4HFWB

Anti rotavirus antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
EFQLVESGAEVKKPGASVKVSCKASGYSFTSYYVHWVREAPGEGLEWMGMINPSDGSTYYAQRFQPRVTMTRDTSTTTVFMEMSGLRSEDTAVYYCARGVVGATNEIDFWGQGTTVTVSSASFKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 6-26 Fab Light chain
publication title Human Rotavirus VP6-Specific Antibodies Mediate Intracellular Neutralization by Binding to a Quaternary Structure in the Transcriptional Pore.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 221
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hfwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hfwB01
1U8JA 1P7QD 3KLHD 4YO0B 2J8UF 5C0CA 2QBWA 4PRHB 3QIUA 4QY8B 3QB7C 1P2CA 5HHXL 2R1XB 2BVYA 5E08L 2ZCHH 4YFEA 3IB4A 5IVXE 4J2XA 1KLUA 3T77A 2R1WB 1XR8B 4WEBH 1NAMH 4I5BB 5JHDB 1CK0L 1I7RA 2VDNH 3PGFL 4D8PA 2FNBA 3Q5OA 4UI2A 4JO4H 4H5SA 1VGKB 4MD0A 1ZGLA 1QNZH 4NCDA 4D0DA 2BK8A 1JYWA 2C3WA 1MVFA 1F45A 1BQLL 1QHOA 2DWDA 4NT6B 5CMAB 3IF1A 3VG0L 2OSLB 1XGUB 4MAYD 4RGOH 3QDMD 4H0HB 1RHHA 1A47A 5DD5H 4JHAH 1FH5H 3ULUD 2YUZA 3AUVA 43C9B 2Z91B 2C9AA 1D5XA 4OBRA 4QRRB 5AZEL 4PJBE 4DFIA 4MHHI 3GSWB 1Z9SA 1T21B 4L9LB 3B2UD 5JA9A 2ITCB 1QO3B 3S4SA 1U8OA 2EDWA 1A7OH 4N1HB 5HHNA 3MROB 4UIMA 1A1NA 2FD6L 1GAFL 3KDMB 5C0CD 5EORH 3QIUD 2IADB 4HIIA 4H8WL 1JYVA 4C55A 3ULUF 4G8GA 3SE9L 4S1DC 4BH7A 3MBXL 3IDXH 1JJUA 5FECB 1SMOA 3C5ZB 2GY5A 2EEBA 2VZVA 4M43L 3TIDB 4WHTB 2Y23A 4JGMA 2B4CH 3I6KB 4ZYKA 1R3LA 4PGBB 5GGUB 2XTJC 4ZAKA 5GZOC 3GSQB 4IRJB 4R4FL 5FYKU 3VXTB 1S7TB 5F3BA 4OLWL 1QEWB 3DWTA 3VCLB 4JFQA 1ZXQA 4G43B 2J5LC 4OSUL 1AGBA 3RA7L 4JFZH 1KCLA 3IU3B 1HQ4B 2VLRE 1CL7H 3VGHA 3ECBB 1KT2A 4HEME 3JWOH 3VMOA 4LGPB 3VWKB 5JW3H 1CLZL 3DI3B 4GRWB 3C6SB 2WIIB 5I71B 4ISVB 1NJ9B 2XN9E 5IESH 5BQ7B 3JV0A 3LPWA 2Z35A 5GGSA 4PFEA 2Q1EA 1JF6A 3GMLB 3U9PH 2QSVA 4JCLA 2GEEA 1A3QA 3GGWB 2ED8A 4LPYA 2XA8H 3MRPB 1FFNA 2AJZA 3QISA 5AWNH 5D7JA 1KBGL 4M8VA 4G8GD 2VABA 3DMMA 3WS3A 4BA8A 3LKRB 2NY2B 1P7HL 3G5VA 3VFPB 1QSVA 3RU8L 