4HFIA

The glic pentameric ligand-gated ion channel at 2.4 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfiA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfiA01
4D01A 3GUAA 3WTJA 2YKSA 4IREA 5HCMA 2Y58A 4ALXA 2XQ6A 3IGQA 2M6IA 5HEGA 3TLUA 3P50A 4IL4A 4ZJSA 2BYNA 4QH1A 3WTKA 1OEDC 2BYSA 4ILBA 4QH4A 3UU3A 4COFA 3UUBA 3U8JA 3RQWA 3RQUA 2YOEA 5JMEA 2QC1B 5HEOA 4QH5A 3TLTA 4ZZBA 2Y56A 3JADA 3UU8A 3ZDGA 4ZRUA 2WNCA 4QABA 2XQ9A 4HFIA 4A98A 2MAWA 1I9BA 3U8LA 1OEDE 2WNLA 2BR8A 3WTOA 2YN6A 4LMLA 4PIRA 3RIFA 3UU5A 4XK9A 4WV9A 4ZR6A 4NPPA 2WN9A 4Z91A 5J5IA 4UM1A 2BJ0A 2PH9A 5FJVA 1OEDA 2W8FA 2XNTA 3RHWA 4IL9A 2WNJA 5HCJA 3JAFA 5BP0A 5AFKA 1UX2A 2VL0A 4NZBA 5AFNA 4A97A 3TLVA 3ZKRA 2Y54A 3RIAA 4LMKA 5KZUA 3EAMA 3ZDHA 2XQAA 2C9TA 2XZ6A 5BW2A 4QACA 4UY2A 4ZJTA 4Z90A 2UZ6A 3UU6A 2Y57A 5HEJA 5L4EA 5AFMA 5LG3A 3LSVA 5L47A 5TVCA 2XQ3A 3C84A 1OEDB 4LMJA 4AFHA 3EHZA 4X5TA 4ZZCA 3U8MA 4HQPA 2LKHA 4TWDA 5CFBA 1UW6A 2W8GA 3PMZA 4TWFA 1UV6A 4XHEA 4BFQA 4TNWA 5L4HA 3SQ9A 5HEUA 3U8NA 4HFDA 3SH1A 2WZYA 4FRRA 2Y7YA 2BYRA 4BQTA 2X00A 5BRXA 5CO5A 3SIOA 3WTIA 5AFLA 5SYOA 2LKGA 3PEOA 4AFTA 2YMEA 4TWHA 2BG9A 5AFHA 3WTNA 2XQ5A 3U8KA 3TLWA 4HFHA 2XZ5A 3EI0A 2YMDA 2BG9C 3WTMA 2XYSA 4TNVA 3WIPA 3SQ6A 3RI5A 2XYTA 2LM2A 2KSRA 2M6BA 3TLSA 3JAEA 3UU4A 2ZJVA 5LXBA 3WTHA 4UM3S 2XQ8A 2XNVA 4EZ1A 4UM3A 4ZK4A 4ILCA 2PGZA 2BG9B 3UQ4A 5AFJA 3T4MA 4ZK1A 3WTLA 2ZJUA 5J5HA 4UXUA 4F8HA 2BG9E 2BYQA 4HFBA 5J5FA 4HFEA 5AINA 3P4WA 5IUXA 4B5DA 4QAAA 2XQ7A 5AFMB 3UQ7A 2XQ4A 2LLYA 5J5GA 5J0ZA 2BR7A 4UM3P 5KE4A 4HFCA 5HEHA 3C79A 4DBMA 4AFGA 2BYPA 4ILAA 2X00D 2XNUA
chains in the Genus database with same CATH superfamily
4JBWF 1Y64B 2Y58A 3CWZB 4IDPA 2Q9QA 5E0OA 3NZQA 4LFAT 3SOLA 3UU8A 2WNCA 1WCRA 1Z0PA 1X9BA 2YN6A 4ZR6A 2VKJA 2WN9A 3HI2A 2DCFA 3FBLA 4IIJE 3LFMA 2BBJA 2CXLA 5JDHA 4JI2T 4N78D 2X9YA 2WS3A 5HEJA 2AXDS 3P7IA 4O4LE 2N1GA 4LMJA 3UUNA 3JC6D 3ONJA 5FNVE 3P4RA 3RYHE 3MXZA 4IHJE 1MMAA 5HXCA 2BYRA 3VRAA 5L2LA 4UELA 3CVRA 3AAAB 4TWHA 4DUZT 2E5VA 2BG9A 3AVSA 2XQ5A 2BS3A 3PUXF 4DBQA 2XM1A 1SE7A 3I1AA 2XYTA 2ZJVA 2JQQA 5LXBA 4UM3A 1UGOA 4EAHA 2YDSA 2X68A 4CXWA 4F8HA 3T1YT 3RKOA 5IUXA 2XQ7A 3RRCA 4Q25A 4UR9A 3MK7C 5C2TA 2WY2A 2VVNA 4H63V 4JYAT 2X00D 5HXEA 4ISTA 4UVAB 4YY3T 3P50A 1KNZA 2WDRA 4YJ2E 2XUEA 1CHUA 3UTKA 3CMLA 2C5IT 3ABVA 4YLHA 3AB3B 2HN1A 2IAKA 3OJAA 4NPPA 4JI7T 1SA0E 4NUUA 3KVBA 2ES0A 1VOMA 3RF1A 4ZJTA 3IF8B 3RLFF 4PK4A 1Y01A 5H6QB 4B3RT 4XHEA 2HH7A 5HEUA 3PUAA 3ZC0A 3N2KE 2ZMAA 5AQLB 4TZ4C 2Z6EA 4FJOA 2JQHA 4CXYA 2XYSA 2FJEA 5LBMA 2WWUA 4BJNA 4OYKA 4YHJA 4TV8E 4AKHA 2DL1A 3SFEA 3UULA 3EDVA 1HF8A 3O1HA 3DP7A 1ZHCA 4JEHB 1FMVA 5AQSB 3VR9A 3ZYLA 3UT5E 5J2TE 1UURA 3ANWA 4AKIA 2I6HA 4ZJSA 3I9WA 2V6XA 4ILBA 2CBIA 4LF9T 3U8JA 2QGSA 1J1JA 5AQKB 5LYJE 5KDMC 1LVFA 4QABA 3N9LA 4IE5A 2K9AA 2A72A 2AE9A 1HNZT 3HKEE 3UU5A 4HWFA 1HFAA 2FJDA 4IL9A 2IMLA 4C90A 5BP0A 2JJ9A 2EHOA 5HWXA 3FZHB 1T98A 2RP4A 3RRWA 3ZKRA 3RIAA 2ZLYA 2XQ3A 3SRZA 2W8GA 3AA0B 1UV6A 1GQEA 4TN7B 4TNWA 2IW5B 2XAGB 2YU2A 4DR5T 2NTXA 2FJAA 4AIUA 3ETUA 3CX7B 2GK9A 4O4IE 3WTNA 3NRXA 3WAKA 2C5KT 2WP9A 3AA6B 2JQKA 2LRLA 3JAEA 2X9HA 5JDLA 3FHNA 4TX5A 4QXHB 2E9XB 2X9XA 4OHFA 2DNXA 2WU5A 2V26A 2BG9E 3PU8A 3P4WA 4MFRA 3E0ZA 2YU1A 4LFBT 3FXEB 2ZM2A 3ZLIA 3RPUA 4P0BA 5A1LA 4DBRA 2MYSA 4EGWA 4LF4T 1W09A 1UX5A 2SPCA 4U31A 4EYUA 4QH4A 3GN5A 4DIDB 2BVLA 3RH3A 4FI5A 4QHOA 4ZZBA 3UFGA 4C91A 1Z8UA 3CK6A 4I43B 1XZYA 1MMNA 5JDMA 4XK9A 4Z91A 4UM1A 1BR2A 5IHYA 2K24A 1BR1A 4WZXA 5CA0E 2CM0A 2XHEB 5ABGA 3AE3A 2CE7A 5KZUA 4UY2A 4HN9A 4L9IA 2KNDA 2XAQB 3AE2A 2CEAA 2CXFA 3HKDE 3SWHA 2CRBA 4ZOLE 3H3AA 5F8PA 2UUBT 5SYOA 2OV9A 2V7IA 5EK2A 4AQFC 3ZT5A 2LSGA 2XSAA 4I55E 1BR0A 4ZI3D 1VRBA 2XAJB 3RC8A 2DWGA 5AFUL 5LA6E 2CPTA 2N2NA 3WTLA 5BMVE 4KHPT 4HFEA 