4HFUH

Crystal structure of fab 8m2 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
VQLVESGADMKPPGSSVKVPCKASGDTFSSYTITWVRQAPGQGLEWMGGITPIFGSPNYAQRFQDRVIITADESTSTAYMEVSNLRSEDTAVYFCARVGGEWGSGRYYLDHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
publication title A recurring motif for antibody recognition of the receptor-binding site of influenza hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
total genus 41
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hfuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hfuH01
3WFZA 1U8HA 5HHPB 1BWWA 4ZSOE 4Y1AA 5EZLB 3O3AA 4PR5A 1TQCB 1WLHA 3OJDB 3B6SB 4WWKC 4MD5B 1LEKB 2YPLE 3T8XA 5EUOA 4PP1D 4JM2F 4L8SA 2ILLA 4ZO6A 5I1HH 5DI8A 4OUUA 5I76A 4XWOC 1IQDB 5EWIL 3DX8A 4KAQH 4U6VL 4WHTB 3KYMB 5FUCC 4X99B 1FNGA 2V5MA 4CU7A 5I1DA 3B9KD 2MCPH 3TBVA 1T4KB 1MCNA 1A4JB 1T3FA 4OUOA 4QT5A 4Z7NF 4M7LL 2HT4D 4X6DB 5F7LB 1R0AL 4EKXA 4LCIL 5HI3D 2VERN 4PB0H 3VXPB 5F3HA 1MFDL 4WEUD 3MLVL 4HUMB 5H94B 4GLRI 1HHKA 4HXBH 5EULV 2BOBB 4AEIL 1CWVA 1CS6A 1UQSA 1Q9WA 1U8IA 1JWSA 1YECH 3KS0J 2BOCB 1AO7B 2NXYB 5CZVH 4G7VH 3KDMA 3AROA 2A9ML 5I17B 3U79A 1MFEL 4DOHE 2A6IB 3ROLB 4G9FE 4OF0A 3GSNL 2K3TA 3K2UL 5LBSL 4L3EE 1EMTL 1FGNL 3NCJL 1Z0MA 4R7NA 2NY7L 3HE7A 4LFHG 2X4PB 3FQNA 1QBML 4NDMA 4OIIH 5E08H 4EOWH 2OJEA 2CDFA 3PP4H 3IKCB 5GXBB 3OKNA 2Q3AA 2Y4SA 3MV8D 4QYOB 2OL3L 1Q0YH 1FNEB 3PG2A 3IDJB 4NO2B 5DFVC 5C0FB 4GXVH 1B0GB 4TUKH 5FYLL 1ZWIB 5KS9F 3RP1A 1KLGA 3BPLB 4U0RC 2AXHA 1CN4A 2PW1B 4JFYA 1IAOB 4QTHA 4JM2C 5ESAB 3C09C 1MWAA 1N8ZA 2IQ9L 4MXWL 5GRXG 2P42B 4WCYH 4TTGA 4PJ7F 5DC4B 1JWUA 2AQ3A 5JORB 3FB8A 2ICWA 5E03A 4QHLB 5FKPB 4Y8DC 5LCVH 1F11B 5FO9B 3GDBA 3AS0A 3I2CL 2X4OB 4GRLB 5D7KD 4UILH 3LIZH 4Y19D 3JV4B 3V52H 1IGYB 5B38A 3NAAH 2HG5A 4JGMA 3RZCB 1W0VB 1DQDH 2B4CC 2ZKHH 4F7PB 1JJUA 5HYSA 4AK1A 2VIRA 1I3UA 4H88L 1BFVH 1WJ3A 1QLEH 1RU9L 5JNYB 5CFHA 3BGAA 3HB3C 5GRVK 2AK4E 1GZPB 2ITCA 5ADPL 3K8KA 2B1HH 1UJ3C 4D9RD 4Q58C 1G9MH 5HDQL 1A1OA 1IGFL 3L5XL 2VLLB 3FN0L 4JQXC 2V17L 5JIHA 2V2TB 4K3HA 3CH1A 2EDWA 3UC0H 1S7VA 5KS9E 4M1GL 5D96B 2PKDA 1A6AB 1HCVA 1QO3B 3T77B 1GZQA 4KTEL 4MAUL 2P8PA 3V6ZA 1R3LA 2WUCL 1FVEB 4GRMA 1RUML 3HC4L 2EE9A 3GI9L 1JWMB 5C2UB 3IDXL 4HWEL 2AEWA 4M61B 3K2MC 1UKQA 1H3PH 5IMOB 1NDMA 1RMFL 4PJ7A 1A6TB 1NMCC 1K2DA 4X9FA 1JK8B 1ZLWH 4HGWB 4J6RH 5DEZA 4YDKH 5SX4H 1KEGL 5C6PB 4JJ5B 5CD5C 4PJAF 4ACPA 1SYVB 2XQYK 1JIBA 3NMEA 1KACB 2G75A 5HY9B 5DWUL 2BHYA 2EXWD 4PJEF 4X9BA 5MHSE 3QXUA 2JKXA 1CDCA 5TF1H 4AMKL 1QSFE 3W0WA 3U36A 5JW4N 1P2CB 2P7TB 1AGFA 2VDML 2D7QA 4XPAH 5FGCB 1PG7H 4Z7QF 5DSCA 5E6ZA 5ISZB 5TE6L 5ICXB 3FTGA 3QI9B 1ZA6B 3QCVH 3UYRL 2ESVB 1XF5B 1R24B 1CDJA 4XBEH 5DYOA 1P4LA 4D9LL 3QFDA 1FGVH 4IRJC 2GEEA 1EHLH 3O9WD 2CO6B 5GRVL 4D0CA 4Q97A 3CFCH 3MODL 4L4TA 4X6EB 4RA3A 1I8MB 4O00A 1ZSDA 4NQDD 5L2KE 4K8RL 3BJLA 4NKOB 4YE4H 2PO6A 4HH8A 1E4WL 1KJ2H 3MJ9L 5F70A 1E27B 5IV2A 5GJTL 2KBGA 3EO9H 2XQBL 4F7TA 4M03A 3IXTB 3KPNB 4HKZB 4JPVL 1VFOA 1MCSA 1F3JB 3T3MF 3TZVD 4PJAE 3UP1A 1PYWB 4IM8A 1JL8A 2VR9A 4MD0A 3L95B 4Q0XL 4S11A 1DLFL 3T2NH 4J1UA 5C86A 4PJAA 4YR6B 4JY5H 1QSEA 2I9LA 3L3KA 2CLVA 1VERA 5IB4A 1V05A 1FZJB 3R0MA 4HJGB 4PJEA 5E8DH 2FJGA 3MROA 3P9LA 3N50A 4JO1H 4Z7QE 4RFNC 1A1MA 5J1AB 1IT9L 1IKNC 4R97B 4Y4FD 4JKPL 3CGTA 3QDMB 1EBPA 1IM3B 5IB2B 4P4RA 1MHPH 1DR9A 4HJ0D 2DF3A 3RVVD 1NUDA 3UBXG 1J0JA 3QJFA 2AEPL 3KG5A 5A40E 5I16B 4Z8FL 3MCKA 1I3VA 1TETL 2LU7A 4MSWA 3EOBA 2YKLL 3DLQR 2IGFH 3ARTA 2IPKA 1NGZB 5T1LD 2NLJA 3R1GH 2OTPA 1OP5H 4MA3B 4E0RA 5JHDD 1W8NA 3VXMD 4HUVB 1CGYA 4RCAA 2LQRA 1HK6A 3JV6A 3V7AE 4QF1A 2C3VB 2YHGA 3DTXA 4R96B 5ILTH 5EIIA 3T3ME 5C08E 4P2QD 3GI8L 3O8XD 4M00A 3DUUB 1BM3L 3K4DA 1ND0B 1LE9A 4ZNEA 2GSIA 1U8OB 4HUNB 4ODTH 5ITBH 4WFGD 3V0VB 3FONA 5C08A 5IHBA 3C2AH 5HYJE 2DQUL 2LVCA 2PR4L 1IFHL 5TDNA 5A16A 4HK3J 3O3DB 4XBPA 5ACZB 1Z9LA 4GW4B 4IDLA 4XNUL 4WNQB 4XZUA 1TCMA 3C6SB 4FABH 1DUYA 1FH5L 4OF8A 1NAKH 2X9WA 1GGCH 3OTTA 4G5ZH 4CUCA 1KB5H 1S9WA 3HZYB 4O2CA 3QUYD 5CZKA 3FO0L 5E4EC 2UWEF 4CL7A 2CPCA 5DURB 4APQD 2BNQD 1N0XH 3O41A 5F7DB 3UBXI 3WIIL 5TQ2H 1N7MH 1A1NA 1QTYT 4ZAKA 1JZ2A 3DECA 4Z5RB 3D6GA 4HEME 3FQXB 4L9LB 5CINL 2DJSA 2AP2A 3QULB 2EYSB 1JNLH 1KEML 1W0YT 2N7AA 1F5WA 3LHPH 2J8HA 4N0UE 4TVSa 5HXMA 3RY5A 3MLSH 3TT3L 3HI1B 3UROR 4YHYC 3BP5B 4ZOBA 3VW3H 3MJ7B 3WYRA 1WISA 4RGND 1VESA 1A6ZB 4WRLA 4NZTH 3RWJB 3VXUB 1F02I 2V2WB 2FGWH 2XWJB 4GW1A 4PUBL 1A2YB 2DLTA 4KROC 5FV2A 4L9DA 4M8QB 2APBA 4NP4H 2ORBL 4XGZA 2YD6A 4J12A 5DJ2A 3MNZA 4QRPA 1OTTC 3LCYA 3KGRA 3N1PC 1YUHB 4X0KB 1J9CT 3G5XB 3MV7D 4OB5H 2WIIB 1R5WB 3QXDB 3VJ6A 2E9IA 4M7KL 2UWEE 2H2PC 1T0MA 1VEOA 2LABA 5ITFA 5FM5O 5I1KH 5C2BH 4HGKC 1PAMA 2OZ4H 3MA7B 2UWEA 4KH2A 1BVKB 1C1EH 5F8RC 1KPVA 1JV5A 4NCC2 3U7WH 3QIWB 5IIEA 4G43B 1U8MB 2IH3A 3KJ6L 2IG2H 4LHUD 4XPGH 3L5IA 3KXFA 3FT3B 1PLGH 1T66C 2O5ZH 4CVWA 1UWEL 3GHBL 3RKPA 4GAFB 4XNYH 5C6TH 5GS1B 1QRND 4LSPL 5FKAB 5C0BA 4R3SB 3KLAB 4P46C 4ZFGL 3WUZA 2Y72A 5TDPB 5C0GB 5IBUB 1J1XL 3ULUF 3G08A 1V7NL 3QRFM 3GZKA 5J7CC 2XA8H 4G6KH 4WTZG 3WD5L 3RL1B 2HVJB 2EIZA 