4HFIA

The glic pentameric ligand-gated ion channel at 2.4 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfiA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfiA01
2XYTA 3RQUA 4HFBA 4HQPA 4UXUA 3GUAA 4QH5A 2PGZA 3T4MA 3ZKRA 4BFQA 3ZDGA 1I9BA 4WV9A 3EI0A 3WTHA 5AFLA 4LMLA 3U8MA 4A98A 3RI5A 5HEJA 4ZK1A 5BRXA 4ZJTA 2YMDA 5AFJA 4Z91A 2BYQA 2YN6A 3WTOA 2QC1B 4TWHA 2BR7A 2XYSA 4ZR6A 5L4HA 3RQWA 4HFDA 2W8FA 2MAWA 5AFMA 2C9TA 2M6IA 1UX2A 3WTKA 2KSRA 2BYSA 2UZ6A 2XQ7A 2ZJVA 2WNJA 2X00A 5AFKA 3P50A 5HCMA 2LKHA 5L47A 2BYPA 5AFMB 4EZ1A 4BQTA 5IUXA 5BP0A 4IL4A 1UV6A 3C84A 2XQ9A 4F8HA 2Y54A 4Z90A 3PMZA 5LG3A 5J5GA 3EAMA 3WTLA 2BYRA 5J0ZA 4ILCA 1OEDA 4ZZBA 4D01A 2LKGA 2XQ5A 3TLWA 4B5DA 2BG9C 3WTIA 4HFEA 3WIPA 5J5IA 4IREA 5J5FA 4QABA 4QH1A 3P4WA 3WTJA 4A97A 5AFNA 5BW2A 3WTMA 2XNTA 5CO5A 2WN9A 1UW6A 3U8NA 3ZDHA 2XQ8A 4HFIA 2XNUA 4UM3P 3SH1A 4XK9A 3UU6A 5CFBA 4XHEA 4ILBA 3WTNA 2ZJUA 4NZBA 4AFHA 2BG9B 4QACA 4IL9A 4TWDA 4ZZCA 2Y57A 3TLVA 2BYNA 2Y7YA 4ILAA 4QAAA 5SYOA 4AFGA 5AFHA 2WZYA 2YMEA 3UU4A 3TLSA 3RHWA 5HCJA 5AINA 1OEDB 3C79A 2BR8A 2YOEA 3JADA 2BG9E 4UM3S 4LMJA 4AFTA 3UU8A 4TNVA 2XQ6A 5KE4A 3JAEA 3PEOA 2XQ3A 3RIAA 3SQ9A 2XNVA 5J5HA 2WNLA 4COFA 2XZ6A 2WNCA 4UY2A 3UUBA 2YKSA 3TLUA 5L4EA 3SIOA 2Y56A 4ZK4A 2LLYA 5TVCA 3U8JA 2X00D 3TLTA 3SQ6A 2M6BA 2XQAA 3IGQA 4UM1A 4DBMA 4LMKA 3RIFA 4ZRUA 4HFHA 2Y58A 3JAFA 2BJ0A 2XZ5A 5FJVA 1OEDC 3U8LA 4TWFA 3UQ7A 4UM3A 2VL0A 2W8GA 5HEOA 5LXBA 3UU3A 4HFCA 5HEHA 4ZJSA 4ALXA 3LSVA 4TNWA 5HEUA 3UQ4A 4FRRA 4PIRA 3U8KA 5JMEA 2PH9A 2LM2A 2XQ4A 3EHZA 5HEGA 3UU5A 4QH4A 5KZUA 4NPPA 2BG9A 4X5TA 1OEDE
chains in the Genus database with same CATH superfamily
4X62T 4YSZA 2CRBA 2D9DA 5HEJA 2YMDA 1U4QA 3PE0A 3ESLA 2VVSA 2Z6EA 2X00A 2LKHA 2Y6XA 2DLRA 2WP9A 1UGOA 3K3NA 1ZEEA 3LBXB 3FHNA 3C4ZA 4HWCA 3WTIA 1D1AA 4IREA 4IDZA 3PDYA 3UT5E 2IW5B 2HN2A 3KBUA 1HX8A 3CWZB 3NBXX 1SA0E 4G2AA 4DBQA 2UXCT 4JI8T 3AB3B 3ONXA 2WZYA 3N9MA 1OEDB 2XAHB 1BR0A 4U3CA 4PJMA 4DR3T 3IEEA 2A72A 3Q2MA 5AQNB 4EIWA 2HHHT 4UVBB 3ZLIA 1J5WA 4H9NC 3LSVA 2ZM8A 3BK9A 4J2CA 3ZYMA 3VR9A 5H6RB 2BVMA 5LJNA 2X67A 5L3DB 1XDPA 4PFPA 4DV7T 3N9PA 2PG8A 2GK9A 2ES0A 2ZLYA 2KWIB 1I6ZA 3VKGA 3FZLB 3AE3A 3ZN1B 2X0LB 1WR6A 2WNJA 5AFMB 3ZT6A 2PTFA 1MIVA 3ZMVB 5JDNA 3ZPOA 3ZEFB 2K5BB 2YINA 4CN6A 4DNDA 5FXZA 2CHNA 2LKGA 4BAYB 2WSSV 1HG2A 4IDQA 2KMFA 3OPCA 2IUBA 4I43B 4WW0A 3MXZA 4U74A 2XUEA 4HWHA 3U8NA 2B1EA 5AQFB 3EVYA 3O9XA 4EOZB 1N32T 4KHPT 4DR1T 4DR4T 3I0QA 2QA7A 2X51A 2PJQA 1U5PA 4UM3S 4EZ4A 5AQIB 4YY3T 4YSYA 3I9WA 2LSKA 3KVAA 4PFOA 1ZV4X 5LGTB 1W0BA 2WNCA 2P9BA 1MNEA 1WLXA 2XQYA 2F4VT 2W62A 2HPJA 2YU1A 1YKHB 2JQKA 3L09A 2XZ5A 4H9RC 5L3GB 4A56A 2UXNB 4ERRA 3B13A 1V9DA 2UUAT 5L2LA 2WDQA 4TN7B 1DU2A 5KDMC 4AKIA 5DQVA 5FVKA 2XASB 2VQFT 3OJAA 4DR7T 3RI5A 5AQVB 3HKCE 3IBPA 3OKQA 2MBGA 3AEBA 1UX2A 2UXDT 4U2ZA 1KF6A 5AQHB 5AQQB 2BYPA 3TKLB 2EHOC 2X9HA 3IHRA 4P1NA 3ZSSA 4Z90A 5JDLA 3WTLA 4GK0E 3KBTA 2XTLA 1OEDA 4H63H 2L9QA 3JC6D 4WNKA 2MYSA 5AFNA 2Y48B 4PK6A 3WTNA 4C90A 2J1DG 2IC9A 1XDOA 2WBLA 4YXDA 3ZT7A 4ZI2C 3C79A 4UIGA 4KP3C 2YOEA 2IDOB 1KEYA 3V5SA 3P4QA 4B3ST 2IMLA 4HGAA 5AQLB 4IHJE 2KZ7B 5L3CB 2J4GA 1VCSA 2J62A 3FB2A 2LSYA 5BMVE 1SUMB 2JRKA 2WS3A 2CLYB 3I0OA 4UM3A 1LVKA 2RP4A 3SS1A 3P8CD 3U8KA 2XAQB 2ZMAA 2Q9QB 4AIUA 1HTJF 2BG9A 5EZYE 2DHRA 3MJXA 2CA5A 4C91A 4K0UA 2VWAA 2A2FX 4CXWA 4IDNA 4U7YA 1S35A 5JDMA 2C5IT 2JMHA 3E08A 5HWXA 2LHNA 3RQWA 2D0UA 4P09A 1XMQT 1N34T 2M6IA 4UEMA 3VHLA 2VKOA 5LXTE 4UV9B 2HH7A 1W09A 3C84A 5TAOA 4NUVA 3GN5B 4ILCA 5KMGP 4ZZBA 3N9OA 4D01A 4OYKA 2LSIA 3J9X1 1VRBA 4O4IE 2QYWA 4A97A 4XHEA 3VR8A 5AFUL 3AE1A 2RA1A 4YSXA 5JQGE 4AKGA 2K3WA 2NOXA 1D1CA 2YMEA 4UVCB 4XBFB 3OYXA 3RHWA 5BR8T 2BG9E 4LMJA 5F3JA 4LFAT 3UU8A 5CGMA 2IC6A 1IBKT 2UU9T 2DI4A 2XZ6A 1UK5A 