4HFIA

The glic pentameric ligand-gated ion channel at 2.4 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfiA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfiA01
5HEHA 2XZ6A 3RIAA 2LM2A 3TLTA 2BG9A 5HCMA 5CFBA 4QH1A 4AFGA 2ZJUA 2YMDA 5HEUA 5AINA 5LG3A 2BG9B 3EAMA 2XYSA 4QH4A 4ZJSA 3ZDGA 4QACA 4HFDA 2XQ9A 2WN9A 2PH9A 2MAWA 2WZYA 2Y7YA 4ZK1A 4AFTA 5HEGA 3UU4A 3UQ4A 5AFJA 2XQ8A 2C9TA 3EI0A 2Y56A 3UQ7A 1OEDC 3TLVA 3WIPA 3JAEA 4LMJA 4HFCA 1UX2A 4QABA 2YN6A 4HFBA 3WTJA 4A98A 5TVCA 2BYSA 1OEDA 3UU8A 2YOEA 2LKHA 3WTOA 1OEDB 3EHZA 2WNCA 4UXUA 3WTIA 3UU5A 4UM3P 5KZUA 3SIOA 2LKGA 3UU3A 2UZ6A 4NPPA 4Z90A 2QC1B 2M6BA 4ZRUA 4TWFA 3RI5A 5CO5A 2XQ5A 4ZJTA 3TLUA 5HEOA 4UY2A 4BFQA 3P4WA 4LMLA 3RQUA 1I9BA 2BR8A 4UM3A 4UM3S 2M6IA 5BP0A 5KE4A 3T4MA 3SQ9A 3PEOA 3RQWA 4B5DA 4IL9A 5J5GA 4NZBA 2Y54A 3WTMA 4BQTA 4HFIA 3P50A 2XQ4A 2XQ6A 2Y58A 2XQ7A 3SH1A 2BG9E 3WTKA 5IUXA 3GUAA 4ALXA 4D01A 2Y57A 2VL0A 4XHEA 4WV9A 3TLWA 2BYRA 4IREA 5SYOA 3LSVA 5J5IA 3UUBA 2W8GA 4F8HA 2XQ3A 4ZR6A 4DBMA 1UV6A 5J5HA 3RHWA 4ILCA 2XNVA 4QH5A 4TNVA 2BR7A 2XYTA 5AFMA 5JMEA 4PIRA 4QAAA 3U8KA 2XZ5A 3U8LA 5FJVA 2X00A 4XK9A 4HFEA 4Z91A 5AFMB 5L4HA 2BG9C 5L4EA 5BRXA 2W8FA 3WTNA 2PGZA 3U8NA 5BW2A 2WNJA 4IL4A 4TWHA 2XQAA 4A97A 2BYQA 3U8JA 4ZZCA 3C84A 4TNWA 4HFHA 3JAFA 4TWDA 5AFNA 2LLYA 5AFKA 3ZDHA 1UW6A 4ILBA 4LMKA 4X5TA 3RIFA 2YKSA 5L47A 3PMZA 4UM1A 4AFHA 3IGQA 2BJ0A 2KSRA 2XNTA 2YMEA 5AFHA 2WNLA 2ZJVA 3WTLA 3UU6A 5LXBA 3JADA 2XNUA 3C79A 5J5FA 5AFLA 5HEJA 3WTHA 4ILAA 3SQ6A 5HCJA 3U8MA 3ZKRA 4COFA 3TLSA 5J0ZA 4ZK4A 4ZZBA 4FRRA 4EZ1A 4HQPA 2BYNA 1OEDE 2X00D 2BYPA
chains in the Genus database with same CATH superfamily
1XWMA 3ZPOA 4PK4A 4AQFC 3CQGB 3A8YC 3AXJA 2C5KT 3UQ4A 3ZYLA 4UF0A 1BR1A 3FBZA 5LMNT 3KINB 5LMUT 2WAUA 3PUVF 4MHCA 4Z8XA 4KMCA 2DL1A 4IL9A 2WDRA 2H89A 3RC3A 5BR8T 2KWHA 2XUEA 4WV9A 3LSVA 2P9BA 2ODVA 2E8IA 1Y01A 4QH5A 2XYTA 4ZI7E 2KXPB 5JMEA 3B57A 4HFEA 5L4EA 2W8FA 4AI6A 1D0YA 4JI6T 4ZHQE 4JI3T 1IZNB 1KNZA 5HXCA 3RRCA 4H9QC 3UTKA 3PDYA 4UIGA 3RC8A 3X1DA 4G63A 4HWCA 3HKDE 3HKCE 4ZEYA 5IYZE 5J0ZA 5LHGB 4TZ4C 2XZ6A 2C5JA 3TLTA 3RYFE 2YMDA 1NENA 4JI1T 4YTNA 2XSBA 1M62A 2LOPA 1IBMT 3RKGA 2M67A 1D0ZA 4L5GA 3WTJA 3I0OA 1N34T 3MZKB 1HG2A 4X1KE 2IHR1 2NOXA 2YINA 2HN1A 3NVOA 3VHLA 3O9XA 4Z90A 2QC1B 2ZM8A 5EZYE 3FZLB 4AQGA 3U3IA 1HNZT 2W61A 2WZIA 1JNRA 5AQRB 1HG5A 1MMGA 2XQ7A 4HKAA 4PJLA 2CLYB 4CN4A 4NXMT 2KZ7B 4NIQA 1ZKEA 3KVBA 4DR6T 3ZLIA 2VKDA 5ABEA 3ZCIA 2XZ5A 5FJVA 3JC6C 4XK9A 3ZJ1A 2JMKA 3Q5DA 2X51A 2WZHA 3F57A 4V1Av 3ZDHA 1W09A 3T1HT 1HX1B 5EK4A 3FBLA 3AVSA 4ADZA 1XDPA 3SWHA 5AFLA 3QC9A 3T1YT 2VASA 3ZKRA 2J47A 3RIAA 5CFBA 2VVNA 5LYJE 4QH4A 4IE4A 3EABA 5FY1A 4FI5A 2FJDA 2PTFA 2C9TA 5CB4E 5AQNB 3WIPA 2EHOC 2XASB 3F2EA 5AQQB 4H9RC 5TVCA 4UV8B 1HNWT 2QVAA 3PUWF 3UU5A 5KZUA 1XNQT 2X68A 5FXZA 3VKGA 3ONLC 4WYVA 3EDUA 1I94T 4IDQA 3PEOA 3LK2B 4HFIA 2GK9A 4NUUA 4OK0A 3ZMUB 1LVKA 5JRCA 2VL8A 3IA3A 3NZQA 2BYRA 4IREA 4ZR6A 5GONE 3BQKA 5HXHA 3ANWB 1W0BA 2X00A 4XAXB 4U31A 2K5BB 4X62T 2BG9C 4GK0E 5C3JA 2F4VT 1SA0E 2XAGB 3Q5EA 5AQLB 2MTQA 3IF8B 3LBXA 1E2AA 4ZZCA 3IEEA 4F6RC 2ODUA 2WCAA 2LLYA 5LP6E 1WR6A 4LMKA 4AKHA 5BMVE 3AE8A 3LJCA 3C79A 3JCFA 2UUAT 4U74A 4LF4T 5ABFB 3GN5A 3RGLA 4ZZBA 2MYSA 3HKEE 1J5ET 3T8OA 1HCIA 5FVLA 2SPCA 3VU7H 2OV9A 4X20E 4B6XA 3FZKB 2JRKA 3Q5XA 2RP4A 5JTGA 4QXHB 4WBOA 4KBMB 5LNKA 4DVDA 3AEAA 3ZSTA 2LKHA 5AQJB 2WNCA 2VQFT 1KF6A 2LKGA 3SIOA 5A1LA 1T98A 2IMLA 4HEAA 3HR0A 5BP0A 2X0HA 5AQGB 2XJ7A 2Q9QB 2B76A 2LSGA 2WU5A 4KI0F 4NZBA 4JV5T 5DQVA 2XQ6A 2Y58A 2DWGA 5LHHB 5JDMA 1NWMX 2XM1A 4QKNA 4K0KT 2QRXA 3K3QC 3D0TA 4MBQA 3TLWA 3QB5K 3OYXA 2W8GA 1N33T 1WFDA 2CHNA 3R6NA 4B3TT 3SFDA 1SE7A 4PIRA 4EOZB 1IBKT 2Q9QD 1WCRA 4OX9T 4PJMA 3U8JA 3I9YA 2QYWA 3SOLA 2LSKA 3IHRA 5IWAT 1YKHB 