3O38A 4CDNA 1A5SB 1NW9B 4Q4CA 4PXAA 3WA6A 5GGYA 3V80A 4CMKA 3PSHA 1ORVA 1BG6A 4FGJA 5CVVA 1V5IA 4PYRA 1TD1A 2JHPA 1FVFA 2P2DA 2HCBA 1NU6A 2NYUA 1DJMA 1XCOA 1USIA 3AU8A 4R6XA 4YXWD 3ANMA 5AOBA 5CH8A 1RZRA 3L8MA 1N1DA 3BN3A 1UM9A 4L3OA 4P36A 4PAQA 1MJNA 4I4TB 3RVRA 4IINA 3VH4A 4ACBA 1GUAA 1FYDA 2H2IA 3GT4A 4HB4A 4KEAA 3H5AA 9GPBA 1JRLA 1Y7IA 2ZB4A 3TOXA 3QA3E 2WRZA 3NAMA 1OXBB 1DJQA 1Q7BA 1WIWA 3KYBA 4JQZA 5CCXA 2XZLA 3K92A 1PR2A 4F1KA 1XMOB 1THGA 2YZNA 2IH4A 1AKVA 1VJ5A 4KAAA 3SSMA 1QHIA 2UYCA 5LZ4A 3PF9A 5LXTF 8LDHA 1QHSA 1GU7A 1QKJA 3WHPA 2YCBA 4DYHA 2DPYA 3TNDA 4ZYYA 1GPYA 4YJ3A 5F7ZA 5E3HA 2H29A 2ZT7A 4YLGA 4ZFNA 2Q0HA 2P5SA 3BDIA 4ZVNA 4LYJA 4IF4A 3HKBB 4RVNA 4RD4A 2WM8A 2CDAA 2ZRPA 4LJ6A 4FDAA 1KMHA 1SXJE 1YZKA 1F48A 4PQRA 1HXHA 3AVQA 5CBPA 2CV2A 4G5RA 3TZ6A 3UC5A 2JIBA 5CJ2A 4EDFA 1R5OA 2O5RA 4NAHA 5A05A 8ATCA 3VR4H 3DEHA 1IN5A 3VV3A 1JQ5A 2NXJA 3C45A 3FWNA 4IJWA 1LVGA 3GT3A 3THYA 4TM7A 1STOA 3BWBA 1MGPA 4E2ZA 2BTQA 3CB2A 2HKIA 4YCSA 2Z0MA 1FNSA 5K1ZA 4LHYA 3O8LA 2ZM6B 1E63A 3PR3A 3QOXA 4R9VA 3ZE9A 1T9GR 3PFCA 5HF8A 3O3NB 4PZEA 5AK6A 5TNXA 2XE8A 1O0SA 1GRRA 1MJGA 1F0PA 1C9NA 3GX1A 4HWKA 1FFEA 4NBLA 3ZHCA 5ICMA 3MMNA 1RJ9B 2NYAA 2ZSDA 3IUSA 1FXSA 2EP8A 4DIEA 4OBBA 4UCFA 4NK4A 2HRCA 3BCRA 2D5LA 1C3JA 1RQ2A 1ZAKA 1HOTA 2IGTA 2CYAA 1DBQA 1F12A 1G5TA 2HRZA 3MA0A 3O4RA 4CM6A 2CNDA 3L07A 2YN4A 1QHXA 4KXLA 2H5LA 3UB2A 1X3LA 2J5RA 2QMUA 4CKZA 2FW8A 4Q3NA 1MN6A 1AHNA 1YRQA 1OBVA 3ZGVA 4BEJA 2ZFUA 3A04A 3EHDA 5AQ1A 5IJ9B 5KINB 4FPXA 2IXDA 4COKA 2PR2A 5CCBA 2OSVA 4QWMA 1V16B 5EXDA 5FL7A 3F5SA 4IW3B 4ZTUB 3QW4B 2DGDA 4CKBB 2WNIA 3Q8LA 2CKDA 2GK4A 3DDZX 1O77A 4IKOA 1QWOA 1YJ8A 4RDHA 1GZ4A 1REQA 4HQNA 3VKWA 2VK1A 2E4XA 4BQQA 4F06A 2PFSA 1SCDA 3T9EA 1MRSA 2OKCA 2HZBA 1Z5GA 2RGNC 4U9UA 3RSQA 2QRUA 3HL4A 2IUTA 4A23A 5KJ1A 1RC0A 2L69A 4WUVA 4LTDA 3LKVA 2ZPTX 2ZJ3A 5JZ9A 4M0UA 1Q7RA 5CG1A 2CF6A 4HT3B 4Z1OA 3QMWA 2BJWA 3KXIA 2GSWA 3I5UA 4G5YA 5A4FS 4QJ4A 5LD2C 1G9SA 2XIQA 1K2WA 2VKQA 3HUUA 3T12A 4YECA 4LGCA 4FHGA 1DC8A 3P4UA 5F1OA 1COWA 1NMZA 4RY9A 3L4EA 2V6JA 4B3SB 1TLFA 4MIEA 4YMIA 3UBMA 5F73A 1G3QA 2ZBVA 1G5IA 2JBAB 4HADA 2AFIB 4YJFB 4G09A 2NADA 5AOCA 4L5JA 4MXDA 3ZCVA 1ZHFA 1UC5B 4XCXA 4B6OA 5C8DA 4C0KA 1GM5A 4BXOA 2ZU6A 1RHQA 2R60A 3ZG6A 2AOTA 1Z07A 1YR8A 2WU4A 3ASVA 1JEYA 4C2UA 2CJWB 2UUPA 3CVJA 3HH8A 4MCAA 4BBJA 3KV3O 1ZMBA 4CMAA 5ITVA 2QAGA 5BN1A 1X2BA 4YV2A 4PLYA 1L7OA 3EXIB 4DGSA 2J6BA 