4HFKB

Crystal structure of the type vi effector-immunity complex tae4-tai4 from enterobacter cloacae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
98
structure length
98
Chain Sequence
b'QTLPDISTFSQQQIFENWVQNRCIGKIADSKSLKEDADASAAAWLEASNLPAENFEKADEVIVSLLKQKVGGTEPGHYQILKCTLIANSDAIRPLKSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structure of the type VI effector-immunity complex (Tae4-Tai4) provides novel insights into the inhibition mechanism of the effector by its immunity protein.
pubmed doi rcsb
source organism Enterobacter cloacae
molecule tags Hydrolase
total genus 36
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4hfkB00
4AX2A 4B6IA 4HFKB 4J32B 4HFFB 4J30B 4JURI 3ZIBA
chains in the Genus database with same CATH superfamily
2A0UA 3VF0A 4JEAA 4N6HA 1YZCA 1ZW2A 2O9XA 2RSEB 2NSFA 3ABMC 2A1DD 2NUPA 2J9VA 3RQFA 3FOOA 2MYSA 2HS5A 1MMNA 3GEEA 3U9JA 1MMAA 1PD1A 2LD6A 2QLAA 2KSFA 1OCRC 5JS5A 3KPHA 1M6TA 2XS8A 4JEBA 3NMKA 1NU9C 3L8JA 2R03A 1WASA 3S9OA 3C8ZA 1PD0A 3E9VA 4MVMA 1OCCC 3U2LA 3DD7A 4MTGA 4OINF 1BZ4A 4O6YA 3JT1A 3S90A 1PV3A 1WWPA 5BUOA 1SYQA 3QVZA 1Q0FA 4RDAA 1M2VB 4HE8D 2XM0A 2Q7RA 2CNWA 3RYLA 3DMDA 5CIVA 1HE1A 5CI8A 4P6IC 5L3QA 1QKRA 3NYMA 2LQGA 2GAQA 1YVIA 4C3DA 3C62A 3K6BA 2YZSA 4BJTA 4MVQA 1OW7A 3OA1A 1A7DA 1M56C 3A11A 2LFDA 2YQYA 3EFOA 3SP1A 4G7ZF 1AVOB 1ST6A 4JC7A 2L9JA 3V7OA 3UMIA 4KBLA 1QLEC 2G3VA 1MNDA 1SZIA 4O6MA 2ZXOA 3CEXA 1OQCA 2F22A 3DM5A 4JIOA 3EGXB 3NYLA 3UMHA 2R05A 4CS9C 2Y3BA 4OIPF 1DOVA 3DM9B 1JPJA 2QNLA 1OCOC 5E3CA 4B6IA 1T5OA 1ZU5A 4O7GA 3EJNA 2J45A 4YJWA 2LP4A 5COMA 4CS8A 2WVOA 4ANJA 4D4XA 1NBBA 2P61A 3Q7LA 1HW2A 1FFHA 2P7VA 1OW8A 1V54C 2QUPA 2YEVA 3T6GB 3T9OA 1NFNA 4J30B 2VCAA 1FAPB 1UFBA 3ECSA 1LKXA 2W4MA 3H2UA 4IRUA 3LAYA 3AGTA 4XPXA 4XPWA 1MQVA 4CX9A 3L1MA 2D4UA 1E85A 4ULVA 1KTMA 2ZPAA 2HV6A 2W4BA 4MW3A 2YL3A 3SEOA 1H6GA 1T01A 5T3WA 1JR8A 2DYSC 2MHRA 4X0RA 4CSAC 1BR2A 4A2NB 1A0BA 1GGQA 4PK4A 1D0ZA 1OKKA 2FGYA 2WL8A 3HTKC 4WJ0A 1LS1A 2Y69C 4QI2A 2Q3TA 4YL1A 4P9FA 3W8HA 2G3KA 3SXYA 1S7ZA 2RD9A 3UNGC 1FTSA 1YYJA 2R7UA 2R25A 3O55A 1RJ9A 5JP7A 4XQ1A 1LE2A 3UGOA 1O5HA 1VOMA 2EPOA 1ZVZA 2EILC 4O79A 3AJMA 2HMZA 4RBNA 3DWWA 2HJ3A 2KNHA 2CYDA 4IAOA 2JD3A 4DOZA 3K66A 4MVRA 2J0XA 4Z9IA 2V3CC 1NSGB 4IB4A 4YWQA 5EGYA 1SMYF 1VTMP 1LPEA 4XEFA 4BJ1A 3MFNA 3S28A 1G4US 3ZC4A 1EKYA 1LVKA 1BR1A 2A6HF 5HV9A 3NMJA 2D5RB 3GEHA 3HKKA 4FX5A 256BA 2OU6A 2YL1A 4AK9A 2XXAB 5JVEA 2G62A 1ORSC 4ZLDA 5EHHA 1ZHWA 2I15A 1R4TA 2XS1A 2H8AA 4FWVA 4ULWA 3SXMA 3DE9A 3LJBA 5A6AA 2YRFA 4PJJA 2XLWA 3U2MA 4JW1A 3CZ6A 3TJ5A 3DXJF 4QI0A 4BJ6A 3DE8A 4YT8A 4EIYA 3G50A 5F28E 1IZMA 3RVZA 2DI3A 1CGOA 1EA8A 3KYIA 4G78A 5GPGB 1LE4A 1IW7F 5KYUA 1LM3B 1L7CA 1ZHZA 3TOMA 2HSQA 2IXOA 1G8XA 3EPVA 4J7TA 4DRIB 5KYWA 2IXNA 2P6VA 5A6JA 4MVSA 3ABKC 3HNJA 5JLIA 1W2WA 1DOWA 4XPYA 1ZU4A 1LI7A 2J7PD 1EI7A 2W9YA 1NZEA 3R7CA 5A6BD 1ZHXA 2R7XA 1APCA 2LSEA 1FMWA 4OIRF 5FCLA 1VK5A 3JRTA 4JJGA 3CAXA 4IWBA 3LEVA 2QTVA 4DXWA 4XLPF 2HKVA 5F5FA 5E2QA 3GM2A 2CCYA 3PCVA 3RIPA 3U9MA 2PP4A 2YL7A 2XLHA 1JPNA 3X2QC 4CDAA 3LLKA 2Q00A 5BQIA 1U0BB 3RKOF 3JYHA 1T6IA 1Z7Qc 4LDKA 1E86A 1HMDA 1QPUA 4H4KC 5BQGA 5KYYA 3DZAA 4I3MA 2NUPB 1F1MA 1OXKA 3AQCA 3L34A 4IJJA 4DRHB 4EKWA 1Q0GA 4YL0A 5A6KA 4PJNA 3ZSUA 3J06A 3KH2A 1K05A 3O10A 3SXKA 3DJUB 1Z6AA 4YT5A 3U8PA 2XLOA 1TWGA 3LESA 4D4NA 4IARA 2R7TA 4C3BA 2R7SA 2OCCC 3RVYA 5L0IA 1HMOA 2YL0A 3MYIA 1OR2A 2IXMA 1E2XA 1GS9A 2BE5F 2KW3C 2MWQA 4JTDB 1HE9A 3UGPA 3EHMA 