4UM1A 1SUMB 2Y6XA 5AQSB 3OJAA 4DV1T 4JLEA 4ZK4A 4EZ1A 4FRRA 3FXEB 2MPKA 2H7VC 2UXNB 2QA7A 4YT0A 3CK6A 2ZJUA 3AA6B 2V6YA 1HTJF 3KV9A 3AE4A 3L09A 4ZJSA 4ZK1A 3NZPA 5LBMA 2WN9A 5JH7E 4KHPT 2PG8A 2UXXB 3CKDA 3MKDA 4GYSA 2K9AA 2YU1A 4ZI2D 1EZ3A 1Y64B 4TUYE 1OEDA 3N9LA 5AFUL 4ZS2A 3ZC1A 2JPFA 2NTXA 2CHOA 3ZMTB 5HEOA 1I9BA 2BR8A 4UM3S 3UUMA 2XAJB 4DMWA 1FIOA 3C51A 2K3WA 2LJLA 3PUGA 4YHJA 4PK6A 4ALXA 5LA6E 1H7CA 4PNIA 2C0SA 2KINB 4CQIA 1NEKA 3LDQB 5FXWA 3ZMVB 1I6ZA 4J2CA 2MOZA 5J2UE 4ZI3D 2WNJA 4KHZF 2ZM6T 4CXWA 1Z0PA 2BBJA 3EVYA 3CWZB 3AA1B 4BA9A 3RIFA 4IE0A 3FZFB 5J2TE 5JR9A 1FMWA 2WM9A 1HFAA 5HCJA 1ZOYA 3AE7A 2JQKA 2BG9A 4QH1A 3V5UA 3AECA 2KLQA 3C50A 2BZBA 2FJBA 5HXEA 4AFTA 3CPZA 2A2FX 3DP7A 1B7TA 2WP9A 4TX5A 3H3AA 5HAXA 4DBRA 5L3DB 3AE3A 4YTPA 1OXZA 4UVCB 2IC9A 1BR0A 4DIDB 4UXUA 2A3DA 4OYKA 5CO5A 4I50E 1HX8A 1AJ3A 4Q25A 3O1IA 5AQHB 1HR0T 2CXDA 4JI2T 5LHIB 2LEHA 3FZMB 3UULA 3PUYF 3UFEA 3ZN1B 2H7OA 5DJQC 1R8IA 2CPTA 4U2ZA 2J1DG 3MXZA 3KV6A 2V7JA 3MA9A 5AQMB 3VR9A 4KUMB 2IC6A 3I0QA 2E5LT 2D0TA 3R84B 5AQVB 1HS7A 2BS4A 5E0OA 3CX8B 3H3MA 4QX7B 4YFSA 5AQOB 1YQ4A 4PJJA 1ZP0A 1XDOA 4HQPA 2BYNA 5HEHA 1US7B 5AINA 1IBLT 2IW5B 3LK42 4TN7B 4JEUB 1E7PA 3AA0B 4EAHA 2D0UA 3PUXF 2RA1A 4K0UA 2LOSA 4LMJA 2YN6A 3AE9A 1NAFA 3UU8A 1T7SA 5FKYA 1YQ3A 5L3CB 1MNDA 5F3JA 2UZ6A 2OLTA 1KNRA 2I6HA 3RI5A 4ZRUA 2V5DA 4JI7T 3ONXA 4UM3A 1W9RA 1UCUA 4HN9A 2JQQA 3AEDA 4B5DA 3ABVA 3AEGA 2A9UA 1ZEEA 1N32T 2V7IA 3WTKA 3ZCJA 1OWAA 1UX5A 4N78D 3N2GE 5LJNA 4ZS3A 2XNVA 2X9XA 3GMIA 3MJXA 4IE5A 2V5CA 1VCSA 2J4GA 3ONJA 1FEWA 2IAKA 5CA0E 2KT9A 4YTMA 4H9NC 1UGOA 1MMAA 5AFKA 2VKOA 5L47A 4AFHA 3A5XA 4EYYR 3SFEA 2CEAA 1ZHCA 2K48A 3L8RA 5L3EB 4GKJT 2LHNA 4JEHB 3WI3A 4IHJE 2AE9A 3GA8A 4GIWA 4X1YE 2CXLA 2X9WA 4JI4T 4GOUA 3K3OA 3ZDGA 3B13A 1UK5A 1DU2A 4BAYB 2E9XA 2Y8DA 2KMFA 2WWUA 4AKRB 3OKQA 4H9PC 4DUZT 2XQ8A 3SS1A 1OEDC 2UXBT 4AKGA 4HFBA 2CA5A 3I1AA 1V9DA 4O4HE 2W66A 2W63A 2L8KA 5AQKB 3P7IA 5L2LA 4BJNA 3C4ZA 2EHOB 2W2UA 2DCFA 2BS3A 1L0VA 4IGUA 3AE1A 3FHNA 5AQTB 4CN1A 3S4UA 2I0MA 2WMNA 5FL0A 2KWIB 1UURA 4U33A 3T4MA 3C4WA 1QLBA 3NBXX 4LFAT 3O4XE 5HXRA 5JDFA 4DV2T 5AQFB 1WRDA 2W0GA 4X65T 5C8YE 4IDNA 2EHOD 4CI3B 4TV8E 4EEBA 3RH3A 4JYAT 2HHHT 5AFMA 1YW0A 4YJ3E 3AAEB 1G73A 4LF8T 5L4HA 3VRAA 1BR2A 3ZYKA 3C98B 2BBHA 2WS3A 3JAFA 4X64T 5JR9C 1HF8A 3CX6B 2W62A 4WBNE 4DV5T 4L9IA 2UXDT 2KSRA 2VVSA 4ILUA 5LXBA 3JADA 2NR4A 5JREA 4DV3T 5EK3A 4MLKA 3L39A 4PK5A 2DHRA 5HCMA 1E1HB 2XAQB 5LCYA 4UXNB 3H37A 5LG3A 2XYSA 5H6QB 2XQ9A 4M1PA 5JDQA 3HI2A 3AXJB 3AA7B 4XZCA 1X9BA 4O2AE 4A98A 2V8SV 5IHYA 2NTYA 3WTOA 2HH7A 4O8SA 4O4JE 5ABGA 3UT5E 3ZT5A 5FXXA 4ZOLE 2HPJA 4UF0B 2D9DA 3P4WA 3PU8A 3PJAA 2X67A 3VR8A 2JQ9A 2YDSA 3Q9DA 1MIYA 4EYUA 1J5WA 3N2KE 2XQ4A 2BG9E 2YDRA 3TKLB 5LB7B 4ERRA 2VL0A 2BKPA 5J5IA 2XAFB 3Q5WA 4DBMA 2BR7A 4QAAA 1XNRT 3U8LA 1LRZA 5CA1E 3ETVA 3CVRA 3SRZA 2BYQA 4B3ST 3C84A 4U3CA 5AQUB 3OBVE 5AFNA 3N9PA 2N9DA 3ZMSB 2WNLA 2X9YA 3PU3A 2D5UA 5J5FA 3C64A 4CI1B 3ESLA 1CHUA 4I0UA 5LOVE 5ETWA 4LFCT 4DV4T 4JI8T 1D1CA 2PH9A 2Y7YA 1LVFA 3K8PC 3PJAJ 1T8BA 3UFGA 2ES0A 3FB2A 3DTOA 3RYCE 1UX2A 4P0BA 2BDEA 4PAGA 3ETUA 4YLHA 2BYSA 2K24A 4JI5T 2YDQA 3C4XA 5J1GA 4GYRA 1KFYA 2CMRA 1D0XA 3ZYMA 4BFQA 4ISTA 5J5GA 2Y54A 4LF5T 3RYHE 4AKIA 5IUXA 4E7ZA 4WZXA 4IDPA 4EZ4A 2WBLA 4DV0T 3AB3B 5FNVE 4DR2T 2VB6A 3OPCA 2LSIA 4MFRA 4YHHT 3WTNA 1LKXA 4A97A 2JIWA 1UUSA 2IDOB 4TNWA 4YSYA 4DV6T 4TWDA 3BK9A 2Y48B 4DR4T 4X5TA 4H9OC 2XNTA 2YMEA 3WTLA 2ZJVA 1GQEA 2CCQA 2CWOA 5FYMA 5HWYA 2VKHA 2WSSV 4WNKA 1CUNA 2WQYA 2LM2A 4AQYT 3N9NA 2E9XC 2WDQA 1MMNA 2W4XA 4LFBT 3ZMZB 2NW7A 2MAWA 5HWXA 2JMHA 5FY7A 2B1EA 5AQPB 2NW8A 2XTLA 4HWHA 5JDHA 3UQ7A 4HFCA 4QABA 3QNUA 3DJBA 3HL6A 1U4QA 1HNXT 2G0UA 3QK6A 1FMVA 3J7Yq 3WAJA 3TLUA 4UY2A 2UUCT 2XM2A 3HKBE 2N1GA 