5KMGP 1XMQT 4P09A 3EUHA 2NW7A 4O2AE 5H6RB 4L0RA 4UV8B 4CZZB 2XNUA 3CQCB 4DR6T 2V7LA 4ZEYA 3BK9A 2XM2A 3PTRB 4EIWA 2BYNA 2Y48B 1SUMB 4DV5T 2PBIA 3AECA 3JC6C 3ETVA 2JMKA 4U7IA 5F3JA 2VB6A 2KXPB 3PUVF 1M62A 3L39A 3M65A 3O1IA 1FMWA 3E08A 3VHLA 4H9QC 2L9QA 1HNWT 2NWBA 3PDYA 1XNQT 4IT4A 1HTJF 4PK5A 5AFKA 5AQMB 1JNRA 4A97A 4YSZA 4HFVA 2Y54A 4YTPA 2V5CA 4H9OC 2XAFB 5FXVA 5TVCA 1OEDB 4X65T 1R8IA 5LGNB 3SQ9A 2BS4A 2D0UA 4LF5T 2Y7YA 4DUYT 5CO5A 5JTGA 4DR1T 5LGTB 4ZXLA 5HXSA 4AFTA 4H9SE 4ZI7E 3ZMSB 4AXPA 2CA5A 5LJMA 1IZNB 5L3GB 1OWAA 1J5ET 2KWIB 1KNRA 1KFYA 4DV6T 1T72A 3KBUA 4YTNA 2X67A 5AINA 3WI3A 2UXNB 2K3WA 2PG8A 4BAYB 4U7YA 3MA9A 3AXJB 3AEEA 5FY1A 4YFSA 5HEGA 1VCTA 5JRCB 3ZMTB 3D0TA 3P4PA 2LSIA 5L3BB 2J47A 3RIUC 4HFIA 4A98A 2OLTA 3AEBA 3QB5A 1AJ3A 4HGAA 5J5IA 2Q9QB 2BJ0A 5AQRB 1L0VA 4H63H 3ZC1A 3ZCJA 3A7MA 2LSYA 2NW8A 1XMOT 3P8CD 4CN1A 3I9YA 3CIRA 4EEDA 5AQNB 5CFBA 4BFQA 4TWFA 4ASKA 5ABFA 4IGUA 4QXCB 5LHIB 2WZYA 4HE8A 3SIOA 3PJAA 5EK3A 4JI0T 4U2ZA 2BZBA 5FVLA 4X62T 2ODUA 3FZKB 1W0BA 3V5UA 3OBVE 5JR9C 4B3MT 1WFDA 4KBMB 1KF6A 3Q2MA 2BG9B 2W0GA 5FXWA 1U4QA 4HFBA 1US7B 3X1DA 1QSDA 4WBOA 2BVMA 5LOVE 5J5GA 5AQVB 1YXRA 4ZS2A 5HEHA 3LG7A 2H7VC 2ZM6T 1HG2A 4IREA 4UIGA 3AA7B 4IL4A 3NVOA 2XAHB 4QH1A 3OVUA 1FIOA 1YQ3A 3FZFB 2WAUA 5JMEA 5FL1A 4DMVA 3S4UA 3AE6A 4YTMA 5J1GA 2MPKA 3RKGA 2IC9A 4I50E 3TLVA 3Q9DA 4MBQA 4CN4A 4CN6A 2UUCT 5FYMA 4EXTA 2H89A 1W0AA 3C4WA 4ZZCA 4BA9A 3UUMA 3ESLA 3ZN0B 1G8XA 2V7KA 4HEAA 4UF0A 3O9XA 2D9DA 4JI8T 4XBFB 3FZLB 4AKGA 3PEOA 3OTOT 3VKHA 4DV3T 3BQIA 2CHOA 2E8IA 3BQLA 5DJQC 3EI0A 3K3NA 1IBMT 4ILUA 1HG5A 2XPKA 1XDOA 4EYYR 2XQ8A 3GA8A 3N5LA 5AQPB 5J5HA 5IYZE 3JCFA 2VASA 2W66A 5JDGA 2HN2A 4HTEA 2HPLA 5AFMB 4U3CA 1MMDA 2LLYA 5KE4A 2NP9A 2LOPA 4E7ZA 4LFCT 4DNDA 2CLYB 3B5MA 4QWNB 4D01A 3LBXA 5HCMA 2E9XD 4DR7T 3QB5K 3CKDA 1OEDC 4H9RC 3LDQB 2B76A 4IE6A 3C98B 4JLEA 5HEOA 4QH5A 4UVBB 5L3DB 3K1SA 3ANWB 3PU3A 5LCYA 4Z8XA 3Q5XA 3U8LA 2WNLA 4HWHA 3VRBA 4IDZA 2PH9A 2NR4A 4ZI3C 2XNTA 2W2UA 3LK2B 2WNJA 4GIWA 5JDQA 3PUZF 5HCJA 2VL0A 5FKYA 2JRKA 5JQGE 3ZDHA 3Q5WA 5DQWA 3W15B 3EVYA 5L47A 2UXBT 2WM9A 1D0ZA 4XAXB 3EHZA 2H3RA 1IJ5A 5L3FB 3ZT7A 1KEYA 1HNXT 2QRXA 2EHOB 4HFDA 3U78A 4HWDA 3IHRA 2X00A 2E2AA 4UVCB 4X1KE 1MIYA 1NENA 2I59A 3OPCA 3TLWA 3WTMA 5CJ5A 2XSBA 4TNVA 3A5XA 3ZYKA 5GONE 2M6BA 2ZM0A 4EB6E 2M67A 2Y6XA 3ZMVB 3C51A 4KP3C 2IIUA 5C3JA 1XWMA 1N33T 3ONXA 2DI4A 3C50A 4X1YE 5JH7E 3ZYMA 3SS1A 4OFZA 4AQGA 4KX6A 4BJMA 5AQTB 2XQ6A 3AVRA 4GYRA 4UV9B 4GK0E 1O3XA 2BKNA 3WTKA 2KLQA 5JDNA 4ISSA 3CQXC 4GKJT 3ZT6A 3RQWA 1T8BA 3RQUA 4JI3T 3RIUA 5LGUB 4MLKA 4QX7B 3TLTA 3K3OA 2WBLA 1T7SA 1N36T 1ZEEA 3GMIA 3RIFA 3DJBA 3GN5B 2W8FA 2V6YB 3VKGA 5HXRA 1IBLT 1V9DA 4K0KT 3OYXA 2YDQA 3UU6A 1MNDA 2BS2A 1WRDA 4AISA 2YK0A 4ZI2D 4WNKA 4FRRA 3NWIA 4IE7A 4PFPA 3MKDA 4PFOA 1XDPA 2YINA 1UK5A 3U8KA 4IDQA 4HFHA 2YEVC 4O8SA 4MALA 5DQVA 3PUQA 5JR9A 5CA1E 1NWMX 3N9PA 3CX6B 2HHHT 2LSJA 3KV5A 3TKLB 3KFWX 4E7SA 5TAOA 1WR0A 3A8YC 2DLRA 3RYFE 2XQ4A 3PUWF 2LT3A 2WDQA 3PUGA 2VK9A 4IE4A 2CWYA 2MBGA 4DBMA 3WTOA 1D0YA 1DU2A 5LXTE 3O1JA 3KV4A 3J7Yq 1E7PA 5AQJB 2FBWA 3G06A 2VKDA 5FXZA 3IBPA 2D2SA 3L09A 4UXNB 3EABA 2XQYA 3N2GE 4XZCA 5ABEA 2QYWA 2JIWA 1LVKA 3AEDA 1I94T 3QC9A 3N9QA 4NZBA 5EZYE 1LKXA 4PJMA 2D5UA 3KBTA 4PJJA 4QACA 1HX8A 2VQET 2X66A 5AQHB 2LEHA 3P4SA 5LP6E 3U8MA 3PMZA 4X20E 2ZM8A 4J2CA 3AE7A 3U8NA 3SH1A 1D0XA 2E5LT 2Q9QD 3P4QA 5AFLA 1YD8G 1HX1B 2CLYC 3PURA 2NOXA 2W61A 2YDRA 4HKAA 5AFHA 4JV5T 2LOSA 2XZ5A 2YMDA 3TLSA 2XY8B 5FL0A 5FY7A 1VCSA 4EV6A 3UQ4A 2ZJUA 4DR2T 3HR0A 4JI6T 3O4XE 2UXCT 4YHHT 2XZEA 4CXXA 4ZS3A 3AEAA 2BKOA 4HFCA 3B57A 2BYPA 3OKQA 3PE0A 1N34T 2X0HA 2XTLA 4DR3T 2WMOA 2VQFT 4ANJA 2MTQA 3H37A 3ZMUB 2XJ7A 3HKBE 3J9X1 4AKRB 2XQ9A 4F6RC 3H3MA 2MAWA 5LG4A 4B3ST 2WU2A 2DHRA 