4HFIA

The glic pentameric ligand-gated ion channel at 2.4 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
molecule tags Membrane protein, transport protein
source organism Gloeobacter violaceus
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfiA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfiA01
5HEJA 4TWDA 4ZJSA 3WTIA 5AFLA 4UY2A 4ZZBA 3U8NA 2WNLA 1I9BA 2LKHA 2VL0A 3JADA 3U8JA 3GUAA 4ILBA 2UZ6A 3ZKRA 5CFBA 3C84A 5TVCA 5BW2A 3TLSA 3WIPA 4HFCA 4UM3P 4NPPA 4AFHA 5BRXA 2BYPA 2LM2A 4ILAA 3UQ7A 4ILCA 4HFEA 2XZ5A 2Y54A 3SIOA 4PIRA 3WTKA 3U8MA 5AFMB 1OEDA 4FRRA 5AINA 2PGZA 3WTMA 2BYQA 2YOEA 4Z91A 2LKGA 5J5HA 3RQUA 5J5GA 3ZDHA 3JAFA 2WNCA 5L4HA 2X00A 4XK9A 4AFGA 5L4EA 3WTLA 3EHZA 2BYRA 1OEDB 4QH1A 3EI0A 5HEOA 3SQ6A 2XYSA 2Y7YA 5J5FA 2YN6A 4B5DA 2M6BA 2LLYA 2BG9B 5SYOA 5AFJA 5KZUA 5HEUA 4ZK1A 2WZYA 2BR8A 3C79A 2XNVA 5HEGA 4DBMA 4ZRUA 3RHWA 4BQTA 5CO5A 3WTNA 4XHEA 3UU5A 5J0ZA 2WNJA 3IGQA 1UV6A 2YKSA 2WN9A 4QAAA 4WV9A 3SQ9A 1OEDC 2XQ5A 5IUXA 4HFBA 4X5TA 3TLVA 3P50A 3UU4A 2XQAA 5HEHA 3ZDGA 4QH5A 2PH9A 2XQ7A 2W8FA 3SH1A 4ZZCA 4EZ1A 4LMJA 3PMZA 4ZR6A 3P4WA 3WTOA 3LSVA 5BP0A 3RIFA 3WTHA 4ALXA 2XZ6A 2QC1B 3WTJA 3TLTA 5LG3A 5HCMA 4A97A 4BFQA 2XQ9A 4LMLA 2W8GA 2BG9C 3UQ4A 3RI5A 4COFA 3PEOA 2KSRA 2C9TA 2YMDA 1UW6A 4TNVA 2BR7A 4D01A 4F8HA 2XQ3A 2XQ6A 2XNTA 5AFMA 3U8LA 5L47A 2BYNA 2Y58A 4HFIA 4UXUA 3UU3A 4ZK4A 2XNUA 2XQ4A 5AFNA 5LXBA 4IREA 4UM3A 2BG9E 4QH4A 2ZJVA 4UM1A 3RQWA 4HFDA 4LMKA 4ZJTA 3RIAA 3TLUA 2YMEA 1OEDE 3EAMA 3T4MA 5FJVA 4UM3S 5HCJA 4Z90A 4NZBA 4TWFA 4A98A 2XYTA 5AFHA 2XQ8A 2Y56A 4QACA 2MAWA 4HQPA 3U8KA 3JAEA 4AFTA 1UX2A 2BG9A 3TLWA 3UU6A 5JMEA 5J5IA 3UUBA 4IL4A 2ZJUA 2BJ0A 2Y57A 4QABA 5KE4A 3UU8A 4IL9A 4TWHA 4HFHA 2M6IA 5AFKA 4TNWA 2BYSA 2X00D
chains in the Genus database with same CATH superfamily
3RYIE 5L3FB 1XNRT 1ZOYA 5JDHA 2IDOB 2X51A 3Q5DA 2LM2A 3LG7A 3AVRA 5AINA 4JI7T 3ZMVB 5J2TE 2YK0A 5F3JA 3N9MA 1XDPA 2JJ9A 5JDQA 3MZKB 3ZLIA 1HNWT 4DR5T 2XYSA 2YN6A 3K3NA 1D1CA 3B57A 3AE9A 3JC6C 3RC3A 4YSXA 4J2CA 4NIQA 3BK9A 3SOLA 2Y48B 1HX8A 2E2AA 2CXLA 3CX7B 3I9YA 5LBQB 2FJEA 4UR9A 5HEHA 3VHLA 5ABFA 5BP0A 1WRDA 5HWXA 4ZS3A 3AE5A 2LT3A 4GYRA 1KF6A 1N33T 2JQQA 4F8HA 2WM9A 3PJAA 2LSKA 4O4HE 5LP6E 1JNRA 4HKAA 4XAXB 2XQ4A 4JI2T 2ZJVA 4IE0A 3RQWA 3OTOT 5AQQB 2BBJA 5HCJA 2J62A 1US7B 3OYXA 5AFHA 4U74A 2C5JA 1NEKA 3CK6A 3BQKA 2M6IA 1HCIA 3HL6A 4L5GA 4ZZBA 2LKHA 2BKOA 3JADA 4LF4T 3P4SA 4JV5T 2OA5A 1GQEA 2YU1A 5LCYA 4U2ZA 3UTKA 5JREA 2C5KT 2HPJA 3CVRA 4YJ2E 2V6XA 2N1GA 4MHCA 2V26A 4IT4A 2NTYA 2B76A 3WTLA 2DHRA 4Q25A 4GK0E 3IHRA 3OKQA 5AFJA 2E9XB 2WAUA 5HEGA 3N5LA 3AEAA 3N2KE 4QAAA 3EVYA 3IA3A 4HFBA 3F57A 4QH5A 4AKIA 2L9QA 2RPAA 2DWKA 4QXHB 3RIFA 4EIWA 5HCMA 2BBHA 1FMVA 4COFA 3UULA 4ZI2D 2E5VA 3ETUA 1KNPA 5F8PA 4DV3T 3O1JA 2V5DA 3DTOA 3FB2A 3F31A 3SFDA 1ZV4X 4LMKA 1OEDE 2WDRA 3AE6A 3ZCIA 4O4IE 4CN4A 3PUAA 4YFSA 3GMIA 3RC8A 3Q5WA 5KX5E 2Y57A 2D9DA 1D0ZA 5HEJA 2W4XA 4ZJSA 5FYMA 4UY2A 4XBFB 4HWHA 3QB5A 1G8XA 3VR8A 3AEGA 5TVCA 2EHOC 4UM3P 2ODUA 4ILCA 4EXTA 3ANWA 2WB5A 4FRRA 3ZN0B 2YOEA 4Z91A 1HS7A 3ZDHA 2X66A 3WAJA 1UCUA 2VKOA 2H88A 3QNUA 3QUJA 3P7IA 2D2SA 2VWAA 1IBKT 1IBMT 3KVAA 3RHWA 4CZZB 3CWZB 3SS1A 4YHHT 1J5WA 2MOZA 4OYJA 1XDOA 1OEDC 2XQ5A 1NAFA 4X5TA 2V7LA 5EK2A 4HWFA 3PMZA 2J47A 4AISA 4I0UA 3WTJA 5FY0A 3RF1A 3UQ4A 5FNVE 5LHIB 5AQSB 3AAEB 2K3WA 4LF5T 4A56A 5AQKB 4UM3A 2WMNA 3HR0A 3EAMA 3LBXA 3T4MA 4OFZA 3RKOA 2W2UA 3K3OA 2Y56A 2VQFT 5J2UE 4EZHA 1MNDA 3ZT7A 3HA4A 2XZEA 2VK9A 4QXBB 1SA0E 4HFHA 4TNWA 1ZP0A 2H89A 2W61A 1MMAA 2H7OA 2BVMA 1W0BA 1R8IA 5CFBA 2IC6A 1NENA 2Q9QD 4ZS2A 1KK7A 5JDNA 2NR4A 3D0TA 1E2AA 2SPCA 2H7VC 3ZC1A 1XWMA 2LEHA 3RGLA 2E5LT 5J5FA 4NXNT 1IJ6A 4KI0F 2E9XD 1MNEA 2HN1A 5L3DB 4ANJA 4PNIA 1FEWA 2JQHA 4YSZA 4ZR6A 3ONJA 4IGUA 2W67A 5AQVB 4LF7T 