2CXFA 4EIWA 3RQWA 1WYBA 4P09A 2DI4A 5C2TA 4DNDA 4ANJA 2DWKA 1MMDA 4KP3C 4IE6A 2V1DB 4PFPA 4XHEA 1YKEB 1MIVA 5JRCB 5JDLA 3UUBA 1S35A 3QB5A 4A5XA 5J5HA 3ANWA 2A72A 2ZM0A 4DUYT 4AKLA 4UEMA 3O1JA 4TWHA 4UVBB 4DR5T 2FUPA 1WYCA 4G2AA 4EEDA 3PV0F 3GWHA 3LBXB 2CRBA 5AQIB 3NKZA 2NW9A 5LGNB 3FXDB 3CX7B 5LXTE 2WU2A 4QHOA 2PJQA 5ABFA 3EUHA 1YD8G 4L0RA 2AXDS 1S94A 5L3FB 2X00D 3GN5B 4I4TE 4AFGA 1IAPA 3CIRA 5HEUA 4OFZA 5FMNA 5HXSA 4QACA 3PUAA 2BS2A 4C90A 2E5VA 5AFJA 2N2NA 3EI0A 2CBJA 2H88A 4CXYA 4EZHA 4EV6A 3WTIA 2VK9A 5KDMC 2LRKA 4UM3P 3N9QA 4KX6A 4ZJTA 3RIUA 2UXCT 2Q9QA 5CJ5A 5HYAA 5CGMA 2J62A 1MIWA 4UVAB 2X9HA 3FZHB 4NXNT 3MACA 1WR0A 5JVDE 4QWNB 4TV9E 2XAHB 2XZEA 2Y57A 5L3BB 2CE7A 4U7YA 3VRBA 2XQ3A 3CQXC 3NRXA 4C91A 4EXTA 3ZSSA 3U8KA 3P8CD 5JDNA 3KVAA 2XQAA 1M7KA 2V26A 3OTOT 3RKOA 3PUQA 2V7MA 2BJ0A 2PBIA 3AE2A 2BVMA 1JNZA 3UU6A 5JQGE 2I59A 2WWVA 4A56A 5ABHA 4LF9T 3SQ6A 1UX4A 2VURA 3BQIA 2FJAA 5LBQB 1WLXA 2NWBA 4HFDA 2V6YB 3RLFF 4EB6E 2ZLYA 2LSJA 2WMOA 1O3XA 4YY3T 1X79A 2Z6EA 4I43B 4AISA 4LF6T 3N5LA 1OEDB 3EHZA 1VCTA 3RYIE 3N9MA 5FVKA 1ZV4X 4HGAA 3JC6D 2XSAA 3ZN0B 3B5MA 4HE8A 4DR3T 4YSZA 2QGSA 2ZM2A 2CLYC 2V7KA 2JJ9A 1N36T 3WTMA 3P50A 5L3GB 3PTRB 2W00A 3N2OA 3IBPA 4HWDA 5LGTB 4F8HA 1UV6A 3QOFA 4UELA 3ZJ2A 3RHWA 4ILCA 2WB5A 2LSYA 1VOMA 4IL4A 4CZZB 4HWFA 4H9SE 4O2BE 2HN2A 2L3LA 4B3MT 1UW6A 1IJ6A 2BKOA 1XMOT 3M3ZB 2VKJA 2VQET 2XHEB 1KEYA 4AIUA 5JR9B 2XY8B 5TAOA 3AAAB 2BVLA 1IJ5A 1OEDE 1XMQT 3L3PA 1QSDA 3K3NA 1BR4A 2X0YA 4FJOA 3KBTA 4HFVA 3NWIA 4P1NA 2BG9B 2WZYA 4WW0A 3UU4A 1VRBA 4U2YA 4AQFA 4DMVA 3KV4A 4HWIB 3KV5A 2Y56A 2W67A 2ZMAA 2ACXA 4IDOA 4QXBB 3P4SA 2FBWA 4ISSA 2YU2A 4IIJE 3KFWX 3UU3A 3E22E 4DR1T 3VKHA 4LMLA 5KE4A 3P4QA 2M6IA 4ZXLA 3SQ9A 4UR9A 3A7MA 3RRWA 4BQTA 4I55E 1D1AA 4D01A 5F8PA 5SYOA 4O4IE 4MALA 2UU9T 5M4YA 2WY2A 4OYJA 4TNVA 4PW8A 3BQLA 3WAKA 2E2AA 3I9WA 4CXXA 3QUJA 5BRXA 3U8NA 3RPUA 3P4PA 2LHRA 5JDGA 3AEBA 4NUVA 2V6XA 4YSXA 4DO0A 4DV7T 3E0ZA 5KX5E 2CM0A 3O1HA 2YEVC 4B3RT 3PE0A 2XQYA 2XNUA 3UUNA 4GK5E 4GKKT 5HEJA 3M65A 3RF1A 2D2SA 2CBIA 3K1SA 2H3RA 3ZC0A 3LFMA 3E08A 4X66T 4U72A 2YK0A 3U78A 3CMLA 2LRLA 4CI2B 5KXJA 4JBWF 1XZYA 3AE5A 3TLVA 3JAEA 3UUXB 2BKNA 2DNXA 1G8XA 4BJMA 2ACZA 4CN6A 3AE6A 3J9X1 4AXPA 2LE8A 3RIUC 2VWAA 2Q9QC 4NPPA 4TWFA 1MNEA 2IUBA 2DLRA 4DR7T 1U5PA 5LJMA 2XPKA 3MK7C 1J1JA 4QXCB 3SH1A 4QX8B 2UUBT 5EK2A 5FL1A 3N9OA 4ASKA 5H6RB 2HPLA 5DABA 2CWYA 2V7LA 4Z91A 3ZT7A 2PGZA 4IT4A 2R6GF 2JQHA 5FP3A 4HFHA 4YJ2E 3IGQA 4ZI2C 4PJNA 1KNPA 2C5IT 4UV9B 2X0LB 4EGWA 3WTHA 4ILAA 4JI0T 4E7SA 3CQCB 4COFA 3TLSA 2X66A 3P4RA 4H63H 5LGUB 3AEEA 3LG7A 3AAIA 2MBGA 3Q2MA 3EAMA 3V5SA 2NP9A 1KK7A 4H63V 5HEGA 2E9XB 3NRYA 3ZT6A 1QUUA 2L9QA 1Z8UA 2EHOA 3PURA 3G06A 2YOEA 2IIUA 4X1IE 4ZI3C 2FJEA 2M6BA 4LF7T 4XBFB 2XQ5A 3PUSA 4DBQA 3AVRA 3RQUA 3PUZF 2E9XD 4U7IA 5FY0A 2LT3A 5ADXL 4IDZA 1D1BA 3GUAA 2LM9A 5LG4A 2KNDA 5F5WA 2OA5A 1YXRA 2WDVA 4O4LE 1FJGT 3W15B 4IE7A 3OYZA 3F31A 3KBUA 5AFMB 4HTEA 5DQWA 3KDSE 3HA4A 5BW2A 3LK3B 3RX6A 2RPAA 1W0AA 3OVUA 5FXVA 1SHZC 4ILBA 2PFVA 5KMGP 3PMZA 2YKSA 3EDVA 4OHFA 5AFHA 3AEFA 4YXDA 3U8MA 1T72A 3ZEFB 4PFOA 4P0AA 4JUYA 2BYPA
chains in the Genus database with same CATH topology
5HEHA 2XZ6A 3RIAA 2LM2A 3TLTA 2BG9A 5HCMA 5CFBA 4QH1A 4AFGA 2ZJUA 2YMDA 5HEUA 5AINA 5LG3A 2BG9B 3EAMA 2XYSA 4QH4A 4ZJSA 3ZDGA 4QACA 4HFDA 2XQ9A 2WN9A 2PH9A 2MAWA 2WZYA 2Y7YA 4ZK1A 4AFTA 5HEGA 3UU4A 3UQ4A 5AFJA 2XQ8A 2C9TA 3EI0A 2Y56A 3UQ7A 1OEDC 3TLVA 3WIPA 3JAEA 4LMJA 4HFCA 1UX2A 4QABA 2YN6A 4HFBA 3WTJA 4A98A 5TVCA 2BYSA 1OEDA 3UU8A 2YOEA 2LKHA 3WTOA 1OEDB 3EHZA 2WNCA 4UXUA 3WTIA 3UU5A 4UM3P 5KZUA 3SIOA 2LKGA 3UU3A 2UZ6A 4NPPA 4Z90A 2QC1B 2M6BA 4ZRUA 4TWFA 3RI5A 5CO5A 2XQ5A 4ZJTA 3TLUA 5HEOA 4UY2A 4BFQA 3P4WA 4LMLA 3RQUA 1I9BA 2BR8A 4UM3A 4UM3S 2M6IA 5BP0A 