3VJ6A 4ZAKD 3QNYA 1NBYA 3TCLA 4RGMB 5ICZA 4YIQA 4GAGL 4NO5B 1QRNA 4RMTA 1YC7A 4U6YA 3HI1A 3BXNA 4NNPH 1AXSA 1NGQL 4PY7A 2CGRH 5E4EC 4JN1H 5IKCA 2FR4B 5C71A 1BJ8A 4QYOA 1P4LB 1BHGA 4NQTA 1WWCA 2HN7B 2WWMC 2RAMA 3CIQA 4JO1H 1ZT4A 2DL2A 3EOAB 4YGVB 1OAZH 4K8RD 4NBXB 3RDTB 2VZ1A 2XIDA 1WBYB 3PQYB 4BK4A 3JV4A 3KPRA 3NCEB 1P9MC 4I4WA 5F1IB 4ZFFA 4C56B 2HKFH 2I24N 1DQDH 1G7PB 3ALWA 3CAFA 3KPQB 4RA3A 1KTKE 1MELA 3ZSSA 1BQHA 5I30L 1A1MA 1U95B 3FO1B 5E4IA 5FOBA 4PV9A 2HA1A 5D7JD 2F54B 3BVNB 5DD3L 1IGTA 1PY9A 4JDZB 3FQNA 3P11H 4YFLI 3H9ZA 2EICA 3DMMD 4Y2DB 1HKFA 5BOZG 4XVJH 4U6HB 2D7OA 1NMAL 2UY7A 4L4VA 2XZZA 4HS8H 3MCKA 4I0PA 3FO0H 5HHPA 3CVHA 3WBDA 1YEFH 1CBVH 1ZLUH 4GUPA 4XVUD 1X6NA 3JV5A 1QRND 1CLOL 2BVPB 5JQ6H 3GSXA 2VMFA 5TGBA 3RVXD 4GW1A 3NH7H 2VITA 2W0KA 2DMBA 5CP7B 3TVMA 2VISB 3HE6B 2CH8A 5I1GH 4EIZC 4XP1L 1PG7X 1Q72H 4UAOB 4LHQB 1B6UA 5DQ9B 2J8UE 2OM5A 1ZT7B 3OHXB 2E7MA 3VH8G 1FGVL 1J0YA 1A64A 4U1MB 4X98B 1V05A 2VOTA 4XPHL 2EXWD 4KJPD 3PP4H 1NANH 4GSDL 3VE0A 3EOTL 3KPRD 5F9WC 3QJFA 1M7IA 1E28A 3MRLB 3Q2CA 5E03A 5ITBL 3GSOA 1XF2A 3CLEH 3FMGL 3MA7B 1OPGL 1WT5A 3A6OA 3FOMB 3H42H 3FO9A 4UU9A 3X3FL 1OSPL 5K9OB 4YHLL 2DN7A 5F70A 3OAYH 1BD2E 4LSDA 4TSBL 4EQ3A 5IIEA 2FLRT 2P24B 3CSGA 4NKDB 2X7LB 5E8OB 2IANE 5D9SB 2MTPA 2J1KA 1BBDL 1BOGA 1HKLL 4L4VD 3MV7E 2ADFH 4I0PD 2DLTA 4R96A 4D9LH 4AH2B 3DX6A 5MERB 1VSCA 1OOAA 1EFXA 2BFVL 4KKBD 1FNHA 4NJ9H 43CAA 3QIBC 2G2RA 3OKDB 4QXGL 3RWHA 4HHAA 5CWSB 4B50A 1WAAF 4Y4FC 3K46A 1SM3H 2NY3C 2K1MA 4TTDD 5ALCL 5J1AA 4AT6A 3TVMD 1ETZA 1IM9B 5E6IC 1BM3L 3UJJH 1H8OA 4D0BA 5HJ3B 4AZ8A 4D0CB 3R8QA 2EO9A 3VDAA 4KQ4H 3QO0B 3QDME 2YD5A 5JO5A 1AE6H 3TBYA 2ICWI 3BW9B 3ULUE 3NA9H 4H25B 3HZYA 3RI5K 1KCSL 4YPJA 4WW1A 3LSOA 3MOBH 3S7GA 3RL2B 1I8LC 3MA9L 1J12A 1U36A 2XNAA 5I19L 3U0WL 2IH3B 1U8HA 3BX7C 3KYMA 2W60A 1T6WA 4XH2A 3S37X 2GW5A 3F58L 5TJWK 5C8JA 2HTKC 2P48B 1WC7A 4GQ9H 2X4PA 3UC0H 3C60A 1IEAB 1XZ0A 1YECH 3TH2T 4IS6A 5C70A 3Q6GH 5LGHH 1RULH 1T89C 1NCDH 1F3JA 4PJ5B 