3RX6A 4AKLA 4LMLA 2KINB 2LHRA 5AQUB 3F31A 5L3EB 1UX2A 4MHCA 5FXXA 4U2YA 4A56A 2ODVA 4DV4T 2F4VT 4AFHA 2LKHA 3C4XA 2DWKA 1D1CA 2LJLA 3RC3A 2IC6A 5LJNA 1H7CA 2E9XC 2X0YA 3FXDB 4GYSA 5JRCA 5FMNA 2K5BB 3HKCE 3AA1B 2LM2A 2KSRA 1WYCA 2PFVA 3ZSSA 1HS7A 2CBJA 2VL8A 4ZK4A 5KX5E 2UXXB 3KV6A 1I6ZA 3IEEA 4DO0A 4UXUA 1BR4A 4CI1B 3L3PA 5JDFA 4G2AA 4JI5T 2I0MA 4L5GA 4P1NA 1YW0A 3AAEB 4X64T 3R84B 2VKHA 4AFGA 2N9DA 3KDSE 2VURA 4ALXA 1E2AA 1KNPA 3GWHA 4QKNA 4CI3B 5AQIB 2FUPA 3CPZA 1B7TA 2D0TA 4ZRUA 3K8PC 2RPAA 5FVKA 1MIWA 3V5SA 3AAIA 4WV9A 4YSXA 1UX4A 4WBNE 1FEWA 1G73A 3HA4A 4X1IE 3EAMA 2WDVA 4Z90A 2CWOA 5L3CB 3AE1A 4JI4T 4TWDA 2KMFA 5LHHB 3WTIA 2A9UA 4PAGA 4O4JE 2R6GF 3AEFA 4DV2T 5DABA 4UF0B 4IDOA 2XNVA 4GK5E 3PUSA 2EHOD 4AQFA 2PJQA 1NAFA 5J5FA 5AQQB 4DR4T 4QAAA 4ZHQE 4KHZF 1N32T 2J4GA 2BR7A 2KWHA 2BYQA 1LRZA 1UUSA 2L3LA 3TLUA 4OK0A 2X0LB 4HWIB 4H9NC 4ZI2C 3UUBA 5EK4A 2QC1B 3KINB 3LBXB 2Y56A 2WMNA 3JADA 2VVSA 4PNIA 2UXDT 1OEDE 5LB7B 2BR8A 3F2EA 2WQYA 3ZJ1A 4YXDA 2QVAA 2V8SV 2CCQA 3AE8A 3JAFA 4KMCA 4JEUB 3M3ZB 1YKEB 1WR6A 2H88A 1ZP0A 2K48A 2C9TA 1X79A 3AE9A 5IWAT 1ZV4X 5AFMA 3FZMB 1M7KA 3T1HT 2XASB 1KK7A 4IE0A 4X5TA 2WB5A 3I0QA 2W00A 4B6XA 4QX8B 1QLBA 3BQKA 4PJNA 5BRXA 2NTYA 2V1DB 1YKHB 5LMNT 3KVAA 1YQ4A 5LMUT 2FJBA 3QUJA 3WIPA 3SQ6A 4YT0A 1HCIA 2ACXA 5BR8T 2IHR1 3L8RA 3EDUA 3WTHA 3OYZA 4EZ1A 4PK6A 4ILCA 2IDOB 3T4MA 4PJLA 2BBHA 2HPJA 4GKKT 1EZ3A 4DMWA 5F5WA 2A3DA 1D1BA 1E1HB 2KT9A 4U74A 4K0UA 4LF8T 3QNUA 5HYAA 4NXNT 5AQOB 3CX8B 3ZN1B 3UUXB 5HAXA 4I0UA 3PUYF 3MACA 2RA1A 4AI6A 4PW8A 2Q9QC 2PTFA 1CUNA 2V5DA 2QA7A 5C8YE 1SHZC 4O2BE 2WCAA 2WZHA 4LF7T 3F57A 4EZHA 4DVDA 4B3TT 4KUMB 1W9RA 5AFNA 5FP3A 2IUBA 1QUUA 4LMKA 4TUYE 5BW2A 2W62A 1ZOYA 2Y57A 3VR8A 5LG3A 3LSVA 2H7OA 2OA5A 4NXMT 4G63A 2VKOA 5ABHA 5L4HA 4U72A 4QXBB 4X66T 2E9XA 3ZPOA 3K3QC 2CHNA 2V7JA 4TV9E 2J62A 3VU7H 2BG9C 4ADZA 4JUYA 5AQGB 3FB2A 4U33A 3T8OA 3UU4A 3ZEFB 4YSYA 5AFJA 4ZK1A 2UU9T 4NUVA 5JR9B 2C0SA 3HL6A 2V6YA 4YJ3E 3UQ7A 1XNRT 3AEGA 3PJAJ 2LM9A 4ILAA 3Q5DA 1NEKA 2YKSA 3ZSTA 1IJ6A 2NW9A 2M6IA 3IGQA 3IA3A 5LHGB 3RGLA 5ADXL 4A5XA 3NBXX 5LBQB 1MIVA 2BDEA 5CGMA 3ZMZB 5HXHA 4H9PC 4V1Av 4DV7T 2CXDA 3ZDGA 2BKPA 1I9BA 3FBZA 2KZ7B 2X51A 5M4YA 3C64A 2JMHA 3B13A 3MZKB 3N9OA 1J5WA 1S35A 2XQAA 4WYVA 4M1PA 1UCUA 3C84A 3KV9A 5CB4E 2B1EA 3LJCA 1MNEA 3NKZA 4WW0A 5KXJA 2L8KA 4P0AA 2LSKA 3I0OA 1S94A 2W67A 1ZKEA 5JVDE 3N2OA 3RI5A 1IAPA 2UUAT 3SFDA 3ONLC 4DV1T 2P9BA 3NRYA 4UM3S 2X9WA 2Y8DA 2PGZA 1HR0T 2J1DG 1WLXA 3ZJ2A 5HWYA 3RYIE 1OXZA 4B5DA 4I4TE 4OYJA 4OX9T 5J0ZA 4UM3P 4NIQA 2LRKA 3C79A 4ERRA 3AE5A 2A2FX 3GUAA 3WTJA 3RYCE 4UEMA 3PV0F 2VWAA 4JI1T 2BYSA 3UU3A 4COFA 3DTOA 4KI0F 2YOEA 1WYBA 5LNKA 3R6NA 2W4XA 3Q5EA 1U5PA 4PIRA 1FJGT 5FJVA 1OEDA 1JNZA 4CI2B 3RHWA 2WZIA 5JREA 4AQYT 2EHOC 2WWVA 2JQ9A 2XZ6A 2UZ6A 5L4EA 4CQIA 2WSSV 4EOZB 1IBKT 4HQPA 1UW6A 3N9NA 5J2UE 4BQTA 4EEBA 3C4ZA 3N9MA 2V7MA 1MMGA 3QK6A 2LKGA 2ACZA 2YMEA 3WAJA 2JPFA 3AE4A 2CMRA 3LK3B 4GOUA 3NZPA 5AQFB 3LK42 4EZ4A 4O4HE 3UFEA 2LHNA 3AXJA 1D1AA 4DV0T 2W63A 5ETWA 4IDNA 5FY0A 3MJXA 3CQGB 2LE8A 4LF6T 2G0UA 2C5JA 3U3IA 5ABFB 3E22E 3QOFA 2MOZA 3ZCIA 4HWCA
chains in the Genus database with same CATH topology
4D01A 3GUAA 3WTJA 2YKSA 4IREA 5HCMA 2Y58A 4ALXA 2XQ6A 3IGQA 2M6IA 5HEGA 3TLUA 3P50A 4IL4A 4ZJSA 2BYNA 4QH1A 3WTKA 1OEDC 2BYSA 4ILBA 4QH4A 3UU3A 4COFA 3UUBA 3U8JA 3RQWA 3RQUA 2YOEA 5JMEA 2QC1B 5HEOA 4QH5A 3TLTA 4ZZBA 2Y56A 3JADA 3UU8A 3ZDGA 4ZRUA 2WNCA 4QABA 2XQ9A 4HFIA 4A98A 2MAWA 1I9BA 3U8LA 1OEDE 2WNLA 2BR8A 3WTOA 2YN6A 4LMLA 4PIRA 3RIFA 3UU5A 4XK9A 4WV9A 4ZR6A 4NPPA 2WN9A 4Z91A 5J5IA 4UM1A 2BJ0A 2PH9A 5FJVA 1OEDA 2W8FA 2XNTA 3RHWA 4IL9A 2WNJA 5HCJA 3JAFA 5BP0A 5AFKA 1UX2A 2VL0A 4NZBA 5AFNA 4A97A 3TLVA 3ZKRA 2Y54A 3RIAA 4LMKA 5KZUA 3EAMA 3ZDHA 2XQAA 2C9TA 