5KE4A 3T4MA 3SQ9A 3PEOA 3RQWA 4B5DA 4IL9A 5J5GA 4NZBA 2Y54A 3WTMA 4BQTA 4HFIA 3P50A 2XQ4A 2XQ6A 2Y58A 2XQ7A 3SH1A 2BG9E 3WTKA 5IUXA 3GUAA 4ALXA 4D01A 2Y57A 2VL0A 4XHEA 4WV9A 3TLWA 2BYRA 4IREA 5SYOA 3LSVA 5J5IA 3UUBA 2W8GA 4F8HA 2XQ3A 4ZR6A 4DBMA 1UV6A 5J5HA 3RHWA 4ILCA 2XNVA 4QH5A 4TNVA 2BR7A 2XYTA 5AFMA 5JMEA 4PIRA 4QAAA 3U8KA 2XZ5A 3U8LA 5FJVA 2X00A 4XK9A 4HFEA 4Z91A 5AFMB 5L4HA 2BG9C 5L4EA 5BRXA 2W8FA 3WTNA 2PGZA 3U8NA 5BW2A 2WNJA 4IL4A 4TWHA 2XQAA 4A97A 2BYQA 3U8JA 4ZZCA 3C84A 4TNWA 4HFHA 3JAFA 4TWDA 5AFNA 2LLYA 5AFKA 3ZDHA 1UW6A 4ILBA 4LMKA 4X5TA 3RIFA 2YKSA 5L47A 3PMZA 4UM1A 4AFHA 3IGQA 2BJ0A 2KSRA 2XNTA 2YMEA 5AFHA 2WNLA 2ZJVA 3WTLA 3UU6A 5LXBA 3JADA 2XNUA 3C79A 5J5FA 5AFLA 5HEJA 3WTHA 4ILAA 3SQ6A 5HCJA 3U8MA 3ZKRA 4COFA 3TLSA 5J0ZA 4ZK4A 4ZZBA 4FRRA 4EZ1A 4HQPA 2BYNA 1OEDE 2X00D 2BYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEH A;  2XZ6 A;  3RIA A;  2LM2 A;  3TLT A;  2BG9 A;  5HCM A;  5CFB A;  4QH1 A;  4AFG A;  2ZJU A;  2YMD A;  5HEU A;  5AIN A;  5LG3 A;  2BG9 B;  3EAM A;  2XYS A;  4QH4 A;  4ZJS A;  3ZDG A;  4QAC A;  4HFD A;  2XQ9 A;  2WN9 A;  2PH9 A;  2MAW A;  2WZY A;  2Y7Y A;  4ZK1 A;  4AFT A;  5HEG A;  3UU4 A;  3UQ4 A;  5AFJ A;  2XQ8 A;  2C9T A;  3EI0 A;  2Y56 A;  3UQ7 A;  1OED C;  3TLV A;  3WIP A;  3JAE A;  4LMJ A;  4HFC A;  1UX2 A;  4QAB A;  2YN6 A;  4HFB A;  3WTJ A;  4A98 A;  5TVC A;  2BYS A;  1OED A;  3UU8 A;  2YOE A;  2LKH A;  3WTO A;  1OED B;  3EHZ A;  2WNC A;  4UXU A;  3WTI A;  3UU5 A;  4UM3 P;  5KZU A;  3SIO A;  2LKG A;  3UU3 A;  2UZ6 A;  4NPP A;  4Z90 A;  2QC1 B;  2M6B A;  4ZRU A;  4TWF A;  3RI5 A;  5CO5 A;  2XQ5 A;  4ZJT A;  3TLU A;  5HEO A;  4UY2 A;  4BFQ A;  3P4W A;  4LML A;  3RQU A;  1I9B A;  2BR8 A;  4UM3 A;  4UM3 S;  2M6I A;  5BP0 A;  5KE4 A;  3T4M A;  3SQ9 A;  3PEO A;  3RQW A;  4B5D A;  4IL9 A;  5J5G A;  4NZB A;  2Y54 A;  3WTM A;  4BQT A;  4HFI A;  3P50 A;  2XQ4 A;  2XQ6 A;  2Y58 A;  2XQ7 A;  3SH1 A;  2BG9 E;  3WTK A;  5IUX A;  3GUA A;  4ALX A;  4D01 A;  2Y57 A;  2VL0 A;  4XHE A;  4WV9 A;  3TLW A;  2BYR A;  4IRE A;  5SYO A;  3LSV A;  5J5I A;  3UUB A;  2W8G A;  4F8H A;  2XQ3 A;  4ZR6 A;  4DBM A;  1UV6 A;  5J5H A;  3RHW A;  4ILC A;  2XNV A;  4QH5 A;  4TNV A;  2BR7 A;  2XYT A;  5AFM A;  5JME A;  4PIR A;  4QAA A;  3U8K A;  2XZ5 A;  3U8L A;  5FJV A;  2X00 A;  4XK9 A;  4HFE A;  4Z91 A;  5AFM B;  5L4H A;  2BG9 C;  5L4E A;  5BRX A;  2W8F A;  3WTN A;  2PGZ A;  3U8N A;  5BW2 A;  2WNJ A;  4IL4 A;  4TWH A;  2XQA A;  4A97 A;  2BYQ A;  3U8J A;  4ZZC A;  3C84 A;  4TNW A;  4HFH A;  3JAF A;  4TWD A;  5AFN A;  2LLY A;  5AFK A;  3ZDH A;  1UW6 A;  4ILB A;  4LMK A;  4X5T A;  3RIF A;  2YKS A;  5L47 A;  3PMZ A;  4UM1 A;  4AFH A;  3IGQ A;  2BJ0 A;  2KSR A;  2XNT A;  2YME A;  5AFH A;  2WNL A;  2ZJV A;  3WTL A;  3UU6 A;  5LXB A;  3JAD A;  2XNU A;  3C79 A;  5J5F A;  5AFL A;  5HEJ A;  3WTH A;  4ILA A;  3SQ6 A;  5HCJ A;  3U8M A;  3ZKR A;  4COF A;  3TLS A;  5J0Z A;  4ZK4 A;  4ZZB A;  4FRR A;  4EZ1 A;  4HQP A;  2BYN A;  1OED E;  2X00 D;  2BYP A; 
#chains in the Genus database with same CATH topology
 1XWM A;  3ZPO A;  4PK4 A;  4AQF C;  3CQG B;  3A8Y C;  3AXJ A;  2C5K T;  3UQ4 A;  3ZYL A;  4UF0 A;  1BR1 A;  3FBZ A;  5LMN T;  3KIN B;  5LMU T;  2WAU A;  3PUV F;  4MHC A;  4Z8X A;  4KMC A;  2DL1 A;  4IL9 A;  2WDR A;  2H89 A;  3RC3 A;  5BR8 T;  2KWH A;  2XUE A;  4WV9 A;  3LSV A;  2P9B A;  2ODV A;  2E8I A;  1Y01 A;  4QH5 A;  2XYT A;  4ZI7 E;  2KXP B;  5JME A;  3B57 A;  4HFE A;  5L4E A;  2W8F A;  4AI6 A;  1D0Y A;  4JI6 T;  4ZHQ E;  4JI3 T;  1IZN B;  1KNZ A;  5HXC A;  3RRC A;  4H9Q C;  3UTK A;  3PDY A;  4UIG A;  3RC8 A;  3X1D A;  4G63 A;  4HWC A;  3HKD E;  3HKC E;  4ZEY A;  5IYZ E;  5J0Z A;  5LHG B;  4TZ4 C;  2XZ6 A;  2C5J A;  3TLT A;  