3F90A 1T34A 2XMRA 4MEJA 5D2CA 5JBIA 4ENSA 3LU1A 1C7EA 1W8DA 1BH2A 1XHFA 3EWIA 4WD3A 5C4IA 6CHYA 2YJNA 3K3PA 2HJGA 3ZZUA 3KDAA 3DM5A 2EWMA 4ITVA 4W99A 2X0NA 3RARA 1CY6A 3OWXA 2O59A 5D1NA 2V7XA 1YQEA 3L49A 2C5SA 4ZPJA 4FFLA 2PM8A 3CE9A 3OSZA 4K6KA 1WZIA 3G23A 1CY2A 3W05A 3WDKA 4KR0A 1M8PA 2PZFA 1U0EA 2WVHA 4UMVA 1W0JA 3UWSA 1SXJD 5LXTB 1G8FA 5KNDH 1II8A 3D3JA 5JAQA 2PG3A 5J4KA 3HKDB 1G38A 2RI1A 2I4MA 5IKEA 2XE7A 5FBKA 2BEVA 1IDOA 5KQPA 4WEQA 2K4MA 1YRLA 2RJOA 1KTIA 4WZAB 1QHNA 2HO5A 3QVMA 4DAOA 5DHFA 3O8CA 3QWHA 2E4VA 3GJ3A 3G3EA 1XN4A 1QQ5A 3BERA 3EEIA 4D41A 3E9MA 1ZGGA 2QMZA 4HQKA 1SXGA 5JCJD 1VIYA 5LU8A 1L1RA 1RRPA 1M2EA 4EPYA 5GM1A 3D8RA 1ZCFA 1SK9A 3IV6A 4PS1A 4X92A 4AF6A 4BKRA 4TMKA 5B3KA 5CA1F 1I8TA 1WMEA 2RAUA 2C2YA 1U2ZA 2NVUB 4QUGA 4WERA 1UBJS 1VKZA 3QVWA 3C6ZA 4N8EA 5I7WA 2Q5IA 5LD2B 1PQ4A 2X40A 1BA2A 4OM8A 3P9SA 1SIUA 3SF0A 4BYGA 1DRWA 3IQZA 2L0XA 3QHPA 1HG0A 1GIAA 1KF0A 1P4RA 5EE0A 1E64A 3HWX1 4BVFA 1EEHA 1GD1O 1PNTA 3GVIA 5CFMA 5KC8A 1GQQA 5IYZF 4R2XA 1S4QA 1VSUA 2W2PA 3AH8A 3KD2A 4DN6A 2F3PA 3O92A 1J06A 2FSSA 1PWYE 1HQCA 2ZIEA 4E4YA 9ABPA 4I9UA 3MTIA 4YT8A 2XKAA 4RZSA 2CT8A 1A9ZA 1XPOA 4TSKA 3VR5D 3U4IA 3Q6IA 2NU8A 4C0JA 1JALA 2Z9BA 2A7QA 4RHEA 5CLQA 2D0DA 1K4YA 5JD6A 4LYAA 3T3EA 1KJIA 5BN3B 3RSZA 4IIFA 2B94A 3K1YA 3QMPA 4K9SA 3NLLA 1R5BA 2B1GA 1ZK1A 4M2LA 1Y1KE 4A2CA 3MUNA 4LYGA 2J9RA 5DNCA 1PW5A 2H7YA 5ENVA 1ULSA 4KP7A 2RI6A 2BBWA 4FB5A 2R9VA 1YS2X 2ZRNA 4OQEA 3CUEF 2GB4A 4HXYA 5LMCA 4G5OA 1C80A 4Q34A 4OY3A 1YB5A 2ZIXA 1CJBA 4Q3LA 1CULC 3CX3A 2ZZMA 1KVRA 2RGUA 3KPWA 4YP1A 1DKLA 3EGXB 2TS1A 4R6WA 1KQNA 1LSJA 1SVOA 2QM0A 3CYFA 4QUHA 3ME5A 3AVTA 1A8SA 5D00A 4R31A 3IYLW 4P98A 2I1QA 2JFFA 3AUUA 1YZVA 3WAJA 3IPAA 4B40A 2CC2A 1XZHA 1Z5PA 4KNVA 2ZJ5A 3BWMA 4G23A 4BFCA 2YJ3A 5HKBA 1WF6A 4MVJA 2G5GX 2I6QA 1R37A 2OHVA 1M9NA 1NHWA 1UWVA 4UZSA 3T7TA 5KOHA 3K16A 3OUZA 2VJAA 3LBIA 2D2EA 2C4KA 1F17A 3OJWA 4J4HA 1MP0A 1RQ7A 2FN3A 2QG9A 1ZD8A 1YZHA 2FMKA 1VSQA 2WIAA 3A10A 3HB0A 5CT5A 2PVCA 3ZY3A 5JQGA 1GNTA 2WJYA 1ACJA 4EEKA 2YWJA 4YPFA 5JTTA 4HUJA 4DIDA 4KLNA 1E5QA 1VI5A 1JSXA 4X6UA 3ZV5A 2C9YA 2CNLA 4MP3A 1O6ZA 5L9AA 2LDXA 3CKYA 4FMPA 2D1QA 4ZJUA 4F3NA 5AESA 3VBCA 1OX4A 4DQUA 2W2XA 4N6OA 4V1CI 3GAAA 5EN4A 2AFHA 3F0TA 2O8DB 1FP2A 2IUYA 2QR2A 2YC4C 1ZR2A 2GNPA 3VKFA 4S35A 5I7OA 1E79D 5DX0A 3LXUX 4XFKA 5C18A 3DMFA 3D6MA 3M1YA 1BRMA 1EJ0A 1YE5A 1X14A 2IT1A 1KARA 3DMYA 3H7IA 3I5MA 4ZQGA 