5TJ5E 5DQTA 4CIHA 2UUIA 2I8BA 3GANA 4MNDA 3TOLA 4ZLCA 3FAPB 4XLNF 1Y4CA 1BBHA 3GM3A 3SZRA 1J8YF 3O39A 1FMVA 3K1IC 3M4BA 5CI9A 4YK5A 5KYNA 1RCPA 3EZHA 2GA0A 4CSAA 2JPUA 1YAUO 1TWAA 2FAPB 5HSWA 2WZLA 1FFTC 3IHUA 4LDRA 3RF3A 3EG9B 4K1OA 4Z9HA 1WOLA 4N06A 4BJ5A 1Z23A 2NUTA 3E70C 1CPQA 3EFOB 2EPLX 5L3VA 1QZXA 3HLZA 1Q0MA 2AU5A 2ZXPA 3SXZA 3NRHA 3LNMB 1PCXA 3N0TA 3JSEO 1Z63A 3VM6A 5L0DA 2XLDA 2W45A 1D1BA 2Y3DA 3KMIA 1MNEA 2L6GA 3DAGA 3GM1A 3QMKA 5AC5A 5L0GA 4NCQA 1K40A 1I5NA 3ZDLA 4BPMA 4GQHA 5L0JA 4JE9A 5L0HA 3C63A 5T3TA 3OWTA 4JRZA 2E87A 2A6EF 3AGUA 4MTOA 2XLEA 2CNWD 2AWYA 2CGEA 1M57C 2VCBA 2HMQA 2FFHA 2J9WA 2UUHA 3IQTA 5B1AC 4EWCA 4UDVA 3C8GA 4DVYP 4O6NA 4I1OB 2EIKC 3DI5A 1VYKA 4JCZA 2KJGA 3AG2C 3GEIA 2XLVA 4JZAA 3RFYA 1B68A 3IEEA 2EINC 1OR3A 2DYRC 2ICWG 4P9TA 1A41A 1YDIA 3Q7GA 4DBQA 4PFPA 1V55C 5E33A 4I1MA 4U5FE 3I5PA 2OQMA 5JT4A 2BC5A 1V74B 2P0NA 2PX0A 5AGFA 5L0CA 4Q4ZF 1Z3IX 2NG1A 3ATPA 2ETSA 4ONSA 4XEKA 1HY5A 2AVKA 1QQ3A 4E0HA 4JTAB 4PFOA 3WHNA 4NTFA 2J8WA 3HNLA 1NFOA 1T6QA 1RJ9B 3DAFA 3MLGA 5T1DB 3T6BA 1V4AA 2EIJC 4XEVA 3OEOA 3CQZA 3ABLC 4MS2A 4NY3A 1JAFA 1XZQA 1C03A 4G0HA 1K04A 5DS5A 2CW0F 2OKUA 2EPNA 2Q9AA 3LS1A 3UMKA 3WODF 1R5ID 2XRHA 2YVKA 2B0HA 2GFHA 3V5XA 3W8IA 3U8VA 3UR3C 2XLMA 1OW6A 3TK0A 3FOPA 4JTCB 2L6FA 1I4ZA 4EUKB 4C7OA 1T9KA 4CS8C 3NDBB 3MX3A 3C7JA 3C8GD 3PDMP 3K7DA 5JSLA 4DVZA 1WATA 2IBFA 2ZD9A 3M1CB 1JMWA 1OKKD 4BG0A 4G7HF 2LCHA 2WB7A 5AC4A 3T6JA 1QSPA 3M4CA 4LLCA 2Q4FA 4U5HA 1Q0DA 3POVA 3NG1A 2WZFA 4XWJA 2OOCA 4E7ZA 2XXAA 2YLDA 1XZPA 3EGDA 4IGGA 3WG7C 3A9CA 4OIQF 3TQOA 2OJED 1KU2A 2P1AA 4WGYA 3R2PA 3WAQA 4MVZA 3LEOA 2M64A 3CSKA 3F47A 4NTAA 4OD4A 2C04A 2H7VC 3B0VC 2YLIA 3ZTZA 4AE4B 2OEVA 2XL6A 2YLGA 5KYUB 1BR4A 3I4UA 3KKBA 3LS0A 1ZHYA 3AG1C 1AEPA 2HZ8A 3M15A 1H9TA 1RMVA 2M4EA 1ZYRF 5KYWB 3G4XA 4JJFA 1RKEB 1YYXA 4MVUA 2Y3GA 5KYXA 4KI2A 1N1CA 1D1CA 1GQAA 3DJNB 3RH3A 3EQLF 3GWNA 4MTFA 4CDYA 5D91A 3JCUQ 2A0BA 4YN0B 3AG3C 4AL1A 2KYHA 4N4WA 1NG1A 2GWWA 1TFKB 2WVQA 2VASA 4DRJB 4K0DA 5DS4A 3PHF2 3NYJA 4U9DA 3GWLA 2QY9A 4E17A 5DVWA 3HNIA 1ZW3A 3ASOC 1Z5ZA 2DGJA 2J9BA 4C3EA 2ZXRA 4EBJA 3QVYA 1G4WR 2HFIA 2YHSA 2J46A 1UG7A 3KYJA 5COGA 4CS9A 3ZG1A 4PACA 4PJMA 2YKZA 3U3FA 4DBRA 1YLMA 5KYYB 2J9UA 4FESA 3HJCA 3TJ6A 1ORYA 2XM4A 1JRAA 1H9GA 2Y3HA 3JSZA 4AL0A 3ZQVA 4YT2A 3T4RA 1MMDA 4R32A 5K0IA 3H65A 2KK1A 2LIGA 4CDVA 4CS7A 4LACB 1VB5A 5COFA 1E83A 4U5BE 4LLEA 2XSEA 4CJGA 3RW0A 3FHDA 1D1AA 2OEXA 2V26A 3MYFA 3QZCA 4H54A 3LNRA 3S0XA 2C03A 4W8PA 2AWCA 3ZVRA 1Y6DA 3FXHA 2Z15A 2L7AA 4RD9A 4MVOA 1CPRA 3VYWA 1M2VA 3IQ5A 3EHNA 3PMRA 3SYNA 4XTKA 2IXPA 2WZGA 3ZTMA 3N2ZB 2L6HA 3H2VA 4LDQA 1TKNA 2A68F 1ZZPA 1VLSA 3FVYA 4BEMJ 2R7RA 5FZTA 2R02A 3AQBA 2PF4E 4YT4A 2HSBA 3U0CA 3MBGA 5JUAA 4MQ9F 1M2OA 1NU7D 3B29A 4NTBA 3B0PA 4JVSA 1MMGA 3U3BA 1RXQA 3IPMO 5L0FA 2NUTB 4G7OF 2KGOA 3RQEA 1YA9A 1VYIA 4JURI 1A7VA 1J8MF 2WVNA 4EHPA 3EG9A 1CGME 2DB4A 4LERA 2IOQA 4Z9JA 3EGXA 4J7YA 2ASRA 4BEJA 5BQHA 5DS6A 1KNYA 5DLJA 3EZIA 1JOGA 3W2VA 4U5DE 3S29A 3I5QA 4AX2A 2NSGA 1C17M 4NC3A 3QTHA 3ZQYA 3ZIBA 4PJLA 1TR2A 1CGNA 4MW8A 1E84A 1GM5A 2A69F 2PNOA 2CDQA 1D0YA 4J32B 3V5ZA 2GDCA 3C8GB 3GORA 3VAYA 1T6UA 1G5ZA 3NKDA 3EH1A 3EH2A 5IY5C 1RKCA 2IYLD 2R7QA 1VLTA 2EPMX 3K1HA 3FAJA 1I4YA 3K33A 2YWAA 3JYYA 3C18A 3N24A 1O87A 1U89A 2VCCA 3KL4A 4FAPB 1A7EA 4HFKB 2OG2A 5A69A 4OIOF 5B3IA 3Q6NA 3DKAA 3JRMO 4PR9A 3SNHA 2H7OA 1SF8A 2Q9CA 2Q9BA 3BEHA 2VH3A 1YA7O 1TWHA 3Q6MA 3NMIA 4JKVA 4BJ5C 1D0XA 3TULA 4HEAJ 4E18A 4U5CE 1XWJA 