2XZ6A 5BW2A 4QACA 4UY2A 4ZJTA 4Z90A 2UZ6A 3UU6A 2Y57A 5HEJA 5L4EA 5AFMA 5LG3A 3LSVA 5L47A 5TVCA 2XQ3A 3C84A 1OEDB 4LMJA 4AFHA 3EHZA 4X5TA 4ZZCA 3U8MA 4HQPA 2LKHA 4TWDA 5CFBA 1UW6A 2W8GA 3PMZA 4TWFA 1UV6A 4XHEA 4BFQA 4TNWA 5L4HA 3SQ9A 5HEUA 3U8NA 4HFDA 3SH1A 2WZYA 4FRRA 2Y7YA 2BYRA 4BQTA 2X00A 5BRXA 5CO5A 3SIOA 3WTIA 5AFLA 5SYOA 2LKGA 3PEOA 4AFTA 2YMEA 4TWHA 2BG9A 5AFHA 3WTNA 2XQ5A 3U8KA 3TLWA 4HFHA 2XZ5A 3EI0A 2YMDA 2BG9C 3WTMA 2XYSA 4TNVA 3WIPA 3SQ6A 3RI5A 2XYTA 2LM2A 2KSRA 2M6BA 3TLSA 3JAEA 3UU4A 2ZJVA 5LXBA 3WTHA 4UM3S 2XQ8A 2XNVA 4EZ1A 4UM3A 4ZK4A 4ILCA 2PGZA 2BG9B 3UQ4A 5AFJA 3T4MA 4ZK1A 3WTLA 2ZJUA 5J5HA 4UXUA 4F8HA 2BG9E 2BYQA 4HFBA 5J5FA 4HFEA 5AINA 3P4WA 5IUXA 4B5DA 4QAAA 2XQ7A 5AFMB 3UQ7A 2XQ4A 2LLYA 5J5GA 5J0ZA 2BR7A 4UM3P 5KE4A 4HFCA 5HEHA 3C79A 4DBMA 4AFGA 2BYPA 4ILAA 2X00D 2XNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D01 A;  3GUA A;  3WTJ A;  2YKS A;  4IRE A;  5HCM A;  2Y58 A;  4ALX A;  2XQ6 A;  3IGQ A;  2M6I A;  5HEG A;  3TLU A;  3P50 A;  4IL4 A;  4ZJS A;  2BYN A;  4QH1 A;  3WTK A;  1OED C;  2BYS A;  4ILB A;  4QH4 A;  3UU3 A;  4COF A;  3UUB A;  3U8J A;  3RQW A;  3RQU A;  2YOE A;  5JME A;  2QC1 B;  5HEO A;  4QH5 A;  3TLT A;  4ZZB A;  2Y56 A;  3JAD A;  3UU8 A;  3ZDG A;  4ZRU A;  2WNC A;  4QAB A;  2XQ9 A;  4HFI A;  4A98 A;  2MAW A;  1I9B A;  3U8L A;  1OED E;  2WNL A;  2BR8 A;  3WTO A;  2YN6 A;  4LML A;  4PIR A;  3RIF A;  3UU5 A;  4XK9 A;  4WV9 A;  4ZR6 A;  4NPP A;  2WN9 A;  4Z91 A;  5J5I A;  4UM1 A;  2BJ0 A;  2PH9 A;  5FJV A;  1OED A;  2W8F A;  2XNT A;  3RHW A;  4IL9 A;  2WNJ A;  5HCJ A;  3JAF A;  5BP0 A;  5AFK A;  1UX2 A;  2VL0 A;  4NZB A;  5AFN A;  4A97 A;  3TLV A;  3ZKR A;  2Y54 A;  3RIA A;  4LMK A;  5KZU A;  3EAM A;  3ZDH A;  2XQA A;  2C9T A;  2XZ6 A;  5BW2 A;  4QAC A;  4UY2 A;  4ZJT A;  4Z90 A;  2UZ6 A;  3UU6 A;  2Y57 A;  5HEJ A;  5L4E A;  5AFM A;  5LG3 A;  3LSV A;  5L47 A;  5TVC A;  2XQ3 A;  3C84 A;  1OED B;  4LMJ A;  4AFH A;  3EHZ A;  4X5T A;  4ZZC A;  3U8M A;  4HQP A;  2LKH A;  4TWD A;  5CFB A;  1UW6 A;  2W8G A;  3PMZ A;  4TWF A;  1UV6 A;  4XHE A;  4BFQ A;  4TNW A;  5L4H A;  3SQ9 A;  5HEU A;  3U8N A;  4HFD A;  3SH1 A;  2WZY A;  4FRR A;  2Y7Y A;  2BYR A;  4BQT A;  2X00 A;  5BRX A;  5CO5 A;  3SIO A;  3WTI A;  5AFL A;  5SYO A;  2LKG A;  3PEO A;  4AFT A;  2YME A;  4TWH A;  2BG9 A;  5AFH A;  3WTN A;  2XQ5 A;  3U8K A;  3TLW A;  4HFH A;  2XZ5 A;  3EI0 A;  2YMD A;  2BG9 C;  3WTM A;  2XYS A;  4TNV A;  3WIP A;  3SQ6 A;  3RI5 A;  2XYT A;  2LM2 A;  2KSR A;  2M6B A;  3TLS A;  3JAE A;  3UU4 A;  2ZJV A;  5LXB A;  3WTH A;  4UM3 S;  2XQ8 A;  2XNV A;  4EZ1 A;  4UM3 A;  4ZK4 A;  4ILC A;  2PGZ A;  2BG9 B;  3UQ4 A;  5AFJ A;  3T4M A;  4ZK1 A;  3WTL A;  2ZJU A;  5J5H A;  4UXU A;  4F8H A;  2BG9 E;  2BYQ A;  4HFB A;  5J5F A;  4HFE A;  5AIN A;  3P4W A;  5IUX A;  4B5D A;  4QAA A;  2XQ7 A;  5AFM B;  3UQ7 A;  2XQ4 A;  2LLY A;  5J5G A;  5J0Z A;  2BR7 A;  4UM3 P;  5KE4 A;  4HFC A;  5HEH A;  3C79 A;  4DBM A;  4AFG A;  2BYP A;  4ILA A;  2X00 D;  2XNU A; 
#chains in the Genus database with same CATH topology
 4JBW F;  1Y64 B;  2Y58 A;  3CWZ B;  4IDP A;  2Q9Q A;  5E0O A;  3NZQ A;  4LFA T;  3SOL A;  3UU8 A;  2WNC A;  1WCR A;  1Z0P A;  1X9B A;  2YN6 A;  4ZR6 A;  2VKJ A;  2WN9 A;  3HI2 A;  2DCF A;  3FBL A;  4IIJ E;  3LFM A;  2BBJ A;  2CXL A;  5JDH A;  4JI2 T;  4N78 D;  2X9Y A;  2WS3 A;  5HEJ A;  2AXD S;  3P7I A;  4O4L E;  2N1G A;  4LMJ A;  3UUN A;  3JC6 D;  3ONJ A;  5FNV E;  3P4R A;  3RYH E;  3MXZ A;  4IHJ E;  1MMA A;  5HXC A;  2BYR A;  3VRA A;  5L2L A;  4UEL A;  3CVR A;  3AAA B;  4TWH A;  4DUZ T;  2E5V A;  2BG9 A;  3AVS A;  2XQ5 A;  2BS3 A;  3PUX F;  4DBQ A;  2XM1 A;  1SE7 A;  3I1A A;  2XYT A;  2ZJV A;  2JQQ A;  5LXB A;  4UM3 A;  1UGO A;  