4G8BA 2JGFA 1TQ6A 3Q98A 4OI2A 1N33B 3N3AC 4FFMA 1JIQA 1HSZA 2XD4A 3R6LA 4H6VA 5HMMA 5KJFA 4JELA 4MGZR 3VOBA 5BRAA 4OUDB 5IM4F 3DCIA 4HD8A 4QOEA 2FWIA 1X7XA 3AESB 3WTCA 3ANTA 2VATA 2Z2JA 4TWRA 1R6DA 3AVWA 1RYFA 1ST3A 3RO7A 3IHWA 3AG5A 5EHQA 3ORHA 4N4AA 2LWIA 2YCLA 4G0WA 3RVNA 2VZLA 4ZAWA 4D9GA 4QTYA 5K6TA 4N8SA 2PX6A 4KG7A 4MA4A 2JK0A 4H7EA 3MEQA 2OFXA 3NBKA 4D0SA 4OLFA 4P3YA 3R5JA 1QUFA 2O8BB 1PEKE 2JLAA 4UW9A 2HCRA 2FR1A 5TEVA 5BMOA 4D26A 4PZZA 2BELA 3X1MA 2XODA 1ESMA 2Q8QA 3W7AA 1WOYA 2APJA 2IZ7A 2JIOA 4ZVMA 1PZGA 3S2FA 3OPQA 4ICIA 1KY3A 2YXEA 1SD5A 5BYBA 1A8UA 1R74A 5C35A 1Y1RA 1Y4ZA 1IM2A 3N28A 1RAIA 2XJ4A 2ZQYA 3ABSB 3TRKA 3KUUA 5K0ZA 1FEZA 2V6FA 2J8ZA 1VGRA 2KX7A 2VA8A 3W3AD 3C48A 5B4UA 5KTSA 1FW6A 3LECA 3DUFA 3DO6A 1D2NA 4DRXB 1KKMA 3OQIB 4X1YB 5IYZB 3R3WA 5IVPA 1H2YA 3V2IA 1OU4A 3ZE0B 4NNPA 4EHFA 5BYKA 1MHPA 2C1EA 4REMA 1AN9A 1JQJC 3FCYA 2ZUFA 4IDNA 1QK3A 1TM2A 2A3RA 1UZLA 3KTOA 1RHKA 4JYPA 4LNAA 2NO9A 4RAQA 3R5KA 4U7GA 1P2SA 1GLNA 2J09A 1DBIA 5ES4B 2REQA 5E9AA 2I6UA 2X1VA 3ADOA 2BBTA 3NV9A 5FPQA 3ANXA 1KIAA 4MWDA 2VP0A 2R2GA 2DE0X 2XUJA 1ABFA 3GFTA 3E3MA 3MRVA 3OC6A 4IUDS 4K6OA 4RQUA 2PGOA 5AIAA 4FE3A 1R6UA 2V6BA 1KRWA 3GF4A 1G20B 1EM8B 1QYRA 3PNOA 4RDCA 4B4UA 1JJFA 5DU2A 2VN8A 4ZP1A 3AUYA 3B3FA 3GEHA 3ZX4A 4TZ0A 1M2HA 2BIFA 2ZRKA 3I01M 3OY7A 4FZ5A 2WT9A 5FV7A 5AK5A 5IDYA 2VXOA 2ZKIA 3ZZ1A 3WQQA 2DBVO 3SD7A 3UNXA 2ZKLA 2LVBA 1EFPB 3LC1O 4DHWA 1J0BA 3U5ZB 1T3TA 4LVCA 2AHOA 1KMMA 4UFNA 2Q28A 3PD1A 1U2SA 3OLCX 3TMAA 1I0ZA 4EZEA 1AC5A 2PMKA 1FBTA 2ZUBA 2BI8A 2HPVA 4PSVA 4KQXA 5H59A 4AJ2A 4CKXA 4KHPB 4DCJA 5FNVB 2YRXA 5K0SA 1CEXA 2Z30A 3HSKA 5M2QA 1DO8A 5AHWA 2RGDA 2ZXUA 1DTWA 5EJ6A 2DR0A 3D7KA 1YU9A 4LJ9A 1S1MA 1PVOA 4A82A 4M7WA 4PFQA 3FTEA 3QI7A 1D07A 4DYVA 1U8UA 3V3TA 2RC6A 4YP9A 2JLSA 3D6HA 4LNUB 2OXIA 1AJEA 3L7YA 5DISB 4F5YA 1E9CA 3L0PA 4Q19A 1IL0A 2A9VA 4KPFC 4B7XA 2WZBA 3MJCA 4J03A 5AHXA 5IJZA 3VPBA 2ROQA 4YWHA 3C41J 4IP0A 1SCUA 1ZFNA 4P3PA 1NV9A 2QRZA 4ZK6A 1QQ7A 3MERA 4R0NA 3RSHA 5JPIA 3KEOA 3ORRA 2DF8A 3NWBA 4RJ2A 3TN7A 4MTCA 4FHDA 1QYVA 2PMEA 1PSDA 2I6FA 3RUPA 1RAHA 3ZV7A 5HKAA 1ZH8A 5KVSA 2H57A 3QEJA 3FVRA 1SBZA 3KSZO 4TWBA 4J16C 2QM8A 5AJHA 4A0QA 4DHEA 2CFRA 5LLTA 3QVUA 3JWGA 1QIJA 2FW9A 4DC0A 4MX8A 1T8WA 4GOMD 3RS3A 1LPBB 4A26A 5K0EA 4BQNA 5HE8A 3OQMA 1G0NA 1H6AA 3GG9A 1N3YA 4PLZA 3OZIA 3LDAA 2O6LA 3V8NA 2QLBA 3I8SA 3MAGA 4PZLA 1XJQA 2J3EA 2X22A 3Q11A 4PX2A 2A30A 