1S94A 5LMNT 3U8JA 4NXMT 2N9DA 3P4RA 4ZEYA 2CXDA 4WBOA 3U8LA 2X0YA 2LJLA 3CPZA 3NZQA 4DVDA 1MMNA 3DJBA 3NZPA 4QH4A 4YTPA 4NPPA 4X5TA 3LK3B 2BKOA 3T4MA 5J1GA 3ZDGA 3ONJA 5AQMB 4LMLA 3AAEB 3PUQA 4X65T 2YK0A 3UULA 4DMWA 3RF1A 4DR5T 3ANWB 4E7ZA 3I1AA 2XYSA 4EAHA 3AA6B 3AVRA 3AE6A 3HA4A 2X0HA 4ZOLE 3QB5K 4O4LE 4JI4T 4KBMB 1O3XA 2YDQA 4K0KT 4MLKA 1D0ZA 3RYIE 4CN1A 2MPKA 2W4XA 3CQGB 3VRAA 1M62A 5CO5A 3PUVF 4JBWF 5LB7B 1EZ3A 4MBQA 4JV5T 4B3MT 5DABA 3KV5A 1SHZC 4WBNE 3T8OA 5JR9A 4OX9T 2ACZA 4GOUA 4ASKA 3ZMUB 3U3IA 2XAGB 1WYCA 5CB4E 5L4EA 4X66T 2Y56A 5F5WA 5EK2A 2X00D 2BBJA 3CMLA 3PUWF 3IGQA 1T98A 5H6QB 4JYAT 3DTOA 2WU5A 1HF8A 3SRZA 4X1IE 2LRKA 3ANWA 1H7CA 3H3MA 2WMOA 2DCFA 2VL0A 2KNDA 3QK6A 2LM9A 1WCRA 4LF8T 3UFGA 3CX8B 3MKDA 1Z8UA 5LHHB 2VB6A 3AEDA 3PUSA 4L0RA 4ZK1A 4JI3T 3RRCA 5CA0E 3UFEA 4HFDA 2LOPA 1SE7A 3RGLA 4L5GA 5LGUB 1YW0A 5L47A 2DL1A 4EZ1A 5IUXA 1YKEB 3OBVE 1ZP0A 3I9YA 4QH1A 1NENA 2KLQA 2CXFA 3M3ZB 2WN9A 3ZDHA 4CI3B 1AJ3A 2WDVA 4ILBA 4EZHA 1UUSA 5C8YE 1J1JA 4ZZCA 1D0YA 5JDFA 1XMOT 1MIYA 5J2TE 4ZI7E 5LYJE 2JMKA 2NR4A 2V5CA 4LF4T 1ZKEA 4ILUA 3LK2B 3JC6C 1IJ6A 4HWIB 4X1KE 3CX7B 4O2AE 5TVCA 3SQ6A 2XQAA 2CHOA 2FJDA 4U33A 4HEAA 4BA9A 3RH3A 3UQ7A 5L3FB 1XZYA 4OHFA 3GMIA 4ALXA 2X9WA 2K48A 2UUBT 4JEHB 2XJ7A 4EYUA 1WRDA 3GUAA 2HPLA 2ACXA 5FL0A 3U8MA 1FEWA 4IE6A 2CWYA 2JJ9A 1BR4A 2YN6A 2WQYA 4AQFA 2EHOB 3EABA 3W15B 5JDQA 2KINB 2IAKA 3EUHA 3Q5EA 2C9TA 2I0MA 3ZYKA 2WWUA 3P50A 4IE4A 2WAUA 3GA8A 4IL4A 1ZOYA 1OXZA 5C2TA 3PMZA 2WCAA 4O8SA 3RC8A 5ABEA 4HFEA 3FXEB 4UR9A 3SH1A 3C4WA 4CI1B 2ODVA 2SPCA 3MACA 2ZJUA 5ABGA 4QACA 4DV5T 4B6XA 1KNPA 2QVAA 4MFRA 1WR0A 4EEDA 5SYOA 4KX6A 4QXHB 1T8BA 3FBLA 3JAEA 4EXTA 2XQ3A 2WNLA 3UUNA 4L9IA 4DMVA 4HTEA 2LLYA 2H7VC 4IDPA 1IZNB 4BJNA 3ZMSB 4DBMA 4DR6T 5AQPB 2BJ0A 4HWFA 3ZC1A 3KDSE 5JRCA 1W9RA 3AA0B 4I0UA 4PK4A 3B57A 4HFCA 4YHHT 4FRRA 3QNUA 1FMVA 1QLBA 5C3JA 5HEGA 5FP3A 4ISSA 1JNRA 1M7KA 3RLFF 4LF5T 4NXNT 2LOSA 3SFDA 1QSDA 3D0TA 4QX8B 3VKHA 4G63A 2LSGA 5FXVA 3R6NA 3BQIA 3K8PC 1N36T 2QC1B 3G06A 4ZR6A 4TZ4C 1D0XA 1US7B 4PJNA 3C64A 4IGUA 2A9UA 4U2YA 4PJJA 5ADXL 5AQGB 4F8HA 4AKLA 1VOMA 3ZMZB 3HKDE 2NW8A 2X68A 4OFZA 2XQ5A 3TLWA 5FVLA 3AE7A 3C98B 4JI7T 1XNRT 2XQ8A 4HE8A 4N78D 5CFBA 3QOFA 3C50A 5A1LA 2C5KT 3KFWX 2NW7A 2DNXA 3FZMB 2YDSA 3TLVA 4TX5A 1B7TA 4P0AA 5AFHA 2E9XA 3TLSA 2NTXA 5AINA 2UXXB 4M1PA 3JADA 4XAXB 5LNKA 5ABFA 2KXPB 3CX6B 2CBIA 4WZXA 4NUUA 4ZHQE 1E7PA 2WY2A 3F2EA 3J7Yq 2Y58A 3JAFA 1HS7A 2NP9A 4EB6E 4TWFA 1IBLT 3PUZF 2AE9A 3UUMA 2XQ4A 2NTYA 5HWYA 2H7OA 2LHRA 3RQUA 4UXUA 2PGZA 3BQKA 1XWMA 4BFQA 5AFLA 4UELA 3FZKB 1J5ET 3O1IA 3PUGA 3QC9A 5L4HA 4QHOA 3F57A 1IAPA 2MAWA 2XZEA 5AFMA 3N2GE 3WTKA 2KSRA 2XQ7A 4QXCB 4B3TT 4ZXLA 5LG4A 4TV9E 2VKJA 2X9XA 4IT4A 2Y8DA 2V1DB 2KT9A 3WTJA 4JEUB 4NZBA 3PJAA 4TWDA 2BS3A 5AQRB 4B3RT 2BYNA 4AFGA 1T72A 2FUPA 4Q25A 3RX6A 5HAXA 3QB5A 3NKZA 5CJ5A 3AE8A 3PEOA 2E9XD 3ZN0B 2KWHA 3AA1B 3SIOA 2LT3A 4QX7B 1HNZT 3KV9A 1N33T 3LFMA 2V6XA 1HX1B 2V5DA 4UM1A 2XSBA 4LMKA 5DQWA 1WFDA 2XY8B 2V8SV 3RIFA 4ZRUA 1I94T 5AQJB 2IIUA 5ABHA 2K24A 4WYVA 2L3LA 1R8IA 4ZS3A 2BS4A 2WZHA 2XYTA 1KK7A 4HQPA 3B5MA 3T1YT 3PTRB 3PU8A 3WAJA 3EI0A 4H63V 4JUYA 4BJMA 4Z91A 5HYAA 5HXCA 3KVBA 4CI2B 5AQTB 4TV8E 3JCFA 4X64T 4AKHA 3Q5DA 3ETUA 2Y54A 3FZHB 5J5GA 2X9YA 3AEAA 2XM2A 4JI0T 3LBXA 5J5FA 3P4WA 1FMWA 2L8KA 3ZJ1A 3HR0A 5LBMA 3CIRA 4E7SA 3ZSTA 3AECA 4U31A 3PJAJ 4U7IA 4CN4A 2Y57A 1FJGT 4NIQA 2ZM2A 3MZKB 3PU3A 2V7MA 3NRXA 4CQIA 2X66A 2JIWA 1YXRA 2V7IA 3GWHA 2XNVA 3V5UA 5IWAT 2MTQA 1Z0PA 2UXBT 2N1GA 1KFYA 4JI6T 4YTMA 3ETVA 4Z8XA 2Q9QA 4UF0A 2DWKA 5EK4A 2V6YA 2M67A 5JH7E 3Q9DA 3OYZA 4YLHA 4V1Av 5LGNB 3ZMTB 3FXDB 2WU2A 1I9BA 2PBIA 2FJAA 4A98A 4DV6T 5BRXA 2VKHA 2XM1A 5HXEA 1BR1A 2JQ9A 4HWDA 5AFKA 2XAJB 5AQKB 3HL6A 2G0UA 4DUYT 1X79A 