4EAH A;  2YDS A;  2X68 A;  4CXW A;  4F8H A;  3T1Y T;  3RKO A;  5IUX A;  2XQ7 A;  3RRC A;  4Q25 A;  4UR9 A;  3MK7 C;  5C2T A;  2WY2 A;  2VVN A;  4H63 V;  4JYA T;  2X00 D;  5HXE A;  4IST A;  4UVA B;  4YY3 T;  3P50 A;  1KNZ A;  2WDR A;  4YJ2 E;  2XUE A;  1CHU A;  3UTK A;  3CML A;  2C5I T;  3ABV A;  4YLH A;  3AB3 B;  2HN1 A;  2IAK A;  3OJA A;  4NPP A;  4JI7 T;  1SA0 E;  4NUU A;  3KVB A;  2ES0 A;  1VOM A;  3RF1 A;  4ZJT A;  3IF8 B;  3RLF F;  4PK4 A;  1Y01 A;  5H6Q B;  4B3R T;  4XHE A;  2HH7 A;  5HEU A;  3PUA A;  3ZC0 A;  3N2K E;  2ZMA A;  5AQL B;  4TZ4 C;  2Z6E A;  4FJO A;  2JQH A;  4CXY A;  2XYS A;  2FJE A;  5LBM A;  2WWU A;  4BJN A;  4OYK A;  4YHJ A;  4TV8 E;  4AKH A;  2DL1 A;  3SFE A;  3UUL A;  3EDV A;  1HF8 A;  3O1H A;  3DP7 A;  1ZHC A;  4JEH B;  1FMV A;  5AQS B;  3VR9 A;  3ZYL A;  3UT5 E;  5J2T E;  1UUR A;  3ANW A;  4AKI A;  2I6H A;  4ZJS A;  3I9W A;  2V6X A;  4ILB A;  2CBI A;  4LF9 T;  3U8J A;  2QGS A;  1J1J A;  5AQK B;  5LYJ E;  5KDM C;  1LVF A;  4QAB A;  3N9L A;  4IE5 A;  2K9A A;  2A72 A;  2AE9 A;  1HNZ T;  3HKE E;  3UU5 A;  4HWF A;  1HFA A;  2FJD A;  4IL9 A;  2IML A;  4C90 A;  5BP0 A;  2JJ9 A;  2EHO A;  5HWX A;  3FZH B;  1T98 A;  2RP4 A;  3RRW A;  3ZKR A;  3RIA A;  2ZLY A;  2XQ3 A;  3SRZ A;  2W8G A;  3AA0 B;  1UV6 A;  1GQE A;  4TN7 B;  4TNW A;  2IW5 B;  2XAG B;  2YU2 A;  4DR5 T;  2NTX A;  2FJA A;  4AIU A;  3ETU A;  3CX7 B;  2GK9 A;  4O4I E;  3WTN A;  3NRX A;  3WAK A;  2C5K T;  2WP9 A;  3AA6 B;  2JQK A;  2LRL A;  3JAE A;  2X9H A;  5JDL A;  3FHN A;  4TX5 A;  4QXH B;  2E9X B;  2X9X A;  4OHF A;  2DNX A;  2WU5 A;  2V26 A;  2BG9 E;  3PU8 A;  3P4W A;  4MFR A;  3E0Z A;  2YU1 A;  4LFB T;  3FXE B;  2ZM2 A;  3ZLI A;  3RPU A;  4P0B A;  5A1L A;  4DBR A;  2MYS A;  4EGW A;  4LF4 T;  1W09 A;  1UX5 A;  2SPC A;  4U31 A;  4EYU A;  4QH4 A;  3GN5 A;  4DID B;  2BVL A;  3RH3 A;  4FI5 A;  4QHO A;  4ZZB A;  3UFG A;  4C91 A;  1Z8U A;  3CK6 A;  4I43 B;  1XZY A;  1MMN A;  5JDM A;  4XK9 A;  4Z91 A;  4UM1 A;  1BR2 A;  5IHY A;  2K24 A;  1BR1 A;  4WZX A;  5CA0 E;  2CM0 A;  2XHE B;  5ABG A;  3AE3 A;  2CE7 A;  5KZU A;  4UY2 A;  4HN9 A;  4L9I A;  2KND A;  2XAQ B;  3AE2 A;  2CEA A;  2CXF A;  3HKD E;  3SWH A;  2CRB A;  4ZOL E;  3H3A A;  5F8P A;  2UUB T;  5SYO A;  2OV9 A;  2V7I A;  5EK2 A;  4AQF C;  3ZT5 A;  2LSG A;  2XSA A;  4I55 E;  1BR0 A;  4ZI3 D;  1VRB A;  2XAJ B;  3RC8 A;  2DWG A;  5AFU L;  5LA6 E;  2CPT A;  2N2N A;  3WTL A;  5BMV E;  4KHP T;  4HFE A;  5KMG P;  1XMQ T;  4P09 A;  3EUH A;  2NW7 A;  4O2A E;  5H6R B;  4L0R A;  4UV8 B;  4CZZ B;  2XNU A;  3CQC B;  4DR6 T;  2V7L A;  4ZEY A;  3BK9 A;  2XM2 A;  3PTR B;  4EIW A;  2BYN A;  2Y48 B;  1SUM B;  4DV5 T;  2PBI A;  3AEC A;  3JC6 C;  3ETV A;  2JMK A;  4U7I A;  5F3J A;  2VB6 A;  2KXP B;  3PUV F;  1M62 A;  3L39 A;  3M65 A;  3O1I A;  1FMW A;  3E08 A;  3VHL A;  4H9Q C;  2L9Q A;  1HNW T;  2NWB A;  3PDY A;  1XNQ T;  4IT4 A;  1HTJ F;  4PK5 A;  5AFK A;  5AQM B;  1JNR A;  4A97 A;  4YSZ A;  4HFV A;  2Y54 A;  4YTP A;  2V5C A;  4H9O C;  2XAF B;  5FXV A;  5TVC A;  1OED B;  4X65 T;  1R8I A;  5LGN B;  3SQ9 A;  2BS4 A;  2D0U A;  4LF5 T;  2Y7Y A;  4DUY T;  5CO5 A;  5JTG A;  4DR1 T;  5LGT B;  4ZXL A;  5HXS A;  4AFT A;  4H9S E;  4ZI7 E;  3ZMS B;  4AXP A;  2CA5 A;  5LJM A;  1IZN B;  5L3G B;  1OWA A;  1J5E T;  2KWI B;  1KNR A;  1KFY A;  4DV6 T;  1T72 A;  3KBU A;  4YTN A;  2X67 A;  5AIN A;  3WI3 A;  2UXN B;  2K3W A;  2PG8 A;  4BAY B;  4U7Y A;  3MA9 A;  3AXJ B;  3AEE A;  5FY1 A;  4YFS A;  5HEG A;  1VCT A;  5JRC B;  3ZMT B;  3D0T A;  3P4P A;  2LSI A;  5L3B B;  2J47 A;  3RIU C;  4HFI A;  4A98 A;  2OLT A;  3AEB A;  3QB5 A;  1AJ3 A;  4HGA A;  5J5I A;  2Q9Q B;  2BJ0 A;  5AQR B;  1L0V A;  4H63 H;  3ZC1 A;  3ZCJ A;  3A7M A;  2LSY A;  2NW8 A;  