3N2ZB 1A8PA 1OXVA 1DXYA 2QDKA 3L1HA 4FNMA 1OZ0A 4KE7A 3WRVA 3ND8A 3QBVA 3MBIA 3WSTA 1EFTA 3HCNA 3K5HA 5LQKA 1H8HD 1QLHA 4MTLA 5HP4A 1B0PA 2CHGA 4HWTA 5BUCA 1A8IA 1OKKD 1QYDA 4GMDA 1FIUA 4B3GA 4BMYA 5HJ5A 3RK0A 1QF6A 1MXFA 5CAEB 4W7IA 4R1UA 3CY6A 1SHKA 3DZ8A 4HGYA 1GAJA 4DMKA 4ZGGA 3WIDA 2YXNA 1N7HA 1ZEJA 3WC4A 4AJLA 4FR5A 3TJMA 4BN5A 5A4KA 1U3TA 2EEZA 3CQ9A 4ER0A 4O29A 4G36A 2ID4A 2DT5A 2G63A 5EQDA 4P35A 4DNXA 4LJSA 1UH5A 3HMQA 3CF6R 3MXOA 4OSPA 2WT4A 4GHWA 4LYFA 1JXAA 4NOKA 2XYPA 1S6YA 4ZQFA 1NQXA 1VFNA 2TSYB 4GL2A 5GOTA 2PK3A 4MQEA 3ZJYA 5BSUA 1XQYA 1Q44A 2A1UB 2D7CA 3AJDA 3H2KA 1IBCA 1P39A 4ZVQA 3VUEA 3FNIA 4ZN6A 4NBVA 4O1HA 1DWUA 3U4AA 1IHYA 3ABZA 2JGDA 1Z83A 3C98A 1IOWA 1UJ6A 3HCCA 4G01B 4JIGA 2X9VA 5FT9A 4D4JA 1NVVR 3AB7A 2F43B 2A5DA 2BLNA 1XN1A 2GO1A 2H06A 5A9SA 3PR2B 1YUBA 3HRKA 4ESVA 3V1NA 3REFA 3RIGA 3I0NA 4XWKA 5K0TA 1L2TA 3QNUA 1PF7E 5AVYA 4B84A 5H68A 4CM3A 1FYFA 3ICVA 1BU8A 2DUNA 4ZOEA 1Q14A 3R23A 2ALJA 4D8VA 2VDMB 1G5HA 4BCDA 3Q6MA 3RUCA 4REOA 2QD1A 1YA4A 2XGOA 3ZKAA 1GQFA 1XWIA 2O2SA 3MGKA 3AF6A 3EPLA 2GXAA 1O5IA 4TV8B 2BFPA 4JUCA 3GLTA 3NB0A 4P4SA 3BSSA 1L5VA 1VRVA 5EIFA 5DNYB 5JZOA 3RAFC 2HMWA 3D3EA 5KNBD 1HE5A 1ISMA 1J8QA 2QT9A 4HXGA 4QO8A 5CK4A 5C53B 2IZZA 1N2ZA 1KZ1A 1VHWA 4EHLA 4I14A 1QH0A 3STYA 3EZ6A 1XHLA 5KYNA 2WFZA 4L50A 4AWBA 1LDBA 2VUIB 8AT1A 3VAZA 5CH3A 3NRJA 1K7SN 3BAZA 3UGQA 1P1KA 2ZJ0A 4WOJA 1KH1A 4PBRA 4RTOA 1XLTA 2C9OA 2V74B 3LUBA 4JLSA 4K8OA 4RNDB 3JQAB 3CIFA 2NU7B 4J2OA 5B1DA 3VI4B 5L3VA 2C3OA 2QQEA 3FB1A 1TRHA 5DX1A 2ZDQA 4PRKA 3SLRA 3EF1A 3TWOA 2IS2A 1Z0UA 3KELA 2VCEA 5PNTA 1KZYC 4CCAA 2K6GA 3OLWA 4EZBA 2ZBFA 3D4OA 4N7JA 2QTHA 2V3WA 3DKVA 3MJSA 3A14A 1G2OA 3KLOA 1HI9A 1AZLA 4WH0A 5K3BA 5TGDA 4D0GA 5JNSA 4KRXA 3DF9A 3OZ7A 5F2NA 1EUDB 3ZHYA 4RTJA 2PKRA 4L0CA 5A2QA 4C7OB 3DZCA 1C5KA 4RD0A 5FLKA 4PGGA 3TW8B 4CI9A 5JNTA 3I4FA 2BFDA 2ATVA 1ZCAA 1F8YA 2NUTB 3OTOB 3E1SA 3EQ7A 3LDUA 1Y9JA 3QTLA 3K9QO 4EMUA 4FGZA 1FXUA 1FS4A 4XUCA 3SNHA 3IAAA 5HKKD 2X6RA 2Y1LA 3ELYA 5DEOA 2WJJA 1S2GA 3RWOA 4ZZ0A 1AH2A 4YMWA 4P4TA 3W06A 3L7JA 1JF8A 1QRAA 1Y5RA 3WIUA 1VG9B 1Y9EA 5AW9A 3VTZA 3W4JA 1E7WA 2H1SA 2I6TA 1FDOA 1RI4A 2W6MA 1CP2A 3QKRA 2CLFB 4IS3A 1XTRA 5EQFA 3ZBUA 4KITB 4YP6A 1S8OA 2HK9A 4XRRA 2AZTA 2QW8A 3AV3A 4ZQBA 2ZSHA 5C3MA 5K9ZA 4KVAA 1HFKA 2Z8YA 4UNQA 4EB3A 2GRJA 3TVTA 1KEPA 3RIXA 3T7AA 4PC7A 1JG3A 4RLFA 2FGJA 3K5PA 4ZQIA 4C03A 3H65A 3IE0A 5HBGA 3Q85A 4ITRC 