1KCRL 2IPUK 4UT9L 1KIRB 2W0LA 3DRQA 1OLLA 3E6FA 5ADPH 3QCTH 1SJXA 1EFXD 2BNUA 4WUUA 4GBXB 4DZ8A 3WHE1 5DWUH 3BZDA 5LGJB 4B0MM 4OIIH 4WWKB 5I73B 1PAMA 5DTFA 4RFNB 2EDFA 5CEYB 1T1XB 4XI5D 1IC5H 4N0YL 1FNSH 2C3VA 1TQBB 1UWGL 1SBBA 3IDMB 1XIWC 3D48R 4OCWH 4YJZL 1MWAB 4PB9H 5CIPB 1NGPH 4S1QH 2EC8A 4ZUUA 5GGVY 4Q9RH 3C8KB 2E9BA 5C0JA 4GKSA 4PTUA 4UBDD 1DQTA 3VXMB 1N7ML 4JFEB 4R0LB 1EO7A 4XMKH 3MLTA 3LKQA 5DMKB 3TN0C 5FHBL 5J13B 5FYJH 5ID0A 5T3XL 1YEIH 1UH2A 3WNKA 3GHEL 3O6KL 5DK2A 5IJVB 1Z9MA 3QEUB 2EH7L 4U6TA 3JTTB 5EOTA 3GUTB 3C60D 4OLVL 1BBJB 3CH1B 3EJZD 2H26B 2BSSA 2YKLL 3X17A 4MJ6A 1NGZB 3N1MC 5DLML 3WIIL 3S9DB 1VERA 4JKKA 4X4YA 1B4JL 5EWIL 1KXQE 2YZ1A 4WUUD 2FYYB 4Z95H 3IFLL 4HK0B 2NY6C 2AEWA 1PJ9A 4OV5B 1IGJB 4QRRE 2PUQT 4TQEH 5DS8B 2Z31C 3LKSA 2PR4L 4JM2B 5HTSA 1AXTH 1ERNA 1QBLH 5CSZB 1XGPB 5EIIA 1WQVT 1MCIA 4LVOC 1MCLA 1JZ7A 4IRSB 1KN2L 4MXVF 3PWVA 3EO9H 3LDBB 1BEYL 4FZEL 2R2HA 1WZ1H 3WXVH 3VXNB 4CU7A 4K94L 1HDMB 3SE4A 4CRPA 3OB0K 4WJ5B 5IMOB 4PJGA 4HGMA 4J6RL 2Q7YB 5C0AA 2AVGA 5TPWH 1FE8H 5T33L 4P3CL 3PWLA 3ZYJA 4G5ZH 3QUXC 3BKJH 4XP5L 2NY5L 1INDL 1FIEA 2G5BB 2V17H 5MENB 3W0WA 2WK2A 4GMTH 3HNVL 4KQ3L 4XPBL 9CGTA 1QFUH 2NCMA 1DE4A 4X99B 4PJXF 5BW7A 1EHLH 3STLA 3LEYL 2XQBL 1F90H 2IQ9H 3MR9A 1LO5A 1JNNL 3VRJA 3IXAB 5DI8B 3JWDC 1OGTB 1D6VL 3WDIA 5D71L 2VDRL 4V1DE 4EN3C 1UKQA 3LIZH 4LPUA 1LEIB 2XACC 4ZUSB 5D70L 2H45A 1VPOL 3R06A 1U8NA 1KGCD 1TCRA 1KN4L 3W9DB 1Q9LA 2XZCH 2ENSA 1BWMA 3RWEA 3EHBC 1YEDB 1A9EA 1EEYB 2DWEA 1TMCB 2Z8SA 3DUHA 5IQ9B 2DQHL 4E0RA 4MSWA 1IGIH 2L4OA 3FOLB 1ZANH 4FQXA 3K2MC 1W0VB 4WI4A 5K59F 5DMGC 3WLBB 1RZKL 5C3LD 3QAZC 5F8QC 3WL9A 5DURD 4TNWK 4AL8L 3DBXB 1OCWL 3ELAT 4KROB 3AREB 4L4TE 1YA5A 3DETD 2K3TA 1UH4A 4F37K 2PYEB 3HI6L 2VQUA 3GO1H 4GKZB 2YPLB 3KYNB 5D8JH 1HZHL 3DSFH 5K93A 5JOPD 3CC5A 3KPRE 3P0GB 1RUKL 3R4DA 4FXLA 4G3YL 3BKCH 4UT7H 1FORH 5KN5A 2ADJA 5DD6A 3MRKA 4URTB 1B0RA 1JF1A 1T1YB 2B20A 3NPZB 3ZYOA 3K0WA 1CG9B 4ZG1A 1T20B 2Z0BA 4TNWF 4LARL 2J6EL 5AYUL 2W1NA 