1ZEAH 4MB3A 1RUQL 1KCRL 4B0MM 5DUPH 3SDYL 4ERSH 3NCCB 4ALAH 3ZHDA 4AYFA 3K81A 3MOAL 4Y16B 4JFFD 3MRCB 1BEYH 1TQBC 1JRHH 5I8CA 1MUJB 2EYTB 4JDVB 1KENL 4K7FA 1N5YL 4IMLB 3TWCL 4ZPVA 4X6CF 4XAKE 4PD4K 5HHVH 4YXKH 3WFEL 4NUJA 3KR3L 3MRIB 1NCWH 1MJUL 4F9LC 3IFOB 3GGWA 1JGUL 1XIWD 1DBKH 1JUFA 4GXUN 2NY4B 2P8MB 4HFUH 3HMXA 4HXAL 4Z0XB 2OTUB 4U1IB 5J6GA 2X9YA 5DZNA 2EYRB 4UU9A 5HVGB 1MWAH 2WBJB 3GMRA 5IVXB 3OX8A 4NQXB 5F44A 4HUWA 3UZEA 5C9JA 5GZOC 3ULUE 1R3IL 2ZNXA 2B4CH 3EDJA 1A6WH 4N1CA 5EOCL 2FSEA 3NFPB 5EIVA 3VFOA 1QBAA 4JRXE 4YGVA 3G6DL 5E8EB 3C5ZA 3S96B 1MJ7H 2VLJD 2MPAL 3MUGB 4PJBB 1X5YA 1NQBA 4JN2A 3TO2A 3IETB 1AR2A 5DJXB 4JRXA 1S7TA 5M95B 3OXRB 1PBYA 3QPQD 1QR1B 4P9HL 1MVFA 3G04A 1NGQL 1GC1H 4OD2B 3ULUC 4TQEL 3MYJA 3X12B 3MFFB 5E8PA 2ED8A 4YLQT 4IHOA 3SE8L 4X6CE 5I75C 1OM3H 3TIDA 4TTDC 4UDUB 4NNYA 3QZWA 2FX7L 5IFJA 4LSQH 5JOPD 5DMJB 1IEHA 1K3IA 3BD3A 3MNVA 4OLVL 1WIPA 2BVTA 4X6CA 5F88A 3BO8B 3RDTC 4EI5A 3S9DB 1CIUA 4G8GE 3RIFF 3PHSA 3SKOB 2QADC 2HFGH 5D8JH 2VSDA 3N1QC 3NFNB 2J5LC 1WZLA 1LO4H 3PXJA 1KCVL 1J1PH 2CUIA 3GBLA 3PJSA 3KVQA 1CT8A 2Y23A 4KKLD 4LAQL 3IVKB 1JPTH 2VLRE 2VDRH 3ARBB 4XAWH 2CDGB 1AFVL 4ZUVB 3D3VB 1HSAA 2X4QB 4QOKD 4QWWC 3OKKB 1YMMB 1AP2B 4F57L 3DUSB 4RMVA 5LKNA 1T2QH 4U05A 3CCHA 4FMKA 4ZXBD 3WKMH 2GTZB 4X6BB 1QBLH 3WUWA 1FYTA 4HS6A 1YEHH 3LKQB 4EI6B 1AXTL 1MCBA 1NLDH 2ADGA 4WO4C 4K55A 5D70L 3P3YA 3UTSA 3DMMB 4XVJH 4O2FA 3QRGH 5FYKE 1U91A 5SWZE 4JZOB 1NL0L 4IRSB 1AHWB 2NX5A 4PP2A 4DGVL 4XB7A 3VWKA 2R0LL 4JPWH 2D0FA 3SE4A 1I1FA 4ODHH 2ZCKH 4XPHH 2HJFA 4Z7VF 1VFAB 3ESUF 2BRQA 3BYYA 2V9RA 2VLMD 4WHYG 3LZFL 1KIQB 3U6RA 1OWRM 2WQ8A 4LLVA 4BZ2L 3F6LA 4M6AA 3VWKC 4EUPB 4UT6H 3N9GL 1AKJA 1T6VN 4N5EC 5DEGB 4NOFA 5J4MA 1MCFA 4WUUA 2UZIH 1RJZA 5D7LD 5FOBA 4Q9QH 4TRPH 3PV7A 2VNCA 3RZWA 5KZCB 4Y4HC 4L4JA 5DQDH 5DMKB 3BEWB 4KC3B 1U3HA 1WITA 4BSWA 3O6FA 3BP7B 1HNFA 4ZD3H 1VGEL 2YXMA 3RWCB 2EDHA 2NNAB 1T21B 3H3KA 2ZPKH 4RGOH 5EBLB 5IQ9A 3SCMD 4PGEA 4FFYH 1NCAH 1HQRA 3IFLH 3O6FC 3VCLB 3Q2CA 3QB7C 1MRFH 3EYOB 5JMRA 2B1AH 3C6LB 3V4PH 5ADOH 5L6YH 2CRZA 2HFFB 1I8LA 1G0YR 4M6NL 3SKJL 4LPCA 5EBWB 4I48A 4P48A 4Z7VE 2NY1D 5I6XC 3P73B 3BPNC 4P4KD 2AI0H 4A2MA 4DKFH 5LVEA 5FF6B 1KJVA 4P57A 3L5HA 2OP4H 4PRHE 5HI4C 1MCOL 4KGJA 2MCG1 3MGTB 5DMIH 5BRZB 2IFFH 1S9VA 4KFZC 1CFTA 4WFED 4PJ5B 4NC1E 1SJVA 1ZV5A 1I4FA 3WIFB 2APWA 5SWQB 4S1RH 5C0AE 4KRLB 5B39A 5CGYC 1DTUA 2A6JB 2VRAA 4PJ8A 4TOYL 2HLAA 4HBQA 1VSCA 2GJ6E 2WP3T 3LH2L 1H5BA 1FO0B 3BKMH 1FVDA 5C0AA 3T1WA 4LVHB 2J6EH 3V4VL 5EU7E 3DYOA 3DVNA 4LLQB 1W72A 5KSAB 4POZC 3UTTD 5IFHH 1ZA3B 4P5KB 4NC1C 3JTTA 3TT1L 1A3LH 3IAQA 5B3JF 3BRDA 1A6PA 1CXHA 1CLYL 5CEZE 1FL6A 5DMGC 5BOZG 5I1EH 3STZB 2E6QA 1G6RB 2CDEB 3X3GL 4GG8A 1NAMH 1UXWB 5I74C 4S1QH 3R8QA 1RD6A 1J88A 1XR8A 3ZYJA 4NNXA 1TVBB 5EU7C 2O5XH 4PJGB 5DS8B 3TBTA 3TCLB 1JGLH 5FOJA 1I75A 4ODXB 3GMPA 3BZFA 4N9GB 1N2RA 2YRZA 3QQ4A 1OD7A 2DMBA 3VFWA 1WIUA 5I66A 5KOMC 1NCDH 1T1YB 4L8DB 3MFGB 1LDPL 1HXYB 4PJXB 4JFQA 5T3XE 1KB9J 43C9B 1RZFH 3BEVA 3ILQD 1FNHA 4PG2A 1CD0A 1VFMA 4KRNA 3S3PA 5TDOA 4Z77A 5JUEH 4YH6A 4PGCA 4YFLI 3VGAC 1BF2A 2W9EL 4QXGL 3D85A 1FN4B 4N0CC 1CXIA 3HI5L 1OARL 2A6DA 7FABH 3ARFA 3BUYB 2B0SH 2ZG2A 4DAGL 1NKRA 5B3JE 2NY0C 3WJJA 3J7HA 4M62H 2P5ED 4FQLL 3FB7B 1EEYB 2Q8BH 3SGJC 5B8CB 2ENSA 4JDTL 3ARFC 2ERJB 1NBQA 4PREA 1QZ1A 2DQDL 3WFHB 5DJYB 3WJJC 4M5YL 4HUKB 2P5WD 2NY6D 2A1WL 2VOTA 3LEVL 2JJTA 4S0TD 4YX2H 5EO0B 3GMOB 4P2RA 1BQHA 1YEIL 1CGTA 3ZZ1A 3HPJA 2IMNA 1NCBH 2X05A 4HG4K 4HC1L 5HHOD 1W0WA 3GM0A 5E94A 4R8WL 3WFDH 5SWSD 5IR1B 4MNQB 1BD2D 3TH3T 5I19H 3ELAT 1KCSH 1OW0A 3BDXA 4OZHB 1S7RA 4G6MH 2VQUA 2PTUA 12E8L 3S36X 4RAVA 1UA6H 3T0XA 4NN7C 1D3CA 1HHJB 4LQFL 1T1XA 5I8OH 4YDVB 4F7CB 5EO1B 1L4IA 3TF7C 1FORH 3DHJA 3PV6B 3PWUA 2HKFH 3OHXB 1I9EA 3QO1B 1INEL 3ZKSD 3TBYA 2P8LB 2VR5A 4NQEA 3WHE1 2EDXA 3L7EB 2P24B 4M5ZL 5ECJE 2R69H 4PB9L 4N8VA 1OB1A 3QWRD 3CVHB 1EZVX 2NXZD 5MERA 3KHOA 4F15B 4S1DC 3F58L 1TIUA 3L3GB 4O5LL 3SDAD 4PJDB 5DD3L 3MXWL 4QRRA 1ZGLM 1TITA 5LGHL 4L8CA 3MCLH 1I7ZA 4K23L 2FBJL 3CLEH 4M4PA 5F7MC 1IGTA 2KPNA 4MAYD 3RNQB 3HMXL 2ZWLT 1A6VL 2IJ0C 4PTUB 5BCAA 1OAZL 5KN5B 32C2A 3NPZB 1IM9A 4M4RA 3SKNA 1IAMA 3FOMA 3Q6GH 5JQHC 3O6ML 5BV7C 4RZCA 4ZPTA 1Q9LA 2XWTA 2BVEA 4WI6A 2DI8A 3UDWC 4JRYA 3QQ9D 3PHQA 1KCKA 5IBUG 3DXAE 3CX5K 3GRWH 5H8DA 2OI9C 4H1LH 4ODSL 3T0ED 5HYQB 4NQCA 1RZ7H 2G9HA 3BZEA 2VDKL 3GFUA 3AREA 1T5XA 1VKXB 4OLZH 1KIPA 3SQOH 5T3ZL 1F4XL 2R2BB 3CLFH 3V8CA 1DFBL 3FRUB 1Z9OA 3EOTH 4U1SB 1CICD 5K9OA 4KKAC 5D9SA 1DANT 3ZKND 4R4BA 3ULUH 5FHAL 4MD4B 4FQ1L 1UADC 2YN3A 3VWJB 2C3HA 3VD3A 1A5FH 1LO2L 1ZANL 4XNZC 1P5VA 1JZ5A 3EGSB 4X5WA 2Y5EA 4XNQB 3ECBA 1CE1L 2IH1A 4RAUA 1XH3B 5TE7H 2J88L 5F89B 2XTJB 1FQ9C 3MMEA 4MZ3A 3DGGB 4MXQD 2YD8A 1FG2B 5KOVC 1I9IH 3QO0A 1EJ6A 4Y5XB 5DT1L 5KVFL 2PYEE 4DJMA 1QSVA 5JLZB 1FG9C 1AR1C 2E6JA 3OV6A 5E8OA 5HSFA 3MLRH 5HGBA 5IQ7H 3MR9B 4KJQC 3JWOC 3VGFA 1I3GL 3WSQH 3DVGB 3EFDH 4J3OC 1YN6A 2WUBH 1IJ9A 3VFPA 3EDDA 3M8OL 5AEAA 4I3SH 4KK9D 4P5TA 4FN0A 1HOCB 1KNOB 3TESA 5GSRB 3E2HB 3P0VH 1BIIA 2C5DC 