3P4PA 4DV2T 3RRWA 1MMAA 3LDQB 4H9OC 5E0OA 3S4UA 3P4SA 4EV6A 3M65A 3N2OA 4HFVA 3SOLA 2W66A 2WM9A 5L3BB 2V7JA 2VQET 2W2UA 4OK0A 3RYHE 5JREA 2ZM0A 4XZCA 2JPFA 2BR8A 4GIWA 1WYBA 2XQ6A 2N2NA 1ZHCA 4LFCT 2CXLA 1KNRA 4ZI2D 3K1SA 3KV6A 4HN9A 3NVOA 2VASA 2W0GA 5FMNA 3E22E 3VRBA 4EGWA 3F31A 5ETWA 2OLTA 3UU3A 4I4TE 4PAGA 4GYSA 2D0TA 1D1BA 2LM2A 3SFEA 5FY7A 2A3DA 4PNIA 4QH5A 3RC3A 3ZKRA 4WV9A 2CWOA 5FL1A 4IE5A 4PW8A 2LEHA 4AXPA 3SWHA 3PURA 2CM0A 3ZCIA 2XQ9A 1CUNA 5JVDE 4YT0A 3MA9A 5JR9C 2V26A 5FY0A 3AVSA 2WMNA 3RKGA 4CZZB 4OYJA 3NWIA 4UM3P 5J5HA 3AXJA 1Y01A 4ANJA 5KXJA 2XHEB 4AI6A 3AAIA 5AQSB 2BBHA 1HFAA 4QAAA 3H3AA 4H9SE 5HCJA 5JDGA 5JDHA 3O4XE 3RIAA 1NWMX 3N9QA 4O4HE 1YQ4A 4AISA 3UUXB 3FBZA 3AA7B 3L39A 2NWBA 5DJQC 2E2AA 1OEDC 3Q5WA 4DV4T 3AEGA 1E1HB 3UQ4A 2PH9A 1HR0T 3RIUC 3DP7A 5HXHA 3HI2A 5AQOB 5FNVE 4HKAA 2W8FA 2CPTA 1LKXA 4U72A 2UZ6A 2AXDS 2LSJA 2V6YB 3EDVA 4UVAB 2V7LA 2W61A 3N9LA 1UV6A 5LG3A 2BYRA 3P7IA 2E9XB 1W0AA 2C5JA 3ABVA 5HXRA 3AE2A 1UCUA 5LCYA 2LE8A 2BKPA 5BW2A 3RKOA 2XNTA 2DWGA 2QGSA 4HFIA 4YHJA 4QKNA 3UU6A 2I6HA 3EDUA 2E8IA 2E9XC 4TUYE 1Y64B 3L3PA 3O1HA 4EYYR 4JI2T 2WWVA 2MOZA 1E2AA 4GYRA 5ABFB 2D5UA 2UUCT 3OVUA 4YJ3E 1KNZA 2VK9A 4ZI3D 2FJBA 4GK5E 3AE9A 2XPKA 4MALA 2YU2A 3UTKA 3R84B 5HEOA 5LXBA 2W63A 5LOVE 2IHR1 2XAFB 3ZJ2A 3L8RA 5KZUA 3ZYLA 3T1HT 3RYCE 1CHUA 4ZI3C 3C51A 1HG5A 3WTHA 2BZBA 5FXWA 3WTOA 3K3OA 4TWHA 5KX5E 4YJ2E 2W67A 4LF9T 1UX4A 3A5XA 2ZJVA 2FBWA 3BQLA 4UV8B 4QXBB 5HCMA 1UX5A 4DR2T 5IHYA 4P0BA 5L3EB 3LJCA 5FYMA 3VU7H 3K3QC 2E5VA 5J5IA 1MNDA 2H88A 4O2BE 2VL8A 2W00A 1NEKA 2XSAA 4PK5A 4DV0T 3UU4A 4F6RC 3NRYA 4YFSA 5JR9B 2QRXA 2VURA 4AFTA 3AE5A 4ZS2A 2OA5A 3AEEA 4JI5T 4ADZA 5CA1E 4DO0A 4DBRA 2CE7A 3SQ9A 5JTGA 4UY2A 2YKSA 3AXJB 4JI1T 3U78A 4FI5A 3TLTA 2YEVC 2M6BA 1HNWT 5JRCB 1YQ3A 4AQFC 4I50E 4DUZT 3IA3A 2V7KA 2WZIA 2CBJA 4MHCA 4I55E 1JNZA 3PUXF 4UXNB 5FY1A 2YDRA 4TNWA 5FXXA 1VCTA 1MMDA 2BS2A 3ZCJA 1LRZA 3HKEE 3E0ZA 5AQUB 3RYFE 5LJMA 2VVNA 2VKDA 4IIJE 3IF8B 2EHOD 3PUAA 5LP6E 2BYQA 4CXXA 2LRLA 2BR7A 2Q9QD 3Q5XA 5IYZE 4AKRB 2HN1A 3AEFA 4A5XA 4IE7A 3O1JA 3LG7A 2WDRA 3GN5A 4KUMB 1L0VA 4BQTA 5BP0A 3EAMA 3N9NA 3AAAB 4IDOA 2BG9C 2R6GF 4FJOA 1HNXT 4O4JE 4QABA 5J2UE 2JQHA 3WTMA 2J47A 4PJLA 2RPAA 4JLEA 4X20E 4AFHA 3CVRA 3CK6A 4LF7T 3ZC0A 4X1YE 2BG9B 5LHGB 2K9AA 2FJEA 4H9PC 3WAKA 4ILAA 3C4XA 4KMCA 4LF6T 4TNVA 5KE4A 4QWNB 3WI3A 4GKKT 4DV3T 2JQQA 5LBQB 2ZM6T 2OV9A 4COFA 3TLUA 4IE0A 3LK42 5LMUT 4ZK4A 4LFBT 4KI0F 3N2KE 4HFHA 2BVLA 5FJVA 2B76A 4DV1T 1QUUA 3AE4A 3ONLC 4YTNA 1NAFA 3X1DA 4ZJSA 5HEHA 2NW9A 5JMEA 4PIRA 4UF0B 3UU5A 2WB5A 1IBMT 1OEDE 1FIOA 1G8XA 2I59A 4HFBA 5LHIB 3CQCB 2H3RA 1UURA 3RPUA 2C0SA 1X9BA 2Q9QC 5HXSA 4ZJTA 3RIUA 5AFJA 1XNQT 1OWAA 2CEAA 2BDEA 2EHOA 1MMGA 2BYSA 1G73A 1GQEA 4ISTA 3KV4A 1HCIA 5J0ZA 3ZT5A 2CMRA 1LVFA 4EEBA 4B5DA 3QUJA 3WIPA 3PV0F 5EK3A 5F8PA 3N5LA 3HKBE 2PFVA 2H89A 1UW6A 3A7MA 2XNUA 4XK9A 2D2SA 4DIDB 4IL9A 3OTOT 2Y7YA 1T7SA 5FKYA 2CLYC 1BR2A 4H9QC 1MIWA 3KINB 5GONE 5LA6E 2E5LT 1YD8G 2ODUA 3UUBA 4CXYA 4GKJT 4AQYT 2CCQA 2BKNA 5M4YA 4AQGA 3FZFB 4KHZF 3PUYF 2W8GA 5HEUA 3CQXC 3A8YC 3MK7C 3EHZA 1IJ5A 3CKDA 3H37A
chains in the Genus database with same CATH topology
2XYTA 3RQUA 4HFBA 4HQPA 4UXUA 3GUAA 4QH5A 2PGZA 3T4MA 3ZKRA 4BFQA 3ZDGA 1I9BA 4WV9A 3EI0A 3WTHA 5AFLA 4LMLA 3U8MA 4A98A 3RI5A 5HEJA 4ZK1A 5BRXA 4ZJTA 2YMDA 5AFJA 4Z91A 2BYQA 2YN6A 3WTOA 2QC1B 4TWHA 2BR7A 2XYSA 4ZR6A 5L4HA 3RQWA 4HFDA 2W8FA 2MAWA 5AFMA 2C9TA 2M6IA 1UX2A 3WTKA 2KSRA 2BYSA 2UZ6A 2XQ7A 2ZJVA 2WNJA 2X00A 5AFKA 3P50A 5HCMA 2LKHA 5L47A 2BYPA 5AFMB 4EZ1A 4BQTA 5IUXA 5BP0A 4IL4A 1UV6A 3C84A 2XQ9A 4F8HA 2Y54A 4Z90A 3PMZA 5LG3A 5J5GA 3EAMA 3WTLA 2BYRA 5J0ZA 4ILCA 1OEDA 4ZZBA 4D01A 2LKGA 2XQ5A 3TLWA 4B5DA 2BG9C 3WTIA 4HFEA 3WIPA 5J5IA 4IREA 5J5FA 4QABA 