2BG9C 2UXDT 4OK0A 3AA7B 3F2EA 2EHOB 3AVSA 2LSYA 2KINB 2X9YA 3KVBA 3UT5E 3L8RA 3RIAA 3SFEA 4HEAA 4DNDA 4YY3T 2XYTA 4WBNE 5LNKA 2CA5A 3Q9DA 5LYJE 4UVBB 4YLHA 4IL9A 2I6HA 2K9AA 2XAGB 4H9OC 1WLXA 1I9BA 5F5WA 2V7JA 5L3EB 3EDUA 2WS3A 4HWDA 3S4UA 2XPKA 4DR6T 5BW2A 3TLSA 2V7MA 2JIWA 3U8MA 2UXBT 1T72A 3AEDA 2PJQA 4P0BA 2FJBA 1O3XA 4DV4T 2V1DB 5KZUA 2YDSA 5DQVA 2XAJB 3BQIA 2XM1A 2FJAA 3PV0F 3OVUA 2W8FA 1WFDA 4EZ1A 2YU2A 3WTOA 4M1PA 4ALXA 3WTHA 3PJAJ 4JLEA 3CKDA 5ADXL 2CPTA 1UX5A 3RI5A 2X67A 2KXPB 4GK5E 4PK5A 2A9UA 2XQ3A 4UF0B 5LHGB 3H3AA 3KFWX 4DV5T 2KNDA 5LXBA 3LDQB 2JPFA 3HI2A 4HFDA 2GK9A 3ZYKA 1I6ZA 4OYKA 2N2NA 1UX2A 2QYWA 4PJMA 5HXCA 2BG9A 5LBMA 5EK4A 2BS4A 3NZPA 3UUBA 3UFGA 4QX8B 2YDRA 3QC9A 1HF8A 1VRBA 4N78D 2V7IA 1XZYA 5JRCA 1XMOT 3ZYLA 4PK4A 2UUAT 2VKDA 2WNLA 1IBLT 3I9WA 1T8BA 2K5BB 4HWCA 4UIGA 3WAKA 2VL8A 4AQFA 4ERRA 2WWVA 4HFEA 2XZ5A 4KX6A 4UEMA 3AB3B 4EV6A 4CI3B 3OJAA 4PK6A 2DCFA 2DNXA 2ZM2A 3JCFA 5IWAT 1X9BA 4MALA 5A1LA 2NW7A 2V5CA 4DR2T 4IDPA 3P4PA 2BR8A 4PW8A 3N2OA 3N9QA 4EZ4A 3OBVE 5C3JA 3PUGA 2CHOA 5AQPB 1YD8G 5LMNT 3TLTA 4CXWA 2JMHA 2XQ9A 1HNZT 5EK3A 4EAHA 2UU9T 2F4VT 2YMDA 2WU2A 4TUYE 2WZIA 3O1HA 3CX6B 3O9XA 2WWUA 4Z90A 4ZHQE 2MAWA 3U8KA 3JAEA 3KV4A 3PDYA 3C84A 3GA8A 2WMOA 3SRZA 2FUPA 2B1EA 2CLYB 2LSJA 3ZT5A 3ESLA 4IE6A 4UELA 2UZ6A 3E0ZA 1L0VA 4WZXA 2CHNA 3C51A 2X9XA 3J9X1 1UURA 4CI1B 2HN2A 1QSDA 1WCRA 4IHJE 2I59A 4OHFA 4AQYT 3RYFE 2CMRA 2KZ7B 2I0MA 4PIRA 4U33A 5KDMC 2WNCA 3ZPOA 3V5UA 1D1AA 4YTPA 1XNQT 3CX8B 3CQCB 2XUEA 2QRXA 4UVCB 3AAAB 2DL1A 4PAGA 4NUVA 1N32T 2UXCT 4DBMA 4JI3T 2ACZA 2EHOD 4XHEA 4ZI7E 5CA0E 3KV5A 2YKSA 2WN9A 4CN6A 3ZDGA 2LHRA 4YTMA 4DV7T 4DR3T 4KHZF 3PUQA 3JC6D 1D0XA 1G73A 5LG3A 5E0OA 2BR7A 3RIUA 2V6YA 3O1IA 3UUXB 4U3CA 2VURA 1KNZA 4WYVA 4B3TT 3RPUA 4DR1T 4PFPA 4JEUB 3FZHB 3AE3A 5FY1A 4NZBA 3CQXC 4TWFA 2LOPA 3TLWA 2W0GA 3TKLB 3VRBA 2ACXA 3E22E 4G63A 4HE8A 1WYBA 2WSSV 2BYSA 5ABFB 4KBMB 4L0RA 3MK7C 2ZM0A 4DV6T 5LJNA 4X65T 4TX5A 3U8JA 2PTFA 4XZCA 2VQET 4UXNB 5EZYE 3VR9A 4H9QC 4X1KE 1J5ET 3CPZA 1SUMB 2IIUA 1OEDA 3EUHA 1BR0A 5HAXA 4EEBA 2BYQA 2X68A 1UX4A 3G06A 2IW5B 4HWIB 4JYAT 1NWMX 2CBJA 2XASB 2WZYA 2BZBA 3E08A 3NRXA 2Q9QA 3AA6B 5FY7A 5JDGA 2J4GA 2XSBA 2PG8A 3IGQA 2W66A 1X79A 3ZMUB 5KMGP 1V9DA 4V1Av 2D5UA 4ZZCA 3SH1A 5AFUL 3RRCA 3LFMA 5LMUT 2DI4A 3C4WA 4I43B 5GONE 4DV2T 2BYNA 3UU3A 1ZKEA 5FXVA 4QH4A 3KBTA 1YQ4A 3I1AA 3C4XA 2JQ9A 5FVLA 3VRAA 4A98A 4CQIA 4MFRA 4QACA 4QXCB 2KLQA 2LRKA 1SHZC 4DUZT 5AFKA 2CE7A 5JH7E 3HKEE 2X00D 3NKZA 2VL0A 3VKGA 1OXZA 3GUAA 4H63H 5JR9B 4U31A 3K3QC 4O2BE 2CWOA 3A5XA 4E7ZA 3O4XE 3L09A 2Y54A 1N36T 3H37A 5AQLB 1IAPA 3W15B 2XTLA 3WTMA 3RQUA 2Y7YA 4GIWA 4B5DA 2NP9A 3ZMZB 4C91A 2BS2A 5HEUA 1M7KA 4F6RC 1HNXT 1N34T 3KV6A 3L39A 1VCTA 3WTNA 1S94A 1Z8UA 3P4QA 1IZNB 3TLVA 3ZMTB 3FZFB 3NBXX 4ZI3D 5ETWA 2W8GA 1FJGT 2ZM6T 4UVAB 1WR6A 4TNVA 2VKHA 4D01A 5C8YE 3ZT6A 1HR0T 4HFIA 2YEVC 3ZJ1A 4UM1A 4AKRB 3MXZA 2KWHA 2WBLA 5LXTE 4GOUA 4PJLA 2MBGA 1W09A 3RLFF 4JI6T 4LF9T 2UXXB 1OWAA 5LA6E 4AIUA 2LJLA 2XAFB 3RYCE 3PUWF 4GYSA 3FXDB 2CCQA 2BJ0A 4QABA 5L3BB 3PU3A 3WTIA 4Z8XA 5AFLA 2LSGA 3NWIA 4ASKA 5AQTB 5H6RB 2HPLA 2LM9A 2MPKA 4OX9T 4KUMB 2X0LB 5HXHA 3WTKA 2WU5A 1MMDA 2CXDA 2PBIA 3A8YC 4H9NC 3Q5XA 3LBXB 2DLRA 4X62T 1UUSA 5L3CB 3ONLC 3EI0A 5JVDE 1YW0A 2WDQA 4A5XA 1XMQT 3RX6A 2MTQA 3DJBA 2XY8B 4ZK1A 3VU7H 4CI2B 3MKDA 5AQRB 4O8SA 2XNVA 4ZRUA 5H6QB 2IC9A 1D1BA 2L3LA 4O4LE 3HKCE 2PH9A 1VOMA 1MMGA 2Q9QC 4BA9A 4UV8B 3M65A 3H3MA 3I0QA 2XHEB 4YHJA 4AQGA 5L47A 2Y58A 2JMKA 1SE7A 2N9DA 4EEDA 5FVKA 3N9PA 5ABEA 3OYZA 1HFAA 3PUYF 3T8OA 2A3DA 4YTNA 3U3IA 1ZHCA 4AKHA 3EDVA 2R6GF 3LK2B 4B6XA 4JI1T 4GKKT 1YKHB 3IF8B 2JRKA 4DUYT 4HFCA 4AFHA 3RH3A 3PUVF 2KMFA 2D0UA 5FKYA 2WCAA 3FBLA 2PGZA 3ZEFB 4X20E 4O4JE 1E7PA 2X00A 4AFGA 3EHZA 3GN5B 4I55E 4IDOA 2LLYA 