4HFKB

Crystal structure of the type vi effector-immunity complex tae4-tai4 from enterobacter cloacae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
98
structure length
98
Chain Sequence
QTLPDISTFSQQQIFENWVQNRCIGKIADSKSLKEDADASAAAWLEASNLPAENFEKADEVIVSLLKQKVGGTEPGHYQILKCTLIANSDAIRPLKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structure of the type VI effector-immunity complex (Tae4-Tai4) provides novel insights into the inhibition mechanism of the effector by its immunity protein.
pubmed doi rcsb
source organism Enterobacter cloacae
molecule tags Hydrolase
total genus 36
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4hfkB00
4B6IA 4AX2A 4JURI 4J30B 4HFKB 3ZIBA 4HFFB 4J32B
chains in the Genus database with same CATH superfamily
5E3CA 2WVNA 3EG9B 4AX2A 1NLXA 3K6BA 1ZW3A 3EFOA 2NUTA 1PV3A 5DQZA 4XLNF 1VK5A 4E7SA 1M57C 2Y3DA 4OD5A 1D0XA 3U9JA 5A6BA 1Q0MA 3T4RA 3DZAA 3QTHA 3JZ0A 1GS9A 3J06A 1D0YA 1LE2A 2H7BA 1NZEA 3U8VA 1A0BA 2CCYA 1RKEA 5HV9A 5L0CA 2W9YA 2LP4A 3HKKA 5B3SC 5IY5C 4OIOF 1YLMA 4JE9A 1NFOA 3JRTA 2I15A 2LK4A 5CI9A 4E0IA 4MVQA 1V74B 1HE1A 5F5HA 1LI7A 3Q6NA 1EQ1A 3RFYA 4NTAA 2X51A 4O7GA 4O6MA 4PJJA 4MTFA 4XTKA 4DJ9A 3VM6A 4U9EA 4CJOA 1LE4A 1MNDA 3MFNA 5JVEA 5DS6A 1PD0A 3O10A 2ZXOA 4XEVA 3POVA 4LLCA 1QVXA 2AU5A 3JRMO 3LEVA 2R7SA 3RW0A 2IXNA 3PCVA 5COMA 1KTMA 2XLWA 4MTGA 3SEOA 4P9FA 2EPOA 5DLJA 1YVIA 3W8HA 3AG4C 1AEPA 4O6NA 5TJ5E 3TULA 1WGWA 3GM3A 5JRAA 4ONSA 3FAPB 4YL1A 5JS5A 5JSLA 1D1BA 4BG0A 1SYQA 3ZG1A 1ZHZA 2EILC 4PFOA 1Z6AA 2J9UA 3NRHA 4BJTA 4W8PA 3ZIBA 2R05A 3DAFA 3QW0A 1EA8A 4NTFA 3ABKC 3W8IA 1KU2A 1O5HA 3SXZA 4DBQA 3U2LA 1FMVA 3R7CA 2UUIA 2R7QA 2IXMA 3CZ6A 3FAJA 3OWTA 4U5FE 4EIYA 2XXAB 3PDMP 3U8PA 4CS8C 2YWAA 3QZCA 4L6RA 4MVRA 2AWYA 4PJNA 1ZYRF 1LM3B 3U3BA 3LLKA 3KH2A 3PMRA 2J9VA 3V5YA 3DXJF 3RIPA 3PHF2 1A41A 5A6KA 2YL7A 4EUKB 1TKNA 1KNYA 1M2VB 3UNGC 4J30B 5KYYA 1GM5A 2KW3C 2L81A 1LKXA 3IQTA 3O55A 1E84A 2WZLA 1L7CA 4OIRF 2OCCC 5BQIA 1M6TA 1XWJA 1E85A 1TWAA 3TQOA 2ETSA 2MHRA 3N2ZB 3ASOC 3MLGA 1DOVA 1ZZPA 2YL1A 2VCCA 2YQYA 2KYHA 3AQCA 4JW1A 4IJJA 1S05A 1JPJA 2GFHA 3U2MA 1T9KA 2D5RB 3L34A 3Q7LA 4EBJA 2KJGA 3JSEO 5COGA 4CIPA 5L3VA 3FDQA 1LIHA 2EIJC 1YZCA 3B0PA 4CDAA 3EGXA 1YZAA 4JEBA 2G62A 4JTDB 1MMGA 2IBFA 2EIKC 4G78A 1Z3IX 3JYHA 4G0HA 2L7AA 3KL4A 2KC3A 2F22A 3BRJA 1UFBA 3IQ6A 4CDVA 1WWPA 1BZ4A 3CEXA 3U0CA 3W4YA 4A2NB 1B68A 2JPUA 3I5PA 4MNDA 4AE4A 1ZU4A 2PNOA 4E17A 2EIMC 4YT4A 1ORSC 2PP4A 3K1IA 1TWGA 3RQEA 1CPQA 3UGOA 3T6JA 1D0ZA 2VB6A 1A7VA 1RJ9B 5L0JA 2YLIA 2HS5A 2FFHA 2VH3A 3ZTZA 2ZXPA 3ECSA 5T3WA 3ZDLA 2OG2A 2XLEA 1JOGA 1O87A 2Q00A 4DRHB 2VC9A 4MVUA 4FX5A 5E3AA 3DJUB 4Q5SF 1HY5A 3C18A 3MYFA 3S29A 1U6HA 2XL8A 3S9OA 3O39A 1ORYA 1U89A 1T6UA 2JD3A 3K33A 1NBBA 4NTBA 1C03A 2KNHA 2P6VA 1E83A 1OCOC 1Q0DA 2WVQA 3CQZA 3FVYA 3SYNA 2DGJA 3NDBB 2IM8A 2HV6A 1APCA 1GQAA 3ZQVA 2YHSA 5L0FA 5AGFA 1MMAA 3HJCA 2PFDA 1CGNA 3VAYA 2ZPAA 3O6XA 2XLMA 1LI5A 1K40A 1QQ3A 1ZHXA 2GA0A 1N1CA 2J0WA 3NYMA 2EPMX 2OKUA 4MVZA 3L8IA 3M1CB 3US6A 3SNHA 1OKKD 3DE9A 4FESA 4K7BA 1RCPA 1H9TA 4MVSA 3ZQYA 2A1DD 4MVMA 4N6CA 4BEMJ 3NMKA 4MW3A 4N4WA 4JRZA 2TMVP 1VLSA 2B0JA 5EHHA 3AOUA 3B9QA 4EBBA 5GPGB 3AG3C 3C8GB 3NYJA 4MVOA 4CDYA 3T9OA 2HKVA 3DAGA 4U5DE 2C03A 2DYRC 3JYYA 1YJGA 3S84A 4HFFB 4E7ZA 4YT2A 1PD1A 3OEOA 3UMIA 2EINC 2R03A 2W45A 2AWCA 4N06A 4P9TA 3U3FA 3W2WA 3DD7A 2HMZA 2YL0A 1DOWA 3NMJA 1FFTC 4DXWA 4U5EE 1YYXA 5FZTA 2Q9BA 1HMDA 2PF4E 2HMQA 1FNTc 2W4BA 4E0HA 5KYXB 2AP3A 2Y3BA 