3RYF E;  2YMD A;  1NEN A;  4JI1 T;  4YTN A;  2XSB A;  1M62 A;  2LOP A;  1IBM T;  3RKG A;  2M67 A;  1D0Z A;  4L5G A;  3WTJ A;  3I0O A;  1N34 T;  3MZK B;  1HG2 A;  4X1K E;  2IHR 1;  2NOX A;  2YIN A;  2HN1 A;  3NVO A;  3VHL A;  3O9X A;  4Z90 A;  2QC1 B;  2ZM8 A;  5EZY E;  3FZL B;  4AQG A;  3U3I A;  1HNZ T;  2W61 A;  2WZI A;  1JNR A;  5AQR B;  1HG5 A;  1MMG A;  2XQ7 A;  4HKA A;  4PJL A;  2CLY B;  4CN4 A;  4NXM T;  2KZ7 B;  4NIQ A;  1ZKE A;  3KVB A;  4DR6 T;  3ZLI A;  2VKD A;  5ABE A;  3ZCI A;  2XZ5 A;  5FJV A;  3JC6 C;  4XK9 A;  3ZJ1 A;  2JMK A;  3Q5D A;  2X51 A;  2WZH A;  3F57 A;  4V1A v;  3ZDH A;  1W09 A;  3T1H T;  1HX1 B;  5EK4 A;  3FBL A;  3AVS A;  4ADZ A;  1XDP A;  3SWH A;  5AFL A;  3QC9 A;  3T1Y T;  2VAS A;  3ZKR A;  2J47 A;  3RIA A;  5CFB A;  2VVN A;  5LYJ E;  4QH4 A;  4IE4 A;  3EAB A;  5FY1 A;  4FI5 A;  2FJD A;  2PTF A;  2C9T A;  5CB4 E;  5AQN B;  3WIP A;  2EHO C;  2XAS B;  3F2E A;  5AQQ B;  4H9R C;  5TVC A;  4UV8 B;  1HNW T;  2QVA A;  3PUW F;  3UU5 A;  5KZU A;  1XNQ T;  2X68 A;  5FXZ A;  3VKG A;  3ONL C;  4WYV A;  3EDU A;  1I94 T;  4IDQ A;  3PEO A;  3LK2 B;  4HFI A;  2GK9 A;  4NUU A;  4OK0 A;  3ZMU B;  1LVK A;  5JRC A;  2VL8 A;  3IA3 A;  3NZQ A;  2BYR A;  4IRE A;  4ZR6 A;  5GON E;  3BQK A;  5HXH A;  3ANW B;  1W0B A;  2X00 A;  4XAX B;  4U31 A;  2K5B B;  4X62 T;  2BG9 C;  4GK0 E;  5C3J A;  2F4V T;  1SA0 E;  2XAG B;  3Q5E A;  5AQL B;  2MTQ A;  3IF8 B;  3LBX A;  1E2A A;  4ZZC A;  3IEE A;  4F6R C;  2ODU A;  2WCA A;  2LLY A;  5LP6 E;  1WR6 A;  4LMK A;  4AKH A;  5BMV E;  3AE8 A;  3LJC A;  3C79 A;  3JCF A;  2UUA T;  4U74 A;  4LF4 T;  5ABF B;  3GN5 A;  3RGL A;  4ZZB A;  2MYS A;  3HKE E;  1J5E T;  3T8O A;  1HCI A;  5FVL A;  2SPC A;  3VU7 H;  2OV9 A;  4X20 E;  4B6X A;  3FZK B;  2JRK A;  3Q5X A;  2RP4 A;  5JTG A;  4QXH B;  4WBO A;  4KBM B;  5LNK A;  4DVD A;  3AEA A;  3ZST A;  2LKH A;  5AQJ B;  2WNC A;  2VQF T;  1KF6 A;  2LKG A;  3SIO A;  5A1L A;  1T98 A;  2IML A;  4HEA A;  3HR0 A;  5BP0 A;  2X0H A;  5AQG B;  2XJ7 A;  2Q9Q B;  2B76 A;  2LSG A;  2WU5 A;  4KI0 F;  4NZB A;  4JV5 T;  5DQV A;  2XQ6 A;  2Y58 A;  2DWG A;  5LHH B;  5JDM A;  1NWM X;  2XM1 A;  4QKN A;  4K0K T;  2QRX A;  3K3Q C;  3D0T A;  4MBQ A;  3TLW A;  3QB5 K;  3OYX A;  2W8G A;  1N33 T;  1WFD A;  2CHN A;  3R6N A;  4B3T T;  3SFD A;  1SE7 A;  4PIR A;  4EOZ B;  1IBK T;  2Q9Q D;  1WCR A;  4OX9 T;  4PJM A;  3U8J A;  3I9Y A;  2QYW A;  3SOL A;  2LSK A;  3IHR A;  5IWA T;  1YKH B;  4UM1 A;  1SUM B;  2Y6X A;  5AQS B;  3OJA A;  4DV1 T;  4JLE A;  4ZK4 A;  4EZ1 A;  4FRR A;  3FXE B;  2MPK A;  2H7V C;  2UXN B;  2QA7 A;  4YT0 A;  3CK6 A;  2ZJU A;  3AA6 B;  2V6Y A;  1HTJ F;  3KV9 A;  3AE4 A;  3L09 A;  4ZJS A;  4ZK1 A;  3NZP A;  5LBM A;  2WN9 A;  5JH7 E;  4KHP T;  2PG8 A;  2UXX B;  3CKD A;  3MKD A;  4GYS A;  2K9A A;  2YU1 A;  4ZI2 D;  1EZ3 A;  1Y64 B;  4TUY E;  1OED A;  3N9L A;  5AFU L;  4ZS2 A;  3ZC1 A;  2JPF A;  2NTX A;  2CHO A;  3ZMT B;  5HEO A;  1I9B A;  2BR8 A;  4UM3 S;  3UUM A;  2XAJ B;  4DMW A;  1FIO A;  3C51 A;  2K3W A;  2LJL A;  3PUG A;  4YHJ A;  4PK6 A;  4ALX A;  5LA6 E;  1H7C A;  4PNI A;  2C0S A;  2KIN B;  4CQI A;  1NEK A;  3LDQ B;  5FXW A;  3ZMV B;  1I6Z A;  4J2C A;  2MOZ A;  5J2U E;  4ZI3 D;  2WNJ A;  4KHZ F;  2ZM6 T;  4CXW A;  1Z0P A;  2BBJ A;  3EVY A;  3CWZ B;  3AA1 B;  4BA9 A;  3RIF A;  4IE0 A;  3FZF B;  5J2T E;  5JR9 A;  1FMW A;  2WM9 A;  1HFA A;  5HCJ A;  1ZOY A;  3AE7 A;  2JQK A;  2BG9 A;  4QH1 A;  3V5U A;  3AEC A;  2KLQ A;  3C50 A;  2BZB A;  2FJB A;  5HXE A;  4AFT A;  3CPZ A;  2A2F X;  3DP7 A;  1B7T A;  2WP9 A;  4TX5 A;  3H3A A;  5HAX A;  4DBR A;  5L3D B;  3AE3 A;  4YTP A;  1OXZ A;  4UVC B;  2IC9 A;  1BR0 A;  4DID B;  4UXU A;  2A3D A;  4OYK A;  5CO5 A;  4I50 E;  1HX8 A;  1AJ3 A;  