5D1XD 2Q86A 4WHYH 1YEGL 5K9KB 3V5KA 2HH0H 4LF3A 4PJIB 4M1CC 3MRQB 3C8KA 3M17A 1S7XA 1MCQA 5DJAB 5LJYH 1EBAA 4P5TC 3MZGB 1JI1A 4U4BA 4AT6A 3GSXA 1A02N 4L4VE 4WU5A 4FFWC 3RTQA 3PQYD 4P3CH 5CSZB 5KVDH 2CK0H 3BRFA 1RK0B 3D18A 1NLBL 5F93C 1QNZL 4D8PB 4L4VA 3DX6A 3P0GB 5I8KL 5E5MB 3GMNA 3RWEB 3DRTA 1EAPA 5C09D 3HFMH 5IUSA 1U3YA 1U3JA 1V3KA 1U9KA 1BMGA 5EZOH 1K4DB 1PKOA 5DD1H 5FYKH 3P4LA 1IAKB 3QEQD 4AG4L 3JBG7 1INDH 3U46A 3AC0A 5DRXB 4S2SB 4C56B 1KCLA 4XP1L 4YNYA 4TVPL 4JB9L 4HPOH 3P4OA 4LCWA 1JYNA 3I02A 4R4FL 1IKFH 1CFSB 1YDPA 5DD0L 2J4WL 4LPYA 5EA0H 4CW1B 5HGDB 1A21A 1OGAB 2EIDA 5ID0A 1BBDL 1KUMA 3W2DH 3MACL 4H5SA 1AD9A 4PJ9A 1ED3A 1HKFA 3H42L 5JOFA 3TBSA 3ZLQC 4MXVF 3TJHD 3FJTA 3BQUC 4FQ2H 3UPRB 5K9JL 3G6JF 2A83A 4CMHC 4ODVL 3EYVB 1Z5LB 4PJ9C 4JFDA 5FO7A 5LWYH 1GSMA 1C16A 1VGKB 2A6KA 4NZRL 3MC0A 1TCRB 3OKDA 5DDHA 1G7MA 4EUPG 3RGVC 4OLEA 5KTEL 4WFHD 3MRPA 4EN3D 2EH8L 1QFWH 4WI5A 4B7LA 5LAXA 4AEHL 3MLYH 4UMGA 4L1DA 3FO2A 4QCIB 2P46B 1XR9A 1RUKL 2F53D 1C7SA 3X11B 5J6HB 2WZPD 1W72L 4LU5L 1X5AA 3S7GA 4OTXH 4ELKA 3PIQA 2Z8SA 4GS7C 3QFJB 5FYLD 3VGHA 2PXYB 3QSKB 1R3JB 4TPRH 3IAGC 4CU8A 4M9PA 3QEGL 4MXVE 4LKCA 4BELD 2A0LC 1IGIH 2F58H 4FRWA 4BH7A 3CXHK 3V79C 3VXSB 1T89A 5IHLB 3WO4B 1AE6H 2X40A 3F62A 4FG6C 3GSRA 4WCYL 1RIVL 2EDJA 4M43H 1NFDF 2VAAA 4IJ3B 2VSCA 3G6JA 1LP9B 3VFMB 5INCB 4DGYL 5GRYA 1T89C 5AAMA 4LLAA 3L9RA 2R0ZL 5CEZH 5E6IC 4HAFA 3L7FB 4NRZB 4MB4A 1DQDL 4N5UA 4IS6A 1K4CB 2ARJB 2QSVA 1CLOH 2Z92B 3NCYP 1U8PB 3QUZD 3B43A 3STLA 2ZUTA 3T2PA 1MCPH 1YMHB 3VA2C 3OSKA 4MJIB 5ESVB 4LSVH 2JB6A 3FB6B 5C0CA 3CZJA 5TGBA 4MQ7B 2FEEL 3EDKA 2VN4A 4GMSL 5D5MB 3NVQA 2IPTL 4Y5YB 5IMKB 3WNKA 5BO1L 3LKPB 2VWEC 5J9PB 3N1MC 5L7XH 4ZS7H 2F54E 5T3XH 4IOFC 3IDIB 3MRNB 1O0VA 4WEBL 1TJHL 1JHLL 4YO0A 2QR0B 4QTIH 4QXWA 3OB8A 1GGBL 3OAZK 5FYKU 5FGSA 4QRTA 5BQ7A 4HWUA 1CLZH 2YUXA 5FGBC 3OBAA 3HCVB 3ARDD 4ZUUA 1BZ9B 1UVQA 2VABA 1N6QL 3EZ8A 5IHZB 5F72S 3HMWL 1NFDA 4LEOB 2R56H 1ZHNA 4KY1L 3RUGB 1J0KA 3Q6FB 4HPYL 2J7LA 5F6IB 4HD9A 4OD3H 5DEFA 3MTRA 1U58A 4JAMB 4NM4L 2ATPA 4C54A 5IWLC 5IJKA 1SJHB 2YEZA 1EK3A 1FBIH 4FQJH 1CXKA 4HIJB 3MLPA 2H32B 1HYSD 5DQ9B 1TTGA 3VI4F 1MAKA 3KPPA 2MQ0A 4AM0B 1XZ0A 4KUZH 5DJ0A 5TH2A 3AS3A 1FZOB 5DVNA 4RIRA 4PY8J 3VRIA 2C4XA 5MI0B 2YK1H 3CH8A 3CPLA 5CIPA 4B50A 3BH8B 5CP3H 2EKSB 1CFVH 1P84K 4FNLH 1DL7H 5JQ6L 3HG1A 3SJVA 4IIQB 3PWPD 1HEZA 3PGDB 4K8RD 3U9UB 3DI2B 1FAIH 4FQXC 3WNLA 2OR9L 2OR7A 1ZHBB 2OTWA 2PN5A 1KJ2L 1FNFA 1YNTB 4KTDL 2E7MA 4MX7A 5HHQB 1NBZB 3HKFA 3MV11 4EVNB 4O4YH 3VMPA 4YDIH 1UWGL 3GSVB 4PP1C 3IKKA 1Q94A 3WE6A 4HWBA 4TUJB 4PRNB 4HMCA 3W5MA 3DSNA 5I1LB 2BY2A 3I6KA 2IADB 4OCSL 5DLMH 4EXPX 4I4WB 3O81A 1DVFD 3T2NL 1II4E 3UJTL 3H9SD 3VI4E 1FFOB 4HCRA 3UBXA 3MO1B 1DE4B 4ZOCA 5F7HA 4OGXL 1S3KH 3F8UB 5ALCH 1HH6B 5BV7H 1AGCA 3QQ3B 3B9KC 3ES6A 4IOIA 5JPNB 3JSSA 5DHVB 1J1OH 1NDGB 1B4JH 4ZUSA 2P47B 4NO5B 1XT5A 3F7VA 3RGHA 1NCCH 5L0QB 2HT4C 3CZFA 4XC1H 4YHKH 3O4OB 1CU4L 1BQLL 5HI3C 1QHOA 3TGXA 1ZTXH 4ISVB 1N59B 4PYHA 2W92A 3RAJH 1AJ7L 4X7EC 1K8DB 4YHNA 3SGEI 2GITB 1BLNA 3REWA 4ONHA 3U4BL 1Q0XH 1A7BA 3MV8E 3TYGH 5KSBF 3LMJH 1OTSD 1D5ZB 2W9LA 3QIUD 5I1GL 2VO5A 2GTWA 4ZQKB 3NGBB 3GKWL 4IRZL 5CEYA 1Q9OA 1X4YA 1OPGL 3IXAB 4Z7UB 4MCYA 1F13A 4OGAD 5HHNB 8FABB 4TULL 1KYOK 5KSUB 4FTVD 4MA1C 4XCFL 4I0PD 3BWAB 2XKSA 2XIDA 5L88L 4WHDA 5ESQB 1FNSL 2EE2A 1Y18A 5FAAA 5ITBL 4XCNB 2Q76A 4NO3B 2DYPD 2V7HB 3KPRA 4P3DA 5C07A 1T03H 2AJVL 4YWGH 2DDQH 1OD9A 3KYNA 3QG7H 5D7KE 5DXWA 2JF1A 4NPYA 1XGPA 3QR2A 1P1ZB 4Y19E 5DJ6B 3FQWB 4HS8L 4PJCB 2FIKB 2FX8L 4R26H 1SBSH 3MOQA 1P6FA 3JWOH 1TZIA 2ARJQ 1H15A 2GJJA 2D31A 4KRPC 4DVBB 3TNMA 4LGRB 5J11C 3V5HA 1JBJA 4XRCA 2XN9B 1TZGL 4G3YL 3KWWA 3UYOD 4YHML 4X80H 5MEPB 1KPRA 3MBED 3AY4A 1KIRB 4QY8B 2BVQB 5IVNA 4KJWC 3PGCB 4D9RE 1JNNH 3GSWB 2R29H 5AUMB 4JFEA 6CGTA 3PDOB 3QH3B 5KSBE 2JTDA 2NMSA 2W65A 4ZUWA 2C4FT 3BDYL 1I7TA 3B3IB 1GPOH 1QLRA 4GLRH 4GUPA 3ZKMD 4LK4A 3MPCA 4LRIA 1QEWB 1BOYA 2AJUH 2JB5H 4NM8H 2XFXA 1V3JA 5JDSA 3F12A 4GAGH 5I9QC 3FFCD 5DQJA 3UTZB 4Q6IB 5JDJA 1I7RB 3RU8L 4WWKD 1YQVH 4ODUB 4NKDB 1LO0L 1MJJA 1M05B 5IK3A 5JOEA 2KZ1B 2SEBB 4U6YB 2VXVH 4Y1AD 4GBXB 4XWOD 5KVMC 5H2BA 2DLGA 1S9YB 1CFBA 1MFCH 4XMKH 4I5BB 1A7OH 5DJ8B 3RNKB 1DQTA 5GRZA 1UEMA 1UM4L 4AIZB 3I50L 3E3QE 4MA7L 1SY6H 4XTRD 1XGRB 2CMRL 5DF0A 3OKMA 2NW2B 3O0RH 5EU6D 5JIPA 3U1SH 1LO5A 3UEZA 4DK3A 4MNGB 4TSAL 4XNXL 3T0VA 5FM5M 3K80A 1S5HA 4P2OA 3QXWA 2YUVA 4C83B 2ADFL 4OAWA 3CUPA 3E3QC 3AB0C 1S5IL 3BT2H 5IESL 2EXWC 1CL7I 1NANI 4QRQA 1ADQA 4F37K 1ZGLP 3W5NA 4TNVF 3U4EB 1G7IA 2CXGA 3KPOA 1T22B 1ZGLB 2XOTA 5I1CH 4NO0B 5EZLA 1RZJL 1KXTB 2PTTB 4HV8B 3O3EB 4NQDE 3SDDB 1NGYB 3PWLA 1EGJH 4WTZA 3OJDA 4RQQB 1P53A 3TN0D 4NJ9L 1EFQA 4LMQI 3NIDE 4MD5A 1LEKA 3I3EA 4V2BA 3B9AA 1F8TL 4QHMB 2N7BA 3WEXB 3U0PA 4FZEH 2XA8L 3VXNB 4WHTA 3KYMA 4X99A 3HE7D 2E7BA 3WIHA 1CCZA 3NPSB 1M4KA 5HBBA 1HXMB 15C8H 4P2YA 4JKLA 2AJXL 3DV4B 2GSGA 4OI7A 2IQAB 3L3OB 4Z78B 1T4KA 3ARGB 1A4JA 2AKRB 1QSZA 5D1ZB 1BEYL 2EDBA 4AL8H 4X6DA 3LD8C 4R2GD 3MX0A 4FXGB 3TZVC 4HJJH 3VXPA 1HDMB 3PNWB 5BOPA 