1XMO T;  3P8C D;  4CN1 A;  3I9Y A;  3CIR A;  4EED A;  5AQN B;  5CFB A;  4BFQ A;  4TWF A;  4ASK A;  5ABF A;  4IGU A;  4QXC B;  5LHI B;  2WZY A;  4HE8 A;  3SIO A;  3PJA A;  5EK3 A;  4JI0 T;  4U2Z A;  2BZB A;  5FVL A;  4X62 T;  2ODU A;  3FZK B;  1W0B A;  3V5U A;  3OBV E;  5JR9 C;  4B3M T;  1WFD A;  4KBM B;  1KF6 A;  3Q2M A;  2BG9 B;  2W0G A;  5FXW A;  1U4Q A;  4HFB A;  1US7 B;  3X1D A;  1QSD A;  4WBO A;  2BVM A;  5LOV E;  5J5G A;  5AQV B;  1YXR A;  4ZS2 A;  5HEH A;  3LG7 A;  2H7V C;  2ZM6 T;  1HG2 A;  4IRE A;  4UIG A;  3AA7 B;  4IL4 A;  3NVO A;  2XAH B;  4QH1 A;  3OVU A;  1FIO A;  1YQ3 A;  3FZF B;  2WAU A;  5JME A;  5FL1 A;  4DMV A;  3S4U A;  3AE6 A;  4YTM A;  5J1G A;  2MPK A;  3RKG A;  2IC9 A;  4I50 E;  3TLV A;  3Q9D A;  4MBQ A;  4CN4 A;  4CN6 A;  2UUC T;  5FYM A;  4EXT A;  2H89 A;  1W0A A;  3C4W A;  4ZZC A;  4BA9 A;  3UUM A;  3ESL A;  3ZN0 B;  1G8X A;  2V7K A;  4HEA A;  4UF0 A;  3O9X A;  2D9D A;  4JI8 T;  4XBF B;  3FZL B;  4AKG A;  3PEO A;  3OTO T;  3VKH A;  4DV3 T;  3BQI A;  2CHO A;  2E8I A;  3BQL A;  5DJQ C;  3EI0 A;  3K3N A;  1IBM T;  4ILU A;  1HG5 A;  2XPK A;  1XDO A;  4EYY R;  2XQ8 A;  3GA8 A;  3N5L A;  5AQP B;  5J5H A;  5IYZ E;  3JCF A;  2VAS A;  2W66 A;  5JDG A;  2HN2 A;  4HTE A;  2HPL A;  5AFM B;  4U3C A;  1MMD A;  2LLY A;  5KE4 A;  2NP9 A;  2LOP A;  4E7Z A;  4LFC T;  4DND A;  2CLY B;  3B5M A;  4QWN B;  4D01 A;  3LBX A;  5HCM A;  2E9X D;  4DR7 T;  3QB5 K;  3CKD A;  1OED C;  4H9R C;  3LDQ B;  2B76 A;  4IE6 A;  3C98 B;  4JLE A;  5HEO A;  4QH5 A;  4UVB B;  5L3D B;  3K1S A;  3ANW B;  3PU3 A;  5LCY A;  4Z8X A;  3Q5X A;  3U8L A;  2WNL A;  4HWH A;  3VRB A;  4IDZ A;  2PH9 A;  2NR4 A;  4ZI3 C;  2XNT A;  2W2U A;  3LK2 B;  2WNJ A;  4GIW A;  5JDQ A;  3PUZ F;  5HCJ A;  2VL0 A;  5FKY A;  2JRK A;  5JQG E;  3ZDH A;  3Q5W A;  5DQW A;  3W15 B;  3EVY A;  5L47 A;  2UXB T;  2WM9 A;  1D0Z A;  4XAX B;  3EHZ A;  2H3R A;  1IJ5 A;  5L3F B;  3ZT7 A;  1KEY A;  1HNX T;  2QRX A;  2EHO B;  4HFD A;  3U78 A;  4HWD A;  3IHR A;  2X00 A;  2E2A A;  4UVC B;  4X1K E;  1MIY A;  1NEN A;  2I59 A;  3OPC A;  3TLW A;  3WTM A;  5CJ5 A;  2XSB A;  4TNV A;  3A5X A;  3ZYK A;  5GON E;  2M6B A;  2ZM0 A;  4EB6 E;  2M67 A;  2Y6X A;  3ZMV B;  3C51 A;  4KP3 C;  2IIU A;  5C3J A;  1XWM A;  1N33 T;  3ONX A;  2DI4 A;  3C50 A;  4X1Y E;  5JH7 E;  3ZYM A;  3SS1 A;  4OFZ A;  4AQG A;  4KX6 A;  4BJM A;  5AQT B;  2XQ6 A;  3AVR A;  4GYR A;  4UV9 B;  4GK0 E;  1O3X A;  2BKN A;  3WTK A;  2KLQ A;  5JDN A;  4ISS A;  3CQX C;  4GKJ T;  3ZT6 A;  3RQW A;  1T8B A;  3RQU A;  4JI3 T;  3RIU A;  5LGU B;  4MLK A;  4QX7 B;  3TLT A;  3K3O A;  2WBL A;  1T7S A;  1N36 T;  1ZEE A;  3GMI A;  3RIF A;  3DJB A;  3GN5 B;  2W8F A;  2V6Y B;  3VKG A;  5HXR A;  1IBL T;  1V9D A;  4K0K T;  3OYX A;  2YDQ A;  3UU6 A;  1MND A;  2BS2 A;  1WRD A;  4AIS A;  2YK0 A;  4ZI2 D;  4WNK A;  4FRR A;  3NWI A;  4IE7 A;  4PFP A;  3MKD A;  4PFO A;  1XDP A;  2YIN A;  1UK5 A;  3U8K A;  4IDQ A;  4HFH A;  2YEV C;  4O8S A;  4MAL A;  5DQV A;  3PUQ A;  5JR9 A;  5CA1 E;  1NWM X;  3N9P A;  3CX6 B;  2HHH T;  2LSJ A;  3KV5 A;  3TKL B;  3KFW X;  4E7S A;  5TAO A;  1WR0 A;  3A8Y C;  2DLR A;  3RYF E;  2XQ4 A;  3PUW F;  2LT3 A;  2WDQ A;  3PUG A;  2VK9 A;  4IE4 A;  2CWY A;  2MBG A;  4DBM A;  3WTO A;  1D0Y A;  1DU2 A;  5LXT E;  3O1J A;  3KV4 A;  3J7Y q;  1E7P A;  5AQJ B;  2FBW A;  3G06 A;  2VKD A;  5FXZ A;  3IBP A;  2D2S A;  3L09 A;  4UXN B;  3EAB A;  2XQY A;  3N2G E;  4XZC A;  5ABE A;  2QYW A;  2JIW A;  1LVK A;  3AED A;  1I94 T;  3QC9 A;  3N9Q A;  4NZB A;  5EZY E;  1LKX A;  4PJM A;  2D5U A;  3KBT A;  4PJJ A;  4QAC A;  1HX8 A;  2VQE T;  2X66 A;  5AQH B;  2LEH A;  3P4S A;  5LP6 E;  3U8M A;  3PMZ A;  4X20 E;  2ZM8 A;  4J2C A;  3AE7 A;  3U8N A;  3SH1 A;  1D0X A;  2E5L