3BRJA 1WTYA 1YARO 1U6HA 1YZAA 4K7BA 2EPKX 4GEHA 1LIHA 4NQFA 2ZXWC 2LK4A 3B9QA 2TMVP 3U5SA 3X1OA 2XL8A 4E7SA 2EIMC 2X51A 3LLIA 3S27A 4EBBA 3ZWIA 4CBEA 2HUJA 4WGZA 3B71A 3AG4C 1YJGA 2BL2A 5E3AA 2LFFA 5EK0A 2L81A 2NPUA 5D92A 2X0CA 4DJ9A 4Q5SF 2B0JA 4C7OB 3IQ6A 1TWCA 1C02A 1QVXA 2J7PA 4N6CA 4Q7CA 4YL3A 4QDLA 1ORJA 2KQ9A 4HFFB 4OD5A 3HNKA 3QW0A 4ER9A 5A6BA 3FDQA 4CIPA 2H7BA 1FR0A 3FMSA 2JX0A 2R7VA 5B3SC 3S84A 1EQ1A 3B0UX 4WABA 3ASNC 2PBEA 3EGDB 4L6RA 4KNVA 4W8KA 2VC9A 2KC3A 2R9RB 4U5EE 5B1BC 2R7OA 4JCHA 3US6A 1TFOB 3W2WA 3QW1A 2HV7A 1VMAA 3NKEA 2VB6A 1WN0A 4IAQA 4A4AA 2IM8A 1LS4A 2QE9A 1S05A 4CJOA 4AE4A 4U9EA 1SR2A 3W4YA 1FNTc 3JZ0A 3LUTB 5KYXB 2Y39A 1BDJB 3JTLO 1H7IA 1L3PA 2HJMA 1HW1A 3ITFA 2AP3A 2PFDA 1OXBA 1TQGA 4EBKA 2R7WA 1ZHTA 3RQGA 1RKEA 3K1IA 1OCZC 1LI5A 5DQZA 4F4BA 2OJQA 3O6XA 4KNWA 1NLXA 4I44A 3G4ZA 3AOUA 3GODA 3L0IA 2J0WA 5F5HA 3F46A 3VRCA 5JRAA 3L8IA 4M63A 2PX3A 3M79A 4GYTA 2XL4A 4U5GA 1Q0KA 1WGWA 1O3UA 3IQCA 4KC9A 1AUEA 3TD7A 3V5YA 4BJ6C 4E0IA
chains in the Genus database with same CATH topology
2O9XA 3ABMC 2A1DD 2NUPA 2J9VA 2MYSA 1MMNA 1MMAA 1PD1A 1OCRC 1NU9C 1PD0A 3E9VA 1OCCC 3DD7A 4OINF 4O6YA 3JT1A 5BUOA 4RDAA 1M2VB 4HE8D 2CNWA 3RYLA 3DMDA 5CI8A 4P6IC 5L3QA 3NYMA 4C3DA 3K6BA 2YZSA 4BJTA 3OA1A 1M56C 3EFOA 3SP1A 4G7ZF 1ST6A 2L9JA 3V7OA 3UMIA 4KBLA 1QLEC 2G3VA 1MNDA 1SZIA 4O6MA 2ZXOA 3UMHA 3DM5A 4OIPF 3EGXB 3NYLA 4CS9C 2Y3BA 3DM9B 1JPJA 1OCOC 5E3CA 4B6IA 1ZU5A 4O7GA 3EJNA 2J45A 4YJWA 4CS8A 2WVOA 4ANJA 3Q7LA 1FFHA 2P7VA 1V54C 2YEVA 4J30B 3ECSA 1LKXA 2W4MA 4IRUA 3LAYA 2ZPAA 2HV6A 2W4BA 3SEOA 5T3WA 2DYSC 4X0RA 4CSAC 1BR2A 4A2NB 4PK4A 1D0ZA 1OKKA 2FGYA 2WL8A 3HTKC 4WJ0A 1LS1A 2Y69C 4QI2A 2Q3TA 3W8HA 2G3KA 3UNGC 1S7ZA 2R7UA 1FTSA 1RJ9A 3UGOA 1O5HA 1VOMA 2EILC 4RBNA 4IAOA 2KNHA 2JD3A 4DOZA 3K66A 2J0XA 2V3CC 4YWQA 5EGYA 1SMYF 4BJ1A 3S28A 3ZC4A 1LVKA 1BR1A 2A6HF 2D5RB 4FX5A 4AK9A 2XXAB 2G62A 4ZLDA 5EHHA 1ZHWA 4FWVA 4ULWA 3LJBA 4PJJA 4BJ6A 4JW1A 3CZ6A 3DXJF 4QI0A 4YT8A 1IZMA 1IW7F 5KYUA 1ZHZA 2IXOA 1G8XA 3EPVA 5KYWA 2IXNA 2P6VA 3ABKC 1W2WA 1ZU4A 2J7PD 2W9YA 1NZEA 1ZHXA 2R7XA 2LSEA 1FMWA 4OIRF 5FCLA 1VK5A 3JRTA 4JJGA 4IWBA 3LEVA 2QTVA 4XLPF 5F5FA 5E2QA 3RIPA 2PP4A 3X2QC 1JPNA 3LLKA 3RKOF 3JYHA 4H4KC 5KYYA 3DZAA 4I3MA 2NUPB 4IJJA 3AQCA 3L34A 4PJNA 3ZSUA 3KH2A 3DJUB 1Z6AA 4YT5A 1TWGA 3LESA 2R7TA 4C3BA 2R7SA 2OCCC 2IXMA 2BE5F 2KW3C 2MWQA 3UGPA 3EHMA 5DQTA 4CIHA 3GANA 2I8BA 4MNDA 4ZLCA 4XLNF 3SZRA 1J8YF 3O39A 1FMVA 3K1IC 5CI9A 5KYNA 3EZHA 4CSAA 1TWAA 5HSWA 2WZLA 1FFTC 3EG9B 4BJ5A 4N06A 1Z23A 2NUTA 3E70C 3EFOB 5L3VA 1QZXA 3HLZA 2ZXPA 3NRHA 1PCXA 3N0TA 1Z63A 2W45A 1D1BA 2Y3DA 3KMIA 1MNEA 3DAGA 3QMKA 5T3TA 3OWTA 2E87A 2A6EF 2CNWD 2CGEA 1M57C 2FFHA 2J9WA 5B1AC 4EWCA 4DVYP 4O6NA 4I1OB 2EIKC 1VYKA 3RFYA 2KJGA 3AG2C 4JZAA 3IEEA 2EINC 2DYRC 3Q7GA 4DBQA 4PFPA 1V55C 5E33A 4I1MA 4U5FE 3I5PA 2PX0A 4Q4ZF 1Z3IX 2NG1A 4PFOA 5T1DB 1RJ9B 3DAFA 3MLGA 3T6BA 2EIJC 3OEOA 3CQZA 3ABLC 4NY3A 4G0HA 5DS5A 2CW0F 2Q9AA 3LS1A 3UMKA 3WODF 2XRHA 2GFHA 3W8IA 3UR3C 4C7OA 4CS8C 3NDBB 3MX3A 3K7DA 4DVZA 3M1CB 1OKKD 4BG0A 4G7HF 2WB7A 3T6JA 4LLCA 4U5HA 3POVA 3NG1A 2WZFA 4XWJA 4E7ZA 2XXAA 3EGDA 3WG7C 4OIQF 1KU2A 3CSKA 3F47A 3B0VC 4OD4A 2C04A 2H7VC 4AE4B 5KYUB 1BR4A 3I4UA 3KKBA 3LS0A 1ZHYA 3AG1C 2M4EA 1ZYRF 5KYWB 4JJFA 5KYXA 2Y3GA 4KI2A 1N1CA 1D1CA 3DJNB 3RH3A 3EQLF 5D91A 3JCUQ 4YN0B 3AG3C 1NG1A 2WVQA 5DS4A 2VASA 3PHF2 4K0DA 3NYJA 2QY9A 5DVWA 3ASOC 1Z5ZA 2DGJA 4C3EA 2ZXRA 2YHSA 2J46A 4CS9A 3ZG1A 4PJMA 4DBRA 5KYYB 2J9UA 