3C4ZA 4U7YA 3ZJ2A 3A7MA 3T1YT 2AXDS 4NUUA 3LK42 1IJ5A 3RRWA 3ZN1B 4IE5A 4DBQA 2XQAA 4WBOA 4DBRA 2VKJA 3C98B 4LMJA 5LG4A 3PTRB 2V8SV 3P4RA 1J1JA 2YINA 4LMLA 5BMVE 3AXJA 1AJ3A 3UUNA 1UW6A 1MIWA 3PURA 3IEEA 4JI0T 2UUBT 4AKGA 2PFVA 3AE4A 4X1YE 2RA1A 4UXUA 4HFVA 3B13A 2C5IT 3QB5K 1QLBA 4EYYR 1BR4A 5LJMA 4DV1T 4BJNA 3HKBE 3AA0B 3PUXF 3KINB 1FMWA 2X9WA 5JDFA 4EB6E 2A72A 3UU6A 5C2TA 5AQMB 3RYHE 2CM0A 5IYZE 2FBWA 3ZKRA 2E8IA 4U2YA 4ADZA 3WIPA 2QGSA 3ANWB 4NPPA 5JR9C 4ILAA 4UF0A 4CXYA 5AQUB 2K48A 2BDEA 3ZCJA 2XJ7A 5JQGE 5AFMB 3PUSA 2CRBA 1Z0PA 3L3PA 2CWYA 4ZXLA 4DMWA 2BG9B 1LVKA 4LF8T 1DU2A 4ZEYA 4FI5A 5LGTB 2LHNA 5AQOB 4BQTA 4H9RC 4K0UA 2C0SA 5DABA 5JRCB 2WNJA 3KBUA 1UV6A 4WV9A 3C64A 1S35A 3U78A 3NVOA 5L2LA 3N9LA 1LKXA 5ABGA 3VKHA 2CBIA 4DO0A 1T98A 1BR1A 4A97A 5JDLA 2IUBA 2C9TA 2ZLYA 1M62A 3AE8A 2X9HA 2LOSA 4DR7T 4QX7B 4BAYB 4ZK4A 2XNUA 3ETVA 2LSIA 2WDVA 4YJ3E 1QUUA 2CLYC 1HTJF 4ZJTA 3TLUA 3CIRA 2XQ8A 3MJXA 3AE7A 5TAOA 5HXRA 5LGUB 5HWYA 2XAQB 4H63V 1CUNA 1HG5A 3QK6A 3OPCA 3AEFA 4JBWF 2IHR1 2MYSA 3UU8A 4TWHA 3X1DA 2BVLA 2WY2A 4ILBA 3Q5EA 4HN9A 3UQ7A 1HG2A 4AKLA 3V5SA 5LGNB 3BQLA 3C50A 2W00A 4H9SE 2Z6EA 5J5HA 4I50E 4QKNA 2ZM8A 2LRLA 2XM2A 1I94T 5FXZA 1UK5A 1EZ3A 4KMCA 3P8CD 2E9XA 5J0ZA 4JEHB 4IIJE 2XQ7A 3AA1B 2EHOA 4K0KT 3N2GE 3PEOA 2L8KA 4B3RT 5AQGB 2HH7A 4ISTA 3CQGB 2KWIB 4ZI2C 3U8LA 4JI5T 2BG9E 2XAHB 2OLTA 3AAIA 4PFOA 5M4YA 4P09A 5FXWA 2NW9A 4AFTA 2V7KA 5CB4E 5AQHB 4IL4A 2HHHT 3GWHA 4ILUA 3NZQA 3U8NA 5AQIB 2WQYA 4MBQA 5HXEA 1CHUA 2BYPA 4AQFC 3I0OA 4U72A 5J1GA 4CN1A 4LFBT 1Y01A 2UUCT 3J7Yq 3ZSTA 3LK3B 3CMLA 2RP4A 5J5GA 3KV9A 4HGAA 1W9RA 2Y6XA 2IAKA 2NTXA 4QH1A 2XSAA 3EABA 2M67A 2W63A 5CGMA 1MIVA 3FZKB 3AECA 2XQYA 3FZLB 1YQ3A 4DV0T 4LFCT 3RIUC 3UUMA 4ISSA 3UU5A 4YT0A 4FJOA 5CA1E 5IUXA 3AEBA 3ZYMA 3P4WA 2BKNA 2NWBA 2XZ6A 5FP3A 5HYAA 2KSRA 2BS3A 4KP3C 4B3ST 4B3MT 5AFMA 3FZMB 4O2AE 3IBPA 2QA7A 2CXFA 1HX1B 1KFYA 2V6YB 4P0AA 3ABVA 1U4QA 4DR4T 3NRYA 3ONXA 3DP7A 3PE0A 2Q9QB 5JDMA 2LE8A 5FL1A 1B7TA 2WZHA 2ZJUA 2AE9A 2UXNB 2ZMAA 4NXMT 4EOZB 3MACA 1LVFA 4L9IA 5DQWA 2DWGA 4AXPA 5JTGA 3KDSE 3M3ZB 4DVDA 1JNZA 3HKDE 4LFAT 1WYCA 4WNKA 5LHHB 3SIOA 3FXEB 4YXDA 4TZ4C 3ZC0A 4P1NA 3B5MA 1UGOA 2QVAA 1U5PA 4CXXA 1YXRA 4XK9A 5FXXA 3SQ6A 1OEDB 3UFEA 5HEOA 5SYOA 4G2AA 5IHYA 1E1HB 3WI3A 2E9XC 3N9OA 2WP9A 4MLKA 4TN7B 4EYUA 1MMNA 3P50A 3UU4A 2NOXA 4HTEA 5JR9A 5AQFB 3LSVA 2X0YA 3Q2MA 2QC1B 2G0UA 5AQNB 5CJ5A 2CEAA 4IDZA 2XNTA 2XQ6A 1KNRA 4PJNA 5ABHA 2J1DG 4X1IE 4LF6T 4DIDB 5AFNA 4IREA 2P9BA 3FHNA 2YMEA 3R6NA 5FJVA 4U7IA 5LB7B 4EGWA 4E7SA 4TV9E 3N9NA 2X0HA 5JMEA 2JQKA 4QWNB 2A2FX 5J5IA 5LOVE 5BR8T 3PUZF 4I4TE 3K1SA 3LJCA 4TWDA 4ZI3C 3K8PC 4PJJA 2H3RA 5KXJA 4ZOLE 2W62A 5BRXA 3MA9A 2IMLA 1BR2A 3AE1A 2KT9A 4IE4A 4GKJT 3GN5A 1T7SA 2LKGA 2FJDA 3JAFA 5L4HA 1FIOA 4DMVA 1WR0A 1Y64B 5L4EA 1YKEB 2BYRA 3AEEA 2YDQA 2M6BA 3T1HT 5FL0A 4YSYA 4AI6A 1W0AA 1D0YA 2NW8A 4JI8T 3C79A 2VVSA 4TV8E 1VCSA 5CO5A 1H7CA 4JUYA 3SQ9A 2VVNA 3PU8A 5DJQC 4UV9B 3AXJB 1LRZA 2ODVA 2BKPA 4X64T 2VB6A 4BFQA 2Y8DA 2K24A 4KHPT 3AE2A 1ZEEA 4IDQA 4X66T 4C90A 5AQJB 2D0TA 5FMNA 3RKGA 5L3GB 3QOFA 3FBZA 4UM3S 5HXSA 3ZSSA 4IDNA 3R84B 4BJMA 4HQPA 2OV9A 2ES0A 4IE7A 4WW0A 3SWHA 1KEYA 3ZMSB 4H9PC 4JI4T 4QHOA 5KE4A 1MIYA 2VASA
chains in the Genus database with same CATH topology