4Z0HO 1U7TA 2CCJA 2JI9A 2VFAA 1Q92A 2D8AA 3LUHA 3N07A 1L8OA 2WKQA 2Z83A 2J3JA 4LDNA 3PC2A 4XSGA 5I5EA 1S0UA 1ZUIA 1IEVA 4GKKB 2WJ3A 3KLPX 4L3WA 2G77B 5IU6A 2C07A 4B35A 3MRTA 2GCNA 3VSBA 5LL6P 4NYJQ 1VG1A 2XRYA 5FUVA 2GEFA 1K98A 2PPLA 1C1DA 2VOJA 4FCVA 5G2OA 3K96A 5EMHA 1BFUA 1Q20A 3U7IA 5ILQA 3NTLA 2VQFB 1JLLA 2QAJA 2QG4A 2YVAA 1T5OA 1YZTA 2PV7A 3HUDA 3LA6A 3NHUA 2PGNA 4H7HA 3LQFA 2HL6A 1M6WA 3PDCA 4BAUA 5A0FA 4B3HA 1N2CE 3EDYA 2OYCA 2B99A 3V34A 4R68A 1G64A 4EUNA 1GOTA 2AZDA 1JZQA 3K0FB 4PNEA 1W4CA 2HQ1A 4UZEA 3GUYA 3TH5A 1JJIA 3ZR4B 1JWLA 2W2KB 4HN4B 2WZDA 3W8FA 4HQRA 3R4VA 4B80A 4KQ1A 3X2FA 3FPAA 1P7VA 1L7XA 3OT1B 4F9TA 1FPQA 1ZI8A 2VSFA 3ZTTA 3DDSA 1WOMA 4RA6A 4EGCB 2X5XA 5E2BA 1CR2A 1CUZA 1XTBA 1XZ8A 1WMDA 3C6QA 2DZDA 4LQLA 4L72A 4NJOA 1QCYA 3H87A 1R6BX 4PZPA 4R3UC 3HK2A 2ZRGA 5KS2A 3BK1A 4JOCA 4Y6LA 1EE2A 5FBVB 3WR5A 4DLTA 4BP8A 2VWHA 2BMEA 3S3TA 2ZIFA 1TVKA 2QD2A 3GEDA 1D3AA 2A84A 5BQPA 5IEJA 3UJCA 2C7OA 2D1TA 2BH9A 2I1WA 3ZDAA 2ASVA 2O5CA 3MN1A 4R1QA 2Y0CA 2GRAA 1Q2XA 2I76A 1Z7YA 3N0TA 1JDVA 3LX4A 4GYWA 1BO6A 4BNNA 5JD3A 3RBVA 1BKDR 4KIUA 4S2EA 3WB0A 1MC4A 1F0NA 4ENRA 3FDIA 4MHOA 4RKFA 2BMVA 2C03A 3TGPA 2JEZA 4HB2A 1TTPB 2VDOB 3VNSA 1HNZB 2DJ5A 1H65A 2QVBA 1PG0A 4ZTZB 5F98A 3P0RA 4MUGA 5AXCA 4FB4A 4RJLA 2IYYA 4OVKA 3QQ5A 1WP4A 1XZGA 2EP7A 2AWOA 3HBNA 1P18A 3MCUA 1FMCA 2C3YA 4LNHA 1JBEA 1JS1X 1LC3A 5KYVA 2CD7A 3HVIA 4UUNA 3DEIA 4OXNA 4YUYA 5CFQA 1V8FA 4DBLE 3BRCA 1Q7GA 3SZOA 3A7DA 2D2IA 2QDXA 5F1KA 1U8AA 3H75A 1UADA 3FHLA 3NIBA 3PYXA 3MVEA 4NCXA 3HWRA 4M22A 3UZUA 3KQHA 2FRDC 2VK4A 2AL7A 4MWSA 3UW1A 4EI8A 4EJSA 3DONA 5TPZA 3ZY5A 1OLSA 1UBEA 4BLPA 1RFGE 4PQYA 3J81k 3B7GA 5FOWA 3WFIA 3HTXA 3QVXA 2RJ3A 4AWAA 2ZI7A 3GPIA 3A6FA 1FDIA 2B9VA 4JXKA 3V4OA 3UAXA 4DSOA 1I5OA 1KI6A 1R3DA 1EHYA 1FNMA 1XKLA 2JLVA 1O6FA 4J0GA 5DCWA 1Z7EA 5JVDA 1BH6A 2RGYA 1UDCA 1YFKA 4QOJA 4GE3A 4Y2XA 4CT5A 1T2CA 3TW0A 1MB4A 4WKGA 4M9CA 3LZ6A 3CO5A 3T7SA 1RI5A 3JS5A 3KPJA 3EVEA 4XLZA 1DDOA 4MQBA 3TTWA 2AXPA 4MUKA 4TL7A 3QMMA 1CUDA 1DG3A 2OHJA 2ZJZA 3T5BA 3GLFE 2FPGA 1F3OA 3ONWA 5JSHA 4URHA 1PJZA 2NSJA 5KSOA 4ERXA 4YDRA 1N3BA 3ZWVA 1UPUA 2DULA 3H3FA 5FADA 3W2TA 4IXMA 5FQNA 6Q21A 3EX7C 5L8VA 3FDFA 2BHNA 3R0VA 3LWNA 3WB1A 4YRQA 3ZJ4A 1D9ZA 1IZYA 2BM9A 4ALNA 1NMQA 4XGIA 1R10A 3ICPA 3DOEA 2ZJ2A 3PT9A 5C8YA 5JC8A 1ZNZA 3WLMA 3HXQA 4YRKA 2MSNA 5EWLA 3BJZA 4OBXA 1I6WA 3VHLB 1XG5A 3DZBA 3FFAA 2IS1A 2Q4EA 1YSCA 5EA2A 