4MQ9F 3ZWIA 2XXAA 4BJ1A 4DRIB 2V3CC 3T6BA 4KI2A 1IZMA 4U5BE 2R7WA 3T6GB 3FOPA 4LACB 1LS4A 1OW7A 4PK4A 5HSWA 1SZIA 4CS8A 3HNLA 2LD6A 2R7RA 4O79A 4YL0A 2YRFA 3WAQA 3QMKA 3C8ZA 4ZLDA 1YAUO 3ASNC 1Z63A 3WG7C 2HSQA 2IXPA 2IYLD 3I5QA 2KGOA 2J8WA 2PX3A 3C63A 2NUTB 1OQCA 3EFOB 3IQ5A 4MTOA 3GODA 1FAPB 5A6AA 2NSGA 4WJ0A 3SP1A 1BR4A 3F47A 3MYIA 5AC5A 1VMAA 2YZSA 1I5NA 1C17M 1M2OA 1QZXA 4XEFA 2R7VA 2EPNA 4HFKB 3ABLC 1RKEB 1MMNA 1A7DA 2XS1A 1S7ZA 1JMWA 4LDQA 3TD7A 4K1OA 1HW2A 4OIQF 1VLTA 3FMSA 3FOOA 2G3KA 1OKKA 2BC5A 2P1AA 4WGZA 4ER9A 4D4NA 2XSEA 1H9GA 3EHMA 2QNLA 4R32A 1RMVA 4XWJA 2QE9A 1FR0A 5L0DA 1ST6A 3DE8A 1QKRA 5JUAA 3FHDA 4M63A 4WABA 5KYUB 4CS9C 1QPUA 3M4CA 1AVOB 3EH1A 4XPYA 2Y69C 2H7VC 4F4BA 3NKEA 3RQGA 1RKCA 4BPMA 3LAYA 2PBEA 3S28A 1YARO 4XPWA 4E18A 2VASA 5DS5A 4GEHA 4N6HA 3TK0A 3H2VA 5DQTA 256BA 2C04A 1Z7Qc 2ZXRA 4XPXA 2XS8A 2EPLX 2HZ8A 4B6IA 3W2VA 2E87A 1RJ9A 2RSEB 1T6QA 2Q4FA 3QVYA 4JURI 5EGYA 2A68F 2UUHA 4XEKA 1HMOA 3SXYA 3KKBA 1ORJA 4QI0A 2M64A 2L6FA 4IWBA 3IQCA 4U9DA 1OW8A 3ITFA 2BL2A 1F1MA 1PCXA 2P0NA 4IARA 4Z9JA 3WHNA 1LPEA 4W8KA 3AG2C 1HE9A 3IPMO 2GDCA 1OR3A 3JSZA 2YLDA 1CGOA 4AK9A 3HNIA 2JX0A 1L3PA 3M15A 5BUOA 5L0IA 4JVSA 3DWWA 4C3EA 1R4TA 4IRUA 1D1CA 1TFKB 2Q9AA 5DVWA 3LNMB 4G7OF 4CJGA 3ABMC 2CNWD 3KPHA 3L8JA 3IHUA 4HEAJ 3EG9A 3U5SA 3IEEA 2YKZA 4I1MA 1OXBA 3DM9B 1GGQA 3RQFA 4FAPB 5D92A 3Q6MA 1IW7F 2OQMA 1M56C 4CX9A 2R02A 4C3BA 1T5OA 1QLEC 4U5CE 4PJMA 2XM4A 1WOLA 4IAQA 2DB4A 3X1OA 3UMHA 2LFDA 2BE5F 3AQBA 4CSAC 1W2WA 4U5GA 4C7OB 2MWQA 1EI7A 1NFNA 1U0BB 3JCUQ 3ZC4A 4U5HA 1OCZC 3UR3C 3V5ZA 3MX3A 3H65A 1E86A 2A0BA 1TFOB 1BBHA 2Z15A 3C8GA 3DKAA 1Q0GA 4KC9A 1VOMA 3KYIA 1ZHWA 3L1MA 4X0RA 4YT5A 3N0TA 5D91A 1R5ID 3TOLA 3GWNA 4PR9A 4YN0B 4KBLA 2KQ9A 2XLHA 3E70C 2XLDA 4FWVA 4JZAA 1G8XA 4Q4ZF 1SR2A 4DOZA 3B0VC 4JTCB 4HE8D 1LVKA 3GEIA 1E2XA 2OEVA 5T3TA 4XQ1A 3S0XA 2NPUA 3LNRA 5K0IA 5L3QA 2R7XA 3ATPA 2R25A 2OEXA 1HW1A 2QY9A 4JIOA 3KYJA 3EGDB 5KYXA 1FFHA 2ICWG 4BJ5C 2DYSC 4G7HF 2OJQA 2IXOA 3F46A 3EZHA 2J46A 3ZVRA 1G5ZA 2Y3HA 1JR8A 4I44A 4Z9HA 3TJ5A 4DBRA 1JPNA 4J32B 2YVKA 1TR2A 3LS0A 4I1OB 4JCZA 4PFPA 2Q7RA 3HNKA 2J9WA 5B1AC 5T1DB 4JKVA 4MS2A 3X2QC 5B3IA 4JC7A 4JJFA 2Q3TA 3OA1A 1G4WR 1J8MF 3HNJA 3QW1A 3E9VA 2MYSA 3ZSUA 4AE4B 2LSEA 4ULVA 2NUPB 2R9RB 3DJNB 4Q7CA 1UG7A 4OINF 3V5XA 3H2UA 3RVZA 3I4UA 4G7ZF 2QUPA 3CSKA 5E2QA 4P6IC 1J8YF 2J45A 2QLAA 2PX0A 3HLZA 4CS7A 1Y6DA 2A0UA 1VTMP 3GEHA 4WGYA 2CNWA 4JTAB 3GANA 3U9MA 4XLPF 2D4UA 5F28E 1Q0KA 2J9BA 3VRCA 3A11A 5COFA 4BJ6A 5KYWB 3DM5A 4EBKA 1NSGB 3M79A 1O3UA 1FTSA 3A9CA 2CW0F 3RH3A 1OR2A 2WZFA 1MQVA 1BDJB 5JLIA 2HV7A 3C7JA 4O6YA 1H6GA 5KYUA 3RVYA 3VF0A 1WN0A 3AG1C 5A69A 3S90A 1M2VA 2NG1A 4H54A 4NQFA 4ZLCA 2I8BA 3GWLA 4QDLA 3EJNA 4CS9A 2XRHA 1H7IA 1FMWA 3EPVA 2GWWA 4NC3A 1BR1A 4Z9IA 1I4ZA 3GORA 3LESA 4CBEA 3TOMA 5E33A 3SXKA 4YJWA 2AVKA 4BJ6C 3B71A 2EPKX 3SXMA 4EWCA 4PACA 3LUTB 5B1BC 4UDVA 4D4XA 3C8GD 1K05A 1YA9A 2ASRA 3K1HA 4MW8A 2XLOA 3EH2A 3GM2A 2R7TA 2CDQA 4YT8A 2WB7A 4JCHA 4RD9A 2YEVA 3LS1A 1MMDA 1V55C 1ZU5A 1YA7O 3LLIA 4IB4A 1VB5A 2VCAA 3R2PA 1OCCC 2FGYA 3L0IA 5L0GA 2YLGA 1I4YA 2H8AA 2J7PD 2Y39A 4KNWA 4IGGA 1Q0FA 5BQGA 3TJ6A 3DMDA 2ZXWC 3NG1A 4DRJB 2HFIA 5JT4A 3AJMA 2GAQA 4H4KC 2CYDA 4BEJA 2OOCA 5JP7A 4AL1A 1BR2A 5KYWA 4OIPF 4LDKA 4YWQA 4LERA 4DVZA 2LQGA 3NMIA 4OD4A 1G4US 2LCHA 5L0HA 4AL0A 2H7OA 5DS4A 4C7OA 1CPRA 3K66A 4NCQA 4CSAA 1EKYA 3NYLA 3C62A 3GM1A 4DVYP 2WL8A 1TQGA 5EK0A 2OJED 1AUEA 2G3VA 4A4AA 1NU7D 1CGME 1XZPA 2LFFA 2HUJA 