5HEJA 4TWDA 4ZJSA 3WTIA 5AFLA 4UY2A 4ZZBA 3U8NA 2WNLA 1I9BA 2LKHA 2VL0A 3JADA 3U8JA 3GUAA 4ILBA 2UZ6A 3ZKRA 5CFBA 3C84A 5TVCA 5BW2A 3TLSA 3WIPA 4HFCA 4UM3P 4NPPA 4AFHA 5BRXA 2BYPA 2LM2A 4ILAA 3UQ7A 4ILCA 4HFEA 2XZ5A 2Y54A 3SIOA 4PIRA 3WTKA 3U8MA 5AFMB 1OEDA 4FRRA 5AINA 2PGZA 3WTMA 2BYQA 2YOEA 4Z91A 2LKGA 5J5HA 3RQUA 5J5GA 3ZDHA 3JAFA 2WNCA 5L4HA 2X00A 4XK9A 4AFGA 5L4EA 3WTLA 3EHZA 2BYRA 1OEDB 4QH1A 3EI0A 5HEOA 3SQ6A 2XYSA 2Y7YA 5J5FA 2YN6A 4B5DA 2M6BA 2LLYA 2BG9B 5SYOA 5AFJA 5KZUA 5HEUA 4ZK1A 2WZYA 2BR8A 3C79A 2XNVA 5HEGA 4DBMA 4ZRUA 3RHWA 4BQTA 5CO5A 3WTNA 4XHEA 3UU5A 5J0ZA 2WNJA 3IGQA 1UV6A 2YKSA 2WN9A 4QAAA 4WV9A 3SQ9A 1OEDC 2XQ5A 5IUXA 4HFBA 4X5TA 3TLVA 3P50A 3UU4A 2XQAA 5HEHA 3ZDGA 4QH5A 2PH9A 2XQ7A 2W8FA 3SH1A 4ZZCA 4EZ1A 4LMJA 3PMZA 4ZR6A 3P4WA 3WTOA 3LSVA 5BP0A 3RIFA 3WTHA 4ALXA 2XZ6A 2QC1B 3WTJA 3TLTA 5LG3A 5HCMA 4A97A 4BFQA 2XQ9A 4LMLA 2W8GA 2BG9C 3UQ4A 3RI5A 4COFA 3PEOA 2KSRA 2C9TA 2YMDA 1UW6A 4TNVA 2BR7A 4D01A 4F8HA 2XQ3A 2XQ6A 2XNTA 5AFMA 3U8LA 5L47A 2BYNA 2Y58A 4HFIA 4UXUA 3UU3A 4ZK4A 2XNUA 2XQ4A 5AFNA 5LXBA 4IREA 4UM3A 2BG9E 4QH4A 2ZJVA 4UM1A 3RQWA 4HFDA 4LMKA 4ZJTA 3RIAA 3TLUA 2YMEA 1OEDE 3EAMA 3T4MA 5FJVA 4UM3S 5HCJA 4Z90A 4NZBA 4TWFA 4A98A 2XYTA 5AFHA 2XQ8A 2Y56A 4QACA 2MAWA 4HQPA 3U8KA 3JAEA 4AFTA 1UX2A 2BG9A 3TLWA 3UU6A 5JMEA 5J5IA 3UUBA 4IL4A 2ZJUA 2BJ0A 2Y57A 4QABA 5KE4A 3UU8A 4IL9A 4TWHA 4HFHA 2M6IA 5AFKA 4TNWA 2BYSA 2X00D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEJ A;  4TWD A;  4ZJS A;  3WTI A;  5AFL A;  4UY2 A;  4ZZB A;  3U8N A;  2WNL A;  1I9B A;  2LKH A;  2VL0 A;  3JAD A;  3U8J A;  3GUA A;  4ILB A;  2UZ6 A;  3ZKR A;  5CFB A;  3C84 A;  5TVC A;  5BW2 A;  3TLS A;  3WIP A;  4HFC A;  4UM3 P;  4NPP A;  4AFH A;  5BRX A;  2BYP A;  2LM2 A;  4ILA A;  3UQ7 A;  4ILC A;  4HFE A;  2XZ5 A;  2Y54 A;  3SIO A;  4PIR A;  3WTK A;  3U8M A;  5AFM B;  1OED A;  4FRR A;  5AIN A;  2PGZ A;  3WTM A;  2BYQ A;  2YOE A;  4Z91 A;  2LKG A;  5J5H A;  3RQU A;  5J5G A;  3ZDH A;  3JAF A;  2WNC A;  5L4H A;  2X00 A;  4XK9 A;  4AFG A;  5L4E A;  3WTL A;  3EHZ A;  2BYR A;  1OED B;  4QH1 A;  3EI0 A;  5HEO A;  3SQ6 A;  2XYS A;  2Y7Y A;  5J5F A;  2YN6 A;  4B5D A;  2M6B A;  2LLY A;  2BG9 B;  5SYO A;  5AFJ A;  5KZU A;  5HEU A;  4ZK1 A;  2WZY A;  2BR8 A;  3C79 A;  2XNV A;  5HEG A;  4DBM A;  4ZRU A;  3RHW A;  4BQT A;  5CO5 A;  3WTN A;  4XHE A;  3UU5 A;  5J0Z A;  2WNJ A;  3IGQ A;  1UV6 A;  2YKS A;  2WN9 A;  4QAA A;  4WV9 A;  3SQ9 A;  1OED C;  2XQ5 A;  5IUX A;  4HFB A;  4X5T A;  3TLV A;  3P50 A;  3UU4 A;  2XQA A;  5HEH A;  3ZDG A;  4QH5 A;  2PH9 A;  2XQ7 A;  2W8F A;  3SH1 A;  4ZZC A;  4EZ1 A;  4LMJ A;  3PMZ A;  4ZR6 A;  3P4W A;  3WTO A;  3LSV A;  5BP0 A;  3RIF A;  3WTH A;  4ALX A;  2XZ6 A;  2QC1 B;  3WTJ A;  3TLT A;  5LG3 A;  5HCM A;  4A97 A;  4BFQ A;  2XQ9 A;  4LML A;  2W8G A;  2BG9 C;  3UQ4 A;  3RI5 A;  4COF A;  3PEO A;  2KSR A;  2C9T A;  2YMD A;  1UW6 A;  4TNV A;  2BR7 A;  4D01 A;  4F8H A;  2XQ3 A;  2XQ6 A;  2XNT A;  5AFM A;  3U8L A;  5L47 A;  2BYN A;  2Y58 A;  4HFI A;  4UXU A;  3UU3 A;  4ZK4 A;  2XNU A;  2XQ4 A;  5AFN A;  5LXB A;  4IRE A;  4UM3 A;  2BG9 E;  4QH4 A;  2ZJV A;  4UM1 A;  3RQW A;  4HFD A;  4LMK A;  4ZJT A;  3RIA A;  3TLU A;  2YME A;  1OED E;  3EAM A;  3T4M A;  5FJV A;  4UM3 S;  5HCJ A;  4Z90 A;  4NZB A;  4TWF A;  4A98 A;  2XYT A;  5AFH A;  2XQ8 A;  2Y56 A;  4QAC A;  2MAW A;  4HQP A;  3U8K A;  3JAE A;  4AFT A;  1UX2 A;  2BG9 A;  3TLW A;  3UU6 A;  5JME A;  5J5I A;  3UUB A;  4IL4 A;  2ZJU A;  2BJ0 A;  2Y57 A;  4QAB A;  5KE4 A;  3UU8 A;  4IL9 A;  4TWH A;  4HFH A;  2M6I A;  5AFK A;  4TNW A;  2BYS A;  2X00 D; 
#chains in the Genus database with same CATH topology
 3RYI E;  5L3F B;  1XNR T;  1ZOY A;  5JDH A;  2IDO B;  2X51 A;  3Q5D A;  2LM2 A;  3LG7 A;  3AVR A;  5AIN A;  4JI7 T;  3ZMV B;  5J2T E;  2YK0 A;  5F3J A;  3N9M A;  1XDP A;  2JJ9 A;  5JDQ A;  3MZK B;  3ZLI A;  1HNW T;  4DR5 T;  2XYS A;  2YN6 A;  3K3N A;  1D1C A;  3B57 A;  3AE9 A;  3JC6 C;  3RC3 A;  4YSX A;  4J2C A;  4NIQ A;  3BK9 A;  3SOL A;  2Y48 B;  1HX8 A;  2E2A A;  2CXL A;  3CX7 B;  3I9Y A;  5LBQ B;  2FJE A;  4UR9 A;  5HEH A;  3VHL A;  5ABF A;  5BP0 A;  1WRD A;  5HWX A;  4ZS3 A;  3AE5 A;  2LT3 A;  4GYR A;  1KF6 A;  1N33 T;  2JQQ A;  4F8H A;  2WM9 A;  3PJA A;  