4Q25 A;  3O1I A;  5AQH B;  1HR0 T;  2CXD A;  4JI2 T;  5LHI B;  2LEH A;  3FZM B;  3UUL A;  3PUY F;  3UFE A;  3ZN1 B;  2H7O A;  5DJQ C;  1R8I A;  2CPT A;  4U2Z A;  2J1D G;  3MXZ A;  3KV6 A;  2V7J A;  3MA9 A;  5AQM B;  3VR9 A;  4KUM B;  2IC6 A;  3I0Q A;  2E5L T;  2D0T A;  3R84 B;  5AQV B;  1HS7 A;  2BS4 A;  5E0O A;  3CX8 B;  3H3M A;  4QX7 B;  4YFS A;  5AQO B;  1YQ4 A;  4PJJ A;  1ZP0 A;  1XDO A;  4HQP A;  2BYN A;  5HEH A;  1US7 B;  5AIN A;  1IBL T;  2IW5 B;  3LK4 2;  4TN7 B;  4JEU B;  1E7P A;  3AA0 B;  4EAH A;  2D0U A;  3PUX F;  2RA1 A;  4K0U A;  2LOS A;  4LMJ A;  2YN6 A;  3AE9 A;  1NAF A;  3UU8 A;  1T7S A;  5FKY A;  1YQ3 A;  5L3C B;  1MND A;  5F3J A;  2UZ6 A;  2OLT A;  1KNR A;  2I6H A;  3RI5 A;  4ZRU A;  2V5D A;  4JI7 T;  3ONX A;  4UM3 A;  1W9R A;  1UCU A;  4HN9 A;  2JQQ A;  3AED A;  4B5D A;  3ABV A;  3AEG A;  2A9U A;  1ZEE A;  1N32 T;  2V7I A;  3WTK A;  3ZCJ A;  1OWA A;  1UX5 A;  4N78 D;  3N2G E;  5LJN A;  4ZS3 A;  2XNV A;  2X9X A;  3GMI A;  3MJX A;  4IE5 A;  2V5C A;  1VCS A;  2J4G A;  3ONJ A;  1FEW A;  2IAK A;  5CA0 E;  2KT9 A;  4YTM A;  4H9N C;  1UGO A;  1MMA A;  5AFK A;  2VKO A;  5L47 A;  4AFH A;  3A5X A;  4EYY R;  3SFE A;  2CEA A;  1ZHC A;  2K48 A;  3L8R A;  5L3E B;  4GKJ T;  2LHN A;  4JEH B;  3WI3 A;  4IHJ E;  2AE9 A;  3GA8 A;  4GIW A;  4X1Y E;  2CXL A;  2X9W A;  4JI4 T;  4GOU A;  3K3O A;  3ZDG A;  3B13 A;  1UK5 A;  1DU2 A;  4BAY B;  2E9X A;  2Y8D A;  2KMF A;  2WWU A;  4AKR B;  3OKQ A;  4H9P C;  4DUZ T;  2XQ8 A;  3SS1 A;  1OED C;  2UXB T;  4AKG A;  4HFB A;  2CA5 A;  3I1A A;  1V9D A;  4O4H E;  2W66 A;  2W63 A;  2L8K A;  5AQK B;  3P7I A;  5L2L A;  4BJN A;  3C4Z A;  2EHO B;  2W2U A;  2DCF A;  2BS3 A;  1L0V A;  4IGU A;  3AE1 A;  3FHN A;  5AQT B;  4CN1 A;  3S4U A;  2I0M A;  2WMN A;  5FL0 A;  2KWI B;  1UUR A;  4U33 A;  3T4M A;  3C4W A;  1QLB A;  3NBX X;  4LFA T;  3O4X E;  5HXR A;  5JDF A;  4DV2 T;  5AQF B;  1WRD A;  2W0G A;  4X65 T;  5C8Y E;  4IDN A;  2EHO D;  4CI3 B;  4TV8 E;  4EEB A;  3RH3 A;  4JYA T;  2HHH T;  5AFM A;  1YW0 A;  4YJ3 E;  3AAE B;  1G73 A;  4LF8 T;  5L4H A;  3VRA A;  1BR2 A;  3ZYK A;  3C98 B;  2BBH A;  2WS3 A;  3JAF A;  4X64 T;  5JR9 C;  1HF8 A;  3CX6 B;  2W62 A;  4WBN E;  4DV5 T;  4L9I A;  2UXD T;  2KSR A;  2VVS A;  4ILU A;  5LXB A;  3JAD A;  2NR4 A;  5JRE A;  4DV3 T;  5EK3 A;  4MLK A;  3L39 A;  4PK5 A;  2DHR A;  5HCM A;  1E1H B;  2XAQ B;  5LCY A;  4UXN B;  3H37 A;  5LG3 A;  2XYS A;  5H6Q B;  2XQ9 A;  4M1P A;  5JDQ A;  3HI2 A;  3AXJ B;  3AA7 B;  4XZC A;  1X9B A;  4O2A E;  4A98 A;  2V8S V;  5IHY A;  2NTY A;  3WTO A;  2HH7 A;  4O8S A;  4O4J E;  5ABG A;  3UT5 E;  3ZT5 A;  5FXX A;  4ZOL E;  2HPJ A;  4UF0 B;  2D9D A;  3P4W A;  3PU8 A;  3PJA A;  2X67 A;  3VR8 A;  2JQ9 A;  2YDS A;  3Q9D A;  1MIY A;  4EYU A;  1J5W A;  3N2K E;  2XQ4 A;  2BG9 E;  2YDR A;  3TKL B;  5LB7 B;  4ERR A;  2VL0 A;  2BKP A;  5J5I A;  2XAF B;  3Q5W A;  4DBM A;  2BR7 A;  4QAA A;  1XNR T;  3U8L A;  1LRZ A;  5CA1 E;  3ETV A;  3CVR A;  3SRZ A;  2BYQ A;  4B3S T;  3C84 A;  4U3C A;  5AQU B;  3OBV E;  5AFN A;  3N9P A;  2N9D A;  3ZMS B;  2WNL A;  2X9Y A;  3PU3 A;  2D5U A;  5J5F A;  3C64 A;  4CI1 B;  3ESL A;  1CHU A;  4I0U A;  5LOV E;  5ETW A;  4LFC T;  4DV4 T;  4JI8 T;  1D1C A;  2PH9 A;  2Y7Y A;  1LVF A;  3K8P C;  3PJA J;  1T8B A;  3UFG A;  2ES0 A;  3FB2 A;  3DTO A;  3RYC E;  1UX2 A;  4P0B A;  2BDE A;  4PAG A;  3ETU A;  4YLH A;  2BYS A;  2K24 A;  4JI5 T;  2YDQ A;  3C4X A;  5J1G A;  4GYR A;  1KFY A;  2CMR A;  1D0X A;  3ZYM A;  4BFQ A;  4IST A;  5J5G A;  2Y54 A;  4LF5 T;  3RYH E;  4AKI A;  5IUX A;  4E7Z A;  4WZX A;  4IDP A;  4EZ4 A;  2WBL A;  4DV0 T;  3AB3 B;  5FNV E;  4DR2 T;  2VB6 A;  3OPC A;  2LSI A;  4MFR A;  4YHH T;  3WTN A;  1LKX A;  4A97 A;  2JIW A;  1UUS A;  2IDO