3WODF 2HJMA 3NKDA 3G50A 1V54C 1Z23A 4JEAA 2XL4A 5A6BD 3MBGA 2Q9CA 4JJGA 2P7VA 1TWCA 1SMYF 4PJLA 3RKOF 5BQHA 4I3MA 2R7OA 5CIVA 1JAFA 5CI8A 3S27A 1NU9C 5F5FA 1ZHTA 1YYJA 4ANJA 1LS1A 3EGDA 2J0XA 2KSFA 3V7OA 2R7UA 1VYIA 4C3DA 1OCRC 1SF8A 1T01A 3JT1A 3LEOA 3EQLF 1A7EA 1WASA 4BJ5A 1ZW2A 1ZVZA 2B0HA 2VCBA 3VYWA 1RXQA 1C02A 1Z5ZA 2ZD9A 1OW6A 2DI3A 2L6HA 2XLVA 3K7DA 5AC4A 1NG1A 3FXHA 5KYYB 3B29A 1ZHYA 1V4AA 2V26A 2WVOA 4IAOA 4NY3A 3Q7GA 1VYKA 2XL6A 2A6EF 4LLEA 4EKWA 3BEHA 2XM0A 3UGPA 1K04A 2RD9A 2W4MA 2NUPA 4RDAA 1XZQA 1TWHA 2KK1A 2HSBA 4K0DA 4YK5A 1YDIA 2O9XA 2Y3GA 4EHPA 5FCLA 2A6HF 2CGEA 3DI5A 3HTKC 2P61A 3AGTA 3CAXA 2HJ3A 1T6IA 2M4EA 2QTVA 1WTYA 2FAPB 3QVZA 4GQHA 2X0CA 4LDRA 4J7YA 5A6JA 2IOQA 3G4ZA 1QSPA 3UMKA 1D1AA 2J7PA 2LIGA 4RBNA 4ULWA 4J7TA 1JRAA 2OU6A 2NSFA 2WZGA 2L9JA 3EHNA 3RF3A 1WATA 3SZRA 3N24A 5KYNA 1Y4CA 3EGXB 3AGUA 3KMIA 3LJBA 3EZIA 4KNVA 4GYTA 4YL3A 1OXKA 4CIHA 3B0UX 3RYLA 2YL3A 3ZTMA 3G4XA 1MNEA 3GEEA 3JTLO 3M4BA 2L6GA 4QI2A 2A69F 3K1IC
chains in the Genus database with same CATH topology
5E3CA 2WVNA 3EG9B 4AX2A 3K6BA 3EFOA 2NUTA 5DQZA 4XLNF 1VK5A 4E7SA 1M57C 2Y3DA 4OD5A 1D0XA 3T4RA 3DZAA 1D0YA 2H7BA 1NZEA 2W9YA 5B3SC 5IY5C 4OIOF 3JRTA 5CI9A 5F5HA 3Q6NA 3RFYA 4O6MA 2X51A 4O7GA 4PJJA 4XTKA 1MNDA 5DS6A 1PD0A 2ZXOA 3POVA 4LLCA 3LEVA 2R7SA 2IXNA 3SEOA 5DLJA 3W8HA 3AG4C 4O6NA 1WGWA 1D1BA 4BG0A 3ZG1A 1ZHZA 2EILC 4PFOA 1Z6AA 2J9UA 3NRHA 4BJTA 3ZIBA 3DAFA 3ABKC 3W8IA 1KU2A 1O5HA 4DBQA 1FMVA 2R7QA 2IXMA 3CZ6A 3FAJA 3OWTA 4U5FE 2XXAB 4CS8C 3QZCA 4PJNA 1ZYRF 3LLKA 3KH2A 3PMRA 2J9VA 3DXJF 3RIPA 3PHF2 1TKNA 1M2VB 3UNGC 4J30B 5KYYA 2KW3C 2L81A 1LKXA 2WZLA 4OIRF 2OCCC 1TWAA 3N2ZB 3ASOC 3MLGA 3AQCA 4JW1A 4IJJA 1JPJA 2GFHA 2D5RB 3L34A 3Q7LA 2KJGA 5L3VA 3FDQA 2EIJC 3B0PA 3EGXA 2G62A 1MMGA 2EIKC 1Z3IX 3JYHA 4G0HA 3KL4A 4Q4ZF 4A2NB 3I5PA 4MNDA 4AE4A 1ZU4A 2EIMC 4YT4A 2PP4A 1TWGA 3UGOA 3T6JA 1D0ZA 2VB6A 1RJ9B 2FFHA 2VH3A 2ZXPA 3ECSA 5T3WA 2OG2A 1O87A 4FX5A 5E3AA 3DJUB 4Q5SF 3S29A 3O39A 2JD3A 3K33A 2KNHA 2P6VA 1OCOC 2WVQA 3FVYA 3CQZA 3SYNA 2DGJA 3NDBB 2HV6A 2YHSA 1MMAA 3HJCA 2PFDA 3VAYA 2ZPAA 3O6XA 1ZHXA 1N1CA 2J0WA 3NYMA 3M1CB 3SNHA 1OKKD 4FESA 4K7BA 2A1DD 2B0JA 5EHHA 3B9QA 4EBBA 3AG3C 3NYJA 3DAGA 4U5DE 2C03A 2DYRC 4HFFB 4E7ZA 4YT2A 1PD1A 3OEOA 3UMIA 2EINC 3W2WA 2W45A 4N06A 3DD7A 1FFTC 4U5EE 2Q9BA 2PF4E 2W4BA 5KYXB 2Y3BA 4MQ9F 2XXAA 4BJ1A 2V3CC 3T6BA 4KI2A 1IZMA 4U5BE 2R7WA 4LACB 4PK4A 5HSWA 1SZIA 4CS8A 2R7RA 4O79A 3QMKA 4ZLDA 3ASNC 1Z63A 3WG7C 2IXPA 2IYLD 3I5QA 2KGOA 3EFOB 2PX3A 4YJWA 2NUTB 3GODA 4WJ0A 3SP1A 1BR4A 3F47A 1VMAA 2YZSA 1M2OA 1QZXA 2R7VA 4HFKB 3ABLC 1MMNA 1S7ZA 3TD7A 4OIQF 2G3KA 1OKKA 2XSEA 3EHMA 4XWJA 1ST6A 3FHDA 4M63A 5KYUB 4CS9C 3EH1A 2Y69C 2H7VC 4F4BA 3NKEA 3LAYA 3S28A 5DS5A 2VASA 4GEHA 5DQTA 2C04A 2ZXRA 4B6IA 3W2VA 2E87A 1RJ9A 5EGYA 4JURI 2A68F 3KKBA 4QI0A 4IWBA 3ITFA 1PCXA 4W8KA 3AG2C 3JSZA 4AK9A 5BUOA 4JVSA 4C3EA 4IRUA 1D1CA 2Q9AA 5DVWA 4G7OF 3ABMC 2CNWD 4HEAJ 3EG9A 3IEEA 4I1MA 3DM9B 5D92A 3Q6MA 1IW7F 1M56C 4C3BA 1QLEC 4U5CE 4PJMA 4CSAC 3X1OA 3UMHA 2BE5F 3AQBA 1W2WA 4U5GA 4C7OB 2MWQA 3JCUQ 3ZC4A 4U5HA 1OCZC 3UR3C 3MX3A 3H65A 2Z15A 4KC9A 3VYWA 5D91A 1VOMA 4YT5A 1ZHWA 4X0RA 3N0TA 4YN0B 4KBLA 2KQ9A 3E70C 4FWVA 4JZAA 1G8XA 4DOZA 3B0VC 4HE8D 1LVKA 5T3TA 3S0XA 3LNRA 2R7XA 5L3QA 2QY9A 5KYXA 3EGDB 1FFHA 4BJ5C 2DYSC 4G7HF 2IXOA 3F46A 3EZHA 2J46A 3ZVRA 2Y3HA 4I44A 4DBRA 1JPNA 4J32B 3LS0A 1TR2A 4PFPA 4I1OB 2J9WA 5B1AC 5T1DB 3X2QC 4JJFA 2Q3TA 3OA1A 1J8MF 3ZSUA 4AE4B 3E9VA 