1UQTA 2YFYA 3OAAA 5ESXA 1Y8ZA 1Q95A 4PIVA 5D3ZA 2YQZA 1OAKA 2E4ZA 1RE1A 2R86A 3B3GA 3ECAA 4LXXA 4S1PA 1EWYA 1KSFX 4O4IA 3RSCA 5K8CA 2QRNA 5MFZA 4A5SA 3KR0A 4HFMA 4XAQA 4LV5B 1CUBA 2ZWMA 3RC9A 1Y7PA 3AK4A 2J0UA 1X7WA 5AKKA 5SY4A 2J3QA 5JSYA 1KDYA 3WKCA 1CDEA 1XEWY 4J3NA 4M7PA 1LNQA 2O8FA 1LFDB 2O3RA 3QIAA 4B6RA 2GPJA 1WW3A 3PEFA 1PTJA 3PSAA 1V8DA 1Z5NA 1GRQA 4MS4A 5JYBA 2I4NA 4Z51A 5JSZA 4ZVUA 4HP8A 3RI3A 4JJ7A 4N76A 3QLUA 5CDSA 1Z4OA 2G80A 1S2NA 2P7IA 2QYOA 2H54A 3DDNA 4IXWA 4FEEA 2C9MA 1XZPA 3HGMA 3OECA 3N2KB 3R75A 4ND3A 2NZXA 3SY8A 1Y89A 5GVRA 3TLYA 3NRBA 3PICA 2G5CA 2QJRA 5SZKB 3BWEA 4CF4A 2JI6A 1QP8A 5IJXA 3RYCA 1N3LA 3KHKA 1WDMA 4M9QA 4O4JF 3HFSA 1NNUA 3E5MA 3UV7A 4GBGA 3D64A 4HX5A 4ZYZA 2I2DA 2X7HA 1CR0A 1UEIA 4MINA 1QFZA 2R8ZA 3ZWNA 1PGPA 4LY3A 1E2BA 1B1CA 2IDKA 1E9SA 1EX9A 2DHCA 2TYSB 2ZG6A 3B1FA 3EZXA 3SAJA 1E3TA 1T9HA 3AG6A 3I1IA 3SXUA 4DJEC 4QRIA 2ZYVX 1QNLA 1A04A 4RCYA 3IVAA 5KVCA 2WTUA 4LE0A 2OFFA 3SI7A 4AZSA 4GICA 5G41A 3HADA 1QVZA 2H1VA 4OO3A 4EELA 3BXFA 5AICA 5J4VA 4CM1A 5MN6A 3HUFA 1OROA 1T3ZA 2Q7OE 2HDWA 2WJ4A 4ER7A 1FLVA 2R87A 4X44A 2IYTA 5DV9A 1DO0A 3NANA 2AR0A 4B6JA 4N3BA 5JWOA 3WGLA 1DJNA 2A0WA 2FLVA 5I7UA 2RE8A 4B4VA 2XUDA 1E5TA 4NZMA 3TXAA 2WIFA 3K5WA 2O2ZA 3JZDA 1KI3A 4A6PA 3L46A 5ALDA 3IBYA 3G02A 3DTVA 3AHHA 4PC6A 4CMCA 3CWZA 1PO7A 2X42A 2XSZA 4KODA 5JG7A 3IOEA 2IY7A 1QB8A 1BJTA 1TLLA 2FRXA 3N87A 4H7DA 4HS4A 3EE6A 2Z4SA 3K9FC 3D8NA 4FM9A 2PJRA 2QX4A 5LA6F 1GAEO 1QZUA 1J9EA 3FYUA 1KK1A 2ZT5A 1CUIA 3ONVA 4E2WA 3R9WA 2E49A 4OBEA 3PXCX 3SS9X 1UKVY 3EAQA 2IEGA 1NR5A 1OSNA 2OV2A 4Y1FA 2QJWA 5DN6A 5BW4A 4ATNA 4Y6RA 4I0WB 5TVKA 1LSUA 5BSVA 1H4SA 3UMBA 1FP6A 2AJCA 2I2FA 4Q82A 2QUHA 4BNWA 1ISGA 4UEQA 3I1JA 2BFBB 1T0IA 1U9IC 2H07A 3EVFA 4R1NA 4YJHB 1XA4A 3UXEA 2O7RA 1EUCA 1T6XA 2FF5A 2QNBA 4CNQA 2CLDX 3BJMA 4LZWA 3GFVA 3ISTA 2IFTA 2MHCA 5AW7A 4CW7A 4LJ4A 2VDWA 3T95A 1Z82A 1CZRA 1PIWA 1U7OA 2PXCA 3HXKA 2YVUA 2FFAA 5IAEA 1TAHA 1V5WA 1EYZA 3OI7A 3G2NA 3GZNA 3V4FA 1DUIA 1RRFA 1T13A 2HWKA 1TU3A 1VCOA 3FWHA 4J1TC 1EH5A 2O6HA 4YP5A 4EWLA 2GESA 4LF5B 3DSRA 1QORA 2G1JA 1C9KA 4YI5A 2GBIA 4OHZA 3G2MA 1L7DA 4C0BA 1J0CA 3QVTA 4GX0A 3I05A 4JEIA 5B64A 2D5BA 4MITA 3BD8A 1J07A 3EZGA 3GL9A 2Y8EA 3MRXA 4BMNA 2IOYA 2ZYIA 1XLVA 3P9NA 5JO9A 2VYNA 2FA9A 2NUAA 4PLFA 5HXAA 5IPFA 4WZAE 1ZC3A 2CGEA 4BAGA 4EOGA 2WHXA 4WWHA 3RC1A 3TW6A 4PZUA 4B9AA 2J32A 1FFHA 1P0QA 1U2DA 2ORVA 2ZR0A 1LBSA 3FOCA 