T;  2Q9Q D;  3P4Q A;  5AFL A;  1YD8 G;  1HX1 B;  2CLY C;  3PUR A;  2NOX A;  2W61 A;  2YDR A;  4HKA A;  5AFH A;  4JV5 T;  2LOS A;  2XZ5 A;  2YMD A;  3TLS A;  2XY8 B;  5FL0 A;  5FY7 A;  1VCS A;  4EV6 A;  3UQ4 A;  2ZJU A;  4DR2 T;  3HR0 A;  4JI6 T;  3O4X E;  2UXC T;  4YHH T;  2XZE A;  4CXX A;  4ZS3 A;  3AEA A;  2BKO A;  4HFC A;  3B57 A;  2BYP A;  3OKQ A;  3PE0 A;  1N34 T;  2X0H A;  2XTL A;  4DR3 T;  2WMO A;  2VQF T;  4ANJ A;  2MTQ A;  3H37 A;  3ZMU B;  2XJ7 A;  3HKB E;  3J9X 1;  4AKR B;  2XQ9 A;  4F6R C;  3H3M A;  2MAW A;  5LG4 A;  4B3S T;  2WU2 A;  2DHR A;  3RX6 A;  4AKL A;  4LML A;  2KIN B;  2LHR A;  5AQU B;  3F31 A;  5L3E B;  1UX2 A;  4MHC A;  5FXX A;  4U2Y A;  4A56 A;  2ODV A;  4DV4 T;  2F4V T;  4AFH A;  2LKH A;  3C4X A;  2DWK A;  1D1C A;  2LJL A;  3RC3 A;  2IC6 A;  5LJN A;  1H7C A;  2E9X C;  2X0Y A;  3FXD B;  4GYS A;  5JRC A;  5FMN A;  2K5B B;  3HKC E;  3AA1 B;  2LM2 A;  2KSR A;  1WYC A;  2PFV A;  3ZSS A;  1HS7 A;  2CBJ A;  2VL8 A;  4ZK4 A;  5KX5 E;  2UXX B;  3KV6 A;  1I6Z A;  3IEE A;  4DO0 A;  4UXU A;  1BR4 A;  4CI1 B;  3L3P A;  5JDF A;  4G2A A;  4JI5 T;  2I0M A;  4L5G A;  4P1N A;  1YW0 A;  3AAE B;  4X64 T;  3R84 B;  2VKH A;  4AFG A;  2N9D A;  3KDS E;  2VUR A;  4ALX A;  1E2A A;  1KNP A;  3GWH A;  4QKN A;  4CI3 B;  5AQI B;  2FUP A;  3CPZ A;  1B7T A;  2D0T A;  4ZRU A;  3K8P C;  2RPA A;  5FVK A;  1MIW A;  3V5S A;  3AAI A;  4WV9 A;  4YSX A;  1UX4 A;  4WBN E;  1FEW A;  1G73 A;  3HA4 A;  4X1I E;  3EAM A;  2WDV A;  4Z90 A;  2CWO A;  5L3C B;  3AE1 A;  4JI4 T;  4TWD A;  2KMF A;  5LHH B;  3WTI A;  2A9U A;  4PAG A;  4O4J E;  2R6G F;  3AEF A;  4DV2 T;  5DAB A;  4UF0 B;  4IDO A;  2XNV A;  4GK5 E;  3PUS A;  2EHO D;  4AQF A;  2PJQ A;  1NAF A;  5J5F A;  5AQQ B;  4DR4 T;  4QAA A;  4ZHQ E;  4KHZ F;  1N32 T;  2J4G A;  2BR7 A;  2KWH A;  2BYQ A;  1LRZ A;  1UUS A;  2L3L A;  3TLU A;  4OK0 A;  2X0L B;  4HWI B;  4H9N C;  4ZI2 C;  3UUB A;  5EK4 A;  2QC1 B;  3KIN B;  3LBX B;  2Y56 A;  2WMN A;  3JAD A;  2VVS A;  4PNI A;  2UXD T;  1OED E;  5LB7 B;  2BR8 A;  3F2E A;  2WQY A;  3ZJ1 A;  4YXD A;  2QVA A;  2V8S V;  2CCQ A;  3AE8 A;  3JAF A;  4KMC A;  4JEU B;  3M3Z B;  1YKE B;  1WR6 A;  2H88 A;  1ZP0 A;  2K48 A;  2C9T A;  1X79 A;  3AE9 A;  5IWA T;  1ZV4 X;  5AFM A;  3FZM B;  1M7K A;  3T1H T;  2XAS B;  1KK7 A;  4IE0 A;  4X5T A;  2WB5 A;  3I0Q A;  2W00 A;  4B6X A;  4QX8 B;  1QLB A;  3BQK A;  4PJN A;  5BRX A;  2NTY A;  2V1D B;  1YKH B;  5LMN T;  3KVA A;  1YQ4 A;  5LMU T;  2FJB A;  3QUJ A;  3WIP A;  3SQ6 A;  4YT0 A;  1HCI A;  2ACX A;  5BR8 T;  2IHR 1;  3L8R A;  3EDU A;  3WTH A;  3OYZ A;  4EZ1 A;  4PK6 A;  4ILC A;  2IDO B;  3T4M A;  4PJL A;  2BBH A;  2HPJ A;  4GKK T;  1EZ3 A;  4DMW A;  5F5W A;  2A3D A;  1D1B A;  1E1H B;  2KT9 A;  4U74 A;  4K0U A;  4LF8 T;  3QNU A;  5HYA A;  4NXN T;  5AQO B;  3CX8 B;  3ZN1 B;  3UUX B;  5HAX A;  4I0U A;  3PUY F;  3MAC A;  2RA1 A;  4AI6 A;  4PW8 A;  2Q9Q C;  2PTF A;  1CUN A;  2V5D A;  2QA7 A;  5C8Y E;  1SHZ C;  4O2B E;  2WCA A;  2WZH A;  4LF7 T;  3F57 A;  4EZH A;  4DVD A;  4B3T T;  4KUM B;  1W9R A;  5AFN A;  5FP3 A;  2IUB A;  1QUU A;  4LMK A;  4TUY E;  5BW2 A;  2W62 A;  1ZOY A;  2Y57 A;  3VR8 A;  5LG3 A;  3LSV A;  2H7O A;  2OA5 A;  4NXM T;  4G63 A;  2VKO A;  5ABH A;  5L4H A;  4U72 A;  4QXB B;  4X66 T;  2E9X A;  3ZPO A;  3K3Q C;  2CHN A;  2V7J A;  4TV9 E;  2J62 A;  3VU7 H;  2BG9 C;  4ADZ A;  4JUY A;  5AQG B;  3FB2 A;  4U33 A;  3T8O A;  3UU4 A;  3ZEF B;  4YSY A;  5AFJ A;  4ZK1 A;  2UU9 T;  4NUV A;  5JR9 B;  2C0S A;  3HL6 A;  2V6Y A;  4YJ3 E;  3UQ7 A;  1XNR T;  3AEG A;  3PJA J;  2LM9 A;  4ILA A;  3Q5D A;  1NEK A;  2YKS A;  3ZST A;  1IJ6 A;  2NW9 A;  2M6I A;  3IGQ A;  3IA3 A;  5LHG B;  3RGL A;  5ADX L;  4A5X A;  3NBX X;  5LBQ B;  1MIV A;  2BDE