2LSK A;  4O4H E;  5LP6 E;  1JNR A;  4HKA A;  4XAX B;  2XQ4 A;  4JI2 T;  2ZJV A;  4IE0 A;  3RQW A;  3OTO T;  5AQQ B;  2BBJ A;  5HCJ A;  2J62 A;  1US7 B;  3OYX A;  5AFH A;  4U74 A;  2C5J A;  1NEK A;  3CK6 A;  3BQK A;  2M6I A;  1HCI A;  3HL6 A;  4L5G A;  4ZZB A;  2LKH A;  2BKO A;  3JAD A;  4LF4 T;  3P4S A;  4JV5 T;  2OA5 A;  1GQE A;  2YU1 A;  5LCY A;  4U2Z A;  3UTK A;  5JRE A;  2C5K T;  2HPJ A;  3CVR A;  4YJ2 E;  2V6X A;  2N1G A;  4MHC A;  2V26 A;  4IT4 A;  2NTY A;  2B76 A;  3WTL A;  2DHR A;  4Q25 A;  4GK0 E;  3IHR A;  3OKQ A;  5AFJ A;  2E9X B;  2WAU A;  5HEG A;  3N5L A;  3AEA A;  3N2K E;  4QAA A;  3EVY A;  3IA3 A;  4HFB A;  3F57 A;  4QH5 A;  4AKI A;  2L9Q A;  2RPA A;  2DWK A;  4QXH B;  3RIF A;  4EIW A;  5HCM A;  2BBH A;  1FMV A;  4COF A;  3UUL A;  4ZI2 D;  2E5V A;  3ETU A;  1KNP A;  5F8P A;  4DV3 T;  3O1J A;  2V5D A;  3DTO A;  3FB2 A;  3F31 A;  3SFD A;  1ZV4 X;  4LMK A;  1OED E;  2WDR A;  3AE6 A;  3ZCI A;  4O4I E;  4CN4 A;  3PUA A;  4YFS A;  3GMI A;  3RC8 A;  3Q5W A;  5KX5 E;  2Y57 A;  2D9D A;  1D0Z A;  5HEJ A;  2W4X A;  4ZJS A;  5FYM A;  4UY2 A;  4XBF B;  4HWH A;  3QB5 A;  1G8X A;  3VR8 A;  3AEG A;  5TVC A;  2EHO C;  4UM3 P;  2ODU A;  4ILC A;  4EXT A;  3ANW A;  2WB5 A;  4FRR A;  3ZN0 B;  2YOE A;  4Z91 A;  1HS7 A;  3ZDH A;  2X66 A;  3WAJ A;  1UCU A;  2VKO A;  2H88 A;  3QNU A;  3QUJ A;  3P7I A;  2D2S A;  2VWA A;  1IBK T;  1IBM T;  3KVA A;  3RHW A;  4CZZ B;  3CWZ B;  3SS1 A;  4YHH T;  1J5W A;  2MOZ A;  4OYJ A;  1XDO A;  1OED C;  2XQ5 A;  1NAF A;  4X5T A;  2V7L A;  5EK2 A;  4HWF A;  3PMZ A;  2J47 A;  4AIS A;  4I0U A;  3WTJ A;  5FY0 A;  3RF1 A;  3UQ4 A;  5FNV E;  5LHI B;  5AQS B;  3AAE B;  2K3W A;  4LF5 T;  4A56 A;  5AQK B;  4UM3 A;  2WMN A;  3HR0 A;  3EAM A;  3LBX A;  3T4M A;  4OFZ A;  3RKO A;  2W2U A;  3K3O A;  2Y56 A;  2VQF T;  5J2U E;  4EZH A;  1MND A;  3ZT7 A;  3HA4 A;  2XZE A;  2VK9 A;  4QXB B;  1SA0 E;  4HFH A;  4TNW A;  1ZP0 A;  2H89 A;  2W61 A;  1MMA A;  2H7O A;  2BVM A;  1W0B A;  1R8I A;  5CFB A;  2IC6 A;  1NEN A;  2Q9Q D;  4ZS2 A;  1KK7 A;  5JDN A;  2NR4 A;  3D0T A;  1E2A A;  2SPC A;  2H7V C;  3ZC1 A;  1XWM A;  2LEH A;  3RGL A;  2E5L T;  5J5F A;  4NXN T;  1IJ6 A;  4KI0 F;  2E9X D;  1MNE A;  2HN1 A;  5L3D B;  4ANJ A;  4PNI A;  1FEW A;  2JQH A;  4YSZ A;  4ZR6 A;  3ONJ A;  4IGU A;  2W67 A;  5AQV B;  4LF7 T;  2BG9 C;  2UXD T;  4OK0 A;  3AA7 B;  3F2E A;  2EHO B;  3AVS A;  2LSY A;  2KIN B;  2X9Y A;  3KVB A;  3UT5 E;  3L8R A;  3RIA A;  3SFE A;  4HEA A;  4DND A;  4YY3 T;  2XYT A;  4WBN E;  5LNK A;  2CA5 A;  3Q9D A;  5LYJ E;  4UVB B;  4YLH A;  4IL9 A;  2I6H A;  2K9A A;  2XAG B;  4H9O C;  1WLX A;  1I9B A;  5F5W A;  2V7J A;  5L3E B;  3EDU A;  2WS3 A;  4HWD A;  3S4U A;  2XPK A;  4DR6 T;  5BW2 A;  3TLS A;  2V7M A;  2JIW A;  3U8M A;  2UXB T;  1T72 A;  3AED A;  2PJQ A;  4P0B A;  2FJB A;  1O3X A;  4DV4 T;  2V1D B;  5KZU A;  2YDS A;  5DQV A;  2XAJ B;  3BQI A;  2XM1 A;  2FJA A;  3PV0 F;  3OVU A;  2W8F A;  1WFD A;  4EZ1 A;  2YU2 A;  3WTO A;  4M1P A;  4ALX A;  3WTH A;  3PJA J;  4JLE A;  3CKD A;  5ADX L;  2CPT A;  1UX5 A;  3RI5 A;  2X67 A;  2KXP B;  4GK5 E;  4PK5 A;  2A9U A;  2XQ3 A;  4UF0 B;  5LHG B;  3H3A A;  3KFW X;  4DV5 T;  2KND A;  5LXB A;  3LDQ B;  2JPF A;  3HI2 A;  4HFD A;  2GK9 A;  3ZYK A;  1I6Z A;  4OYK A;  2N2N A;  1UX2 A;  2QYW A;  4PJM A;  5HXC A;  2BG9 A;  5LBM A;  5EK4 A;  2BS4 A;  3NZP A;  3UUB A;  3UFG A;  4QX8 B;  2YDR A;  3QC9 A;  1HF8 A;  1VRB A;  4N78 D;  2V7I A;  1XZY A;  5JRC A;  1XMO T;  3ZYL A;  4PK4 A;  2UUA T;  2VKD A;  2WNL A;  1IBL T;  3I9W A;  1T8B A;  2K5B B;  4HWC A;  4UIG A;  3WAK A;  2VL8 A;  4AQF A;  4ERR A;  2WWV A;  4HFE A;  2XZ5 A;  4KX6 A;  4UEM A;  3AB3 B;  4EV6 A;  4CI3 B;  3OJA A;  4PK6 A;  2DCF A;  2DNX A;  2ZM2 A;  3JCF A;  5IWA