2MYSA 2LSEA 2NUPB 4Q7CA 3DJNB 4OINF 3I4UA 4G7ZF 3CSKA 5E2QA 4P6IC 1J8YF 2J45A 2PX0A 3HLZA 4CS7A 2CNWA 3GANA 4XLPF 4BJ6A 5KYWB 3DM5A 1FTSA 2CW0F 3RH3A 2WZFA 2HV7A 4O6YA 5KYUA 3AG1C 2NG1A 1M2VA 4ZLCA 2I8BA 4QDLA 3EJNA 4CS9A 2XRHA 1FMWA 3EPVA 1BR1A 3LESA 4CBEA 5E33A 4BJ6C 4EWCA 5B1BC 3K1HA 2R7TA 3EH2A 2CDQA 4YT8A 2WB7A 4JCHA 4RD9A 2YEVA 3LS1A 1MMDA 1V55C 1ZU5A 3LLIA 1OCCC 2FGYA 3L0IA 4KNWA 2J7PD 2Y39A 3DMDA 2ZXWC 3NG1A 4H4KC 4BEJA 4OIPF 1BR2A 4YWQA 4LERA 4DVZA 4OD4A 2H7OA 5DS4A 4C7OA 3K66A 4CSAA 3NYLA 4DVYP 2WL8A 2G3VA 1NU7D 3WODF 3NKDA 1V54C 1Z23A 2XL4A 2Q9CA 4JJGA 2P7VA 1TWCA 1SMYF 4PJLA 3RKOF 4I3MA 2R7OA 5CI8A 3S27A 1NU9C 5F5FA 1ZHTA 4ANJA 1LS1A 3EGDA 2J0XA 3V7OA 2R7UA 1VYIA 4C3DA 1OCRC 1SF8A 3JT1A 3EQLF 4BJ5A 1Z5ZA 3K7DA 1NG1A 5KYYB 4IAOA 1ZHYA 2V26A 2WVOA 4NY3A 3Q7GA 1VYKA 2A6EF 4LLEA 3UGPA 2W4MA 4RDAA 2NUPA 1TWHA 4K0DA 5FCLA 2O9XA 2Y3GA 2A6HF 2CGEA 3HTKC 2M4EA 2QTVA 2IOQA 3UMKA 1D1AA 2J7PA 4RBNA 4ULWA 5KYWA 2WZGA 3EHNA 2L9JA 3SZRA 5KYNA 3N24A 3EGXB 3KMIA 3LJBA 3EZIA 4KNVA 4GYTA 4CIHA 3B0UX 3RYLA 1MNEA 4QI2A 2A69F 3K1IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6I A;  4AX2 A;  4JUR I;  4J30 B;  4HFK B;  3ZIB A;  4HFF B;  4J32 B; 
#chains in the Genus database with same CATH topology
 5E3C A;  2WVN A;  3EG9 B;  4AX2 A;  1NLX A;  3K6B A;  1ZW3 A;  3EFO A;  2NUT A;  1PV3 A;  5DQZ A;  4XLN F;  1VK5 A;  4E7S A;  1M57 C;  2Y3D A;  4OD5 A;  1D0X A;  3U9J A;  5A6B A;  1Q0M A;  3T4R A;  3DZA A;  3QTH A;  3JZ0 A;  1GS9 A;  3J06 A;  1D0Y A;  1LE2 A;  2H7B A;  1NZE A;  3U8V A;  1A0B A;  2CCY A;  1RKE A;  5HV9 A;  5L0C A;  2W9Y A;  2LP4 A;  3HKK A;  5B3S C;  5IY5 C;  4OIO F;  1YLM A;  4JE9 A;  1NFO A;  3JRT A;  2I15 A;  2LK4 A;  5CI9 A;  4E0I A;  4MVQ A;  1V74 B;  1HE1 A;  5F5H A;  1LI7 A;  3Q6N A;  1EQ1 A;  3RFY A;  4NTA A;  2X51 A;  4O7G A;  4O6M A;  4PJJ A;  4MTF A;  4XTK A;  4DJ9 A;  3VM6 A;  4U9E A;  4CJO A;  1LE4 A;  1MND A;  3MFN A;  5JVE A;  5DS6 A;  1PD0 A;  3O10 A;  2ZXO A;  4XEV A;  3POV A;  4LLC A;  1QVX A;  2AU5 A;  3JRM O;  3LEV A;  2R7S A;  3RW0 A;  2IXN A;  3PCV A;  5COM A;  1KTM A;  2XLW A;  4MTG A;  3SEO A;  4P9F A;  2EPO A;  5DLJ A;  1YVI A;  3W8H A;  3AG4 C;  1AEP A;  4O6N A;  5TJ5 E;  3TUL A;  1WGW A;  3GM3 A;  5JRA A;  4ONS A;  3FAP B;  4YL1 A;  5JS5 A;  5JSL A;  1D1B A;  4BG0 A;  1SYQ A;  3ZG1 A;  1ZHZ A;  2EIL C;  4PFO A;  1Z6A A;  2J9U A;  3NRH A;  4BJT A;  4W8P A;  3ZIB A;  2R05 A;  3DAF A;  3QW0 A;  1EA8 A;  4NTF A;  3ABK C;  3W8I A;  1KU2 A;  1O5H A;  3SXZ A;  4DBQ A;  3U2L A;  1FMV A;  3R7C A;  2UUI A;  2R7Q A;  2IXM A;  3CZ6 A;  3FAJ A;  3OWT A;  4U5F E;  4EIY A;  2XXA B;  3PDM P;  3U8P A;  4CS8 C;  2YWA A;  3QZC A;  4L6R A;  4MVR A;  2AWY A;  4PJN A;  1ZYR F;  1LM3 B;  3U3B A;  3LLK A;  3KH2 A;  3PMR A;  2J9V A;  3V5Y A;  3DXJ F;  3RIP A;  3PHF 2;  1A41 A;  5A6K A;  2YL7 A;  4EUK B;  1TKN A;  1KNY A;  1M2V B;  3UNG C;  4J30 B;  5KYY A;  1GM5 A;  2KW3 C;  2L81 A;  1LKX A;  3IQT A;  3O55 A;  1E84 A;  2WZL A;  1L7C A;  4OIR F;  2OCC C;  5BQI A;  1M6T A;  1XWJ A;  1E85 A;  1TWA A;  3TQO A;  2ETS A;  2MHR A;  3N2Z B;  3ASO C;  3MLG A;  1DOV A;  1ZZP A;  2YL1 A;  2VCC A;  2YQY A;  2KYH A;  3AQC A;  4JW1 A;  4IJJ A;  1S05 A;  1JPJ A;  2GFH A;  3U2M A;  1T9K A;  2D5R B;  3L34 A;  3Q7L A;  4EBJ A;  2KJG A;  3JSE O;  5COG A;  4CIP A;  5L3V A;  3FDQ A;  1LIH A;  2EIJ C;  1YZC A;  3B0P A;  4CDA A;  3EGX A;  1YZA A;  4JEB A;  2G62 A;  4JTD B;  1MMG A;  