B;  4TNW A;  4YSY A;  4DV6 T;  4TWD A;  3BK9 A;  2Y48 B;  4DR4 T;  4X5T A;  4H9O C;  2XNT A;  2YME A;  3WTL A;  2ZJV A;  1GQE A;  2CCQ A;  2CWO A;  5FYM A;  5HWY A;  2VKH A;  2WSS V;  4WNK A;  1CUN A;  2WQY A;  2LM2 A;  4AQY T;  3N9N A;  2E9X C;  2WDQ A;  1MMN A;  2W4X A;  4LFB T;  3ZMZ B;  2NW7 A;  2MAW A;  5HWX A;  2JMH A;  5FY7 A;  2B1E A;  5AQP B;  2NW8 A;  2XTL A;  4HWH A;  5JDH A;  3UQ7 A;  4HFC A;  4QAB A;  3QNU A;  3DJB A;  3HL6 A;  1U4Q A;  1HNX T;  2G0U A;  3QK6 A;  1FMV A;  3J7Y q;  3WAJ A;  3TLU A;  4UY2 A;  2UUC T;  2XM2 A;  3HKB E;  2N1G A;  2CXF A;  4EIW A;  3RQW A;  1WYB A;  4P09 A;  2DI4 A;  5C2T A;  4DND A;  4ANJ A;  2DWK A;  1MMD A;  4KP3 C;  4IE6 A;  2V1D B;  4PFP A;  4XHE A;  1YKE B;  1MIV A;  5JRC B;  5JDL A;  3UUB A;  1S35 A;  3QB5 A;  4A5X A;  5J5H A;  3ANW A;  2A72 A;  2ZM0 A;  4DUY T;  4AKL A;  4UEM A;  3O1J A;  4TWH A;  4UVB B;  4DR5 T;  2FUP A;  1WYC A;  4G2A A;  4EED A;  3PV0 F;  3GWH A;  3LBX B;  2CRB A;  5AQI B;  3NKZ A;  2NW9 A;  5LGN B;  3FXD B;  3CX7 B;  5LXT E;  2WU2 A;  4QHO A;  2PJQ A;  5ABF A;  3EUH A;  1YD8 G;  4L0R A;  2AXD S;  1S94 A;  5L3F B;  2X00 D;  3GN5 B;  4I4T E;  4AFG A;  1IAP A;  3CIR A;  5HEU A;  4OFZ A;  5FMN A;  5HXS A;  4QAC A;  3PUA A;  2BS2 A;  4C90 A;  2E5V A;  5AFJ A;  2N2N A;  3EI0 A;  2CBJ A;  2H88 A;  4CXY A;  4EZH A;  4EV6 A;  3WTI A;  2VK9 A;  5KDM C;  2LRK A;  4UM3 P;  3N9Q A;  4KX6 A;  4ZJT A;  3RIU A;  2UXC T;  2Q9Q A;  5CJ5 A;  5HYA A;  5CGM A;  2J62 A;  1MIW A;  4UVA B;  2X9H A;  3FZH B;  4NXN T;  3MAC A;  1WR0 A;  5JVD E;  4QWN B;  4TV9 E;  2XAH B;  2XZE A;  2Y57 A;  5L3B B;  2CE7 A;  4U7Y A;  3VRB A;  2XQ3 A;  3CQX C;  3NRX A;  4C91 A;  4EXT A;  3ZSS A;  3U8K A;  3P8C D;  5JDN A;  3KVA A;  2XQA A;  1M7K A;  2V26 A;  3OTO T;  3RKO A;  3PUQ A;  2V7M A;  2BJ0 A;  2PBI A;  3AE2 A;  2BVM A;  1JNZ A;  3UU6 A;  5JQG E;  2I59 A;  2WWV A;  4A56 A;  5ABH A;  4LF9 T;  3SQ6 A;  1UX4 A;  2VUR A;  3BQI A;  2FJA A;  5LBQ B;  1WLX A;  2NWB A;  4HFD A;  2V6Y B;  3RLF F;  4EB6 E;  2ZLY A;  2LSJ A;  2WMO A;  1O3X A;  4YY3 T;  1X79 A;  2Z6E A;  4I43 B;  4AIS A;  4LF6 T;  3N5L A;  1OED B;  3EHZ A;  1VCT A;  3RYI E;  3N9M A;  5FVK A;  1ZV4 X;  4HGA A;  3JC6 D;  2XSA A;  3ZN0 B;  3B5M A;  4HE8 A;  4DR3 T;  4YSZ A;  2QGS A;  2ZM2 A;  2CLY C;  2V7K A;  2JJ9 A;  1N36 T;  3WTM A;  3P50 A;  5L3G B;  3PTR B;  2W00 A;  3N2O A;  3IBP A;  4HWD A;  5LGT B;  4F8H A;  1UV6 A;  3QOF A;  4UEL A;  3ZJ2 A;  3RHW A;  4ILC A;  2WB5 A;  2LSY A;  1VOM A;  4IL4 A;  4CZZ B;  4HWF A;  4H9S E;  4O2B E;  2HN2 A;  2L3L A;  4B3M T;  1UW6 A;  1IJ6 A;  2BKO A;  1XMO T;  3M3Z B;  2VKJ A;  2VQE T;  2XHE B;  1KEY A;  4AIU A;  5JR9 B;  2XY8 B;  5TAO A;  3AAA B;  2BVL A;  1IJ5 A;  1OED E;  1XMQ T;  3L3P A;  1QSD A;  3K3N A;  1BR4 A;  2X0Y A;  4FJO A;  3KBT A;  4HFV A;  3NWI A;  4P1N A;  2BG9 B;  2WZY A;  4WW0 A;  3UU4 A;  1VRB A;  4U2Y A;  4AQF A;  4DMV A;  3KV4 A;  4HWI B;  3KV5 A;  2Y56 A;  2W67 A;  2ZMA A;  2ACX A;  4IDO A;  4QXB B;  3P4S A;  2FBW A;  4ISS A;  2YU2 A;  4IIJ E;  3KFW X;  3UU3 A;  3E22 E;  4DR1 T;  3VKH A;  4LML A;  5KE4 A;  3P4Q A;  2M6I A;  4ZXL A;  3SQ9 A;  4UR9 A;  3A7M A;  3RRW A;  4BQT A;  4I55 E;  1D1A A;  4D01 A;  5F8P A;  5SYO A;  4O4I E;  4MAL A;  2UU9 T;  5M4Y A;  2WY2 A;  4OYJ A;  4TNV A;  4PW8 A;  3BQL A;  3WAK A;  2E2A A;  3I9W A;  4CXX A;  3QUJ A;  5BRX A;  3U8N A;  3RPU A;  3P4P A;  2LHR A;  5JDG A;  3AEB A;  4NUV A;  2V6X A;  4YSX A;  4DO0 A;  4DV7 T;  3E0Z A;  5KX5 E;  2CM0 A;  3O1H A;  2YEV C;  4B3R T;  3PE0 A;  2XQY A;  2XNU A;  3UUN A;  4GK5 E;  4GKK T;  5HEJ A;  3M65 A;  3RF1 A;  2D2S A;  2CBI A;  3K1S A;  2H3R A;  3ZC0 A;  3LFM A;  3E08 A;  4X66 T;  4U72 A;  2YK0 A;  3U78 A;  3CML