1PRYA 2I7CA 2O52A 3A0UA 3NR2A 1PKXA 5FL3A 5CXXA 4IUCS 2ERYA 4HL6A 3MD0A 1OLXA 4MMZB 4LFCB 5JS6A 5KYWA 1J5PA 3E3OA 2MOKA 5ECYA 1W96A 5AW1A 1NY6A 4FS8A 3NKVA 1S96A 1Y3HA 4O5AA 1IK4A 1L7QA 3NBXX 4RESA 1FX0B 4DLVA 4H3KB 4WLVA 4WXYB 4RVCA 4GMXA 3JAKB 1ZOPA 1PAUA 1NTRA 5HFNA 1XALA 1O94C 4AZ3B 4LTMA 2X9QA 1NYQA 2ZYWX 4RGQA 3FNBA 1U2EA 3GMDA 3V8EA 1BWPA 1MCZA 2DBZA 4ONEA 1CE8B 1EMDA 1UBFA 1LPSA 1ORDA 2IU4A 4MS1B 4TTVA 1OFUA 3MCVA 4K3UA 4FCWA 4WKNA 1Y0BA 5EL0A 5CEFA 2WJVA 3QJYA 4NOLA 4IKPA 4WCFA 3A4YA 4BMZA 1G9TA 5I3CA 3I04A 4M7RA 5J59A 2DHQA 4JI0B 1R5JA 2XUZA 1ABEA 2P2CA 3H8WA 4IXTA 1KJZA 4O4JB 4GE0A 2P9EA 5CT9A 5DT2A 3Q8KA 1GYQA 2BKXA 3OHSX 4RGYA 3WZMA 2VHWA 3U4DA 3HE3A 1OH6A 3N75A 1MR3F 2DY0A 5JJBA 1B6RA 1U3CA 1NQTA 1X74A 4IIUA 1ZUNB 3K9CA 5EXXA 2D06A 1B2RA 2C00A 4NCKA 3AEXA 3QKTA 4UC0A 4XI9A 3V8PA 3VNRA 2FLKA 4NBTA 3VX4A 1SIBE 4P58A 3QKIA 4B3XA 3ZHBA 3PNLA 1P91A 3U62A 2Q1TA 4BZWA 4MS3B 1OBHA 1ZDMA 3T1YB 1N6NA 1OLUA 3GLIA 3TSWA 4I4CA 5J63A 2YHUA 2E4WA 5JAZA 2LP4Y 3KFXA 2W8BB 3CEAA 3PXGA 4QJ3A 3CF2A 1TVEA 2X1MA 3I9OA 1EG2A 4U2GA 3DE5X 3TM5A 3LGAA 1G4HA 2QN1A 3DE1X 3PI6A 3I5AA 5LJIA 4PCAA 2GEVA 2CVZA 4DMUB 3QYAA 5JMPA 2F17A 4ZCQA 2WUEA 2HSGA 3COPA 2H1IA 3U26A 5IN4A 4R9SA 3COJA 2WLTA 1Q7EA 2JGIA 1EVQA 2VXBA 3R6GA 4B81A 5I4BA 2ZWVA 2RBKA 2XDAA 3Q2IA 3TTYA 1TCCA 3B6ZA 4URVR 1Z0DA 5BRJA 3QYJA 1M34E 1WMAA 2AW5A 4LE1A 1KJYA 3CRNA 2D13A 1G60A 2WG1A 3HABA 3F71A 4EP1A 5LA6B 4II7A 2JEYA 5LZ2A 4OIFA 1FBNA 2ZTHA 1GPBA 2FFRA 3H5OA 3LP5A 5DHPA 3PTLA 5K4HA 1CZKA 2XRZA 3ZXSA 1H3EA 1D1PA 4C6RA 1K89A 2E18A 2IY9A 4C3OB 1KJ9A 1RZ3A 5TS3A 4RLSA 2YHIA 3BB1A 1T2EA 2AMFA 4ZMSA 2JLXA 3T9DA 1O87A 4CNBA 2QTVB 3V32A 1VLJA 1H9CA 1FMTA 4MUYA 4C4RA 4G07A 1I2CA 2A9QA 1PK8A 3IRUA 1GP2A 1WDLA 1PU2A 1WW8A 2J3LA 3ZQ4A 3B8EA 3QKSB 1QGOA 3AJ9A 5A6SB 2ODWA 1OAOC 1XFAA 1J22A 3FZQA 3EGWA 3T7DA 4CIDA 4DXHA 5BNIA 4US2R 1QRDA 4DUZB 5ECGC 3RLIA 2J3DA 4EO4A 3M5WA 4RH3A 1P1IA 5A1JA 3HL0A 2P9ZA 5C46F 4FBLA 4KREA 2Q2WA 4ZALA 1K3TA 3R7WA 3BKWA 1XZCA 5ERYA 3DDWA 1XD8A 5KNLA 2JCVA 1E59A 5EUBA 1EESA 3P9RA 4C5AA 1PJBA 1VCMA 3BULA 1H2XA 1K8QA 1PZMA 1XL1A 3B51X 3F9RA 3KB6A 1N8TA 4XCQA 5EFOA 4RD3A 1ULTA 3EBLA 3NM4A 2DOKA 3E5NA 1C9MA 5JS7A 3DHWC 4DRYA 1XYYA 3RVSA 1AKQA 2DB3A 1H6DA 1F20A 2ZWIA 4LOHA 2XXAB 2C9BA 4QHTA 4QUDA 3K35A 4EENA 2RONA 1ZD1A 1L5MA 2XITA 4ENTA 1JYEA 2I66A 3DAGA 4RETA 4BBZA 2AF4C 2W2LA 4TLCA 1XROA 1QMPA 5CVCA 5E1MA 3V4ZA 1HYQA 