4FESA 3HJCA 2Y3HA 3JSZA 4YT2A 3T4RA 1MMDA 3H65A 4CS7A 4LACB 4U5BE 4LLEA 2XSEA 3FHDA 1D1AA 2V26A 3QZCA 3LNRA 3S0XA 2C03A 3ZVRA 2Z15A 4RD9A 3VYWA 1M2VA 3EHNA 3PMRA 3SYNA 4XTKA 2IXPA 2WZGA 3N2ZB 1TKNA 2A68F 3FVYA 2R7RA 3AQBA 4YT4A 2PF4E 4MQ9F 1M2OA 1NU7D 3B0PA 4JVSA 1MMGA 2NUTB 4G7OF 2KGOA 1VYIA 4JURI 1J8MF 2WVNA 3EG9A 4LERA 4BEJA 2IOQA 3EGXA 5DS6A 5DLJA 3EZIA 3W2VA 4U5DE 3S29A 3I5QA 4AX2A 3ZIBA 4PJLA 1TR2A 2A69F 2CDQA 1D0YA 4J32B 3VAYA 3NKDA 3EH1A 3EH2A 5IY5C 2IYLD 2R7QA 3K1HA 3FAJA 3K33A 3N24A 1O87A 3KL4A 4HFKB 2OG2A 4OIOF 3Q6NA 3SNHA 2H7OA 1SF8A 2Q9CA 2Q9BA 2VH3A 1TWHA 3Q6MA 4BJ5C 1D0XA 4HEAJ 4U5CE 4K7BA 4O79A 4GEHA 2ZXWC 3B9QA 3X1OA 4E7SA 2EIMC 2X51A 3LLIA 3S27A 4EBBA 4CBEA 3AG4C 4Q5SF 5E3AA 2L81A 5D92A 2B0JA 4C7OB 1TWCA 2J7PA 4Q7CA 4QDLA 2KQ9A 4HFFB 4OD5A 3FDQA 2H7BA 2R7VA 5B3SC 3B0UX 3ASNC 3EGDB 4KNVA 4W8KA 4U5EE 5B1BC 2R7OA 4JCHA 3W2WA 2HV7A 1VMAA 3NKEA 2VB6A 4AE4A 5KYXB 2Y39A 3ITFA 2PFDA 2R7WA 1ZHTA 1OCZC 5DQZA 4F4BA 3O6XA 4KNWA 4I44A 3GODA 3L0IA 2J0WA 5F5HA 3F46A 4M63A 2PX3A 4GYTA 2XL4A 4U5GA 1WGWA 4KC9A 3TD7A 4BJ6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AX2 A;  4B6I A;  4HFK B;  4J32 B;  4HFF B;  4J30 B;  4JUR I;  3ZIB A; 
#chains in the Genus database with same CATH topology
 2A0U A;  3VF0 A;  4JEA A;  4N6H A;  1YZC A;  1ZW2 A;  2O9X A;  2RSE B;  2NSF A;  3ABM C;  2A1D D;  2NUP A;  2J9V A;  3RQF A;  3FOO A;  2MYS A;  2HS5 A;  1MMN A;  3GEE A;  3U9J A;  1MMA A;  1PD1 A;  2LD6 A;  2QLA A;  2KSF A;  1OCR C;  5JS5 A;  3KPH A;  1M6T A;  2XS8 A;  4JEB A;  3NMK A;  1NU9 C;  3L8J A;  2R03 A;  1WAS A;  3S9O A;  3C8Z A;  1PD0 A;  3E9V A;  4MVM A;  1OCC C;  3U2L A;  3DD7 A;  4MTG A;  4OIN F;  1BZ4 A;  4O6Y A;  3JT1 A;  3S90 A;  1PV3 A;  1WWP A;  5BUO A;  1SYQ A;  3QVZ A;  1Q0F A;  4RDA A;  1M2V B;  4HE8 D;  2XM0 A;  2Q7R A;  2CNW A;  3RYL A;  3DMD A;  5CIV A;  1HE1 A;  5CI8 A;  4P6I C;  5L3Q A;  1QKR A;  3NYM A;  2LQG A;  2GAQ A;  1YVI A;  4C3D A;  3C62 A;  3K6B A;  2YZS A;  4BJT A;  4MVQ A;  1OW7 A;  3OA1 A;  1A7D A;  1M56 C;  3A11 A;  2LFD A;  2YQY A;  3EFO A;  3SP1 A;  4G7Z F;  1AVO B;  1ST6 A;  4JC7 A;  2L9J A;  3V7O A;  3UMI A;  4KBL A;  1QLE C;  2G3V A;  1MND A;  1SZI A;  4O6M A;  2ZXO A;  3CEX A;  1OQC A;  2F22 A;  3DM5 A;  4JIO A;  3EGX B;  3NYL A;  3UMH A;  2R05 A;  4CS9 C;  2Y3B A;  4OIP F;  1DOV A;  3DM9 B;  1JPJ A;  2QNL A;  1OCO C;  5E3C A;  4B6I A;  1T5O A;  1ZU5 A;  4O7G A;  3EJN A;  2J45 A;  4YJW A;  2LP4 A;  5COM A;  4CS8 A;  2WVO A;  4ANJ A;  4D4X A;  1NBB A;  2P61 A;  3Q7L A;  1HW2 A;  1FFH A;  2P7V A;  1OW8 A;  1V54 C;  2QUP A;  2YEV A;  3T6G B;  3T9O A;  1NFN A;  4J30 B;  2VCA A;  1FAP B;  1UFB A;  3ECS A;  1LKX A;  2W4M A;  3H2U A;  4IRU A;  3LAY A;  3AGT A;  4XPX A;  4XPW A;  1MQV A;  4CX9 A;  3L1M A;  2D4U A;  1E85 A;  4ULV A;  1KTM A;  2ZPA A;  2HV6 A;  2W4B A;  4MW3 A;  2YL3 A;  3SEO A;  1H6G A;  1T01 A;  5T3W A;  1JR8 A;  2DYS C;  2MHR A;  4X0R A;  4CSA C;  1BR2 A;  4A2N B;  1A0B A;  1GGQ A;  4PK4 A;  1D0Z A;  1OKK A;  2FGY A;  2WL8 A;  3HTK C;  4WJ0 A;  1LS1 A;  2Y69 C;  4QI2 A;  2Q3T A;  4YL1 A;  4P9F A;  3W8H A;  2G3K A;  3SXY A;  1S7Z A;  2RD9 A;  3UNG C;  1FTS A;  1YYJ A;  2R7U A;  2R25 A;  3O55 A;  1RJ9 A;  5JP7 A;  4XQ1 A;  1LE2 A;  3UGO A;  1O5H A;  1VOM A;  2EPO A;  1ZVZ A;  2EIL C;  4O79 A;  3AJM A;  2HMZ A;  4RBN A;  3DWW A;  2HJ3 A;  2KNH A;  2CYD A;  4IAO A;  2JD3 A;  4DOZ A;  3K66 A;  4MVR A;  2J0X A;  4Z9I A;  2V3C