A;  2LRL A;  4CI2 B;  5KXJ A;  4JBW F;  1XZY A;  3AE5 A;  3TLV A;  3JAE A;  3UUX B;  2BKN A;  2DNX A;  1G8X A;  4BJM A;  2ACZ A;  4CN6 A;  3AE6 A;  3J9X 1;  4AXP A;  2LE8 A;  3RIU C;  2VWA A;  2Q9Q C;  4NPP A;  4TWF A;  1MNE A;  2IUB A;  2DLR A;  4DR7 T;  1U5P A;  5LJM A;  2XPK A;  3MK7 C;  1J1J A;  4QXC B;  3SH1 A;  4QX8 B;  2UUB T;  5EK2 A;  5FL1 A;  3N9O A;  4ASK A;  5H6R B;  2HPL A;  5DAB A;  2CWY A;  2V7L A;  4Z91 A;  3ZT7 A;  2PGZ A;  4IT4 A;  2R6G F;  2JQH A;  5FP3 A;  4HFH A;  4YJ2 E;  3IGQ A;  4ZI2 C;  4PJN A;  1KNP A;  2C5I T;  4UV9 B;  2X0L B;  4EGW A;  3WTH A;  4ILA A;  4JI0 T;  4E7S A;  3CQC B;  4COF A;  3TLS A;  2X66 A;  3P4R A;  4H63 H;  5LGU B;  3AEE A;  3LG7 A;  3AAI A;  2MBG A;  3Q2M A;  3EAM A;  3V5S A;  2NP9 A;  1KK7 A;  4H63 V;  5HEG A;  2E9X B;  3NRY A;  3ZT6 A;  1QUU A;  2L9Q A;  1Z8U A;  2EHO A;  3PUR A;  3G06 A;  2YOE A;  2IIU A;  4X1I E;  4ZI3 C;  2FJE A;  2M6B A;  4LF7 T;  4XBF B;  2XQ5 A;  3PUS A;  4DBQ A;  3AVR A;  3RQU A;  3PUZ F;  2E9X D;  4U7I A;  5FY0 A;  2LT3 A;  5ADX L;  4IDZ A;  1D1B A;  3GUA A;  2LM9 A;  5LG4 A;  2KND A;  5F5W A;  2OA5 A;  1YXR A;  2WDV A;  4O4L E;  1FJG T;  3W15 B;  4IE7 A;  3OYZ A;  3F31 A;  3KBU A;  5AFM B;  4HTE A;  5DQW A;  3KDS E;  3HA4 A;  5BW2 A;  3LK3 B;  3RX6 A;  2RPA A;  1W0A A;  3OVU A;  5FXV A;  1SHZ C;  4ILB A;  2PFV A;  5KMG P;  3PMZ A;  2YKS A;  3EDV A;  4OHF A;  5AFH A;  3AEF A;  4YXD A;  3U8M A;  1T72 A;  3ZEF B;  4PFO A;  4P0A A;  4JUY A;  2BYP A; 
#chains in the Genus database with same CATH homology
 5HEH A;  2XZ6 A;  3RIA A;  2LM2 A;  3TLT A;  2BG9 A;  5HCM A;  5CFB A;  4QH1 A;  4AFG A;  2ZJU A;  2YMD A;  5HEU A;  5AIN A;  5LG3 A;  2BG9 B;  3EAM A;  2XYS A;  4QH4 A;  4ZJS A;  3ZDG A;  4QAC A;  4HFD A;  2XQ9 A;  2WN9 A;  2PH9 A;  2MAW A;  2WZY A;  2Y7Y A;  4ZK1 A;  4AFT A;  5HEG A;  3UU4 A;  3UQ4 A;  5AFJ A;  2XQ8 A;  2C9T A;  3EI0 A;  2Y56 A;  3UQ7 A;  1OED C;  3TLV A;  3WIP A;  3JAE A;  4LMJ A;  4HFC A;  1UX2 A;  4QAB A;  2YN6 A;  4HFB A;  3WTJ A;  4A98 A;  5TVC A;  2BYS A;  1OED A;  3UU8 A;  2YOE A;  2LKH A;  3WTO A;  1OED B;  3EHZ A;  2WNC A;  4UXU A;  3WTI A;  3UU5 A;  4UM3 P;  5KZU A;  3SIO A;  2LKG A;  3UU3 A;  2UZ6 A;  4NPP A;  4Z90 A;  2QC1 B;  2M6B A;  4ZRU A;  4TWF A;  3RI5 A;  5CO5 A;  2XQ5 A;  4ZJT A;  3TLU A;  5HEO A;  4UY2 A;  4BFQ A;  3P4W A;  4LML A;  3RQU A;  1I9B A;  2BR8 A;  4UM3 A;  4UM3 S;  2M6I A;  5BP0 A;  5KE4 A;  3T4M A;  3SQ9 A;  3PEO A;  3RQW A;  4B5D A;  4IL9 A;  5J5G A;  4NZB A;  2Y54 A;  3WTM A;  4BQT A;  4HFI A;  3P50 A;  2XQ4 A;  2XQ6 A;  2Y58 A;  2XQ7 A;  3SH1 A;  2BG9 E;  3WTK A;  5IUX A;  3GUA A;  4ALX A;  4D01 A;  2Y57 A;  2VL0 A;  4XHE A;  4WV9 A;  3TLW A;  2BYR A;  4IRE A;  5SYO A;  3LSV A;  5J5I A;  3UUB A;  2W8G A;  4F8H A;  2XQ3 A;  4ZR6 A;  4DBM A;  1UV6 A;  5J5H A;  3RHW A;  4ILC A;  2XNV A;  4QH5 A;  4TNV A;  2BR7 A;  2XYT A;  5AFM A;  5JME A;  4PIR A;  4QAA A;  3U8K A;  2XZ5 A;  3U8L A;  5FJV A;  2X00 A;  4XK9 A;  4HFE A;  4Z91 A;  5AFM B;  5L4H A;  2BG9 C;  5L4E A;  5BRX A;  2W8F A;  3WTN A;  2PGZ A;  3U8N A;  5BW2 A;  2WNJ A;  4IL4 A;  4TWH A;  2XQA A;  4A97 A;  2BYQ A;  3U8J A;  4ZZC A;  3C84 A;  4TNW A;  4HFH A;  3JAF A;  4TWD A;  5AFN A;  2LLY A;  5AFK A;  3ZDH A;  1UW6 A;  4ILB A;  4LMK A;  4X5T A;  3RIF A;  2YKS A;  5L47 A;  3PMZ A;  4UM1 A;  4AFH A;  3IGQ A;  2BJ0 A;  2KSR A;  2XNT A;  2YME A;  5AFH A;  2WNL A;  2ZJV A;  3WTL A;  3UU6 A;  5LXB A;  3JAD A;  2XNU A;  3C79 A;  5J5F A;  5AFL A;  5HEJ A;  3WTH A;  4ILA A;  3SQ6 A;  5HCJ A;  3U8M A;  3ZKR A;  4COF A;  3TLS A;  5J0Z A;  4ZK4 A;  4ZZB A;  4FRR A;  4EZ1 A;  4HQP A;  2BYN A;  1OED E;  2X00 D;  2BYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...