4KVZA 5HK8A 5A04A 4WLNA 2AEEA 2IL1A 3D43A 2KLHA 3MJTA 4QX6A 3VH2A 4AJNA 4DARA 4D9BA 4KVGA 2I7DA 4LMBA 1C41A 1KAEA 4L57A 3KJIA 2CF5A 1AGYA 2GF2A 2NQTA 4U9IS 5BSFA 3UWOA 2EARA 3PGVA 5KHAA 3USES 1UOPA 3TI7A 3GUZA 1IEWA 1R2QA 4CFYA 5GZ1A 1MW8X 3H11A 1WHTB 4BCCA 2VT2A 4FEAA 4FLEA 3ZJTA 5DBOA 2GN8A 3C3XA 3ED1A 1E8NA 1V5EA 1AZSC 3TLBA 3TEMA 4B5KA 3QXJA 1W36C 3CUVA 2HPHA 4MV8A 2YWFA 2XMQA 3RC7A 1I36A 1JJBA 2Q6KA 3NBZC 3P9YA 1F4PA 1UUFA 1GDDA 3LBNA 4MRNA 5KQMA 2R3SA 2J0QA 2FPIB 1SCAA 4M99A 1SUFA 1Z6YA 5DWVA 1NSTA 4YS6A 4YYEA 1T2AA 3FDZA 1MO3A 1U94A 5J2UF 1HOXA 1WEKA 2VPTA 4MAMA 5ARDA 3AGPA 5BPFA 2GTIA 5ERGB 4KRFA 2BY4A 4HYTA 2DU8A 4HTFA 3IE1A 4D8XA 5HZMA 4EF6A 2OV6A 1AB6A 2UXBB 5CNMA 3P2EA 2FOXA 4JVNA 2ZJBA 2ECOA 1DLJA 5SZJA 4ZRMA 1SIOA 3N8NA 2OBNA 3CINA 1LK5A 4H7PA 3MF4A 3S81A 3OZUA 1Y81A 1XTSA 4MI9A 5F64A 5H4GA 4RORA 3M1AA 3WMRA 5EYPB 2H65A 5JDIA 4ZOBA 3SX4A 3WMXA 3L40A 2ZREA 1UZAA 4ZCTA 1G20E 3FMPB 1SPBS 2VZEA 3LH5A 5ALJA 2D6FA 2FN7A 3UIEA 1TZBA 2Z95A 1YDGA 3EMVA 1GKYA 2OD9A 3PDWA 3QPBA 4L95C 4A7PA 1Z8HA 4RPCA 1YZUA 2GVDC 4C4XA 1F8FA 1BVHA 5DYYA 1K4MA 2ZJOA 1U0BB 5GGXA 1ARZA 3UOGA 5HM8A 3DC2A 5IEBA 3BRWD 3GGGA 3N0XA 3NDIA 4YAWA 4PBSA 5DXAA 3IL2A 3SVLA 4AD8A 3MSXA 1EDZA 2QA5A 3TR5A 1X1EA 1U4NA 4EAQA 5JANA 3BFPA 1A82A 4GEKA 4B3CA 2IEIA 3H13A 1H0KA 1E2MA 3U4HA 1RTTA 3ZWWA 1TZJA 5GZ6A 4TZ6A 4EIWA 1CX9B 4RY8A 2QVGA 1BD4A 2R1VB 4G4JA 4I5DA 3ZD9A 2UVPB 2DQSA 1IN4A 2XADA 2IZOA 3BZWA 4G81A 4POAA 4X6YA 4ZPXA 1Z6ZA 2GO7A 3SF8B 2QN6A 3FHJA 3L8YA 2B78A 2O4UX 4X1KB 2CUNA 1JKJA 5KDOA 2IHVA 3AKYA 4DUYB 3G68A 3W8EA 2BGMA 2HWXA 3ADDA 1D5CA 1Q15A 3ADCA 3AHJA 2W6NA 2X9GA 3CNEA 4S3MA 1EFKA 2J9ZB 1TCUA 2BMAA 2XH8A 1W36B 4KUGA 2XDQA 4CLOB 5JAHA 3KEFA 1U81A 1YS1X 4IHJF 3VZSA 3LL4A 2IU0A 4L02A 1O0CA 4DQXA 4EJ2A 1V45E 4OQLA 2J5KA 4LXGA 5AHKA 2V9CA 3EDRA 1PV1A 4HEHA 4NE7A 1GAWA 3M81A 4LGMA 1Y48E 3RQIA 2BYTA 2YVQA 5DK6A 4I50F 4QQKA 1E0KA 5TLSA 1K88A 2FW0A 3AVOA 2ECKA 2PX3A 2G70A 1GPAA 4BBAA 1L4UA 3ZLTA 5AKHA 1U63A 3HCEA 1WBDA 3UJNA 2Q3FA 4C07A 4DV4B 5G4LA 4ZDWA 5AKZA 2QJOA 3C6KA 1PT5A 1DB3A 4B3DA 3TJZA 3GRRA 2P0YA 4M9ZA 5FFNA 4WZ6A 1G98A 1TTQB 3ILYA 3RKRA 1J2JA 5HQ3A 3R8XA 2JFGA 4CHTA 1YRWA 4XFDA 3GRFA 4UTXA 3ZK8A 4FOSA 1ZD2P 2JLUA 1ZUWA 4OB6A 4Y7CA 1USUA 1ZNWA 5FPSA 4DV7B 3ZH9B 4DQ0A 5FRDA 3LFTA 4M36A 5TQ0B 3LMKA 3A9TA 2LD4A 3M33A 2VK8A 4J1SA 3BXHA 5GV7A 3I4CA 4HLCA 3O8NA 1WZCA 2OA0A 2WY2D 4D82A 1V3UA 3RYFB 1HDYA