4QH1A 3P4WA 3WTJA 4A97A 5AFNA 5BW2A 3WTMA 2XNTA 5CO5A 2WN9A 1UW6A 3U8NA 3ZDHA 2XQ8A 4HFIA 2XNUA 4UM3P 3SH1A 4XK9A 3UU6A 5CFBA 4XHEA 4ILBA 3WTNA 2ZJUA 4NZBA 4AFHA 2BG9B 4QACA 4IL9A 4TWDA 4ZZCA 2Y57A 3TLVA 2BYNA 2Y7YA 4ILAA 4QAAA 5SYOA 4AFGA 5AFHA 2WZYA 2YMEA 3UU4A 3TLSA 3RHWA 5HCJA 5AINA 1OEDB 3C79A 2BR8A 2YOEA 3JADA 2BG9E 4UM3S 4LMJA 4AFTA 3UU8A 4TNVA 2XQ6A 5KE4A 3JAEA 3PEOA 2XQ3A 3RIAA 3SQ9A 2XNVA 5J5HA 2WNLA 4COFA 2XZ6A 2WNCA 4UY2A 3UUBA 2YKSA 3TLUA 5L4EA 3SIOA 2Y56A 4ZK4A 2LLYA 5TVCA 3U8JA 2X00D 3TLTA 3SQ6A 2M6BA 2XQAA 3IGQA 4UM1A 4DBMA 4LMKA 3RIFA 4ZRUA 4HFHA 2Y58A 3JAFA 2BJ0A 2XZ5A 5FJVA 1OEDC 3U8LA 4TWFA 3UQ7A 4UM3A 2VL0A 2W8GA 5HEOA 5LXBA 3UU3A 4HFCA 5HEHA 4ZJSA 4ALXA 3LSVA 4TNWA 5HEUA 3UQ4A 4FRRA 4PIRA 3U8KA 5JMEA 2PH9A 2LM2A 2XQ4A 3EHZA 5HEGA 3UU5A 4QH4A 5KZUA 4NPPA 2BG9A 4X5TA 1OEDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYT A;  3RQU A;  4HFB A;  4HQP A;  4UXU A;  3GUA A;  4QH5 A;  2PGZ A;  3T4M A;  3ZKR A;  4BFQ A;  3ZDG A;  1I9B A;  4WV9 A;  3EI0 A;  3WTH A;  5AFL A;  4LML A;  3U8M A;  4A98 A;  3RI5 A;  5HEJ A;  4ZK1 A;  5BRX A;  4ZJT A;  2YMD A;  5AFJ A;  4Z91 A;  2BYQ A;  2YN6 A;  3WTO A;  2QC1 B;  4TWH A;  2BR7 A;  2XYS A;  4ZR6 A;  5L4H A;  3RQW A;  4HFD A;  2W8F A;  2MAW A;  5AFM A;  2C9T A;  2M6I A;  1UX2 A;  3WTK A;  2KSR A;  2BYS A;  2UZ6 A;  2XQ7 A;  2ZJV A;  2WNJ A;  2X00 A;  5AFK A;  3P50 A;  5HCM A;  2LKH A;  5L47 A;  2BYP A;  5AFM B;  4EZ1 A;  4BQT A;  5IUX A;  5BP0 A;  4IL4 A;  1UV6 A;  3C84 A;  2XQ9 A;  4F8H A;  2Y54 A;  4Z90 A;  3PMZ A;  5LG3 A;  5J5G A;  3EAM A;  3WTL A;  2BYR A;  5J0Z A;  4ILC A;  1OED A;  4ZZB A;  4D01 A;  2LKG A;  2XQ5 A;  3TLW A;  4B5D A;  2BG9 C;  3WTI A;  4HFE A;  3WIP A;  5J5I A;  4IRE A;  5J5F A;  4QAB A;  4QH1 A;  3P4W A;  3WTJ A;  4A97 A;  5AFN A;  5BW2 A;  3WTM A;  2XNT A;  5CO5 A;  2WN9 A;  1UW6 A;  3U8N A;  3ZDH A;  2XQ8 A;  4HFI A;  2XNU A;  4UM3 P;  3SH1 A;  4XK9 A;  3UU6 A;  5CFB A;  4XHE A;  4ILB A;  3WTN A;  2ZJU A;  4NZB A;  4AFH A;  2BG9 B;  4QAC A;  4IL9 A;  4TWD A;  4ZZC A;  2Y57 A;  3TLV A;  2BYN A;  2Y7Y A;  4ILA A;  4QAA A;  5SYO A;  4AFG A;  5AFH A;  2WZY A;  2YME A;  3UU4 A;  3TLS A;  3RHW A;  5HCJ A;  5AIN A;  1OED B;  3C79 A;  2BR8 A;  2YOE A;  3JAD A;  2BG9 E;  4UM3 S;  4LMJ A;  4AFT A;  3UU8 A;  4TNV A;  2XQ6 A;  5KE4 A;  3JAE A;  3PEO A;  2XQ3 A;  3RIA A;  3SQ9 A;  2XNV A;  5J5H A;  2WNL A;  4COF A;  2XZ6 A;  2WNC A;  4UY2 A;  3UUB A;  2YKS A;  3TLU A;  5L4E A;  3SIO A;  2Y56 A;  4ZK4 A;  2LLY A;  5TVC A;  3U8J A;  2X00 D;  3TLT A;  3SQ6 A;  2M6B A;  2XQA A;  3IGQ A;  4UM1 A;  4DBM A;  4LMK A;  3RIF A;  4ZRU A;  4HFH A;  2Y58 A;  3JAF A;  2BJ0 A;  2XZ5 A;  5FJV A;  1OED C;  3U8L A;  4TWF A;  3UQ7 A;  4UM3 A;  2VL0 A;  2W8G A;  5HEO A;  5LXB A;  3UU3 A;  4HFC A;  5HEH A;  4ZJS A;  4ALX A;  3LSV A;  4TNW A;  5HEU A;  3UQ4 A;  4FRR A;  4PIR A;  3U8K A;  5JME A;  2PH9 A;  2LM2 A;  2XQ4 A;  3EHZ A;  5HEG A;  3UU5 A;  4QH4 A;  5KZU A;  4NPP A;  2BG9 A;  4X5T A;  1OED E; 
#chains in the Genus database with same CATH topology
 4X62 T;  4YSZ A;  2CRB A;  2D9D A;  5HEJ A;  2YMD A;  1U4Q A;  3PE0 A;  3ESL A;  2VVS A;  2Z6E A;  2X00 A;  2LKH A;  2Y6X A;  2DLR A;  2WP9 A;  1UGO A;  3K3N A;  1ZEE A;  3LBX B;  3FHN A;  3C4Z A;  4HWC A;  3WTI A;  1D1A A;  4IRE A;  4IDZ A;  3PDY A;  3UT5 E;  2IW5 B;  2HN2 A;  3KBU A;  1HX8 A;  3CWZ B;  3NBX X;  1SA0 E;  4G2A A;  4DBQ A;  2UXC T;  4JI8 T;  3AB3 B;  3ONX A;  2WZY A;  3N9M A;  1OED B;  2XAH B;  1BR0 A;  4U3C A;  4PJM A;  4DR3 T;  3IEE A;  2A72 A;  3Q2M A;  5AQN B;  4EIW A;  2HHH T;  4UVB B;  3ZLI A;  1J5W A;  4H9N C;  3LSV A;  2ZM8 A;  3BK9 A;  4J2C A;  3ZYM A;  3VR9 A;  5H6R B;  2BVM A;  5LJN A;  2X67 A;  5L3D B;  