C;  1NSG B;  4IB4 A;  4YWQ A;  5EGY A;  1SMY F;  1VTM P;  1LPE A;  4XEF A;  4BJ1 A;  3MFN A;  3S28 A;  1G4U S;  3ZC4 A;  1EKY A;  1LVK A;  1BR1 A;  2A6H F;  5HV9 A;  3NMJ A;  2D5R B;  3GEH A;  3HKK A;  4FX5 A;  256B A;  2OU6 A;  2YL1 A;  4AK9 A;  2XXA B;  5JVE A;  2G62 A;  1ORS C;  4ZLD A;  5EHH A;  1ZHW A;  2I15 A;  1R4T A;  2XS1 A;  2H8A A;  4FWV A;  4ULW A;  3SXM A;  3DE9 A;  3LJB A;  5A6A A;  2YRF A;  4PJJ A;  2XLW A;  3U2M A;  4JW1 A;  3CZ6 A;  3TJ5 A;  3DXJ F;  4QI0 A;  4BJ6 A;  3DE8 A;  4YT8 A;  4EIY A;  3G50 A;  5F28 E;  1IZM A;  3RVZ A;  2DI3 A;  1CGO A;  1EA8 A;  3KYI A;  4G78 A;  5GPG B;  1LE4 A;  1IW7 F;  5KYU A;  1LM3 B;  1L7C A;  1ZHZ A;  3TOM A;  2HSQ A;  2IXO A;  1G8X A;  3EPV A;  4J7T A;  4DRI B;  5KYW A;  2IXN A;  2P6V A;  5A6J A;  4MVS A;  3ABK C;  3HNJ A;  5JLI A;  1W2W A;  1DOW A;  4XPY A;  1ZU4 A;  1LI7 A;  2J7P D;  1EI7 A;  2W9Y A;  1NZE A;  3R7C A;  5A6B D;  1ZHX A;  2R7X A;  1APC A;  2LSE A;  1FMW A;  4OIR F;  5FCL A;  1VK5 A;  3JRT A;  4JJG A;  3CAX A;  4IWB A;  3LEV A;  2QTV A;  4DXW A;  4XLP F;  2HKV A;  5F5F A;  5E2Q A;  3GM2 A;  2CCY A;  3PCV A;  3RIP A;  3U9M A;  2PP4 A;  2YL7 A;  2XLH A;  1JPN A;  3X2Q C;  4CDA A;  3LLK A;  2Q00 A;  5BQI A;  1U0B B;  3RKO F;  3JYH A;  1T6I A;  1Z7Q c;  4LDK A;  1E86 A;  1HMD A;  1QPU A;  4H4K C;  5BQG A;  5KYY A;  3DZA A;  4I3M A;  2NUP B;  1F1M A;  1OXK A;  3AQC A;  3L34 A;  4IJJ A;  4DRH B;  4EKW A;  1Q0G A;  4YL0 A;  5A6K A;  4PJN A;  3ZSU A;  3J06 A;  3KH2 A;  1K05 A;  3O10 A;  3SXK A;  3DJU B;  1Z6A A;  4YT5 A;  3U8P A;  2XLO A;  1TWG A;  3LES A;  4D4N A;  4IAR A;  2R7T A;  4C3B A;  2R7S A;  2OCC C;  3RVY A;  5L0I A;  1HMO A;  2YL0 A;  3MYI A;  1OR2 A;  2IXM A;  1E2X A;  1GS9 A;  2BE5 F;  2KW3 C;  2MWQ A;  4JTD B;  1HE9 A;  3UGP A;  3EHM A;  5TJ5 E;  5DQT A;  4CIH A;  2UUI A;  2I8B A;  3GAN A;  4MND A;  3TOL A;  4ZLC A;  3FAP B;  4XLN F;  1Y4C A;  1BBH A;  3GM3 A;  3SZR A;  1J8Y F;  3O39 A;  1FMV A;  3K1I C;  3M4B A;  5CI9 A;  4YK5 A;  5KYN A;  1RCP A;  3EZH A;  2GA0 A;  4CSA A;  2JPU A;  1YAU O;  1TWA A;  2FAP B;  5HSW A;  2WZL A;  1FFT C;  3IHU A;  4LDR A;  3RF3 A;  3EG9 B;  4K1O A;  4Z9H A;  1WOL A;  4N06 A;  4BJ5 A;  1Z23 A;  2NUT A;  3E70 C;  1CPQ A;  3EFO B;  2EPL X;  5L3V A;  1QZX A;  3HLZ A;  1Q0M A;  2AU5 A;  2ZXP A;  3SXZ A;  3NRH A;  3LNM B;  1PCX A;  3N0T A;  3JSE O;  1Z63 A;  3VM6 A;  5L0D A;  2XLD A;  2W45 A;  1D1B A;  2Y3D A;  3KMI A;  1MNE A;  2L6G A;  3DAG A;  3GM1 A;  3QMK A;  5AC5 A;  5L0G A;  4NCQ A;  1K40 A;  1I5N A;  3ZDL A;  4BPM A;  4GQH A;  5L0J A;  4JE9 A;  5L0H A;  3C63 A;  5T3T A;  3OWT A;  4JRZ A;  2E87 A;  2A6E F;  3AGU A;  4MTO A;  2XLE A;  2CNW D;  2AWY A;  2CGE A;  1M57 C;  2VCB A;  2HMQ A;  2FFH A;  2J9W A;  2UUH A;  3IQT A;  5B1A C;  4EWC A;  4UDV A;  3C8G A;  4DVY P;  4O6N A;  4I1O B;  2EIK C;  3DI5 A;  1VYK A;  4JCZ A;  2KJG A;  3AG2 C;  3GEI A;  2XLV A;  4JZA A;  3RFY A;  1B68 A;  3IEE A;  2EIN C;  1OR3 A;  2DYR C;  2ICW G;  4P9T A;  1A41 A;  1YDI A;  3Q7G A;  4DBQ A;  4PFP A;  1V55 C;  5E33 A;  4I1M A;  4U5F E;  3I5P A;  2OQM A;  5JT4 A;  2BC5 A;  1V74 B;  2P0N A;  2PX0 A;  5AGF A;  5L0C A;  4Q4Z F;  1Z3I X;  2NG1 A;  3ATP A;  2ETS A;  4ONS A;  4XEK A;  1HY5 A;  2AVK A;  1QQ3 A;  4E0H A;  4JTA B;  4PFO A;  3WHN A;  4NTF A;  2J8W A;  3HNL A;  1NFO A;  1T6Q A;  1RJ9 B;  3DAF A;  3MLG A;  5T1D B;  3T6B A;  1V4A A;  2EIJ C;  4XEV A;  3OEO A;  3CQZ A;  3ABL C;  4MS2 