2IBF A;  2EIK C;  4G78 A;  1Z3I X;  3JYH A;  4G0H A;  2L7A A;  3KL4 A;  2KC3 A;  2F22 A;  3BRJ A;  1UFB A;  3IQ6 A;  4CDV A;  1WWP A;  1BZ4 A;  3CEX A;  3U0C A;  3W4Y A;  4A2N B;  1B68 A;  2JPU A;  3I5P A;  4MND A;  4AE4 A;  1ZU4 A;  2PNO A;  4E17 A;  2EIM C;  4YT4 A;  1ORS C;  2PP4 A;  3K1I A;  1TWG A;  3RQE A;  1CPQ A;  3UGO A;  3T6J A;  1D0Z A;  2VB6 A;  1A7V A;  1RJ9 B;  5L0J A;  2YLI A;  2HS5 A;  2FFH A;  2VH3 A;  3ZTZ A;  2ZXP A;  3ECS A;  5T3W A;  3ZDL A;  2OG2 A;  2XLE A;  1JOG A;  1O87 A;  2Q00 A;  4DRH B;  2VC9 A;  4MVU A;  4FX5 A;  5E3A A;  3DJU B;  4Q5S F;  1HY5 A;  3C18 A;  3MYF A;  3S29 A;  1U6H A;  2XL8 A;  3S9O A;  3O39 A;  1ORY A;  1U89 A;  1T6U A;  2JD3 A;  3K33 A;  1NBB A;  4NTB A;  1C03 A;  2KNH A;  2P6V A;  1E83 A;  1OCO C;  1Q0D A;  2WVQ A;  3CQZ A;  3FVY A;  3SYN A;  2DGJ A;  3NDB B;  2IM8 A;  2HV6 A;  1APC A;  1GQA A;  3ZQV A;  2YHS A;  5L0F A;  5AGF A;  1MMA A;  3HJC A;  2PFD A;  1CGN A;  3VAY A;  2ZPA A;  3O6X A;  2XLM A;  1LI5 A;  1K40 A;  1QQ3 A;  1ZHX A;  2GA0 A;  1N1C A;  2J0W A;  3NYM A;  2EPM X;  2OKU A;  4MVZ A;  3L8I A;  3M1C B;  3US6 A;  3SNH A;  1OKK D;  3DE9 A;  4FES A;  4K7B A;  1RCP A;  1H9T A;  4MVS A;  3ZQY A;  2A1D D;  4MVM A;  4N6C A;  4BEM J;  3NMK A;  4MW3 A;  4N4W A;  4JRZ A;  2TMV P;  1VLS A;  2B0J A;  5EHH A;  3AOU A;  3B9Q A;  4EBB A;  5GPG B;  3AG3 C;  3C8G B;  3NYJ A;  4MVO A;  4CDY A;  3T9O A;  2HKV A;  3DAG A;  4U5D E;  2C03 A;  2DYR C;  3JYY A;  1YJG A;  3S84 A;  4HFF B;  4E7Z A;  4YT2 A;  1PD1 A;  3OEO A;  3UMI A;  2EIN C;  2R03 A;  2W45 A;  2AWC A;  4N06 A;  4P9T A;  3U3F A;  3W2W A;  3DD7 A;  2HMZ A;  2YL0 A;  1DOW A;  3NMJ A;  1FFT C;  4DXW A;  4U5E E;  1YYX A;  5FZT A;  2Q9B A;  1HMD A;  2PF4 E;  2HMQ A;  1FNT c;  2W4B A;  4E0H A;  5KYX B;  2AP3 A;  2Y3B A;  4MQ9 F;  3ZWI A;  2XXA A;  4BJ1 A;  4DRI B;  2V3C C;  3T6B A;  4KI2 A;  1IZM A;  4U5B E;  2R7W A;  3T6G B;  3FOP A;  4LAC B;  1LS4 A;  1OW7 A;  4PK4 A;  5HSW A;  1SZI A;  4CS8 A;  3HNL A;  2LD6 A;  2R7R A;  4O79 A;  4YL0 A;  2YRF A;  3WAQ A;  3QMK A;  3C8Z A;  4ZLD A;  1YAU O;  3ASN C;  1Z63 A;  3WG7 C;  2HSQ A;  2IXP A;  2IYL D;  3I5Q A;  2KGO A;  2J8W A;  2PX3 A;  3C63 A;  2NUT B;  1OQC A;  3EFO B;  3IQ5 A;  4MTO A;  3GOD A;  1FAP B;  5A6A A;  2NSG A;  4WJ0 A;  3SP1 A;  1BR4 A;  3F47 A;  3MYI A;  5AC5 A;  1VMA A;  2YZS A;  1I5N A;  1C17 M;  1M2O A;  1QZX A;  4XEF A;  2R7V A;  2EPN A;  4HFK B;  3ABL C;  1RKE B;  1MMN A;  1A7D A;  2XS1 A;  1S7Z A;  1JMW A;  4LDQ A;  3TD7 A;  4K1O A;  1HW2 A;  4OIQ F;  1VLT A;  3FMS A;  3FOO A;  2G3K A;  1OKK A;  2BC5 A;  2P1A A;  4WGZ A;  4ER9 A;  4D4N A;  2XSE A;  1H9G A;  3EHM A;  2QNL A;  4R32 A;  1RMV A;  4XWJ A;  2QE9 A;  1FR0 A;  5L0D A;  1ST6 A;  3DE8 A;  1QKR A;  5JUA A;  3FHD A;  4M63 A;  4WAB A;  5KYU B;  4CS9 C;  1QPU A;  3M4C A;  1AVO B;  3EH1 A;  4XPY A;  2Y69 C;  2H7V C;  4F4B A;  3NKE A;  3RQG A;  1RKC A;  4BPM A;  3LAY A;  2PBE A;  3S28 A;  1YAR O;  4XPW A;  4E18 A;  2VAS A;  5DS5 A;  4GEH A;  4N6H A;  3TK0 A;  3H2V A;  5DQT A;  256B A;  2C04 A;  1Z7Q c;  2ZXR A;  4XPX A;  2XS8 A;  2EPL X;  2HZ8 A;  4B6I A;  3W2V A;  2E87 A;  1RJ9 A;  2RSE B;  1T6Q A;  2Q4F A;  3QVY A;  4JUR I;  5EGY A;  2A68 F;  2UUH A;  4XEK A;  1HMO A;  3SXY A;  3KKB A;  1ORJ A;  4QI0 A;  2M64 A;  2L6F A;  4IWB A;  3IQC A;  4U9D A;  1OW8 A;  3ITF A;  2BL2 A;  1F1M A;  1PCX A;  2P0N A;  4IAR A;  4Z9J A;  3WHN A;  1LPE A;  4W8K A;  3AG2 C;  