1XDP A;  4PFP A;  4DV7 T;  3N9P A;  2PG8 A;  2GK9 A;  2ES0 A;  2ZLY A;  2KWI B;  1I6Z A;  3VKG A;  3FZL B;  3AE3 A;  3ZN1 B;  2X0L B;  1WR6 A;  2WNJ A;  5AFM B;  3ZT6 A;  2PTF A;  1MIV A;  3ZMV B;  5JDN A;  3ZPO A;  3ZEF B;  2K5B B;  2YIN A;  4CN6 A;  4DND A;  5FXZ A;  2CHN A;  2LKG A;  4BAY B;  2WSS V;  1HG2 A;  4IDQ A;  2KMF A;  3OPC A;  2IUB A;  4I43 B;  4WW0 A;  3MXZ A;  4U74 A;  2XUE A;  4HWH A;  3U8N A;  2B1E A;  5AQF B;  3EVY A;  3O9X A;  4EOZ B;  1N32 T;  4KHP T;  4DR1 T;  4DR4 T;  3I0Q A;  2QA7 A;  2X51 A;  2PJQ A;  1U5P A;  4UM3 S;  4EZ4 A;  5AQI B;  4YY3 T;  4YSY A;  3I9W A;  2LSK A;  3KVA A;  4PFO A;  1ZV4 X;  5LGT B;  1W0B A;  2WNC A;  2P9B A;  1MNE A;  1WLX A;  2XQY A;  2F4V T;  2W62 A;  2HPJ A;  2YU1 A;  1YKH B;  2JQK A;  3L09 A;  2XZ5 A;  4H9R C;  5L3G B;  4A56 A;  2UXN B;  4ERR A;  3B13 A;  1V9D A;  2UUA T;  5L2L A;  2WDQ A;  4TN7 B;  1DU2 A;  5KDM C;  4AKI A;  5DQV A;  5FVK A;  2XAS B;  2VQF T;  3OJA A;  4DR7 T;  3RI5 A;  5AQV B;  3HKC E;  3IBP A;  3OKQ A;  2MBG A;  3AEB A;  1UX2 A;  2UXD T;  4U2Z A;  1KF6 A;  5AQH B;  5AQQ B;  2BYP A;  3TKL B;  2EHO C;  2X9H A;  3IHR A;  4P1N A;  3ZSS A;  4Z90 A;  5JDL A;  3WTL A;  4GK0 E;  3KBT A;  2XTL A;  1OED A;  4H63 H;  2L9Q A;  3JC6 D;  4WNK A;  2MYS A;  5AFN A;  2Y48 B;  4PK6 A;  3WTN A;  4C90 A;  2J1D G;  2IC9 A;  1XDO A;  2WBL A;  4YXD A;  3ZT7 A;  4ZI2 C;  3C79 A;  4UIG A;  4KP3 C;  2YOE A;  2IDO B;  1KEY A;  3V5S A;  3P4Q A;  4B3S T;  2IML A;  4HGA A;  5AQL B;  4IHJ E;  2KZ7 B;  5L3C B;  2J4G A;  1VCS A;  2J62 A;  3FB2 A;  2LSY A;  5BMV E;  1SUM B;  2JRK A;  2WS3 A;  2CLY B;  3I0O A;  4UM3 A;  1LVK A;  2RP4 A;  3SS1 A;  3P8C D;  3U8K A;  2XAQ B;  2ZMA A;  2Q9Q B;  4AIU A;  1HTJ F;  2BG9 A;  5EZY E;  2DHR A;  3MJX A;  2CA5 A;  4C91 A;  4K0U A;  2VWA A;  2A2F X;  4CXW A;  4IDN A;  4U7Y A;  1S35 A;  5JDM A;  2C5I T;  2JMH A;  3E08 A;  5HWX A;  2LHN A;  3RQW A;  2D0U A;  4P09 A;  1XMQ T;  1N34 T;  2M6I A;  4UEM A;  3VHL A;  2VKO A;  5LXT E;  4UV9 B;  2HH7 A;  1W09 A;  3C84 A;  5TAO A;  4NUV A;  3GN5 B;  4ILC A;  5KMG P;  4ZZB A;  3N9O A;  4D01 A;  4OYK A;  2LSI A;  3J9X 1;  1VRB A;  4O4I E;  2QYW A;  4A97 A;  4XHE A;  3VR8 A;  5AFU L;  3AE1 A;  2RA1 A;  4YSX A;  5JQG E;  4AKG A;  2K3W A;  2NOX A;  1D1C A;  2YME A;  4UVC B;  4XBF B;  3OYX A;  3RHW A;  5BR8 T;  2BG9 E;  4LMJ A;  5F3J A;  4LFA T;  3UU8 A;  5CGM A;  2IC6 A;  1IBK T;  2UU9 T;  2DI4 A;  2XZ6 A;  1UK5 A;  1S94 A;  5LMN T;  3U8J A;  4NXM T;  2N9D A;  3P4R A;  4ZEY A;  2CXD A;  4WBO A;  3U8L A;  2X0Y A;  2LJL A;  3CPZ A;  3NZQ A;  4DVD A;  1MMN A;  3DJB A;  3NZP A;  4QH4 A;  4YTP A;  4NPP A;  4X5T A;  3LK3 B;  2BKO A;  3T4M A;  5J1G A;  3ZDG A;  3ONJ A;  5AQM B;  4LML A;  3AAE B;  3PUQ A;  4X65 T;  2YK0 A;  3UUL A;  4DMW A;  3RF1 A;  4DR5 T;  3ANW B;  4E7Z A;  3I1A A;  2XYS A;  4EAH A;  3AA6 B;  3AVR A;  3AE6 A;  3HA4 A;  2X0H A;  4ZOL E;  3QB5 K;  4O4L E;  4JI4 T;  4KBM B;  1O3X A;  2YDQ A;  4K0K T;  4MLK A;  1D0Z A;  3RYI E;  4CN1 A;  2MPK A;  2W4X A;  3CQG B;  3VRA A;  1M62 A;  5CO5 A;  3PUV F;  4JBW F;  5LB7 B;  1EZ3 A;  4MBQ A;  4JV5 T;  4B3M T;  5DAB A;  3KV5 A;  1SHZ C;  4WBN E;  3T8O A;  5JR9 A;  4OX9 T;  2ACZ A;  4GOU A;  4ASK A;  3ZMU B;  3U3I A;  2XAG B;  1WYC A;  5CB4 E;  5L4E A;  4X66 T;  2Y56 A;  5F5W A;  5EK2 A;  2X00 D;  2BBJ A;  3CML A;  3PUW F;  3IGQ A;  1T98 A;  5H6Q B;  4JYA T;  3DTO A;  2WU5 A;  1HF8 A;  3SRZ A;  4X1I E;  2LRK A;  3ANW A;  1H7C A;  3H3M A;  2WMO A;  2DCF A;  2VL0 A;  2KND A;  3QK6 A;  2LM9 A;  1WCR A;  4LF8 T;  3UFG A;  3CX8 B;  3MKD A;  1Z8U A;  5LHH B;  2VB6 A;  3AED A;  3PUS A;  4L0R A;  4ZK1 A;  4JI3 T;  3RRC A;  5CA0 E;  3UFE A;  4HFD A;  2LOP A;  1SE7 A;  3RGL A;  4L5G A;  5LGU