3IFNH 2QQKH 4WU7B 1PEWA 4LSTL 3TFKD 1Z3GL 5H94A 4P4KB 2BOBA 1JZ7A 5EOTB 4NJAL 1RIHL 2DTML 2Y36H 2Y5TB 4TNWK 3QYCA 4I1NB 4DKEH 2GUOB 4AEFA 5HGHA 1BZ7B 5IVZB 4MNHB 1FHGA 5DD6B 1CK0L 4OZIB 3OL2A 3CDCA 3CK0H 2A6IA 3OGOE 2EDNA 3Q5TA 3ROLA 1YJDC 4UUJB 4Y4FC 2AS5M 2WINB 5JHDE 4NQSB 2DMKA 2X4PA 4HJ0C 3RVVC 4LBEB 3C60B 3IKCA 5MENB 3GEWB 3TPUB 2ZJSL 3QUMB 4P2QE 3VXMA 4QYOA 3VH8A 4GG6B 2JIXB 3HNSL 1M7DB 4DEPC 1FNEA 1M71A 3ZO0A 4RBPK 5C0FA 4WFGE 3DURB 1B0GA 5BJTB 2XYCA 3N1FC 1RIUH 1ZLUK 5D7IF 1J0ZA 5CILL 2CGRH 4JFHD 1IAOA 5IMMA 5ESAA 1QQDA 4IDJH 35C8H 4MJIE 5HJ3B 4I2XE 5KVEL 5IW1B 1R5VA 2BC4B 2M2DA 1DBML 4H0IA 4O02H 2OBGA 1JE6A 1P4IL 4QHLA 4JR9H 4ONGH 5FKPA 4K3JH 5BS0B 1F11A 4I2XA 2Q6WB 2XZQH 3QDGB 4GRLA 4EEEA 5CD5D 1LMKA 4PLNC 3JV4A 1IGYA 1V3LA 1RHHB 3RZCA 4F7PA 1A7PL 2BK8A 3QNYA 4FOMA 2I9TB 2XG5A 5EC1B 1UFUA 2BNQE 5EOCJ 5IT2H 2P49B 1WSST 5ACMA 3RPKA 1JF1B 1GZPA 5CHNB 1SEQH 3QCTH 1MRCH 2FX9H 2LAAA 2XACC 1GAFH 4XAWL 2VLLA 3W0WD 4DN4H 3QUYC 1MPAH 1PKQE 2V2XB 5E5UB 1A7NH 1UB6B 4XPBH 2V2TA 4APQC 1BQSA 2VQ1B 1BFOB 4HF5H 1KN2H 4RGNE 3IDGB 2FHFA 5D7IE 1A7QL 3H7LA 1KJ3L 1QO3A 3T77A 3SGDI 1F90H 3O3UN 4PRPB 3WFCH 1TJIL 1U6AH 3RIAK 3GJFH 4L3CB 1JWMA 1GOFA 4WGWB 5D7IA 4YFLF 4LVNB 2OQJB 3K46A 4ELMB 2ZUUA 3MLZH 1RPQA 4KZDH 1S8DB 3QRGL 2BX5A 1IEAB 2AK1L 5GISL 4M6OL 3V95A 1A6TA 4L4TD 43CAB 4HGWA 5CZXD 1WTLA 3MV7E 4YDLC 2PO6D 4RGNC 1QKZL 1QP1A 4JJ5A 1IC7L 5D93B 2OSLB 1ULVA 4EJ1C 1YEJH 1SYVA 3BVNA 3VFTA 5AG8A 1RUPL 4HX1B 1QVOA 5HY9A 3DYPA 5T5NF 4G6JH 1GJIA 4IEFB 1RV6X 3PL6D 2F8XC 3FCTA 2BNRD 5ANMB 5GGVH 5DRNB 1P2CA 2AGJH 1FZMB 3JTSB 4HWBL 5T1DH 3QHFL 4X8XA 4XP6L 5GIRB 5ISZA 1GCFA 1MFAH 5ICXA 3MV9B 1QSED 1ZA6A 3QI9A 2MWCA 3TVMB 2ESVA 1XF5A 1R24A 4RISH 1QRNE 5AG9A 2LV4A 4LPXA 4OCYH 4X5XB 3RVUD 3K1KC 1O7VA 1F4YH 5A43C 5DVKA 4ZOAA 1PY9A 1CXEA 4BKLB 1B2WL 1LNUB 1I8MA 1PD6A 3ISWA 1RZGB 5MP6L 3ZL4H 4OV5B 3ZKQD 4HCRH 3BFOA 2ZUWA 1G9NL 2XZCL 5FK9B 3KPSB 1E27A 3TV3H 5IB3B 3ZE1F 5CP7A 2R4SL 3TJEL 3IXTA 3KPNA 4HQQH 4D9QD 2LTQB 4JCLA 4IOSD 4JZNB 1F3JA 3VGEA 3IJHA 1PYWA 4JFFE 4UIMB 4OGYL 4R7DB 4ONOA 1WEJL 4LHUG 5E9DB 1JGVH 4OD1H 1LK3L 5IEKB 1YEDA 4U1JA 5A2FA 4YR6A 5D2LB 2WANA 4UAOB 3LQAH 2DBLL 1FZJA 4HJGA 4S1SL 5AZEL 4JLRB 1G1YA 4ESKA 3O4LB 4FXKA 5DMYA 5J1AA 3MCG1 4RGMC 1M7XA 1FSKB 2AXJA 2NTFB 2YN5A 1IM3A 5FDWB 4F9PA 3S3SA 4BUGA 5D2NE 1KXQE 2EEAA 3DI3B 3GSOB 1U8LB 4JY6B 4YHZH 4JFOA 5F7KC 2HN7B 1D6EB 5I16A 3GB7B 3QUXA 5CKAA 4HT1H 2VLKB 1KN4H 1NGZA 2YRPA 1XIWC 2C1PB 1ZLSH 3LY6A 4MA3A 3TO4D 4HUVA 3ZE1E 5D2NC 5IM7B 2HLFD 3QUXC 4PGZA 1ZK9A 1TXKA 2C3VA 2VLJE 4R96A 4NFBA 4LIQL 3BP4B 1IVLA 5DZLA 3CFJB 4JQIH 4ZAKD 3DUUA 3HAEB 1ND0A 5EU5B 5AYUL 5C0EB 1U8OA 1I1AD 3P4NB 5D72H 2DM7A 4YGAB 1P7QD 4P9MH 1ZVSB 1OSPH 5E5RB 3UMTA 3HZKB 3RHWF 3B4NA 4KROD 3O3DA 5ACZA 5DR5H 4D2NA 2R1XB 4GW4A 5E00B 5C0ND 5JOPE 1WVZA 3K8MA 1TJGH 3C6SA 3QAZC 1DBAL 1YYML 3QPQC 4WTWA 3S36H 1LO3L 1CZ8H 2Z31B 5DRZB 1T04B 1CR9H 3HZYA 1CBVL 1TNNA 4QRPD 1UM5L 3OKLB 5DRWA 5H37H 4K3EL 1GGTA 5F7DA 4QOKE 5F21B 2GK2A 1S7UB 2UUDH 4NKMA 4WDIB 3D2UB 4R4ND 4Z5RA 4L9LA 3FQXA 4U1MB 4A6YB 1NUFA 4YHLL 4XT1C 3QULA 4OCXL 3VE0A 2EYSA 1G9EA 1A6UH 4ZFOA 4OCWL 3OZ9H 3QWOB 3DSFL 1DQMH 1ACYL 5CJOH 3KJ4C 3KXFD 3BP5A 1FDLL 1JNHA 4DZ8B 3P30L 2VDOH 3RWJA 3VXUA 5MEOB 3NOIA 1AQDB 2V2WA 3EOAB 4ZXBC 2GCYA 2XWJA 1A2YA 4YEFA 2AEQH 2VLME 5C0BD 4M8QA 4RFOH 3L3DB 2VKWA 5GGTH 2GY5A 4Y2DB 1RZIB 3BUTA 5HHMD 1A9BB 3OR7B 1ADQH 4JHBA 1LDSA 4UTAH 1YUHA 4X0KA 2Y06L 4HZLB 2ZG3A 1F00I 3R0NA 1IC5H 2WIIA 1TVDA 4U7MA 5D7LE 1R5WA 2R23B 5FV1L 2NY3D 4PGBB 1DEEB 5DJDB 1C8PA 2BSSB 4YHOL 2L7UA 1EEZB 3SQBA 3MA7A 1EJOH 3QIWA 1V5JA 4G8IB 4G43A 3O2DA 4OCRH 3T4AA 4DCQB 5I1JH 3FT3A 3WIHH 4PG9B 5FYJU 1NFIB 4DTGL 4NBXB 1YNLL 1NSNH 3BHBB 4UT9L 2QV2A 2AABL 4KRMB 5J8OA 1YJDL 5GS1A 3HRPA 1YY8A 4R3SA 5F7NC 5AYQA 3KLAA 1PDKA 4UI2A 4V1DB 5TDPA 5C0GA 1BFSA 1XGUA 4NOBA 2NY5L 3I75B 3QXAB 5JIKA 5LGJB 4RDQF 5GS1C 2P48B 3DX9B 1KSRA 1VACB 2DMCA 3RL1A 3ULVL 2HVJA 5F9OL 3VFSB 5FXCH 4WW2F 4WFEE 1MF2H 1ONQB 3KYKL 4BSJA 5C1MB 5BMFL 2A77H 4H8WC 5E2VL 1CFNB 3MRGB 4XBGB 4Y16A 2Y7QA 3MRCA 3HS0A 4KJPD 1A7RH 3MRDB 1MUJA 3C5ZD 2EYTA 2NY1C 4OLYH 4G42A 4JDVA 5T3ZD 1X7QB 4IMLA 3CXDH 1ZXQA 1H8NA 4NN6B 4NNPH 1A64A 4HDIB 3MRIA 5I2IA 4GG6E 4P23B 2UZYB 4PRIB 3OAUL 3UTTE 4CAGA 2AV7B 3IFOA 1QACA 3RWIB 4XWGH 1FIGL 2WW8A 1AQKH 1MVUB 2P8MA 5D1QD 4Z0XA 1NBVH 2OTUA 5HD8D 1A5FL 4U1IA 4G8EB 1A0QL 2E9BA 4EI5D 2EYRA 4J23A 1YPZF 1KCUL 5FCUH 5IVXA 4CRPA 1VDGA 2NY4C 4YC2C 3V0WL 2CKBA 3MRBB 2Z35A 5IFAH 4LSRH 3NFPA 4KQ3L 5FIEA 4J3TA 1MFBL 1L6XA 4KU1A 1AI1L 5CMAB 3H8NA 2QBWA 5E8EA 3S96A 4PJBA 3AU1A 3IETA 5DJXA 3OXRA 4J2XA 2H6PB 2YD2A 1QR1A 1PZ5A 1T0PB 3CJJA 1JPGB 3VG0H 3X12A 1I1YB 1FYTD 1KC5H 3MFFA 2VH5L 1BBJB 3SE9H 1BP3B 4JZJA 2FECI 5TE4H 3T4YB 4UDUA 4WW2C 3UTSD 3SDXF 3THMH 5IMLA 5SX5K 4FQPA 2NX5D 1F4WL 3ILQC 3SKOA 3QIBB 3VWKD 2P5EE 4JZJC 4N5ED 3DO7B 3HUJF 3WDIA 4OLWH 2NZ9D 5E2WH 3NFNA 3LKOB 4KI5F 3NBNA 5JW3L 1YPZE 2Z93A 3IVKA 5IGXH 2DLFL 3ARBA 2CDGA 5F6HJ 1ZHLA 1AKJD 2P5WE 4ZUVA 3CFIC 4WUUD 3STBA 3NABL 4HIEA 2VXQH 4Y4KB 3OKKA 