T;  1X9B A;  4MAL A;  5A1L A;  2NW7 A;  2V5C A;  4DR2 T;  4IDP A;  3P4P A;  2BR8 A;  4PW8 A;  3N2O A;  3N9Q A;  4EZ4 A;  3OBV E;  5C3J A;  3PUG A;  2CHO A;  5AQP B;  1YD8 G;  5LMN T;  3TLT A;  4CXW A;  2JMH A;  2XQ9 A;  1HNZ T;  5EK3 A;  4EAH A;  2UU9 T;  2F4V T;  2YMD A;  2WU2 A;  4TUY E;  2WZI A;  3O1H A;  3CX6 B;  3O9X A;  2WWU A;  4Z90 A;  4ZHQ E;  2MAW A;  3U8K A;  3JAE A;  3KV4 A;  3PDY A;  3C84 A;  3GA8 A;  2WMO A;  3SRZ A;  2FUP A;  2B1E A;  2CLY B;  2LSJ A;  3ZT5 A;  3ESL A;  4IE6 A;  4UEL A;  2UZ6 A;  3E0Z A;  1L0V A;  4WZX A;  2CHN A;  3C51 A;  2X9X A;  3J9X 1;  1UUR A;  4CI1 B;  2HN2 A;  1QSD A;  1WCR A;  4IHJ E;  2I59 A;  4OHF A;  4AQY T;  3RYF E;  2CMR A;  2KZ7 B;  2I0M A;  4PIR A;  4U33 A;  5KDM C;  2WNC A;  3ZPO A;  3V5U A;  1D1A A;  4YTP A;  1XNQ T;  3CX8 B;  3CQC B;  2XUE A;  2QRX A;  4UVC B;  3AAA B;  2DL1 A;  4PAG A;  4NUV A;  1N32 T;  2UXC T;  4DBM A;  4JI3 T;  2ACZ A;  2EHO D;  4XHE A;  4ZI7 E;  5CA0 E;  3KV5 A;  2YKS A;  2WN9 A;  4CN6 A;  3ZDG A;  2LHR A;  4YTM A;  4DV7 T;  4DR3 T;  4KHZ F;  3PUQ A;  3JC6 D;  1D0X A;  1G73 A;  5LG3 A;  5E0O A;  2BR7 A;  3RIU A;  2V6Y A;  3O1I A;  3UUX B;  4U3C A;  2VUR A;  1KNZ A;  4WYV A;  4B3T T;  3RPU A;  4DR1 T;  4PFP A;  4JEU B;  3FZH B;  3AE3 A;  5FY1 A;  4NZB A;  3CQX C;  4TWF A;  2LOP A;  3TLW A;  2W0G A;  3TKL B;  3VRB A;  2ACX A;  3E22 E;  4G63 A;  4HE8 A;  1WYB A;  2WSS V;  2BYS A;  5ABF B;  4KBM B;  4L0R A;  3MK7 C;  2ZM0 A;  4DV6 T;  5LJN A;  4X65 T;  4TX5 A;  3U8J A;  2PTF A;  4XZC A;  2VQE T;  4UXN B;  5EZY E;  3VR9 A;  4H9Q C;  4X1K E;  1J5E T;  3CPZ A;  1SUM B;  2IIU A;  1OED A;  3EUH A;  1BR0 A;  5HAX A;  4EEB A;  2BYQ A;  2X68 A;  1UX4 A;  3G06 A;  2IW5 B;  4HWI B;  4JYA T;  1NWM X;  2CBJ A;  2XAS B;  2WZY A;  2BZB A;  3E08 A;  3NRX A;  2Q9Q A;  3AA6 B;  5FY7 A;  5JDG A;  2J4G A;  2XSB A;  2PG8 A;  3IGQ A;  2W66 A;  1X79 A;  3ZMU B;  5KMG P;  1V9D A;  4V1A v;  2D5U A;  4ZZC A;  3SH1 A;  5AFU L;  3RRC A;  3LFM A;  5LMU T;  2DI4 A;  3C4W A;  4I43 B;  5GON E;  4DV2 T;  2BYN A;  3UU3 A;  1ZKE A;  5FXV A;  4QH4 A;  3KBT A;  1YQ4 A;  3I1A A;  3C4X A;  2JQ9 A;  5FVL A;  3VRA A;  4A98 A;  4CQI A;  4MFR A;  4QAC A;  4QXC B;  2KLQ A;  2LRK A;  1SHZ C;  4DUZ T;  5AFK A;  2CE7 A;  5JH7 E;  3HKE E;  2X00 D;  3NKZ A;  2VL0 A;  3VKG A;  1OXZ A;  3GUA A;  4H63 H;  5JR9 B;  4U31 A;  3K3Q C;  4O2B E;  2CWO A;  3A5X A;  4E7Z A;  3O4X E;  3L09 A;  2Y54 A;  1N36 T;  3H37 A;  5AQL B;  1IAP A;  3W15 B;  2XTL A;  3WTM A;  3RQU A;  2Y7Y A;  4GIW A;  4B5D A;  2NP9 A;  3ZMZ B;  4C91 A;  2BS2 A;  5HEU A;  1M7K A;  4F6R C;  1HNX T;  1N34 T;  3KV6 A;  3L39 A;  1VCT A;  3WTN A;  1S94 A;  1Z8U A;  3P4Q A;  1IZN B;  3TLV A;  3ZMT B;  3FZF B;  3NBX X;  4ZI3 D;  5ETW A;  2W8G A;  1FJG T;  2ZM6 T;  4UVA B;  1WR6 A;  4TNV A;  2VKH A;  4D01 A;  5C8Y E;  3ZT6 A;  1HR0 T;  4HFI A;  2YEV C;  3ZJ1 A;  4UM1 A;  4AKR B;  3MXZ A;  2KWH A;  2WBL A;  5LXT E;  4GOU A;  4PJL A;  2MBG A;  1W09 A;  3RLF F;  4JI6 T;  4LF9 T;  2UXX B;  1OWA A;  5LA6 E;  4AIU A;  2LJL A;  2XAF B;  3RYC E;  3PUW F;  4GYS A;  3FXD B;  2CCQ A;  2BJ0 A;  4QAB A;  5L3B B;  3PU3 A;  3WTI A;  4Z8X A;  5AFL A;  2LSG A;  3NWI A;  4ASK A;  5AQT B;  5H6R B;  2HPL A;  2LM9 A;  2MPK A;  4OX9 T;  4KUM B;  2X0L B;  5HXH A;  3WTK A;  2WU5 A;  1MMD A;  2CXD A;  2PBI A;  3A8Y C;  4H9N C;  3Q5X A;  3LBX B;  2DLR A;  4X62 T;  1UUS A;  5L3C B;  3ONL C;  3EI0 A;  5JVD E;  1YW0 A;  2WDQ A;  4A5X A;  1XMQ T;  3RX6 A;  2MTQ A;  3DJB A;  2XY8 B;  4ZK1 A;  3VU7 H;  4CI2 B;  3MKD A;  5AQR B;  4O8S A;  2XNV A;  4ZRU A;  5H6Q B;  2IC9 A;  1D1B A;  2L3L A;  4O4L E;  3HKC E;  2PH9 A;  1VOM A;  1MMG A;  2Q9Q C;  4BA9 A;  4UV8 B;  3M65 A;  3H3M A;  3I0Q A;  2XHE B;  4YHJ A;  4AQG