A;  4NY3 A;  1JAF A;  1XZQ A;  1C03 A;  4G0H A;  1K04 A;  5DS5 A;  2CW0 F;  2OKU A;  2EPN A;  2Q9A A;  3LS1 A;  3UMK A;  3WOD F;  1R5I D;  2XRH A;  2YVK A;  2B0H A;  2GFH A;  3V5X A;  3W8I A;  3U8V A;  3UR3 C;  2XLM A;  1OW6 A;  3TK0 A;  3FOP A;  4JTC B;  2L6F A;  1I4Z A;  4EUK B;  4C7O A;  1T9K A;  4CS8 C;  3NDB B;  3MX3 A;  3C7J A;  3C8G D;  3PDM P;  3K7D A;  5JSL A;  4DVZ A;  1WAT A;  2IBF A;  2ZD9 A;  3M1C B;  1JMW A;  1OKK D;  4BG0 A;  4G7H F;  2LCH A;  2WB7 A;  5AC4 A;  3T6J A;  1QSP A;  3M4C A;  4LLC A;  2Q4F A;  4U5H A;  1Q0D A;  3POV A;  3NG1 A;  2WZF A;  4XWJ A;  2OOC A;  4E7Z A;  2XXA A;  2YLD A;  1XZP A;  3EGD A;  4IGG A;  3WG7 C;  3A9C A;  4OIQ F;  3TQO A;  2OJE D;  1KU2 A;  2P1A A;  4WGY A;  3R2P A;  3WAQ A;  4MVZ A;  3LEO A;  2M64 A;  3CSK A;  3F47 A;  4NTA A;  4OD4 A;  2C04 A;  2H7V C;  3B0V C;  2YLI A;  3ZTZ A;  4AE4 B;  2OEV A;  2XL6 A;  2YLG A;  5KYU B;  1BR4 A;  3I4U A;  3KKB A;  3LS0 A;  1ZHY A;  3AG1 C;  1AEP A;  2HZ8 A;  3M15 A;  1H9T A;  1RMV A;  2M4E A;  1ZYR F;  5KYW B;  3G4X A;  4JJF A;  1RKE B;  1YYX A;  4MVU A;  2Y3G A;  5KYX A;  4KI2 A;  1N1C A;  1D1C A;  1GQA A;  3DJN B;  3RH3 A;  3EQL F;  3GWN A;  4MTF A;  4CDY A;  5D91 A;  3JCU Q;  2A0B A;  4YN0 B;  3AG3 C;  4AL1 A;  2KYH A;  4N4W A;  1NG1 A;  2GWW A;  1TFK B;  2WVQ A;  2VAS A;  4DRJ B;  4K0D A;  5DS4 A;  3PHF 2;  3NYJ A;  4U9D A;  3GWL A;  2QY9 A;  4E17 A;  5DVW A;  3HNI A;  1ZW3 A;  3ASO C;  1Z5Z A;  2DGJ A;  2J9B A;  4C3E A;  2ZXR A;  4EBJ A;  3QVY A;  1G4W R;  2HFI A;  2YHS A;  2J46 A;  1UG7 A;  3KYJ A;  5COG A;  4CS9 A;  3ZG1 A;  4PAC A;  4PJM A;  2YKZ A;  3U3F A;  4DBR A;  1YLM A;  5KYY B;  2J9U A;  4FES A;  3HJC A;  3TJ6 A;  1ORY A;  2XM4 A;  1JRA A;  1H9G A;  2Y3H A;  3JSZ A;  4AL0 A;  3ZQV A;  4YT2 A;  3T4R A;  1MMD A;  4R32 A;  5K0I A;  3H65 A;  2KK1 A;  2LIG A;  4CDV A;  4CS7 A;  4LAC B;  1VB5 A;  5COF A;  1E83 A;  4U5B E;  4LLE A;  2XSE A;  4CJG A;  3RW0 A;  3FHD A;  1D1A A;  2OEX A;  2V26 A;  3MYF A;  3QZC A;  4H54 A;  3LNR A;  3S0X A;  2C03 A;  4W8P A;  2AWC A;  3ZVR A;  1Y6D A;  3FXH A;  2Z15 A;  2L7A A;  4RD9 A;  4MVO A;  1CPR A;  3VYW A;  1M2V A;  3IQ5 A;  3EHN A;  3PMR A;  3SYN A;  4XTK A;  2IXP A;  2WZG A;  3ZTM A;  3N2Z B;  2L6H A;  3H2V A;  4LDQ A;  1TKN A;  2A68 F;  1ZZP A;  1VLS A;  3FVY A;  4BEM J;  2R7R A;  5FZT A;  2R02 A;  3AQB A;  2PF4 E;  4YT4 A;  2HSB A;  3U0C A;  3MBG A;  5JUA A;  4MQ9 F;  1M2O A;  1NU7 D;  3B29 A;  4NTB A;  3B0P A;  4JVS A;  1MMG A;  3U3B A;  1RXQ A;  3IPM O;  5L0F A;  2NUT B;  4G7O F;  2KGO A;  3RQE A;  1YA9 A;  1VYI A;  4JUR I;  1A7V A;  1J8M F;  2WVN A;  4EHP A;  3EG9 A;  1CGM E;  2DB4 A;  4LER A;  2IOQ A;  4Z9J A;  3EGX A;  4J7Y A;  2ASR A;  4BEJ A;  5BQH A;  5DS6 A;  1KNY A;  5DLJ A;  3EZI A;  1JOG A;  3W2V A;  4U5D E;  3S29 A;  3I5Q A;  4AX2 A;  2NSG A;  1C17 M;  4NC3 A;  3QTH A;  3ZQY A;  3ZIB A;  4PJL A;  1TR2 A;  1CGN A;  4MW8 A;  1E84 A;  1GM5 A;  2A69 F;  2PNO A;  2CDQ A;  1D0Y A;  4J32 B;  3V5Z A;  2GDC A;  3C8G B;  3GOR A;  3VAY A;  1T6U A;  1G5Z A;  3NKD A;  3EH1 A;  3EH2 A;  5IY5 C;  1RKC A;  2IYL D;  2R7Q A;  1VLT A;  2EPM X;  3K1H A;  3FAJ A;  1I4Y A;  3K33 A;  2YWA A;  3JYY A;  3C18 A;  3N24 A;  1O87 A;  1U89 A;  2VCC A;  3KL4 A;  4FAP B;  1A7E A;  4HFK B;  2OG2 A;  5A69 A;  4OIO F;  5B3I A;  3Q6N A;  3DKA A;  3JRM O;  4PR9 A;  3SNH A;  2H7O A;  1SF8 A;  2Q9C A;  2Q9B A;  3BEH A;  2VH3 A;  1YA7 O;  1TWH A;  3Q6M A;  3NMI