1YMMA 1AP2A 3DUSA 4QLRA 5FYKL 2GTZA 1U3HD 4X6BA 3INUH 3O6FD 3VI3F 3NA4A 3MUY1 3LKQA 4O9HH 4EI6A 1ZLVH 2C1OB 4TVPD 3VXRB 5HHOE 4WI4A 2FH8A 3EFFB 5SWSE 5IBLD 1XF3B 3HE6B 3CMOH 2NY6C 3OAYH 4JZOA 4I18C 1LEIB 4IRSA 1AHWA 1RAMA 3CX5J 4ZOEA 1H3WM 1BAFL 3ARYA 5GRJH 1BD2A 1FYHB 3SDXE 1VFAA 3U7YH 4XMPL 4FQIL 1WQVT 1YEEH 2ZOLB 1H9VA 4K9EC 2Q8AL 3TC9A 3W82A 5KAQG 2B8OT 3BKJL 3HUJE 3OKEB 3SOBL 4KHTH 4EUPA 4JDZB 1T5WB 5DEGA 3QNXA 5D71H 3PP3H 4OQTL 5D7JB 5F7EL 3KPMB 1A3QA 2GY7B 4ORGB 4XC3L 4I77H 4P0DA 4Q9BA 5DMKA 3BEWA 4KGLA 2VDLL 4RMSA 2CRIA 2DQEL 1J8HD 1QFUH 1DVFB 4UTBL 3VFGH 2DQGH 1I7UB 3QPXL 2NNAA 4PJ8D 2JCCB 4JFZL 5EBLA 3GBMH 4KI5C 1UEYA 3VI3E 1MAJA 1S9XB 3H2WA 2X09A 1MI5B 4HWZB 4F2MB 3VCLA 1OAQH 2H1PH 1WUNT 2NXZC 4F33B 2HFFA 1CQYA 2DB8A 4RMRA 4MA8L 4OM1H 5KJRH 1Z9MA 2APTA 2BDNL 3A6BL 3BGFC 5HGAB 2BSRB 3P73A 2UV3A 1GXEA 1XGTA 5EPMB 5C0RH 5FF6A 4MAYC 4KQ4L 3LPGA 4PTTB 4RFEB 3T0EE 5E24E 3MGTA 5BRZA 3RVXD 4F7MB 1G7HB 3N06B 4LRNH 5IG7B 2D4FA 1IAIH 4U1NB 2VLKE 2R2HB 3WIFA 4JO4H 5SWQA 1WTGT 4OJFL 2F74B 3X17A 1JZ3A 5LQBL 1CF8H 2A6JA 4U3HA 4GAYB 1AD0B 3S4SB 2AJZB 3QQ9C 4P5MB 1OP3K 4X6FB 1FO0A 1K9TA 4NWUL 1KB5B 3QDJA 1CD8A 2GHWB 3U30B 3IT8D 1CICA 3T0EC 1TZHA 2IANB 3LN5B 4LLQA 1CLOL 1MEXH 3FO1B 5KSAA 4UQ3A 1BREA 1ZA3A 4P5KA 4YBLC 3G5VB 5IF0B 2F19L 4KVCL 1ORSB 4KMTH 3D85D 4LVHC 1S7QB 3JUYA 1CICC 3SDCB 1KTKE 3LKNB 3STZA 2VKXA 3EHBD 1G6RA 4UT7L 2CDEA 4QXUL 3ZKNC 3BGMA 1FPTL 1QUNA 5CJXC 1DUZB 1URLA 4K3GA 1TVBA 3PDDA 5DS8A 2CXKA 3WS3B 3LS5L 3TCLA 2EZ0D 4XCCH 5IBTH 4ODXA 2WV3A 2OK0L 1NC4D 1C12B 2Y07L 4TSBL 4MXQC 4OZGB 3AAZA 3TH4T 2OLDA 3TBWB 2NCMA 5GS0L 3C8HA 1UZ6F 1T1YA 4L8DA 2L7JA 1HXYA 4PJXA 2P45B 43C9A 5T33H 4OZHF 3U9PH 1UACH 3HAEG 4P2RD 3VDBA 4E9LA 2R56L 3NACL 2HAZA 1U8KA 3E8UL 1VA9A 1ACZA 3V6FB 3FMGL 1AIFB 3V7MA 4DGIL 1FN4A 3PQYE 3MXVH 5D7SH 5CBAA 4KK9C 3S37L 3BUYA 4BZYA 3K8LA 5JR1H 2V9TA 2XA3A 2FEDD 5D1XC 1JCKA 5GJSL 4ZSOB 5KG9B 1JGEB 2I27N 1VEPA 1EEYA 5C09E 2X42A 5B8CA 5DUMH 3C5SB 4XVSH 5E2UH 1Q72L 5FUZL 2AJYH 2YPLB 1F2XK 4OZFH 1UYWH 4PJFF 4E41D 3QEQE 4PRDB 2CIKB 3P11L 4UV4H 4S1DD 4NQED 1DL7L 4J4PA 1DDHB 1ZE3C 4X7DC 1P9MA 2DQHH 3FB5B 2DQCL 1B4RA 4M3KB 4GRWF 1V7MH 3GMOA 1EHXA 1UXSB 1UZ6E 4QT5B 2CJUL 2VXSH 3NZHH 4HFWB 4KPHL 4J4PC 4DK6A 3BD5A 5AWNL 4QRRD 4MNQA 3BW9B 4MGXA 3EYSH 4Z0BH 2CIIB 3QJHB 1RULH 3O2DH 4OZHA 1QYGH 1XCTB 5K93A 2PYFB 3EYQD 2BCKB 2KQMA 5I71B 1S7SB 1IM9D 4RMQA 3TYFB 3KPLB 3W9DB 5F6HI 1HHJA 4M48H 1U93B 1A4KB 4YDVA 4F7CA 5F9AC 2K7QA 3PV6A 4DOHB 1MIMH 4JRYD 3QO1A 4G9FB 2P8LA 4PV8B 4U0RB 3TJHC 4L3EB 1WGOA 3L7EA 3UAJD 4WFHE 1N6VA 4H8WH 4JM2B 4PJFE 3C09B 3OJVC 4NQCD 1TMCB 3IU3A 3UTPE 1BIHA 4LP4A 3AM8A 3ARED 2ZSWB 4WEMB 4WGVB 1H3UA 3LQZB 4MWFB 1ZTXL 2ZP0T 4CMMB 4PJFA 3RY6A 4EN3A 1WFUA 4GRWE 2F53E 1LHZA 3L3GA 4PJDA 3LS4H 3EW3B 4KI1A 4YK4C 1EDQA 1MWAB 1MY7A 1QFWM 2ZCHL 3MLXL 4A2LA 1DQLL 1JWUB 5IJVB 4JPKH 5FYLE 3RNQA 2YMXL 1U0QA 4EN3C 4PTUA 1OAYH 3A0OA 5KN5A 3NZ8A 3S34H 3ZTNL 1CTOA 4YXHH 1D9KB 3IDUA 1N64L 1E4XH 3H3PH 5B38B 4KJQD 3SKMB 9CGTA 1UJ3B 3OB0K 4MZ2A 5IB5B 2VL5B 2H3NB 5E99L 3QXTA 1B9ZA 2VIRB 4EBQL 2QSTA 3H3BC 2XZAH 3L5WB 1UCBL 2D03H 3S3JA 3JV0A 1J5OH 2K7PA 2ITCB 5HYQA 2V9QA 3DETD 3RQ3A 4P59H 1K8IB 1PW3A 2JE8A 1VKXA 2WBWB 1MIEL 1R3HA 2R2BA 3CU7A 2AK4B 3NH7L 1ZT1B 2CKBH 3FRUA 3F5WB 1I9RL 1L7TL 4MDJB 1WT5A 3F7RA 4HLJA 3IF1B 1S7VB 2VZOA 1ZAGA 2AEIT 1D5XB 1MCEA 4NHCL 4MD4A 2BNUB 1GZQB 3NCMA 1FZKB 3MLWL 4U1LA 1NMCB 3DNKA 1IGJA 3UTOA 4GW5B 5KS9B 3EGSA 4C4KO 4DUWA 1G6VK 3TM6A 4XNQA 2DQTL 1PEZA 4DN3L 3MRHB 1XH3A 2DM3A 3VDAA 4WFFD 1B6UA 4N8CH 4Z95H 1FG2A 1NEUA 3RTQD 3QUZC 1K2DB 1K5NA 2I60L 4NKIL 1ZVHA 4Y5XA 1QA9B 5I1IH 4BFEA 4PRAB 4KVNH 1G0XA 5JLZA 3EO1B 4JEGB 2XTJC 1OAKL 3KPQB 3MR9A 1FC2D 3DVGA 4EDWL 3LEYL 1JPSH 1SMOA 2EXYD 4X4XA 3LKRB 2BY1A 3PDGA 1GGIL 2Q20A 4MS8D 2W91A 2YPVL 4IRJB 4OGZA 1KNOA 1QSFB 5GSRA 4OCNC 4LCWD 5K9KA 3I6LD 4ZDHB 4OLUH 4XPFL 2DQJL 3UJIH 1I85A 4PJIA 4LVEA 3MRQA 5KVGL 3QFDB 4PBWD 5DJAA 3VFUB 2HFTA 5H35B 1HILB 4CADB 4JRWA 4HKXB 4D0CB 4PJ9D 1UKSA 3EDFA 2DL2A 5CSZA 4YFDB 5JTWA 1I85C 1RK0A 4D8PA 2DLIA 2EE3A 3A6CL 4K9EH 5IV2B 5E5MA 4R0LC 2RIKA 3N85H 2A9NL 4RRPG 4JFDD 1K4DA 3PWPE 1DCLA 2BSED 2QSQA 5DJCB 4LGPB 1IAKA 1NGWB 4LFHD 4RFNB 3S97C 3I6GA 4X7TB 4C56A 3LKSA 4O58H 4PJAB 1CD1A 4D94A 4Z18A 1CFSA 4XVTH 1RUAL 4CW1A 5ETUB 5CJQL 5HGDA 4DW2L 2X70B 4JANA 1U2HA 4K8RC 2IF7A 4P4RB 3LRSA 3H9SE 4F7EB 4JKWA 5BVPL 3C08L 2YA1A 4TUOB 2QHRL 2OXGA 4BQ6A 1J87A 2FGZA 4MSWB 3EOBB 3EYVA 3ARXA 2A73B 1Z5LA 5FM8A 4LSSL 2M8XA 4N0YL 1XF2B 1MH5B 3U2SB 1T1WA 1TCRA 1YEFL 4HK0B 3JV6B 4QF1B 1BJMA 5SX4I 1R3KB 1PSKL 3O2WL 2OXHA 4GQ9H 3N0PB 2BSTB 3BD4A 4NWTL 4HIXH 4JM4H 4JHAH 4KK5D 1FO0L 3FONB 5C08B 2WP3O 2B5IC 4U7SA 4UQ2B 4QCIA 2BY0A 1TTFA 5A16B 2AVGA 2PNDA 3X11A 2QQLH 5J6HA 1NAMB 4XX1G 2JK5B 3H9YA 4FTVE 3RPIB 5HYJB 3QEUA 4GQPH 3ZT7A 4FFZL 2D7TH 2PXYA 1R3JA 3BWUC 5C0CD 1X5XA 4C55A 3D39D 2X1OA 3N1GC 4I0PA 4KK6D 1OTSC 1S9WB 2VUYA 1G6RL 3QIUC 4KKBD 4K71C 4O2CB 2AJSL 3H9HB 1BHGA 3NCYS 4IDJL 5F1NA 4LQ1A 1JYVA 4NHUB 1EHNA 1RZKL 4I0PC 5EUOF 3ZTJH 3O41B 1LP9A 