1HE9 A;  3IPM O;  2GDC A;  1OR3 A;  3JSZ A;  2YLD A;  1CGO A;  4AK9 A;  3HNI A;  2JX0 A;  1L3P A;  3M15 A;  5BUO A;  5L0I A;  4JVS A;  3DWW A;  4C3E A;  1R4T A;  4IRU A;  1D1C A;  1TFK B;  2Q9A A;  5DVW A;  3LNM B;  4G7O F;  4CJG A;  3ABM C;  2CNW D;  3KPH A;  3L8J A;  3IHU A;  4HEA J;  3EG9 A;  3U5S A;  3IEE A;  2YKZ A;  4I1M A;  1OXB A;  3DM9 B;  1GGQ A;  3RQF A;  4FAP B;  5D92 A;  3Q6M A;  1IW7 F;  2OQM A;  1M56 C;  4CX9 A;  2R02 A;  4C3B A;  1T5O A;  1QLE C;  4U5C E;  4PJM A;  2XM4 A;  1WOL A;  4IAQ A;  2DB4 A;  3X1O A;  3UMH A;  2LFD A;  2BE5 F;  3AQB A;  4CSA C;  1W2W A;  4U5G A;  4C7O B;  2MWQ A;  1EI7 A;  1NFN A;  1U0B B;  3JCU Q;  3ZC4 A;  4U5H A;  1OCZ C;  3UR3 C;  3V5Z A;  3MX3 A;  3H65 A;  1E86 A;  2A0B A;  1TFO B;  1BBH A;  2Z15 A;  3C8G A;  3DKA A;  1Q0G A;  4KC9 A;  1VOM A;  3KYI A;  1ZHW A;  3L1M A;  4X0R A;  4YT5 A;  3N0T A;  5D91 A;  1R5I D;  3TOL A;  3GWN A;  4PR9 A;  4YN0 B;  4KBL A;  2KQ9 A;  2XLH A;  3E70 C;  2XLD A;  4FWV A;  4JZA A;  1G8X A;  4Q4Z F;  1SR2 A;  4DOZ A;  3B0V C;  4JTC B;  4HE8 D;  1LVK A;  3GEI A;  1E2X A;  2OEV A;  5T3T A;  4XQ1 A;  3S0X A;  2NPU A;  3LNR A;  5K0I A;  5L3Q A;  2R7X A;  3ATP A;  2R25 A;  2OEX A;  1HW1 A;  2QY9 A;  4JIO A;  3KYJ A;  3EGD B;  5KYX A;  1FFH A;  2ICW G;  4BJ5 C;  2DYS C;  4G7H F;  2OJQ A;  2IXO A;  3F46 A;  3EZH A;  2J46 A;  3ZVR A;  1G5Z A;  2Y3H A;  1JR8 A;  4I44 A;  4Z9H A;  3TJ5 A;  4DBR A;  1JPN A;  4J32 B;  2YVK A;  1TR2 A;  3LS0 A;  4I1O B;  4JCZ A;  4PFP A;  2Q7R A;  3HNK A;  2J9W A;  5B1A C;  5T1D B;  4JKV A;  4MS2 A;  3X2Q C;  5B3I A;  4JC7 A;  4JJF A;  2Q3T A;  3OA1 A;  1G4W R;  1J8M F;  3HNJ A;  3QW1 A;  3E9V A;  2MYS A;  3ZSU A;  4AE4 B;  2LSE A;  4ULV A;  2NUP B;  2R9R B;  3DJN B;  4Q7C A;  1UG7 A;  4OIN F;  3V5X A;  3H2U A;  3RVZ A;  3I4U A;  4G7Z F;  2QUP A;  3CSK A;  5E2Q A;  4P6I C;  1J8Y F;  2J45 A;  2QLA A;  2PX0 A;  3HLZ A;  4CS7 A;  1Y6D A;  2A0U A;  1VTM P;  3GEH A;  4WGY A;  2CNW A;  4JTA B;  3GAN A;  3U9M A;  4XLP F;  2D4U A;  5F28 E;  1Q0K A;  2J9B A;  3VRC A;  3A11 A;  5COF A;  4BJ6 A;  5KYW B;  3DM5 A;  4EBK A;  1NSG B;  3M79 A;  1O3U A;  1FTS A;  3A9C A;  2CW0 F;  3RH3 A;  1OR2 A;  2WZF A;  1MQV A;  1BDJ B;  5JLI A;  2HV7 A;  3C7J A;  4O6Y A;  1H6G A;  5KYU A;  3RVY A;  3VF0 A;  1WN0 A;  3AG1 C;  5A69 A;  3S90 A;  1M2V A;  2NG1 A;  4H54 A;  4NQF A;  4ZLC A;  2I8B A;  3GWL A;  4QDL A;  3EJN A;  4CS9 A;  2XRH A;  1H7I A;  1FMW A;  3EPV A;  2GWW A;  4NC3 A;  1BR1 A;  4Z9I A;  1I4Z A;  3GOR A;  3LES A;  4CBE A;  3TOM A;  5E33 A;  3SXK A;  4YJW A;  2AVK A;  4BJ6 C;  3B71 A;  2EPK X;  3SXM A;  4EWC A;  4PAC A;  3LUT B;  5B1B C;  4UDV A;  4D4X A;  3C8G D;  1K05 A;  1YA9 A;  2ASR A;  3K1H A;  4MW8 A;  2XLO A;  3EH2 A;  3GM2 A;  2R7T A;  2CDQ A;  4YT8 A;  2WB7 A;  4JCH A;  4RD9 A;  2YEV A;  3LS1 A;  1MMD A;  1V55 C;  1ZU5 A;  1YA7 O;  3LLI A;  4IB4 A;  1VB5 A;  2VCA A;  3R2P A;  1OCC C;  2FGY A;  3L0I A;  5L0G A;  2YLG A;  1I4Y A;  2H8A A;  2J7P D;  2Y39 A;  4KNW A;  4IGG A;  1Q0F A;  5BQG A;  3TJ6 A;  3DMD A;  2ZXW C;  3NG1 A;  4DRJ B;  2HFI A;  5JT4 A;  3AJM A;  2GAQ A;  4H4K C;  2CYD A;  4BEJ A;  2OOC A;  5JP7 A;  4AL1 A;  1BR2 A;  5KYW A;  4OIP F;  4LDK A;  4YWQ A;  4LER A;  4DVZ A;  2LQG A;  3NMI A;  4OD4 A;  1G4U S;  2LCH A;  5L0H A;  4AL0 A;  2H7O A;  5DS4 A;  4C7O A;  1CPR A;  3K66 A;  4NCQ A;  4CSA A;  1EKY A;  3NYL A;  3C62 A;  3GM1 A;  4DVY P;  2WL8 A;  1TQG A;  5EK0 A;  