B;  1YW0 A;  5L47 A;  2DL1 A;  4EZ1 A;  5IUX A;  1YKE B;  3OBV E;  1ZP0 A;  3I9Y A;  4QH1 A;  1NEN A;  2KLQ A;  2CXF A;  3M3Z B;  2WN9 A;  3ZDH A;  4CI3 B;  1AJ3 A;  2WDV A;  4ILB A;  4EZH A;  1UUS A;  5C8Y E;  1J1J A;  4ZZC A;  1D0Y A;  5JDF A;  1XMO T;  1MIY A;  5J2T E;  4ZI7 E;  5LYJ E;  2JMK A;  2NR4 A;  2V5C A;  4LF4 T;  1ZKE A;  4ILU A;  3LK2 B;  3JC6 C;  1IJ6 A;  4HWI B;  4X1K E;  3CX7 B;  4O2A E;  5TVC A;  3SQ6 A;  2XQA A;  2CHO A;  2FJD A;  4U33 A;  4HEA A;  4BA9 A;  3RH3 A;  3UQ7 A;  5L3F B;  1XZY A;  4OHF A;  3GMI A;  4ALX A;  2X9W A;  2K48 A;  2UUB T;  4JEH B;  2XJ7 A;  4EYU A;  1WRD A;  3GUA A;  2HPL A;  2ACX A;  5FL0 A;  3U8M A;  1FEW A;  4IE6 A;  2CWY A;  2JJ9 A;  1BR4 A;  2YN6 A;  2WQY A;  4AQF A;  2EHO B;  3EAB A;  3W15 B;  5JDQ A;  2KIN B;  2IAK A;  3EUH A;  3Q5E A;  2C9T A;  2I0M A;  3ZYK A;  2WWU A;  3P50 A;  4IE4 A;  2WAU A;  3GA8 A;  4IL4 A;  1ZOY A;  1OXZ A;  5C2T A;  3PMZ A;  2WCA A;  4O8S A;  3RC8 A;  5ABE A;  4HFE A;  3FXE B;  4UR9 A;  3SH1 A;  3C4W A;  4CI1 B;  2ODV A;  2SPC A;  3MAC A;  2ZJU A;  5ABG A;  4QAC A;  4DV5 T;  4B6X A;  1KNP A;  2QVA A;  4MFR A;  1WR0 A;  4EED A;  5SYO A;  4KX6 A;  4QXH B;  1T8B A;  3FBL A;  3JAE A;  4EXT A;  2XQ3 A;  2WNL A;  3UUN A;  4L9I A;  4DMV A;  4HTE A;  2LLY A;  2H7V C;  4IDP A;  1IZN B;  4BJN A;  3ZMS B;  4DBM A;  4DR6 T;  5AQP B;  2BJ0 A;  4HWF A;  3ZC1 A;  3KDS E;  5JRC A;  1W9R A;  3AA0 B;  4I0U A;  4PK4 A;  3B57 A;  4HFC A;  4YHH T;  4FRR A;  3QNU A;  1FMV A;  1QLB A;  5C3J A;  5HEG A;  5FP3 A;  4ISS A;  1JNR A;  1M7K A;  3RLF F;  4LF5 T;  4NXN T;  2LOS A;  3SFD A;  1QSD A;  3D0T A;  4QX8 B;  3VKH A;  4G63 A;  2LSG A;  5FXV A;  3R6N A;  3BQI A;  3K8P C;  1N36 T;  2QC1 B;  3G06 A;  4ZR6 A;  4TZ4 C;  1D0X A;  1US7 B;  4PJN A;  3C64 A;  4IGU A;  2A9U A;  4U2Y A;  4PJJ A;  5ADX L;  5AQG B;  4F8H A;  4AKL A;  1VOM A;  3ZMZ B;  3HKD E;  2NW8 A;  2X68 A;  4OFZ A;  2XQ5 A;  3TLW A;  5FVL A;  3AE7 A;  3C98 B;  4JI7 T;  1XNR T;  2XQ8 A;  4HE8 A;  4N78 D;  5CFB A;  3QOF A;  3C50 A;  5A1L A;  2C5K T;  3KFW X;  2NW7 A;  2DNX A;  3FZM B;  2YDS A;  3TLV A;  4TX5 A;  1B7T A;  4P0A A;  5AFH A;  2E9X A;  3TLS A;  2NTX A;  5AIN A;  2UXX B;  4M1P A;  3JAD A;  4XAX B;  5LNK A;  5ABF A;  2KXP B;  3CX6 B;  2CBI A;  4WZX A;  4NUU A;  4ZHQ E;  1E7P A;  2WY2 A;  3F2E A;  3J7Y q;  2Y58 A;  3JAF A;  1HS7 A;  2NP9 A;  4EB6 E;  4TWF A;  1IBL T;  3PUZ F;  2AE9 A;  3UUM A;  2XQ4 A;  2NTY A;  5HWY A;  2H7O A;  2LHR A;  3RQU A;  4UXU A;  2PGZ A;  3BQK A;  1XWM A;  4BFQ A;  5AFL A;  4UEL A;  3FZK B;  1J5E T;  3O1I A;  3PUG A;  3QC9 A;  5L4H A;  4QHO A;  3F57 A;  1IAP A;  2MAW A;  2XZE A;  5AFM A;  3N2G E;  3WTK A;  2KSR A;  2XQ7 A;  4QXC B;  4B3T T;  4ZXL A;  5LG4 A;  4TV9 E;  2VKJ A;  2X9X A;  4IT4 A;  2Y8D A;  2V1D B;  2KT9 A;  3WTJ A;  4JEU B;  4NZB A;  3PJA A;  4TWD A;  2BS3 A;  5AQR B;  4B3R T;  2BYN A;  4AFG A;  1T72 A;  2FUP A;  4Q25 A;  3RX6 A;  5HAX A;  3QB5 A;  3NKZ A;  5CJ5 A;  3AE8 A;  3PEO A;  2E9X D;  3ZN0 B;  2KWH A;  3AA1 B;  3SIO A;  2LT3 A;  4QX7 B;  1HNZ T;  3KV9 A;  1N33 T;  3LFM A;  2V6X A;  1HX1 B;  2V5D A;  4UM1 A;  2XSB A;  4LMK A;  5DQW A;  1WFD A;  2XY8 B;  2V8S V;  3RIF A;  4ZRU A;  1I94 T;  5AQJ B;  2IIU A;  5ABH A;  2K24 A;  4WYV A;  2L3L A;  1R8I A;  4ZS3 A;  2BS4 A;  2WZH A;  2XYT A;  1KK7 A;  4HQP A;  3B5M A;  3T1Y T;  3PTR B;  3PU8 A;  3WAJ A;  3EI0 A;  4H63 V;  4JUY A;  4BJM A;  4Z91 A;  5HYA A;  5HXC A;  3KVB A;  4CI2 B;  5AQT B;  4TV8 E;  3JCF A;  4X64 T;  4AKH A;  3Q5D A;  3ETU A;  2Y54 A;  3FZH B;  5J5G A;  2X9Y A;  3AEA A;  2XM2 A;  4JI0 T;  3LBX A;  5J5F A;  3P4W A;  1FMW A;  2L8K A;  3ZJ1 A;  3HR0 A;  5LBM A;  3CIR A;  4E7S A;  3ZST A;  3AEC A;  4U31 A;  3PJA