3VFMA 5INCA 1RFDH 3IYLW 4YHYB 2W9DL 4U2YA 1M6OB 5FHBH 2ARJA 2X4NA 2Z92A 1IBGH 2W1NA 1EIBA 2RCSL 2XRAH 3IFPB 2E7CA 2E7LA 5ESVA 1T7YA 4N0UB 1ZHKB 1A3RH 5ALBL 4F58L 3S4SG 1ZMYA 3FB6A 5EOQH 1HKLH 5J3HD 1SVZA 4LVOC 3VGBA 5D5MA 4FQHB 5ELIA 5L8JB 4Y5YA 3RFZC 3MBEC 5IMKA 3FFCE 2VC2H 3WXVH 4LEXL 4MMZC 3LKPA 1CGUA 5DJ2B 4ZUTA 3B8SA 2EDRA 4KHXH 4X7SL 2FATL 2X4TA 4R90L 4FFVD 4BZ1L 1LGVA 3IDIA 1QFOA 3MRNA 4UINL 3V4UL 3DBXB 2QR0A 5GGRY 4Y1AE 3MLUH 3X14B 3ZKMC 3O6LL 2YD7A 2BFVH 4XCEB 1N3NA 4YBHA 5FUCE 1WWAX 3B2VH 5EUOE 1BZ9A 1T83A 1HHIB 3HG1D 3SJVD 4BA8A 4Y7MA 4PS4L 2UWEB 4JVWA 1A22B 1NUNB 3HZVA 5IHZA 1C5CL 4LPVA 2R8SH 1P4BH 4Q2ZB 3RUGA 2J1KA 4P46B 5ICYB 1T83C 1HINL 5FECB 1G7LB 4JAMA 3BKCL 1SJHA 3FHQA 4LCYB 5EU6A 1T7XA 4HIJA 5E1AB 3LN9A 4OBRA 2H32A 2BVOA 5DQ9A 1A9EA 3WHXB 4L8SC 4AM0A 2O61B 4YPJA 3MRLB 4XTRC 4L8BB 5T1DL 1FZOA 1OAXH 2DWDB 3CMGA 1E6OL 3GUTB 1NMBL 3CSBA 1JPFA 2DICA 3LV3B 5EWIH 5L2KD 3ARSA 3OPZH 4U6VH 1TQBB 2Z8RA 3BDBA 2EKSA 4URTB 1QBBA 5DD5L 5J13C 1YNKL 3BAEL 5IB1B 5L8LB 2HJKA 1OF2B 3TN0A 1NGPH 1JYWA 5CBEB 3U9UA 3ZDZF 1PZUB 3CVHL 3K4ZA 1FL5A 4M7LH 4U2ZA 1SQ2N 3CDYA 1R0AH 1D5MB 4LCIH 5EBMB 1WZ1L 1YNTA 1DANU 2ZCLH 3MLVH 5HHQA 1NBZA 4NUJB 2PETA 4RX4A 4AEIH 3TN0C 2R4RL 3ZYZA 1D6VL 2R9HD 1F6AB 3GSVA 1PJ9A 4TUJA 3GGWB 4PRNA 2WLYA 5I1LA 1BGXL 2VXTL 4I4WA 2DWEB 2IMMA 4XPTL 3GSNH 3IJYB 3K2UH 2HTKC 2R0WL 4H1LB 3HE7C 5LBSH 1EMTH 3MO1A 1FGNH 1WWCA 3NCJH 1DE4A 4YFEA 3LQAL 1N5AB 2NY7H 1QBMH 4K94H 1JZ8A 1ERNA 1HH6A 3BIAX 3QQ3A 1V3MA 1CDIA 3KPRD 2EO9A 4GRWH 5C07D 2BJML 4Q9CA 5JPNA 4KRPD 4Z7NE 5DHVA 5ID1B 3ROOB 4HUXB 4MDIA 5FYJL 1TTUA 3NIFF 2OL3H 4NO5A 4NCDA 2B39A 4R2GC 5FYLH 3PE9A 1HN1A 1CL7L 4ISVA 1N59A 4KJWD 5GQBA 1K8DA 3S35L 5I75B 3TFKC 5JIIA 2W0PA 1ES0B 4JRXB 1S7TB 2GITA 3ZDZE 3ULSB 2IQ9H 4MXWH 3WV0A 5E7FA 1MHEB 3O4OC 4PLKD 1D5ZA 3MYJB 2MSPA 5E8PB 3RDTB 4HLZG 2QADB 3U7AA 2HTLD 3TIDB 3T2OA 4JFED 5CJ5A 4Z7UA 1G7PB 3IXAA 2FR4B 1DBBL 2J5LB 3I2CH 5HHNA 2WSKA 4HKJB 1H0DB 4JFHE 8FABA 5K33A 5KSUA 1X9QA 1CGSL 2GAZB 3MNVB 3W9EB 2XKNA 3SY0A 2MNUA 4X6CB 3BWAA 2GFBA 4NIKB 2UZXB 3QUKA 3MJGX 5ESQA 3TA3B 3RWHA 5BXFB 4MQXD 1I1CA 4H88H 4NQUA 4NO3A 1MAML 2QKIB 1N26A 1RU9H 2DIBA 4QO1A 1EO8L 4G8GB 3FN9A 4NZUL 5ADPH 3ARVA 1P1ZA 5DJ6A 5B38G 4PJCA 2VDPL 5EN2A 5HDQH 1IGFH 2FIKA 3L5XH 3FN0H 4P9HC 4PJ7E 4XP9L 3NIFE 2V17H 4GMTL 5DGQA 4WO4B 4U6TA 2VLRB 3MRMB 4WW1A 2XN9A 4M1GH 3O2VH 5JW4Q 2DRUA 2H2SD 5FUOL 5MEPA 4GSDH 1IEBB 1KIRA 4KTEH 2BVQA 4MAUH 1V8HA 4QY8A 4XXDA 2WUCH 3GSWA 3LB6D 1BX2A 2I07B 5AUMA 1RUMH 3HC4H 3ZHLA 4F3FB 2ADGB 1T0NB 3GI9H 3PDOA 4O2EA 3QH3A 3W0WE 2C3XA 3IDXH 4HWEH 3B3IA 4W4OA 4IMKA 3T2QA 1QEWA 1RMFH 3MNWA 3MJ8B 1JHKL 2HRPL 4P99A 2FJFB 3IGAB 1FV1B 1KEGH 1NKOA 5SWZB 4P2OD 3MOBL 5GSVB 1A14L 3UTZA 4YXLL 4J3WA 4Y4HB 1FCCA 1I7RA 4IMKC 4OSUL 2BMKA 4ODUA 1D7FA 2W0FB 4HUUB 1FLRL 5DWUH 4HIHB 1M05A 1P6AB 3NN8B 4U0QB 3WFBL 2SEBA 4AMKH 4L4TE 4GBXA 3T1FA 2VDMH 1U41A 1DEDA 4I5BA 1YN7B 5DJ8A 3RNKA 2WNGA 5TE6H 3W11C 4AIZA 2JELL 3CSPA 3UYRH 1IE5A 1TVHB 4B41A 2D9CA 2B2XL 1XGRA 2BNRE 4D9LH 4UOJA 1OT2A 2NW2A 3PXHA 1HQRB 3MODH 3PL6A 5CZXC 2BNRA 2PO6C 4MNGA 5I6XB 2KH2B 1IL1B 1QSEE 4PV9B 4K8RH 3BPNB 1I9JL 3H7BB 4PJEE 1KGCD 4C83A 1YZZA 1UC6A 3MJ9H 3T09A 4GKZB 3VD4A 5GJTH 1ZVYA 5J12C 4OCRL 2XQBH 3PL6C 3U4EA 2ZG1A 2K9UA 3VXTB 1J11A 4JPVH 3HLAB 1OQXA 1T22A 1ZGLA 2EDTA 2E27H 2PTTA 1KJVB 3O3EA 3SDDA 3VGDA 3TEUA 4Z7VB 4Q0XH 1NGYA 3WHE0 1DLFH 4RQQA 4JKMA 2ICEB 1UWXK 1LEGB 3HRZB 1N4XL 1AO7D 2NXYD 2MFNA 2WIMA 3GNML 4QHMA 4PRHB 4Y89A 1I4FB 4D9QE 1P7HL 4OF6A 3WEXA 3BN9D 2RR3A 4JFPB 3RVUC 3SDDC 4HH9A 4OT1L 1IT9H 2HLAB 3VXNA 4JKPH 2XXMB 3ULVD 5A1AA 2FO1A 1HXMA 1FVDB 5C0AB 3RBGA 5EZIL 5IP4A 5JZ7C 3DV4A 1QLFA 3LSOB 2FCBA 2GJ6B 2IQAA 3B5HA 2AEPH 3L3OA 1X5KA 2A77L 2RBLA 3ARGA 4FP8L 5I74B 4ZNEE 2AKRA 4Z8FH 1JYXA 2G2RB 1TETH 5D1ZA 5FB8A 2VITA 3NPSC 2YKLH 1BVLB 3Q48A 1HDMA 3PNWA 4WU7A 2APFA 3EYUL 4NGHL 3MGOB 3KNBA 4NNXB 1REIA 2GUOA 1F3DH 4G6FB 2MJWA 1BZ7A 5IVZA 2OX5A 3GI8H 4MNHA 1BM3H 5DD6A 4OZIA 1N2RB 4GRLD 3QQ4B 4UUJA 2CR6A 2WINA 5IVOA 3RZCD 3D1MC 2DQUH 2PR4H 4NQSA 1IFHH 1LVEA 1DLHB 3VDCA 1F45A 3C60A 3ETBF 1U8NB 3GO1L 1CVRA 3WNOA 2NY2B 5MENA 1AGEB 4XNUH 4D0BB 3TO4A 2H45A 3FFDB 3U83A 2JIXA 3V7AG 5GGQL 1FH5H 1M7DA 4Z77B 2NY0B 3HA0A 4PGCB 3L1OL 4XP5L 2QQNL 4HSQA 4OV6F 2MKLC 2X4UA 1I1AA 1RHFA 2EEDA 3TO4C 3ARFB 1P7QA 1E0OB 1X6NA 2HLFC 2ARWA 3FO0H 5HJ3A 2F5BL 5IW1A 3DPBA 2R39A 5DHYB 4ZAKC 2P1YA 5BS0A 3WIIH 3OG6B 5BZDA 1I1AC 2Q6WA 3FN3A 3QDGA 3R8BB 1AXSB 5CINH 4NQTA 4KZEL 1EH9A 4OM0L 1FE8L 3DOSA 1KEMH 1RHHA 4QRPE 4NN5C 1KIUA 3X3FL 3TT3H 5C0NC 5CJ8A 5EC1A 2DJ4A 3B5TA 1X3DA 1JF1A 2HVKB 3ARQA 5CHNA 2AW2A 4C58B 1WC7B 2WMPA 4D0DB 2BY3A 3WXWL 2VAJA 4YHIB 4B5EA 1WBYA 4PJHF 3BSZL 5LXGL 4GKNA 4QRSB 4NN7B 1IGCL 2ORBH 2V2XA 2VXQL 1AGDB 1DP0A 1D5BB 3KXFE 1BFOA 1KG0B 4LCCB 5FYKD 4Q9RL 3C9NB 3IDGA 1RQ5A 5TQ0L 5I30L 5ISZD 1S7RB 3QA3B 1HZHL 2G5RA 3QI9D 3BKYL 4H26B 2ESVD 4R4NC 3QG6A 3RX8A 4MB5A 4DFIA 4L3CA 4M7KH 1T1XB 4OQ1A 3L3IB 5C0BE 1KPUB 2OQJA 3S6CA 1B88A 4ELMA 3ZE0F 4HC1A 1RVFL 2FHBA 2BERA 1IEAA 5HHME 3TBYB 2QTEA 