A;  4JKV A;  4BJ5 C;  1D0X A;  3TUL A;  4HEA J;  4E18 A;  4U5C E;  1XWJ A;  3BRJ A;  1WTY A;  1YAR O;  1U6H A;  1YZA A;  4K7B A;  2EPK X;  4GEH A;  1LIH A;  4NQF A;  2ZXW C;  2LK4 A;  3B9Q A;  2TMV P;  3U5S A;  3X1O A;  2XL8 A;  4E7S A;  2EIM C;  2X51 A;  3LLI A;  3S27 A;  4EBB A;  3ZWI A;  4CBE A;  2HUJ A;  4WGZ A;  3B71 A;  3AG4 C;  1YJG A;  2BL2 A;  5E3A A;  2LFF A;  5EK0 A;  2L81 A;  2NPU A;  5D92 A;  2X0C A;  4DJ9 A;  4Q5S F;  2B0J A;  4C7O B;  3IQ6 A;  1TWC A;  1C02 A;  1QVX A;  2J7P A;  4N6C A;  4Q7C A;  4YL3 A;  4QDL A;  1ORJ A;  2KQ9 A;  4HFF B;  4OD5 A;  3HNK A;  3QW0 A;  4ER9 A;  5A6B A;  3FDQ A;  4CIP A;  2H7B A;  1FR0 A;  3FMS A;  2JX0 A;  2R7V A;  5B3S C;  3S84 A;  1EQ1 A;  3B0U X;  4WAB A;  3ASN C;  2PBE A;  3EGD B;  4L6R A;  4KNV A;  4W8K A;  2VC9 A;  2KC3 A;  2R9R B;  4U5E E;  5B1B C;  2R7O A;  4JCH A;  3US6 A;  1TFO B;  3W2W A;  3QW1 A;  2HV7 A;  1VMA A;  3NKE A;  2VB6 A;  1WN0 A;  4IAQ A;  4A4A A;  2IM8 A;  1LS4 A;  2QE9 A;  1S05 A;  4CJO A;  4AE4 A;  4U9E A;  1SR2 A;  3W4Y A;  1FNT c;  3JZ0 A;  3LUT B;  5KYX B;  2Y39 A;  1BDJ B;  3JTL O;  1H7I A;  1L3P A;  2HJM A;  1HW1 A;  3ITF A;  2AP3 A;  2PFD A;  1OXB A;  1TQG A;  4EBK A;  2R7W A;  1ZHT A;  3RQG A;  1RKE A;  3K1I A;  1OCZ C;  1LI5 A;  5DQZ A;  4F4B A;  2OJQ A;  3O6X A;  4KNW A;  1NLX A;  4I44 A;  3G4Z A;  3AOU A;  3GOD A;  3L0I A;  2J0W A;  5F5H A;  3F46 A;  3VRC A;  5JRA A;  3L8I A;  4M63 A;  2PX3 A;  3M79 A;  4GYT A;  2XL4 A;  4U5G A;  1Q0K A;  1WGW A;  1O3U A;  3IQC A;  4KC9 A;  1AUE A;  3TD7 A;  3V5Y A;  4BJ6 C;  4E0I A; 
#chains in the Genus database with same CATH homology
 2O9X A;  3ABM C;  2A1D D;  2NUP A;  2J9V A;  2MYS A;  1MMN A;  1MMA A;  1PD1 A;  1OCR C;  1NU9 C;  1PD0 A;  3E9V A;  1OCC C;  3DD7 A;  4OIN F;  4O6Y A;  3JT1 A;  5BUO A;  4RDA A;  1M2V B;  4HE8 D;  2CNW A;  3RYL A;  3DMD A;  5CI8 A;  4P6I C;  5L3Q A;  3NYM A;  4C3D A;  3K6B A;  2YZS A;  4BJT A;  3OA1 A;  1M56 C;  3EFO A;  3SP1 A;  4G7Z F;  1ST6 A;  2L9J A;  3V7O A;  3UMI A;  4KBL A;  1QLE C;  2G3V A;  1MND A;  1SZI A;  4O6M A;  2ZXO A;  3UMH A;  3DM5 A;  4OIP F;  3EGX B;  3NYL A;  4CS9 C;  2Y3B A;  3DM9 B;  1JPJ A;  1OCO C;  5E3C A;  4B6I A;  1ZU5 A;  4O7G A;  3EJN A;  2J45 A;  4YJW A;  4CS8 A;  2WVO A;  4ANJ A;  3Q7L A;  1FFH A;  2P7V A;  1V54 C;  2YEV A;  4J30 B;  3ECS A;  1LKX A;  2W4M A;  4IRU A;  3LAY A;  2ZPA A;  2HV6 A;  2W4B A;  3SEO A;  5T3W A;  2DYS C;  4X0R A;  4CSA C;  1BR2 A;  4A2N B;  4PK4 A;  1D0Z A;  1OKK A;  2FGY A;  2WL8 A;  3HTK C;  4WJ0 A;  1LS1 A;  2Y69 C;  4QI2 A;  2Q3T A;  3W8H A;  2G3K A;  3UNG C;  1S7Z A;  2R7U A;  1FTS A;  1RJ9 A;  3UGO A;  1O5H A;  1VOM A;  2EIL C;  4RBN A;  4IAO A;  2KNH A;  2JD3 A;  4DOZ A;  3K66 A;  2J0X A;  2V3C C;  4YWQ A;  5EGY A;  1SMY F;  4BJ1 A;  3S28 A;  3ZC4 A;  1LVK A;  1BR1 A;  2A6H F;  2D5R B;  4FX5 A;  4AK9 A;  2XXA B;  2G62 A;  4ZLD A;  5EHH A;  1ZHW A;  4FWV A;  4ULW A;  3LJB A;  4PJJ A;  4BJ6 A;  4JW1 A;  3CZ6 A;  3DXJ F;  4QI0 A;  4YT8 A;  1IZM A;  1IW7 F;  5KYU A;  1ZHZ A;  2IXO A;  1G8X A;  3EPV A;  5KYW A;  2IXN A;  2P6V A;  3ABK C;  1W2W A;  1ZU4 A;  2J7P D;  2W9Y A;  1NZE A;  1ZHX A;  2R7X A;  2LSE A;  1FMW A;  4OIR F;  5FCL A;  1VK5 A;  3JRT A;  4JJG A;  4IWB A;  3LEV A;  2QTV A;  4XLP F;  5F5F A;  5E2Q A;  3RIP A;  2PP4 A;  3X2Q C;  1JPN A;  3LLK A;  3RKO F;  3JYH A;  4H4K C;  5KYY A;  3DZA A;  4I3M A;  2NUP B;  4IJJ A;  3AQC A;  3L34 A;  4PJN A;  3ZSU