A;  5L47 A;  2Y58 A;  2JMK A;  1SE7 A;  2N9D A;  4EED A;  5FVK A;  3N9P A;  5ABE A;  3OYZ A;  1HFA A;  3PUY F;  3T8O A;  2A3D A;  4YTN A;  3U3I A;  1ZHC A;  4AKH A;  3EDV A;  2R6G F;  3LK2 B;  4B6X A;  4JI1 T;  4GKK T;  1YKH B;  3IF8 B;  2JRK A;  4DUY T;  4HFC A;  4AFH A;  3RH3 A;  3PUV F;  2KMF A;  2D0U A;  5FKY A;  2WCA A;  3FBL A;  2PGZ A;  3ZEF B;  4X20 E;  4O4J E;  1E7P A;  2X00 A;  4AFG A;  3EHZ A;  3GN5 B;  4I55 E;  4IDO A;  2LLY A;  3C4Z A;  4U7Y A;  3ZJ2 A;  3A7M A;  3T1Y T;  2AXD S;  4NUU A;  3LK4 2;  1IJ5 A;  3RRW A;  3ZN1 B;  4IE5 A;  4DBQ A;  2XQA A;  4WBO A;  4DBR A;  2VKJ A;  3C98 B;  4LMJ A;  5LG4 A;  3PTR B;  2V8S V;  3P4R A;  1J1J A;  2YIN A;  4LML A;  5BMV E;  3AXJ A;  1AJ3 A;  3UUN A;  1UW6 A;  1MIW A;  3PUR A;  3IEE A;  4JI0 T;  2UUB T;  4AKG A;  2PFV A;  3AE4 A;  4X1Y E;  2RA1 A;  4UXU A;  4HFV A;  3B13 A;  2C5I T;  3QB5 K;  1QLB A;  4EYY R;  1BR4 A;  5LJM A;  4DV1 T;  4BJN A;  3HKB E;  3AA0 B;  3PUX F;  3KIN B;  1FMW A;  2X9W A;  5JDF A;  4EB6 E;  2A72 A;  3UU6 A;  5C2T A;  5AQM B;  3RYH E;  2CM0 A;  5IYZ E;  2FBW A;  3ZKR A;  2E8I A;  4U2Y A;  4ADZ A;  3WIP A;  2QGS A;  3ANW B;  4NPP A;  5JR9 C;  4ILA A;  4UF0 A;  4CXY A;  5AQU B;  2K48 A;  2BDE A;  3ZCJ A;  2XJ7 A;  5JQG E;  5AFM B;  3PUS A;  2CRB A;  1Z0P A;  3L3P A;  2CWY A;  4ZXL A;  4DMW A;  2BG9 B;  1LVK A;  4LF8 T;  1DU2 A;  4ZEY A;  4FI5 A;  5LGT B;  2LHN A;  5AQO B;  4BQT A;  4H9R C;  4K0U A;  2C0S A;  5DAB A;  5JRC B;  2WNJ A;  3KBU A;  1UV6 A;  4WV9 A;  3C64 A;  1S35 A;  3U78 A;  3NVO A;  5L2L A;  3N9L A;  1LKX A;  5ABG A;  3VKH A;  2CBI A;  4DO0 A;  1T98 A;  1BR1 A;  4A97 A;  5JDL A;  2IUB A;  2C9T A;  2ZLY A;  1M62 A;  3AE8 A;  2X9H A;  2LOS A;  4DR7 T;  4QX7 B;  4BAY B;  4ZK4 A;  2XNU A;  3ETV A;  2LSI A;  2WDV A;  4YJ3 E;  1QUU A;  2CLY C;  1HTJ F;  4ZJT A;  3TLU A;  3CIR A;  2XQ8 A;  3MJX A;  3AE7 A;  5TAO A;  5HXR A;  5LGU B;  5HWY A;  2XAQ B;  4H63 V;  1CUN A;  1HG5 A;  3QK6 A;  3OPC A;  3AEF A;  4JBW F;  2IHR 1;  2MYS A;  3UU8 A;  4TWH A;  3X1D A;  2BVL A;  2WY2 A;  4ILB A;  3Q5E A;  4HN9 A;  3UQ7 A;  1HG2 A;  4AKL A;  3V5S A;  5LGN B;  3BQL A;  3C50 A;  2W00 A;  4H9S E;  2Z6E A;  5J5H A;  4I50 E;  4QKN A;  2ZM8 A;  2LRL A;  2XM2 A;  1I94 T;  5FXZ A;  1UK5 A;  1EZ3 A;  4KMC A;  3P8C D;  2E9X A;  5J0Z A;  4JEH B;  4IIJ E;  2XQ7 A;  3AA1 B;  2EHO A;  4K0K T;  3N2G E;  3PEO A;  2L8K A;  4B3R T;  5AQG B;  2HH7 A;  4IST A;  3CQG B;  2KWI B;  4ZI2 C;  3U8L A;  4JI5 T;  2BG9 E;  2XAH B;  2OLT A;  3AAI A;  4PFO A;  5M4Y A;  4P09 A;  5FXW A;  2NW9 A;  4AFT A;  2V7K A;  5CB4 E;  5AQH B;  4IL4 A;  2HHH T;  3GWH A;  4ILU A;  3NZQ A;  3U8N A;  5AQI B;  2WQY A;  4MBQ A;  5HXE A;  1CHU A;  2BYP A;  4AQF C;  3I0O A;  4U72 A;  5J1G A;  4CN1 A;  4LFB T;  1Y01 A;  2UUC T;  3J7Y q;  3ZST A;  3LK3 B;  3CML A;  2RP4 A;  5J5G A;  3KV9 A;  4HGA A;  1W9R A;  2Y6X A;  2IAK A;  2NTX A;  4QH1 A;  2XSA A;  3EAB A;  2M67 A;  2W63 A;  5CGM A;  1MIV A;  3FZK B;  3AEC A;  2XQY A;  3FZL B;  1YQ3 A;  4DV0 T;  4LFC T;  3RIU C;  3UUM A;  4ISS A;  3UU5 A;  4YT0 A;  4FJO A;  5CA1 E;  5IUX A;  3AEB A;  3ZYM A;  3P4W A;  2BKN A;  2NWB A;  2XZ6 A;  5FP3 A;  5HYA A;  2KSR A;  2BS3 A;  4KP3 C;  4B3S T;  4B3M T;  5AFM A;  3FZM B;  4O2A E;  3IBP A;  2QA7 A;  2CXF A;  1HX1 B;  1KFY A;  2V6Y B;  4P0A A;  3ABV A;  1U4Q A;  4DR4 T;  3NRY A;  3ONX A;  3DP7 A;  3PE0 A;  2Q9Q B;  5JDM A;  2LE8 A;  5FL1 A;  1B7T A;  2WZH A;  2ZJU A;  2AE9 A;  2UXN B;  2ZMA A;  4NXM T;  4EOZ B;  3MAC A;  1LVF A;  4L9I A;  5DQW A;  2DWG A;  4AXP A;  5JTG A;  3KDS E;  3M3Z B;  4DVD A;  1JNZ A;  3HKD E;  4LFA T;  1WYC A;  4WNK A;  5LHH B;  3SIO A;  3FXE B;  4YXD A;  4TZ4 C;  3ZC0 A;  4P1N A;  3B5M A;  1UGO A;  2QVA A;  1U5P A;  4CXX