2F5AL 43CAA 4NUGL 3KJ6H 4N8VB 3KLDA 3CC5B 2IAMB 5J06A 2OSLA 1OTUD 4HX1A 1UWEH 3GHBH 1J8KA 2D7OA 4RMUA 3EJYD 4LSPH 1OAUL 5ANMA 3M07A 2VDNL 1FZMA 5BV7B 1OCWH 3JTSA 4ZFGH 3RJDA 3MA9L 3HNTL 1Z0NA 2CQVA 1J1XH 4LASL 1E6JL 2DQIL 4PJHE 3MV9A 1G0DA 1MNUL 3AVEA 2W07A 3TVMA 2NY3C 3VXQB 2BVYA 1FRGL 3BI9X 3SKNB 3H0TA 2DLEA 2OI9B 1Y0LB 3FOMB 3VFGL 3WD5H 1DN0B 3HZMB 1VFUA 4PJHA 1RUQH 5FA4B 1KCRH 2XWTB 1F3RB 3RL2B 3MRFB 3QDMD 3IB4A 4LLUB 4ZFFA 4BKLA 2GQHA 3MOAH 4I3RL 2FJHB 1OAQL 1RZGA 3DRQB 4OV5A 3ZE0E 4J3UA 4HLZH 3HNVL 5GHWL 1KENH 5FK9A 3KPSA 4EQ3A 1N5YH 2J12B 3QUXD 4X4MA 3TWCH 2FO4B 3DXAB 4KK8D 2DN7A 5C92A 5JHLH 2UY6A 3WFEH 3K3QA 3KR3H 2RQ8A 4M7JL 4WUKL 4JZNA 4XNZB 4OLXH 1MREL 1MJUH 4M6ML 1HI6B 1MCDA 4JO2L 4UIMA 1CD9B 1BF8A 1JGUH 4IBLT 5E9DA 2C4FU 4HXAH 4BQ9A 4OF5A 3ZDXF 3FQUB 3ALWA 2W59A 5T3ZE 2FB4L 4BJLA 5D2LA 3ZMRA 3FO9B 1WFOA 3JUZA 1MRDL 4I0KA 4JLRA 4ZTPL 5A2JH 3O4LA 3ARPA 4LAJH 1R3IH 2V5TA 2NTFA 2VMFA 4K3DL 5FDWA 3KLHC 4KJPC 3GSOA 4C59B 1NC2B 3C5ZC 1W2KT 4JY6A 2MMXA 4H1LG 2AQ1A 3MRRB 3G6DH 3QISA 2I5YL 2HN7A 2DOCA 1INQB 1U8JB 2IEPA 2MPAH 5D1QA 4C4KT 3GB7A 3EJZD 2PYEB 3JWDL 4OBSA 4P9HH 4LSUL 1NGQH 4DUVA 2NPLX 4TQEH 2EDOA 2C1PA 2D0GA 4P5TB 3SE8H 5DURD 5D1QC 5IM7A 1HIML 5GS2D 6FABL 5HD8C 4FHBD 3S88L 1NBYA 3D9AL 1Q1JH 3BP4A 2FX7H 3RBSA 3LN4A 4OLVH 4EI5C 1ZT4B 2YD1A 3HAEA 4ZYKB 4LF3B 5EU5A 4JO3L 3C8KB 2LFGA 3LPFA 3P4NA 5DA4A 5GS0D 2IBZY 1FYTE 3ZDXE 2EDLA 1IC4L 1DSFL 2ATKB 3O45B 4WU5B 1KCVH 2X4SB 2WWKT 3PABA 3G6AB 3HZKA 4L5FL 4UOW0 4YPGB 1FLTX 4LAQH 3BZ4A 4KWUA 3UTSE 5E00A 1RZ8B 4L4VB 1AFVH 5I18L 3B9EA 2NX5E 3GMNB 3CIQA 4PRBA 4XI5D 3VXUD 3E1F1 5I8EB 4PLOB 4F57H 2Z31A 5F96L 5CD3A 5DRZA 1T04A 3E6FB 1AXTH 3VD7A 3OKLA 3D0LB 4UB0L 2EH7L 5TFSL 4H25B 2YXFA 4WUUE 3U0WL 1MQKL 4NFCA 1KFAL 5E2TL 1S7UA 4WDIA 5HI5D 1NL0H 3SE4C 2YR3A 3QCUL 3BQUB 4DGVH 4A6YA 4OIAA 2NZ9C 5ID0B 2R0LH 3WUWG 4CMHB 4GAJL 3OKOA 4MCZB 4TVPE 4XMLL 3QWOA 1ED3B 4PJ9B 3QIWD 2VL4A 3LZFH 4XHQA 4DVRH 4BZ2H 4G9DB 2G5BB 4Y88A 1L9MA 3N9GH 1NJ9B 4DZ8A 1YY9D 2A83B 1AGBB 4PIRF 1MCWW 5MEOA 5GRUH 3RGVB 1AQDA 4HKBB 4ETQA 1KTLB 2BXZA 2YA0A 3U82B 1U3HC 3CAFA 2A6KB 3L3DA 4XP4H 4Y2DA 4J3VA 4E42B 2WM0A 2OYPA 3OR7A 5JXEA 1J86A 2CLRB 5IBLC 1VGEH 3WMSA 2FECL 4HZLA 3AXLB 4KMLB 3HI6L 2R23A 1MCRA 3GMMB 1EA9C 4R6UA 4PGBA 4AJ0A 1DEEA 4GS7B 3M1BB 3FHAA 4MHHG 4POUB 2BSSA 5KBNC 1T20B 5GGSY 1XR9B 1I8LC 5JW5A 2DLHA 3MUZ1 1J8HE 1LD9B 3UYPA 4Y16D 2VYRE 3FT4B 4G8IA 3SKJH 3PIQB 4M6NH 3PWJB 3BIBX 2IFGA 5IHUL 5CCKH 3OG4B 1J8HA 4ONFL 4PG9A 1NFIA 3QBTB 4HBCL 1VADB 3BHBA 3FAXA 5DVMA 3GK8L 1HQ4A 3IDMA 2Y6SD 4JN1L 3LS4L 2OMNA 1YA5A 3HR5B 1AY1L 3GSRB 2NY4D 2YPKB 5E6IB 3LAFA 4V1DA 4UDTB 1OSZA 4PJ8C 2AXFA 4WI7A 3QXAA 4WJ5B 5LGJA 1H5BC 4TOYH 1XF4A 1VACA 1Q8MA 3LH2H 4YXHL 2WBJD 3VFSA 2ADJB 3V4VH 1KTRL 2NW3B 5E0QA 1ONQA 5E70A 4JCMA 3QUML 1WBZB 1CFNA 5EC2A 3MRGA 3STLB 4XBGA 5B39G 2D03L 4U6HB 4QHNB 1YYLL 5T5FL 3MRDA 1IQWL 1IGML 2HRLA 3IDYC 1CLYH 1PFCA 1KOAA 3BXNB 1X7QA 3MUHL 5TGBB 1F6LL 4FQCL 5EB9A 2XICA 1IAIM 3X3GH 4HDIA 3OMZA 2O5YL 1HHHB 2DD8L 3RVXC 1RURL 4P23A 1SM3L 4PRIA 1SBBA 1BQUA 2XZZA 2VDQL 2AV7A 4MHHI 3RWIA 1L0QA 1MVUA 4W70A 4OFPA 3GHEL 4G8EA 2F54B 4QRTB 3NA9L 3EO0A 4ZTOL 5BZWA 1C5BL 1X4XA 2ZNWA 4C57C 1LDPH 4QGYA 4ZUUB 3KYOA 4PG2C 4PYGA 3MRBA 1X5IA 4DQOL 3WN5A 2E3VA 1Z9SA 1ZHNB 3QHZL 3CVIL 3ARBD 3VFNB 2W9EH 4G7YL 4QXGH 3T0WA 3D3VD 5FFLA 3EHBC 5DEFB 3HI5H 1OARH 1YEKL 1NC4A 1R6VA 3GJFB 2YD5A 4LARL 1JPST 1YMMD 3WN5C 1QFWI 2H6PA 4DAGH 1K6QH 4WY7L 1EFXB 3O3BB 4P2RE 1FL3B 7CGTA 3KPPB 5T1KB 2EZ0C 1I1YA 4FQLH 1I8IB 4NZJA 1SEBB 1BBJA 2UVFA 5IROA 5SV3A 3VRIB 4JDTH 3T4YA 2Z91B 3CPLB 2EC8A 2OS7A 3DMMD 3IAPA 1FFNB 4FQXB 4M5YH 4IRSD 1KBGL 2JJTC 2A1WH 3LEVH 3QIBA 3DO7A 5IROC 1HHGB 4YIQB 3LKOA 1T2XA 1YEIH 3MBXL 4E41E 1IZJA 3R06B 4LOUD 4NQEE 4Z76A 2D9QB 2JCCF 4R8WH 4K2UL 5CWSB 1OW0C 2FEDC 4E41A 5KZCD 4YUEL 3WL9B 1MJ8L 1WCBB 2OJZL 4Y5VB 4KI5D 12E8H 2DJUA 3B9KB 3I6KB 2HKHL 2C1OA 2BRRL 3VXRA 1PVHA 4O58L 5J57B 4QRRE 2QSCL 3EFFA 3FZUD 1KJ2A 3IU4L 4JG1L 3HC3H 2NQCA 1INEH 3ES6B 4LCUB 1XGYL 1EVTC 3GSQB 4RWYL 4M5ZH 3C6LD 1F2QA 1KELL 4ZUSB 4PB9H 3BN3B 1F58L 3GMLA 5CLTA 5L9DL 4UIKL 2ZOLA 1MCCA 4QNPF 3D69B 3OKEA 1S7WB 3F58H 2J8UF 2DAVA 4JRYE 5FM4A 1T5WA 4O5LH 2F8OA 5DD3H 3MXWH 1BLNB 5D7JA 2N1KA 3VD9A 4ONHB 5LGHH 3CFBB 4HZAA 3BYTA 3KPMA 4M7ZC 4K23H 2FBJH 4N8VG 3SO3B 1LWRA 4ORGA 3EYQC 4NQCE 1ZS8B 1VPOL 5BRZD 4PBXA 5EU4B 4UBDD 3HMXH 1RJYB 2AAVA 2JJSA 1A6VH 4P49A 4PJ5D 1OAZH 2AXGB 3Q1SL 1Q9OB 3MV8B 1HSBA 1UM6L 4N1HB 1KTDB 3O6MH 1I7UA 2JCCA 3JWNC 4DKDC 1H8SA 2MQCA 5T1MB 1S9XA 4HWZA 1MI5A 5FA3B 5F1KC 4W6XB 3QDJD 3UAJC 1X4ZA 1WK0A 1OP9A 4P3DB 4X4YA 5J11B 3AREC 4ODSH 5KSAD 1FJ1A 1GIGL 1MFNA 2Q7YA 4F33A 2VDKH 1BJ8A 3P9WB 4CDHA 2P44B 1DQJB 5I1AB 3T65B 1PG7W 1GVIA 4H20L 5T3ZH 1F4XH 3P2TA 3BZDA 1DFBH 2CD0A 3RA7L 2D31B 5HGAA 1B3JA 2BSRA 3GIZL 4Y19B 2DI9A 5EPMA 4QNPE 1F42A 5FHAH 4FZ8L 4FQ1H 4PTTA 4RFEA 1KPRB 2J8UE 5I15L 4OCLC 2MTPA 2R2CA 2NTSP 4F7MA 1G7HA 1LO2H 4NZDA 1ZANH 1H3GA 4HW6A 2HWZL 1P69B 5JXAL 4FXLA 5I9QB 1CE1H 2J8UA 2J88H 2F74A 4YZFF 4GFTB 3P0YL 1UH2A 