A;  5CGM A;  3ZMZ B;  5HXH A;  4H9P C;  4V1A v;  4DV7 T;  2CXD A;  3ZDG A;  2BKP A;  1I9B A;  3FBZ A;  2KZ7 B;  2X51 A;  5M4Y A;  3C64 A;  2JMH A;  3B13 A;  3MZK B;  3N9O A;  1J5W A;  1S35 A;  2XQA A;  4WYV A;  4M1P A;  1UCU A;  3C84 A;  3KV9 A;  5CB4 E;  2B1E A;  3LJC A;  1MNE A;  3NKZ A;  4WW0 A;  5KXJ A;  2L8K A;  4P0A A;  2LSK A;  3I0O A;  1S94 A;  2W67 A;  1ZKE A;  5JVD E;  3N2O A;  3RI5 A;  1IAP A;  2UUA T;  3SFD A;  3ONL C;  4DV1 T;  2P9B A;  3NRY A;  4UM3 S;  2X9W A;  2Y8D A;  2PGZ A;  1HR0 T;  2J1D G;  1WLX A;  3ZJ2 A;  5HWY A;  3RYI E;  1OXZ A;  4B5D A;  4I4T E;  4OYJ A;  4OX9 T;  5J0Z A;  4UM3 P;  4NIQ A;  2LRK A;  3C79 A;  4ERR A;  3AE5 A;  2A2F X;  3GUA A;  3WTJ A;  3RYC E;  4UEM A;  3PV0 F;  2VWA A;  4JI1 T;  2BYS A;  3UU3 A;  4COF A;  3DTO A;  4KI0 F;  2YOE A;  1WYB A;  5LNK A;  3R6N A;  2W4X A;  3Q5E A;  1U5P A;  4PIR A;  1FJG T;  5FJV A;  1OED A;  1JNZ A;  4CI2 B;  3RHW A;  2WZI A;  5JRE A;  4AQY T;  2EHO C;  2WWV A;  2JQ9 A;  2XZ6 A;  2UZ6 A;  5L4E A;  4CQI A;  2WSS V;  4EOZ B;  1IBK T;  4HQP A;  1UW6 A;  3N9N A;  5J2U E;  4BQT A;  4EEB A;  3C4Z A;  3N9M A;  2V7M A;  1MMG A;  3QK6 A;  2LKG A;  2ACZ A;  2YME A;  3WAJ A;  2JPF A;  3AE4 A;  2CMR A;  3LK3 B;  4GOU A;  3NZP A;  5AQF B;  3LK4 2;  4EZ4 A;  4O4H E;  3UFE A;  2LHN A;  3AXJ A;  1D1A A;  4DV0 T;  2W63 A;  5ETW A;  4IDN A;  5FY0 A;  3MJX A;  3CQG B;  2LE8 A;  4LF6 T;  2G0U A;  2C5J A;  3U3I A;  5ABF B;  3E22 E;  3QOF A;  2MOZ A;  3ZCI A;  4HWC A; 
#chains in the Genus database with same CATH homology
 4D01 A;  3GUA A;  3WTJ A;  2YKS A;  4IRE A;  5HCM A;  2Y58 A;  4ALX A;  2XQ6 A;  3IGQ A;  2M6I A;  5HEG A;  3TLU A;  3P50 A;  4IL4 A;  4ZJS A;  2BYN A;  4QH1 A;  3WTK A;  1OED C;  2BYS A;  4ILB A;  4QH4 A;  3UU3 A;  4COF A;  3UUB A;  3U8J A;  3RQW A;  3RQU A;  2YOE A;  5JME A;  2QC1 B;  5HEO A;  4QH5 A;  3TLT A;  4ZZB A;  2Y56 A;  3JAD A;  3UU8 A;  3ZDG A;  4ZRU A;  2WNC A;  4QAB A;  2XQ9 A;  4HFI A;  4A98 A;  2MAW A;  1I9B A;  3U8L A;  1OED E;  2WNL A;  2BR8 A;  3WTO A;  2YN6 A;  4LML A;  4PIR A;  3RIF A;  3UU5 A;  4XK9 A;  4WV9 A;  4ZR6 A;  4NPP A;  2WN9 A;  4Z91 A;  5J5I A;  4UM1 A;  2BJ0 A;  2PH9 A;  5FJV A;  1OED A;  2W8F A;  2XNT A;  3RHW A;  4IL9 A;  2WNJ A;  5HCJ A;  3JAF A;  5BP0 A;  5AFK A;  1UX2 A;  2VL0 A;  4NZB A;  5AFN A;  4A97 A;  3TLV A;  3ZKR A;  2Y54 A;  3RIA A;  4LMK A;  5KZU A;  3EAM A;  3ZDH A;  2XQA A;  2C9T A;  2XZ6 A;  5BW2 A;  4QAC A;  4UY2 A;  4ZJT A;  4Z90 A;  2UZ6 A;  3UU6 A;  2Y57 A;  5HEJ A;  5L4E A;  5AFM A;  5LG3 A;  3LSV A;  5L47 A;  5TVC A;  2XQ3 A;  3C84 A;  1OED B;  4LMJ A;  4AFH A;  3EHZ A;  4X5T A;  4ZZC A;  3U8M A;  4HQP A;  2LKH A;  4TWD A;  5CFB A;  1UW6 A;  2W8G A;  3PMZ A;  4TWF A;  1UV6 A;  4XHE A;  4BFQ A;  4TNW A;  5L4H A;  3SQ9 A;  5HEU A;  3U8N A;  4HFD A;  3SH1 A;  2WZY A;  4FRR A;  2Y7Y A;  2BYR A;  4BQT A;  2X00 A;  5BRX A;  5CO5 A;  3SIO A;  3WTI A;  5AFL A;  5SYO A;  2LKG A;  3PEO A;  4AFT A;  2YME A;  4TWH A;  2BG9 A;  5AFH A;  3WTN A;  2XQ5 A;  3U8K A;  3TLW A;  4HFH A;  2XZ5 A;  3EI0 A;  2YMD A;  2BG9 C;  3WTM A;  2XYS A;  4TNV A;  3WIP A;  3SQ6 A;  3RI5 A;  2XYT A;  2LM2 A;  2KSR A;  2M6B A;  3TLS A;  3JAE A;  3UU4 A;  2ZJV A;  5LXB A;  3WTH A;  4UM3 S;  2XQ8 A;  2XNV A;  4EZ1 A;  4UM3 A;  4ZK4 A;  4ILC A;  2PGZ A;  2BG9 B;  3UQ4 A;  5AFJ A;  3T4M A;  4ZK1 A;  3WTL A;  2ZJU A;  5J5H A;  4UXU A;  4F8H A;  2BG9 E;  2BYQ A;  4HFB A;  5J5F A;  4HFE A;  5AIN A;  3P4W A;  5IUX A;  4B5D A;  4QAA A;  2XQ7 A;  5AFM B;  3UQ7 A;  2XQ4 A;  2LLY A;  5J5G A;  5J0Z A;  2BR7 A;  4UM3 P;  5KE4 A;  4HFC A;  5HEH A;  3C79 A;  4DBM A;  4AFG A;  2BYP A;  4ILA A;  2X00 D;  2XNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...