A;  3KH2 A;  3DJU B;  1Z6A A;  4YT5 A;  1TWG A;  3LES A;  2R7T A;  4C3B A;  2R7S A;  2OCC C;  2IXM A;  2BE5 F;  2KW3 C;  2MWQ A;  3UGP A;  3EHM A;  5DQT A;  4CIH A;  3GAN A;  2I8B A;  4MND A;  4ZLC A;  4XLN F;  3SZR A;  1J8Y F;  3O39 A;  1FMV A;  3K1I C;  5CI9 A;  5KYN A;  3EZH A;  4CSA A;  1TWA A;  5HSW A;  2WZL A;  1FFT C;  3EG9 B;  4BJ5 A;  4N06 A;  1Z23 A;  2NUT A;  3E70 C;  3EFO B;  5L3V A;  1QZX A;  3HLZ A;  2ZXP A;  3NRH A;  1PCX A;  3N0T A;  1Z63 A;  2W45 A;  1D1B A;  2Y3D A;  3KMI A;  1MNE A;  3DAG A;  3QMK A;  5T3T A;  3OWT A;  2E87 A;  2A6E F;  2CNW D;  2CGE A;  1M57 C;  2FFH A;  2J9W A;  5B1A C;  4EWC A;  4DVY P;  4O6N A;  4I1O B;  2EIK C;  1VYK A;  3RFY A;  2KJG A;  3AG2 C;  4JZA A;  3IEE A;  2EIN C;  2DYR C;  3Q7G A;  4DBQ A;  4PFP A;  1V55 C;  5E33 A;  4I1M A;  4U5F E;  3I5P A;  2PX0 A;  4Q4Z F;  1Z3I X;  2NG1 A;  4PFO A;  5T1D B;  1RJ9 B;  3DAF A;  3MLG A;  3T6B A;  2EIJ C;  3OEO A;  3CQZ A;  3ABL C;  4NY3 A;  4G0H A;  5DS5 A;  2CW0 F;  2Q9A A;  3LS1 A;  3UMK A;  3WOD F;  2XRH A;  2GFH A;  3W8I A;  3UR3 C;  4C7O A;  4CS8 C;  3NDB B;  3MX3 A;  3K7D A;  4DVZ A;  3M1C B;  1OKK D;  4BG0 A;  4G7H F;  2WB7 A;  3T6J A;  4LLC A;  4U5H A;  3POV A;  3NG1 A;  2WZF A;  4XWJ A;  4E7Z A;  2XXA A;  3EGD A;  3WG7 C;  4OIQ F;  1KU2 A;  3CSK A;  3F47 A;  3B0V C;  4OD4 A;  2C04 A;  2H7V C;  4AE4 B;  5KYU B;  1BR4 A;  3I4U A;  3KKB A;  3LS0 A;  1ZHY A;  3AG1 C;  2M4E A;  1ZYR F;  5KYW B;  4JJF A;  5KYX A;  2Y3G A;  4KI2 A;  1N1C A;  1D1C A;  3DJN B;  3RH3 A;  3EQL F;  5D91 A;  3JCU Q;  4YN0 B;  3AG3 C;  1NG1 A;  2WVQ A;  5DS4 A;  2VAS A;  3PHF 2;  4K0D A;  3NYJ A;  2QY9 A;  5DVW A;  3ASO C;  1Z5Z A;  2DGJ A;  4C3E A;  2ZXR A;  2YHS A;  2J46 A;  4CS9 A;  3ZG1 A;  4PJM A;  4DBR A;  5KYY B;  2J9U A;  4FES A;  3HJC A;  2Y3H A;  3JSZ A;  4YT2 A;  3T4R A;  1MMD A;  3H65 A;  4CS7 A;  4LAC B;  4U5B E;  4LLE A;  2XSE A;  3FHD A;  1D1A A;  2V26 A;  3QZC A;  3LNR A;  3S0X A;  2C03 A;  3ZVR A;  2Z15 A;  4RD9 A;  3VYW A;  1M2V A;  3EHN A;  3PMR A;  3SYN A;  4XTK A;  2IXP A;  2WZG A;  3N2Z B;  1TKN A;  2A68 F;  3FVY A;  2R7R A;  3AQB A;  4YT4 A;  2PF4 E;  4MQ9 F;  1M2O A;  1NU7 D;  3B0P A;  4JVS A;  1MMG A;  2NUT B;  4G7O F;  2KGO A;  1VYI A;  4JUR I;  1J8M F;  2WVN A;  3EG9 A;  4LER A;  4BEJ A;  2IOQ A;  3EGX A;  5DS6 A;  5DLJ A;  3EZI A;  3W2V A;  4U5D E;  3S29 A;  3I5Q A;  4AX2 A;  3ZIB A;  4PJL A;  1TR2 A;  2A69 F;  2CDQ A;  1D0Y A;  4J32 B;  3VAY A;  3NKD A;  3EH1 A;  3EH2 A;  5IY5 C;  2IYL D;  2R7Q A;  3K1H A;  3FAJ A;  3K33 A;  3N24 A;  1O87 A;  3KL4 A;  4HFK B;  2OG2 A;  4OIO F;  3Q6N A;  3SNH A;  2H7O A;  1SF8 A;  2Q9C A;  2Q9B A;  2VH3 A;  1TWH A;  3Q6M A;  4BJ5 C;  1D0X A;  4HEA J;  4U5C E;  4K7B A;  4O79 A;  4GEH A;  2ZXW C;  3B9Q A;  3X1O A;  4E7S A;  2EIM C;  2X51 A;  3LLI A;  3S27 A;  4EBB A;  4CBE A;  3AG4 C;  4Q5S F;  5E3A A;  2L81 A;  5D92 A;  2B0J A;  4C7O B;  1TWC A;  2J7P A;  4Q7C A;  4QDL A;  2KQ9 A;  4HFF B;  4OD5 A;  3FDQ A;  2H7B A;  2R7V A;  5B3S C;  3B0U X;  3ASN C;  3EGD B;  4KNV A;  4W8K A;  4U5E E;  5B1B C;  2R7O A;  4JCH A;  3W2W A;  2HV7 A;  1VMA A;  3NKE A;  2VB6 A;  4AE4 A;  5KYX B;  2Y39 A;  3ITF A;  2PFD A;  2R7W A;  1ZHT A;  1OCZ C;  5DQZ A;  4F4B A;  3O6X A;  4KNW A;  4I44 A;  3GOD A;  3L0I A;  2J0W A;  5F5H A;  3F46 A;  4M63 A;  2PX3 A;  4GYT A;  2XL4 A;  4U5G A;  1WGW A;  4KC9 A;  3TD7 A;  4BJ6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...