2DQFA 3BJ91 4GAYA 1AD0A 3S4SA 2AJZA 4P5MA 1G1CA 4X6FA 5DFWH 1MCHA 5KSBB 5FHBL 3I9GL 1M7IA 2JLLA 3MRKB 3E6HB 5DT1H 4QHUB 5KVFH 3LN5A 3F12B 3DETC 5DQJB 2B7DT 3FO1A 3A67L 2ZSVA 4Q74A 1I3GH 2AJ3B 5IF0A 2HMID 3UJJL 4Z7OF 4WFFE 1S7QA 3VMNA 3SDCA 2X1XR 4JHWL 1JFQL 5F9WC 3M8OH 1TNMA 1DUZA 2FD6L 2VXUL 3IS1X 1F4HA 2GW5A 1D5IL 1YEGH 2YWYA 3SDCC 2QHLA 3WS6A 4CDGC 2X7LB 2ITDA 3BP6B 1C12A 5GGRB 4M93C 3NTCL 4OZGA 5F1IB 3AB0B 3UO1L 4A6YL 2W0KA 3RTQC 4MQTB 1FP5A 1E28B 4J4PD 4LCWE 1NLBH 3I6LE 1QNZH 3VRLF 5I8KH 1RJLB 2VZVA 2EXYC 4G8FB 1UKTA 1B6DA 4FQQB 3L3JB 3V6FA 1AIFA 3KPOB 4MS8C 5I1HL 1JGDB 3WKNA 4MNQD 4KAQL 4UZGA 4AG4H 3PWLB 3O9WB 4Z7OE 4NYLB 4ZSOA 5KG9A 1JGEA 3HPLB 4TVPH 4JB9H 4XP1H 2OZ4A 4NQDB 2MCPL 3QEHB 3ZT5A 4R4FH 1NGXA 1OAXL 3C5SA 4JFDE 4WV1A 5DD0H 2J4WH 3U0PB 5IKCA 1I8KB 5FDYA 2YPLA 2H9GB 3OPZL 1BBDH 3ZE2F 3MACH 4PRDA 2CIKA 4PB0L 3LD8B 5IOPB 3TZVB 4YHPA 1DDHA 2QEJA 3H42H 4KXZH 3SBWA 4WV1C 2GSGB 4HXBL 3FB5A 1C5DB 4F37F 1UXSA 4U1GC 1NGPL 2JJUA 5K9JH 2HJLB 1YECL 4JFXB 4M7LT 4ODVH 4XNMB 5CZVL 4G7VL 2EO1A 4OFKA 1RZJC 4AZ8A 4HFWA 3TPKA 3VRLE 5HYFA 3SBWC 1Y6MR 5DTFB 2PW2B 2ZCLL 4NZRH 2YC1B 3BW9A 4Y4FB 4N0RA 2CIIA 3QJHA 4OIIL 5E08L 3DARA 3FT2A 4EOWL 1HH9A 1XCTA 2PYFA 3PP4L 2BCKA 5HGHB 5KTEH 1S7SA 3BPOC 3NFSH 3PWNB 1C08B 1M1SA 5CJBA 3TYFA 2EH8H 4JY4B 3KPLA 3W9DA 1Q0YL 4MJ6B 4AEHH 1U93A 1A4KA 3G9VA 5J1TC 1ZLWK 2YBRA 4GXVL 4TUKL 4DEPB 1DBJH 2VJXA 3BMWA 1RUKH 4K94L 5T1LB 4G9FA 5I71C 1Q9KB 1KT2B 4PV8A 4L3EA 5FYJD 1W72H 4LU5H 3G6JE 5JHDB 3VXMB 3VH8B 2RFXB 4JM2A 3ZE2E 3UX9B 1EPFA 1M71B 4XVUD 5DJZB 2ZSWA 3QEGH 3LQZA 4MWFA 2OM5A 2F15A 4P2QB 5LCVL 3O8XB 4CMMA 3IRPX 2Z0BA 4UILL 3LIZL 1FAKT 3V52L 5IMMB 4TNWF 1QQDB 2ZOKA 3NAAL 2BXYA 2VWEE 1RIVH 5IW6B 2ZKHL 1R5VB 3VWJD 5IJVA 4K7PX 5C0CE 1BFVL 1KLUB 4M1DH 1QLEL 3D39E 4DGYH 4I2XB 2CUHA 2FLRT 4KK5C 1D9KA 2B1HL 4WI2A 2R0ZH 2XTJD 1MCWM 4LLDB 3D39A 3SKMA 1G9ML 1UJ3A 4CNIB 5IB5A 2VL5A 3QNYB 2H3NA 3KAAA 4JQXA 3L5WA 3VMOA 5D6CB 4UOW1 3UC0L 3QUYB 1D9KC 3FQRA 1P5UA 5JW4R 4APQB 3ARWA 3RI5K 2BNQB 1K8IA 3AS1A 4KK6C 5ACLA 3FKUS 3QNZA 4GMSH 4KKBC 3U48A 2AK4A 2IPTH 1EX0A 1ZT1A 2HP4A 4EIGB 3F5WA 1GC1C 5BO1H 1NFDE 4MDJA 4M9OA 3IF1A 2XPGB 2Y25A 3RX5A 3O2VL 1H3PL 1D5XA 3AUVA 4WEBH 1TJHH 1JHLH 2IPUG 4GSDL 2BNUA 1SJEB 2LU4A 1FZKA 1PKQB 4J6RL 4YDKL 3O11B 1GGBH 4GW5A 5KS9A 1FFPB 3VGGA 5TJWK 2UYLB 4YDLB 4RGNB 1DZBA 3U0TB 4KDWA 5D7IB 3MRHA 3E0GA 3UPAA 4LDOB 2D2OA 5TF1L 3CDGA 1N6QH 3MSPA 4U6XB 5C0JB 3ILPB 3HMWH 2V7NA 1N0LA 1QA9A 2CO7B 4KY1H 2CRYA 5CS7A 4PRAA 4ETYA 4XPAL 5E95B 4HPYH 3EO1A 1PG7L 5J3HC 5IJKC 5CSBA 1B0RB 3BVNB 3KPQA 3VFTB 1OP5K 5TPWH 4NM4H 1QVOB 3QCVL 3MV7B 3DROB 3LKRA 4XBEL 3HG1E 4JVPA 3SJVE 2KDGA 2Y1VA 3FCTB 1CDYA 1FGVL 4JKKA 4FFVC 2VISB 1EHLL 4IRJA 1MHCA 1JMXA 4C56D 3CFCL 1QSFA 3RIAF 4KJYB 3Q3GA 4NSKB 1JN6B 4LHUB 4YE4L 4ZDHA 2GIYA 5KW9H 1MCJA 1XF1A 2EDDA 1OGAD 2ZUVA 3HC0A 4JG0H 3VFUA 5JQ6H 3EO9L 5H35A 3REVB 1HILA 4CADA 5AD0B 4HKXA 1R5IB 4KMQA 1QRNB 5B3NA 1U3ZA 3VFRB 1EXUB 4ZFZB 5DZOA 2OR9H 3CSGA 2W60B 2EDFA 4KTDH 4JY5L 5CUSH 5L2KA 4JREB 1CFQA 5CP7B 2FZ3B 3IDNB 5EBGA 5A2IH 3FL7A 5E8DL 3IJHB 1UWGH 3B2UD 4JO1L 2E27L 5DJCA 4CN1A 1NGWA 3OAZH 3MREB 4OCSH 1IKNA 3OR6B 4RGMB 5CEXB 4X7TA 1YEDB 4U1JB 3UJTH 1MHPL 3V8OA 3DGCR 4JFFB 3V5DB 3S37X 4Z7WF 4HGMA 4OGXH 5ETUA 4AQOA 3CFKB 4GKSB 2X70A 4FXKB 5GZND 2YSSB 2IGFL 4G80B 1WF5A 3R1GL 3DWTA 1G9NC 4F7EA 5E8NB 3AFLA 1CU4H 2R1YB 4XCYB 1BQLH 1XIWB 4JFOB 3D87B 2DM2A 3QHTC 4TUOA 1LQSR 3QFJD 1AJ7H 5ILTL 2PXYD 5D2NB 1L7IH 3QUXB 3RVWD 2XG4A 3KPRE 5C07E 2A73A 3U4BH 4HK3N 2R9HC 4ODTL 3J8F7 5F97E 3S5LB 3VXSD 1MCKA 5I1GH 1SVCP 1XF2A 1MH5A 1MHHA 4LSDA 2BVUA 3GKWH 3U2SA 3GMQB 3C2AL 4IRZH 3WNMA 4HK0A 5A2LH 1OPGH 2J6EA 4BYHA 3MQIA 4MJ5B 4TULH 1R3KA 2GK0A 4DUXA 4XCFH 5K9QG 2BSTA 4FABL 5L88H 2VLJB 1UT9A 1FNSH 1NAKL 3QAZB 3P9MB 4WI3A 4X4ZA 4YDJA 1GGCL 4G5ZL 4AQ1B 4UQ2A 1KB5L 2AJVH 4LIQE 4Z7WE 4JFEE 5DK2B 3ZKXC 4Z6AT 3ORJA 1NAMA 2JK5A 4MJID 2J2ZA 3F65A 3RPIA 4HS8H 1LE5B 3C8DA 3CFEA 5HYJA 3OGCB 3V6OE 2FX8H 4Z7WA 2L4OA 3ZYOA 3IJSA 1N0XL 3VG9C 3ZSSA 5TQ2L 1N7ML 4PLKC 3A6OA 3B8YA 1TZGH 4G3YH 3AY4C 3V6OA 3KLSA 4YHMH 4PY7B 1MY5A 2D7NA 2HTLC 3H9HA 4X9IA 5F8QC 1JNLL 5E2JA 3LHPL 3CFDB 5DRWB 4NHUA 3WNPA 1X5LA 3MLSL 1JF5A 2Q87A 1QR4A 3V6OC 4AEEA 3BDYH 4LRIC 3VW3L 4NKMB 3KJ4B 4MQXC 4QHKJ 3OXSB 5I73C 3QQNA 1M6OA 4NZTL 4N90D 5ICZB 3VE0B 3JXAA 3AMKA 4QOKB 4ZFOB 1EUUA 2FGWL 1U95B 3D0VB 4ZXBB 5EFIB 4NP4L 1GGUA 3RU8H 1WIOA 4RNRA 3IFPA 2GJZB 1LO0H 4N0UA 1JNHB 1ZHKA 5HYIA 1BJ1J 2ZUQC 3K74B 4X6DF 4OKVB 4LKXA 4OB5L 1XAUA 5K9QI 2GCYB 2H2SC 4FQHA 1VENA 4OZFB 4MJ4A 5JPMB 4OI9A 3LB6C 1UM4H 5I1KL 1EVUA 3I50H 5C2BL 4RWHA 5F9JB 4MA7H 5H37G 2OZ4L 5HVHC 1C1EL 3DIFA 1ZOXA 3U7WL 3DBXA 2CMRH 3QXVA 1UH3A 2AV1B 2PCPB 3X14A 4XPGL 2IG2L 1F97A 1P7KB 4GJTB 4XCEA 1PLGL 5EU3B 5HHPA 3UXFA 4TSAH 2O5ZL 4XNXH 1TPXB 4HEPG 4P2OC 3ULVF 5D7LB 1HHIA 4XNYL 4CN6A 5C6TL 1J05B 2ADFH 3B6SA 1S5IH 5IESH 1OLLA 3WDHA 5KSVB 1MELA 4Q2ZA 3T4AB 2GT9B 4L29B 1L0YA 4P46A 5ICYA 4AH2B 1TQCC 3EOYG 1IQDA 1G7JB 5DA0B 5FECA 1G7LA 1RZJH 5DK0B 2XI9A 4G6KL 3BE1H 4RX4D 4LCYA 2HTKD