2OJE D;  1AUE A;  2G3V A;  4A4A A;  1NU7 D;  1CGM E;  1XZP A;  2LFF A;  2HUJ A;  3WOD F;  2HJM A;  3NKD A;  3G50 A;  1V54 C;  1Z23 A;  4JEA A;  2XL4 A;  5A6B D;  3MBG A;  2Q9C A;  4JJG A;  2P7V A;  1TWC A;  1SMY F;  4PJL A;  3RKO F;  5BQH A;  4I3M A;  2R7O A;  5CIV A;  1JAF A;  5CI8 A;  3S27 A;  1NU9 C;  5F5F A;  1ZHT A;  1YYJ A;  4ANJ A;  1LS1 A;  3EGD A;  2J0X A;  2KSF A;  3V7O A;  2R7U A;  1VYI A;  4C3D A;  1OCR C;  1SF8 A;  1T01 A;  3JT1 A;  3LEO A;  3EQL F;  1A7E A;  1WAS A;  4BJ5 A;  1ZW2 A;  1ZVZ A;  2B0H A;  2VCB A;  3VYW A;  1RXQ A;  1C02 A;  1Z5Z A;  2ZD9 A;  1OW6 A;  2DI3 A;  2L6H A;  2XLV A;  3K7D A;  5AC4 A;  1NG1 A;  3FXH A;  5KYY B;  3B29 A;  1ZHY A;  1V4A A;  2V26 A;  2WVO A;  4IAO A;  4NY3 A;  3Q7G A;  1VYK A;  2XL6 A;  2A6E F;  4LLE A;  4EKW A;  3BEH A;  2XM0 A;  3UGP A;  1K04 A;  2RD9 A;  2W4M A;  2NUP A;  4RDA A;  1XZQ A;  1TWH A;  2KK1 A;  2HSB A;  4K0D A;  4YK5 A;  1YDI A;  2O9X A;  2Y3G A;  4EHP A;  5FCL A;  2A6H F;  2CGE A;  3DI5 A;  3HTK C;  2P61 A;  3AGT A;  3CAX A;  2HJ3 A;  1T6I A;  2M4E A;  2QTV A;  1WTY A;  2FAP B;  3QVZ A;  4GQH A;  2X0C A;  4LDR A;  4J7Y A;  5A6J A;  2IOQ A;  3G4Z A;  1QSP A;  3UMK A;  1D1A A;  2J7P A;  2LIG A;  4RBN A;  4ULW A;  4J7T A;  1JRA A;  2OU6 A;  2NSF A;  2WZG A;  2L9J A;  3EHN A;  3RF3 A;  1WAT A;  3SZR A;  3N24 A;  5KYN A;  1Y4C A;  3EGX B;  3AGU A;  3KMI A;  3LJB A;  3EZI A;  4KNV A;  4GYT A;  4YL3 A;  1OXK A;  4CIH A;  3B0U X;  3RYL A;  2YL3 A;  3ZTM A;  3G4X A;  1MNE A;  3GEE A;  3JTL O;  3M4B A;  2L6G A;  4QI2 A;  2A69 F;  3K1I C; 
#chains in the Genus database with same CATH homology
 5E3C A;  2WVN A;  3EG9 B;  4AX2 A;  3K6B A;  3EFO A;  2NUT A;  5DQZ A;  4XLN F;  1VK5 A;  4E7S A;  1M57 C;  2Y3D A;  4OD5 A;  1D0X A;  3T4R A;  3DZA A;  1D0Y A;  2H7B A;  1NZE A;  2W9Y A;  5B3S C;  5IY5 C;  4OIO F;  3JRT A;  5CI9 A;  5F5H A;  3Q6N A;  3RFY A;  4O6M A;  2X51 A;  4O7G A;  4PJJ A;  4XTK A;  1MND A;  5DS6 A;  1PD0 A;  2ZXO A;  3POV A;  4LLC A;  3LEV A;  2R7S A;  2IXN A;  3SEO A;  5DLJ A;  3W8H A;  3AG4 C;  4O6N A;  1WGW A;  1D1B A;  4BG0 A;  3ZG1 A;  1ZHZ A;  2EIL C;  4PFO A;  1Z6A A;  2J9U A;  3NRH A;  4BJT A;  3ZIB A;  3DAF A;  3ABK C;  3W8I A;  1KU2 A;  1O5H A;  4DBQ A;  1FMV A;  2R7Q A;  2IXM A;  3CZ6 A;  3FAJ A;  3OWT A;  4U5F E;  2XXA B;  4CS8 C;  3QZC A;  4PJN A;  1ZYR F;  3LLK A;  3KH2 A;  3PMR A;  2J9V A;  3DXJ F;  3RIP A;  3PHF 2;  1TKN A;  1M2V B;  3UNG C;  4J30 B;  5KYY A;  2KW3 C;  2L81 A;  1LKX A;  2WZL A;  4OIR F;  2OCC C;  1TWA A;  3N2Z B;  3ASO C;  3MLG A;  3AQC A;  4JW1 A;  4IJJ A;  1JPJ A;  2GFH A;  2D5R B;  3L34 A;  3Q7L A;  2KJG A;  5L3V A;  3FDQ A;  2EIJ C;  3B0P A;  3EGX A;  2G62 A;  1MMG A;  2EIK C;  1Z3I X;  3JYH A;  4G0H A;  3KL4 A;  4Q4Z F;  4A2N B;  3I5P A;  4MND A;  4AE4 A;  1ZU4 A;  2EIM C;  4YT4 A;  2PP4 A;  1TWG A;  3UGO A;  3T6J A;  1D0Z A;  2VB6 A;  1RJ9 B;  2FFH A;  2VH3 A;  2ZXP A;  3ECS A;  5T3W A;  2OG2 A;  1O87 A;  4FX5 A;  5E3A A;  3DJU B;  4Q5S F;  3S29 A;  3O39 A;  2JD3 A;  3K33 A;  2KNH A;  2P6V A;  1OCO C;  2WVQ A;  3FVY A;  3CQZ A;  3SYN A;  2DGJ A;  3NDB B;  2HV6 A;  2YHS A;  1MMA A;  3HJC A;  2PFD A;  3VAY A;  2ZPA A;  3O6X A;  1ZHX A;  1N1C A;  2J0W A;  3NYM A;  3M1C B;  3SNH A;  1OKK D;  4FES A;  4K7B A;  2A1D D;  2B0J A;  5EHH A;  3B9Q A;  4EBB A;  3AG3 C;  3NYJ A;  3DAG A;  4U5D E;  2C03 A;  2DYR C;  4HFF B;  4E7Z A;  4YT2 A;  1PD1 A;  3OEO A;  3UMI A;  2EIN