A;  1YXR A;  4XK9 A;  5FXX A;  3SQ6 A;  1OED B;  3UFE A;  5HEO A;  5SYO A;  4G2A A;  5IHY A;  1E1H B;  3WI3 A;  2E9X C;  3N9O A;  2WP9 A;  4MLK A;  4TN7 B;  4EYU A;  1MMN A;  3P50 A;  3UU4 A;  2NOX A;  4HTE A;  5JR9 A;  5AQF B;  3LSV A;  2X0Y A;  3Q2M A;  2QC1 B;  2G0U A;  5AQN B;  5CJ5 A;  2CEA A;  4IDZ A;  2XNT A;  2XQ6 A;  1KNR A;  4PJN A;  5ABH A;  2J1D G;  4X1I E;  4LF6 T;  4DID B;  5AFN A;  4IRE A;  2P9B A;  3FHN A;  2YME A;  3R6N A;  5FJV A;  4U7I A;  5LB7 B;  4EGW A;  4E7S A;  4TV9 E;  3N9N A;  2X0H A;  5JME A;  2JQK A;  4QWN B;  2A2F X;  5J5I A;  5LOV E;  5BR8 T;  3PUZ F;  4I4T E;  3K1S A;  3LJC A;  4TWD A;  4ZI3 C;  3K8P C;  4PJJ A;  2H3R A;  5KXJ A;  4ZOL E;  2W62 A;  5BRX A;  3MA9 A;  2IML A;  1BR2 A;  3AE1 A;  2KT9 A;  4IE4 A;  4GKJ T;  3GN5 A;  1T7S A;  2LKG A;  2FJD A;  3JAF A;  5L4H A;  1FIO A;  4DMV A;  1WR0 A;  1Y64 B;  5L4E A;  1YKE B;  2BYR A;  3AEE A;  2YDQ A;  2M6B A;  3T1H T;  5FL0 A;  4YSY A;  4AI6 A;  1W0A A;  1D0Y A;  2NW8 A;  4JI8 T;  3C79 A;  2VVS A;  4TV8 E;  1VCS A;  5CO5 A;  1H7C A;  4JUY A;  3SQ9 A;  2VVN A;  3PU8 A;  5DJQ C;  4UV9 B;  3AXJ B;  1LRZ A;  2ODV A;  2BKP A;  4X64 T;  2VB6 A;  4BFQ A;  2Y8D A;  2K24 A;  4KHP T;  3AE2 A;  1ZEE A;  4IDQ A;  4X66 T;  4C90 A;  5AQJ B;  2D0T A;  5FMN A;  3RKG A;  5L3G B;  3QOF A;  3FBZ A;  4UM3 S;  5HXS A;  3ZSS A;  4IDN A;  3R84 B;  4BJM A;  4HQP A;  2OV9 A;  2ES0 A;  4IE7 A;  4WW0 A;  3SWH A;  1KEY A;  3ZMS B;  4H9P C;  4JI4 T;  4QHO A;  5KE4 A;  1MIY A;  2VAS A; 
#chains in the Genus database with same CATH homology
 5HEJ A;  4TWD A;  4ZJS A;  3WTI A;  5AFL A;  4UY2 A;  4ZZB A;  3U8N A;  2WNL A;  1I9B A;  2LKH A;  2VL0 A;  3JAD A;  3U8J A;  3GUA A;  4ILB A;  2UZ6 A;  3ZKR A;  5CFB A;  3C84 A;  5TVC A;  5BW2 A;  3TLS A;  3WIP A;  4HFC A;  4UM3 P;  4NPP A;  4AFH A;  5BRX A;  2BYP A;  2LM2 A;  4ILA A;  3UQ7 A;  4ILC A;  4HFE A;  2XZ5 A;  2Y54 A;  3SIO A;  4PIR A;  3WTK A;  3U8M A;  5AFM B;  1OED A;  4FRR A;  5AIN A;  2PGZ A;  3WTM A;  2BYQ A;  2YOE A;  4Z91 A;  2LKG A;  5J5H A;  3RQU A;  5J5G A;  3ZDH A;  3JAF A;  2WNC A;  5L4H A;  2X00 A;  4XK9 A;  4AFG A;  5L4E A;  3WTL A;  3EHZ A;  2BYR A;  1OED B;  4QH1 A;  3EI0 A;  5HEO A;  3SQ6 A;  2XYS A;  2Y7Y A;  5J5F A;  2YN6 A;  4B5D A;  2M6B A;  2LLY A;  2BG9 B;  5SYO A;  5AFJ A;  5KZU A;  5HEU A;  4ZK1 A;  2WZY A;  2BR8 A;  3C79 A;  2XNV A;  5HEG A;  4DBM A;  4ZRU A;  3RHW A;  4BQT A;  5CO5 A;  3WTN A;  4XHE A;  3UU5 A;  5J0Z A;  2WNJ A;  3IGQ A;  1UV6 A;  2YKS A;  2WN9 A;  4QAA A;  4WV9 A;  3SQ9 A;  1OED C;  2XQ5 A;  5IUX A;  4HFB A;  4X5T A;  3TLV A;  3P50 A;  3UU4 A;  2XQA A;  5HEH A;  3ZDG A;  4QH5 A;  2PH9 A;  2XQ7 A;  2W8F A;  3SH1 A;  4ZZC A;  4EZ1 A;  4LMJ A;  3PMZ A;  4ZR6 A;  3P4W A;  3WTO A;  3LSV A;  5BP0 A;  3RIF A;  3WTH A;  4ALX A;  2XZ6 A;  2QC1 B;  3WTJ A;  3TLT A;  5LG3 A;  5HCM A;  4A97 A;  4BFQ A;  2XQ9 A;  4LML A;  2W8G A;  2BG9 C;  3UQ4 A;  3RI5 A;  4COF A;  3PEO A;  2KSR A;  2C9T A;  2YMD A;  1UW6 A;  4TNV A;  2BR7 A;  4D01 A;  4F8H A;  2XQ3 A;  2XQ6 A;  2XNT A;  5AFM A;  3U8L A;  5L47 A;  2BYN A;  2Y58 A;  4HFI A;  4UXU A;  3UU3 A;  4ZK4 A;  2XNU A;  2XQ4 A;  5AFN A;  5LXB A;  4IRE A;  4UM3 A;  2BG9 E;  4QH4 A;  2ZJV A;  4UM1 A;  3RQW A;  4HFD A;  4LMK A;  4ZJT A;  3RIA A;  3TLU A;  2YME A;  1OED E;  3EAM A;  3T4M A;  5FJV A;  4UM3 S;  5HCJ A;  4Z90 A;  4NZB A;  4TWF A;  4A98 A;  2XYT A;  5AFH A;  2XQ8 A;  2Y56 A;  4QAC A;  2MAW A;  4HQP A;  3U8K A;  3JAE A;  4AFT A;  1UX2 A;  2BG9 A;  3TLW A;  3UU6 A;  5JME A;  5J5I A;  3UUB A;  4IL4 A;  2ZJU A;  2BJ0 A;  2Y57 A;  4QAB A;  5KE4 A;  3UU8 A;  4IL9 A;  4TWH A;  4HFH A;  2M6I A;  5AFK A;  4TNW A;  2BYS A;  2X00 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...