J;  4U7I A;  4CN4 A;  2Y57 A;  1FJG T;  4NIQ A;  2ZM2 A;  3MZK B;  3PU3 A;  2V7M A;  3NRX A;  4CQI A;  2X66 A;  2JIW A;  1YXR A;  2V7I A;  3GWH A;  2XNV A;  3V5U A;  5IWA T;  2MTQ A;  1Z0P A;  2UXB T;  2N1G A;  1KFY A;  4JI6 T;  4YTM A;  3ETV A;  4Z8X A;  2Q9Q A;  4UF0 A;  2DWK A;  5EK4 A;  2V6Y A;  2M67 A;  5JH7 E;  3Q9D A;  3OYZ A;  4YLH A;  4V1A v;  5LGN B;  3ZMT B;  3FXD B;  2WU2 A;  1I9B A;  2PBI A;  2FJA A;  4A98 A;  4DV6 T;  5BRX A;  2VKH A;  2XM1 A;  5HXE A;  1BR1 A;  2JQ9 A;  4HWD A;  5AFK A;  2XAJ B;  5AQK B;  3HL6 A;  2G0U A;  4DUY T;  1X79 A;  3P4P A;  4DV2 T;  3RRW A;  1MMA A;  3LDQ B;  4H9O C;  5E0O A;  3S4U A;  3P4S A;  4EV6 A;  3M65 A;  3N2O A;  4HFV A;  3SOL A;  2W66 A;  2WM9 A;  5L3B B;  2V7J A;  2VQE T;  2W2U A;  4OK0 A;  3RYH E;  5JRE A;  2ZM0 A;  4XZC A;  2JPF A;  2BR8 A;  4GIW A;  1WYB A;  2XQ6 A;  2N2N A;  1ZHC A;  4LFC T;  2CXL A;  1KNR A;  4ZI2 D;  3K1S A;  3KV6 A;  4HN9 A;  3NVO A;  2VAS A;  2W0G A;  5FMN A;  3E22 E;  3VRB A;  4EGW A;  3F31 A;  5ETW A;  2OLT A;  3UU3 A;  4I4T E;  4PAG A;  4GYS A;  2D0T A;  1D1B A;  2LM2 A;  3SFE A;  5FY7 A;  2A3D A;  4PNI A;  4QH5 A;  3RC3 A;  3ZKR A;  4WV9 A;  2CWO A;  5FL1 A;  4IE5 A;  4PW8 A;  2LEH A;  4AXP A;  3SWH A;  3PUR A;  2CM0 A;  3ZCI A;  2XQ9 A;  1CUN A;  5JVD E;  4YT0 A;  3MA9 A;  5JR9 C;  2V26 A;  5FY0 A;  3AVS A;  2WMN A;  3RKG A;  4CZZ B;  4OYJ A;  3NWI A;  4UM3 P;  5J5H A;  3AXJ A;  1Y01 A;  4ANJ A;  5KXJ A;  2XHE B;  4AI6 A;  3AAI A;  5AQS B;  2BBH A;  1HFA A;  4QAA A;  3H3A A;  4H9S E;  5HCJ A;  5JDG A;  5JDH A;  3O4X E;  3RIA A;  1NWM X;  3N9Q A;  4O4H E;  1YQ4 A;  4AIS A;  3UUX B;  3FBZ A;  3AA7 B;  3L39 A;  2NWB A;  5DJQ C;  2E2A A;  1OED C;  3Q5W A;  4DV4 T;  3AEG A;  1E1H B;  3UQ4 A;  2PH9 A;  1HR0 T;  3RIU C;  3DP7 A;  5HXH A;  3HI2 A;  5AQO B;  5FNV E;  4HKA A;  2W8F A;  2CPT A;  1LKX A;  4U72 A;  2UZ6 A;  2AXD S;  2LSJ A;  2V6Y B;  3EDV A;  4UVA B;  2V7L A;  2W61 A;  3N9L A;  1UV6 A;  5LG3 A;  2BYR A;  3P7I A;  2E9X B;  1W0A A;  2C5J A;  3ABV A;  5HXR A;  3AE2 A;  1UCU A;  5LCY A;  2LE8 A;  2BKP A;  5BW2 A;  3RKO A;  2XNT A;  2DWG A;  2QGS A;  4HFI A;  4YHJ A;  4QKN A;  3UU6 A;  2I6H A;  3EDU A;  2E8I A;  2E9X C;  4TUY E;  1Y64 B;  3L3P A;  3O1H A;  4EYY R;  4JI2 T;  2WWV A;  2MOZ A;  1E2A A;  4GYR A;  5ABF B;  2D5U A;  2UUC T;  3OVU A;  4YJ3 E;  1KNZ A;  2VK9 A;  4ZI3 D;  2FJB A;  4GK5 E;  3AE9 A;  2XPK A;  4MAL A;  2YU2 A;  3UTK A;  3R84 B;  5HEO A;  5LXB A;  2W63 A;  5LOV E;  2IHR 1;  2XAF B;  3ZJ2 A;  3L8R A;  5KZU A;  3ZYL A;  3T1H T;  3RYC E;  1CHU A;  4ZI3 C;  3C51 A;  1HG5 A;  3WTH A;  2BZB A;  5FXW A;  3WTO A;  3K3O A;  4TWH A;  5KX5 E;  4YJ2 E;  2W67 A;  4LF9 T;  1UX4 A;  3A5X A;  2ZJV A;  2FBW A;  3BQL A;  4UV8 B;  4QXB B;  5HCM A;  1UX5 A;  4DR2 T;  5IHY A;  4P0B A;  5L3E B;  3LJC A;  5FYM A;  3VU7 H;  3K3Q C;  2E5V A;  5J5I A;  1MND A;  2H88 A;  4O2B E;  2VL8 A;  2W00 A;  1NEK A;  2XSA A;  4PK5 A;  4DV0 T;  3UU4 A;  4F6R C;  3NRY A;  4YFS A;  5JR9 B;  2QRX A;  2VUR A;  4AFT A;  3AE5 A;  4ZS2 A;  2OA5 A;  3AEE A;  4JI5 T;  4ADZ A;  5CA1 E;  4DO0 A;  4DBR A;  2CE7 A;  3SQ9 A;  5JTG A;  4UY2 A;  2YKS A;  3AXJ B;  4JI1 T;  3U78 A;  4FI5 A;  3TLT A;  2YEV C;  2M6B A;  1HNW T;  5JRC B;  1YQ3 A;  4AQF C;  4I50 E;  4DUZ T;  3IA3 A;  2V7K A;  2WZI A;  2CBJ A;  4MHC A;  4I55 E;  1JNZ A;  3PUX F;  4UXN B;  5FY1 A;  2YDR A;  4TNW A;  5FXX A;  1VCT A;  1MMD A;  2BS2 A;  3ZCJ A;  1LRZ A;  3HKE E;  3E0Z A;  5AQU B;  3RYF E;  5LJM A;  2VVN A;  2VKD A;  4IIJ E;  3IF8 B;  2EHO D;  3PUA A;  5LP6 E;  2BYQ A;  4CXX A;  2LRL A;  2BR7 A;  2Q9Q D;  3Q5X A;  5IYZ E;  4AKR B;  2HN1 A;  3AEF A;  4A5X A;  4IE7 A;  3O1J A;  3LG7 A;  2WDR A;  3GN5 A;  4KUM B;  1L0V A;  