C;  3W2W A;  2W45 A;  4N06 A;  3DD7 A;  1FFT C;  4U5E E;  2Q9B A;  2PF4 E;  2W4B A;  5KYX B;  2Y3B A;  4MQ9 F;  2XXA A;  4BJ1 A;  2V3C C;  3T6B A;  4KI2 A;  1IZM A;  4U5B E;  2R7W A;  4LAC B;  4PK4 A;  5HSW A;  1SZI A;  4CS8 A;  2R7R A;  4O79 A;  3QMK A;  4ZLD A;  3ASN C;  1Z63 A;  3WG7 C;  2IXP A;  2IYL D;  3I5Q A;  2KGO A;  3EFO B;  2PX3 A;  4YJW A;  2NUT B;  3GOD A;  4WJ0 A;  3SP1 A;  1BR4 A;  3F47 A;  1VMA A;  2YZS A;  1M2O A;  1QZX A;  2R7V A;  4HFK B;  3ABL C;  1MMN A;  1S7Z A;  3TD7 A;  4OIQ F;  2G3K A;  1OKK A;  2XSE A;  3EHM A;  4XWJ A;  1ST6 A;  3FHD A;  4M63 A;  5KYU B;  4CS9 C;  3EH1 A;  2Y69 C;  2H7V C;  4F4B A;  3NKE A;  3LAY A;  3S28 A;  5DS5 A;  2VAS A;  4GEH A;  5DQT A;  2C04 A;  2ZXR A;  4B6I A;  3W2V A;  2E87 A;  1RJ9 A;  5EGY A;  4JUR I;  2A68 F;  3KKB A;  4QI0 A;  4IWB A;  3ITF A;  1PCX A;  4W8K A;  3AG2 C;  3JSZ A;  4AK9 A;  5BUO A;  4JVS A;  4C3E A;  4IRU A;  1D1C A;  2Q9A A;  5DVW A;  4G7O F;  3ABM C;  2CNW D;  4HEA J;  3EG9 A;  3IEE A;  4I1M A;  3DM9 B;  5D92 A;  3Q6M A;  1IW7 F;  1M56 C;  4C3B A;  1QLE C;  4U5C E;  4PJM A;  4CSA C;  3X1O A;  3UMH A;  2BE5 F;  3AQB A;  1W2W A;  4U5G A;  4C7O B;  2MWQ A;  3JCU Q;  3ZC4 A;  4U5H A;  1OCZ C;  3UR3 C;  3MX3 A;  3H65 A;  2Z15 A;  4KC9 A;  3VYW A;  5D91 A;  1VOM A;  4YT5 A;  1ZHW A;  4X0R A;  3N0T A;  4YN0 B;  4KBL A;  2KQ9 A;  3E70 C;  4FWV A;  4JZA A;  1G8X A;  4DOZ A;  3B0V C;  4HE8 D;  1LVK A;  5T3T A;  3S0X A;  3LNR A;  2R7X A;  5L3Q A;  2QY9 A;  5KYX A;  3EGD B;  1FFH A;  4BJ5 C;  2DYS C;  4G7H F;  2IXO A;  3F46 A;  3EZH A;  2J46 A;  3ZVR A;  2Y3H A;  4I44 A;  4DBR A;  1JPN A;  4J32 B;  3LS0 A;  1TR2 A;  4PFP A;  4I1O B;  2J9W A;  5B1A C;  5T1D B;  3X2Q C;  4JJF A;  2Q3T A;  3OA1 A;  1J8M F;  3ZSU A;  4AE4 B;  3E9V A;  2MYS A;  2LSE A;  2NUP B;  4Q7C A;  3DJN B;  4OIN F;  3I4U A;  4G7Z F;  3CSK A;  5E2Q A;  4P6I C;  1J8Y F;  2J45 A;  2PX0 A;  3HLZ A;  4CS7 A;  2CNW A;  3GAN A;  4XLP F;  4BJ6 A;  5KYW B;  3DM5 A;  1FTS A;  2CW0 F;  3RH3 A;  2WZF A;  2HV7 A;  4O6Y A;  5KYU A;  3AG1 C;  2NG1 A;  1M2V A;  4ZLC A;  2I8B A;  4QDL A;  3EJN A;  4CS9 A;  2XRH A;  1FMW A;  3EPV A;  1BR1 A;  3LES A;  4CBE A;  5E33 A;  4BJ6 C;  4EWC A;  5B1B C;  3K1H A;  2R7T A;  3EH2 A;  2CDQ A;  4YT8 A;  2WB7 A;  4JCH A;  4RD9 A;  2YEV A;  3LS1 A;  1MMD A;  1V55 C;  1ZU5 A;  3LLI A;  1OCC C;  2FGY A;  3L0I A;  4KNW A;  2J7P D;  2Y39 A;  3DMD A;  2ZXW C;  3NG1 A;  4H4K C;  4BEJ A;  4OIP F;  1BR2 A;  4YWQ A;  4LER A;  4DVZ A;  4OD4 A;  2H7O A;  5DS4 A;  4C7O A;  3K66 A;  4CSA A;  3NYL A;  4DVY P;  2WL8 A;  2G3V A;  1NU7 D;  3WOD F;  3NKD A;  1V54 C;  1Z23 A;  2XL4 A;  2Q9C A;  4JJG A;  2P7V A;  1TWC A;  1SMY F;  4PJL A;  3RKO F;  4I3M A;  2R7O A;  5CI8 A;  3S27 A;  1NU9 C;  5F5F A;  1ZHT A;  4ANJ A;  1LS1 A;  3EGD A;  2J0X A;  3V7O A;  2R7U A;  1VYI A;  4C3D A;  1OCR C;  1SF8 A;  3JT1 A;  3EQL F;  4BJ5 A;  1Z5Z A;  3K7D A;  1NG1 A;  5KYY B;  4IAO A;  1ZHY A;  2V26 A;  2WVO A;  4NY3 A;  3Q7G A;  1VYK A;  2A6E F;  4LLE A;  3UGP A;  2W4M A;  4RDA A;  2NUP A;  1TWH A;  4K0D A;  5FCL A;  2O9X A;  2Y3G A;  2A6H F;  2CGE A;  3HTK C;  2M4E A;  2QTV A;  2IOQ A;  3UMK A;  1D1A A;  2J7P A;  4RBN A;  4ULW A;  5KYW A;  2WZG A;  3EHN A;  2L9J A;  3SZR A;  5KYN A;  3N24 A;  3EGX B;  3KMI A;  3LJB A;  3EZI A;  4KNV A;  4GYT A;  4CIH A;  3B0U X;  3RYL A;  1MNE A;  4QI2 A;  2A69 F;  3K1I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...