4BQT A;  5BP0 A;  3EAM A;  3N9N A;  3AAA B;  4IDO A;  2BG9 C;  2R6G F;  4FJO A;  1HNX T;  4O4J E;  4QAB A;  5J2U E;  2JQH A;  3WTM A;  2J47 A;  4PJL A;  2RPA A;  4JLE A;  4X20 E;  4AFH A;  3CVR A;  3CK6 A;  4LF7 T;  3ZC0 A;  4X1Y E;  2BG9 B;  5LHG B;  2K9A A;  2FJE A;  4H9P C;  3WAK A;  4ILA A;  3C4X A;  4KMC A;  4LF6 T;  4TNV A;  5KE4 A;  4QWN B;  3WI3 A;  4GKK T;  4DV3 T;  2JQQ A;  5LBQ B;  2ZM6 T;  2OV9 A;  4COF A;  3TLU A;  4IE0 A;  3LK4 2;  5LMU T;  4ZK4 A;  4LFB T;  4KI0 F;  3N2K E;  4HFH A;  2BVL A;  5FJV A;  2B76 A;  4DV1 T;  1QUU A;  3AE4 A;  3ONL C;  4YTN A;  1NAF A;  3X1D A;  4ZJS A;  5HEH A;  2NW9 A;  5JME A;  4PIR A;  4UF0 B;  3UU5 A;  2WB5 A;  1IBM T;  1OED E;  1FIO A;  1G8X A;  2I59 A;  4HFB A;  5LHI B;  3CQC B;  2H3R A;  1UUR A;  3RPU A;  2C0S A;  1X9B A;  2Q9Q C;  5HXS A;  4ZJT A;  3RIU A;  5AFJ A;  1XNQ T;  1OWA A;  2CEA A;  2BDE A;  2EHO A;  1MMG A;  2BYS A;  1G73 A;  1GQE A;  4IST A;  3KV4 A;  1HCI A;  5J0Z A;  3ZT5 A;  2CMR A;  1LVF A;  4EEB A;  4B5D A;  3QUJ A;  3WIP A;  3PV0 F;  5EK3 A;  5F8P A;  3N5L A;  3HKB E;  2PFV A;  2H89 A;  1UW6 A;  3A7M A;  2XNU A;  4XK9 A;  2D2S A;  4DID B;  4IL9 A;  3OTO T;  2Y7Y A;  1T7S A;  5FKY A;  2CLY C;  1BR2 A;  4H9Q C;  1MIW A;  3KIN B;  5GON E;  5LA6 E;  2E5L T;  1YD8 G;  2ODU A;  3UUB A;  4CXY A;  4GKJ T;  4AQY T;  2CCQ A;  2BKN A;  5M4Y A;  4AQG A;  3FZF B;  4KHZ F;  3PUY F;  2W8G A;  5HEU A;  3CQX C;  3A8Y C;  3MK7 C;  3EHZ A;  1IJ5 A;  3CKD A;  3H37 A; 
#chains in the Genus database with same CATH homology
 2XYT A;  3RQU A;  4HFB A;  4HQP A;  4UXU A;  3GUA A;  4QH5 A;  2PGZ A;  3T4M A;  3ZKR A;  4BFQ A;  3ZDG A;  1I9B A;  4WV9 A;  3EI0 A;  3WTH A;  5AFL A;  4LML A;  3U8M A;  4A98 A;  3RI5 A;  5HEJ A;  4ZK1 A;  5BRX A;  4ZJT A;  2YMD A;  5AFJ A;  4Z91 A;  2BYQ A;  2YN6 A;  3WTO A;  2QC1 B;  4TWH A;  2BR7 A;  2XYS A;  4ZR6 A;  5L4H A;  3RQW A;  4HFD A;  2W8F A;  2MAW A;  5AFM A;  2C9T A;  2M6I A;  1UX2 A;  3WTK A;  2KSR A;  2BYS A;  2UZ6 A;  2XQ7 A;  2ZJV A;  2WNJ A;  2X00 A;  5AFK A;  3P50 A;  5HCM A;  2LKH A;  5L47 A;  2BYP A;  5AFM B;  4EZ1 A;  4BQT A;  5IUX A;  5BP0 A;  4IL4 A;  1UV6 A;  3C84 A;  2XQ9 A;  4F8H A;  2Y54 A;  4Z90 A;  3PMZ A;  5LG3 A;  5J5G A;  3EAM A;  3WTL A;  2BYR A;  5J0Z A;  4ILC A;  1OED A;  4ZZB A;  4D01 A;  2LKG A;  2XQ5 A;  3TLW A;  4B5D A;  2BG9 C;  3WTI A;  4HFE A;  3WIP A;  5J5I A;  4IRE A;  5J5F A;  4QAB A;  4QH1 A;  3P4W A;  3WTJ A;  4A97 A;  5AFN A;  5BW2 A;  3WTM A;  2XNT A;  5CO5 A;  2WN9 A;  1UW6 A;  3U8N A;  3ZDH A;  2XQ8 A;  4HFI A;  2XNU A;  4UM3 P;  3SH1 A;  4XK9 A;  3UU6 A;  5CFB A;  4XHE A;  4ILB A;  3WTN A;  2ZJU A;  4NZB A;  4AFH A;  2BG9 B;  4QAC A;  4IL9 A;  4TWD A;  4ZZC A;  2Y57 A;  3TLV A;  2BYN A;  2Y7Y A;  4ILA A;  4QAA A;  5SYO A;  4AFG A;  5AFH A;  2WZY A;  2YME A;  3UU4 A;  3TLS A;  3RHW A;  5HCJ A;  5AIN A;  1OED B;  3C79 A;  2BR8 A;  2YOE A;  3JAD A;  2BG9 E;  4UM3 S;  4LMJ A;  4AFT A;  3UU8 A;  4TNV A;  2XQ6 A;  5KE4 A;  3JAE A;  3PEO A;  2XQ3 A;  3RIA A;  3SQ9 A;  2XNV A;  5J5H A;  2WNL A;  4COF A;  2XZ6 A;  2WNC A;  4UY2 A;  3UUB A;  2YKS A;  3TLU A;  5L4E A;  3SIO A;  2Y56 A;  4ZK4 A;  2LLY A;  5TVC A;  3U8J A;  2X00 D;  3TLT A;  3SQ6 A;  2M6B A;  2XQA A;  3IGQ A;  4UM1 A;  4DBM A;  4LMK A;  3RIF A;  4ZRU A;  4HFH A;  2Y58 A;  3JAF A;  2BJ0 A;  2XZ5 A;  5FJV A;  1OED C;  3U8L A;  4TWF A;  3UQ7 A;  4UM3 A;  2VL0 A;  2W8G A;  5HEO A;  5LXB A;  3UU3 A;  4HFC A;  5HEH A;  4ZJS A;  4ALX A;  3LSV A;  4TNW A;  5HEU A;  3UQ4 A;  4FRR A;  4PIR A;  3U8K A;  5JME A;  2PH9 A;  2LM2 A;  2XQ4 A;  3EHZ A;  5HEG A;  3UU5 A;  4QH4 A;  5KZU A;  4NPP A;  2BG9 A;  4X5T A;  1OED E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...