3VFRB 3HS0A 4JRYB 2V7NA 2VZOA 3GMNA 3RWJA 5HHXH 3B5GA 4MA3B 5E08H 3WJLC 4WFGE 3WMSA 4K3DH 4F37F 2XKNB 5HDLA 4DK3A 1CK0H 3PGFH 1XF3B 2DBLL 1BMGA 4NOBA 3RGHA 4JY5L 1DUZB 5CD5C 5TE4L 5F96L 3PQYE 4FQXD 5EBMA 4L8SB 1KTLA 4X6BB 4HWZA 3SDCA 2YWYA 5EZIL 3BD3A 1BQLH 2GTZA 3VG0H 1WJ3A 1M6OB 3RVWC 5E94B 3S37L 1WIPA 2QL1A 3WXWL 1TPXB 4DTGL 3LKPB 1PYWB 3JUYA 4MAUL 1MWAL 3BUYB 4YUEL 2DKSA 3CD4A 4WHYG 3DURA 2CKBB 5AZEH 3MLWH 3QDHA 1GC1C 4HLZH 3TO4B 2XA3A 2LVEA 1YEEL 4XBPB 3BO8A 1IAOB 5ETUB 4QXWA 4H88L 2FL5A 5IGXL 5EB9A 1JZ4A 4KV5F 3WFHA 2VKXA 3DIFB 1FL6A 3PHQA 1Z3GL 4JY6A 4P4KA 2KDGA 2V7HA 4ZPTB 1RURL 4FOMA 3DYMA 1GAFH 1OM3L 5D6CB 4H8WH 2HG5B 4MQXD 4U1IB 1LDSA 1VACB 1AD9B 3SGDI 3LEXA 2AERT 1IGYB 3L3GA 3RAJL 1NDGB 1H15B 5DR5L 1LWRA 3B2UC 3SE9H 1A21A 3MBXH 5D5MA 1X6LA 4M43H 1KLFA 2HRLA 4P23A 3EBAA 4L3CA 2CDFA 4RMUA 1TETL 3QIUC 2X9XA 4HKJB 4LSQL 4R4FH 5GGTA 1M1SA 3SDCD 4Z5RB 4AMKL 1C08B 4OLWH 3V79C 3PV7A 2ZP0T 3QO1B 4U1HA 2FGWL 2PYFA 2BY0A 3RA7H 3MUGB 1NGWB 4FHBD 5HDOA 1V5JA 1D5ZB 1Z5LA 1UM4L 1CD0A 1IC7L 3ZKND 4N8VA 1VESA 2P49B 1SY6H 4WHCA 5SWSA 3PHOB 1L0YA 3MLRH 1AH1A 4YK4B 3GSUB 1J05B 4OZIB 4DCQB 2NR6C 3SKJL 5JW5A 4LFHD 4MA1B 3BAEL 1DL7L 1C8PA 2XXMB 3MRRB 5C0FB 3G5YA 4P4KD 1ZWIB 2OTWA 3FQXB 5F1NA 2P5WB 4ODUA 3SDDA 5J3HD 3O11B 3VFNA 3KPNA 1PX4A 1KBGH 2R39A 1HCVA 5IR1A 2H1PL 3BDXA 4MXVE 3QXDA 4FMKA 5BVJA 2XZQL 4P59L 4HQQL 3QHZL 4JDTL 1A6ZA 4I18A 4P23D 5DA0B 3SCMB 4R3SA 4WUUE 3D69B 3RU8H 5D7KD 3DVNB 1I3UA 4LSTL 4EDWL 4FXKB 5BRZA 3SQOH 5DFWH 3RZCA 3MNWB 3H3KA 3S98A 4GAGH 5HPMB 1YPZB 5CJQL 2VLJB 4C4KO 5ENWB 3WNOA 4PJXE 1NGQH 4Z7QF 1F8TL 3NA4A 2ZUTA 4RFEB 1HH9B 3KHQA 4NQXB 2HVJA 4BSWB 1D3CA 4XCEB 2ZSVA 4F3FB 2X1WL 5SWSD 4Y5XB 1YEJL 2HJLB 5K9KB 4HF5L 4HEPG 3K74B 3LQZA 3B6SB 3O41B 1CE6A 3PABB 3QDJD 4F7EA 1GGIL 3WHE0 2CLRA 4YC2C 3O0RL 5JNYA 1U58A 3DI2B 2BXZA 4UUJA 4LF3B 1UWXH 5GZND 3DVIA 4AY0A 5AZ2L 5IW6A 3SDDD 4BUGA 2IMMA 4H26B 5I30H 4K8RC 4NQCD 5DD3H 3GHBL 4MXQD 5SX5H 3KS0J 5K59E 1D5MB 4MCZA 3LS5L 4ZFZB 3UDWA 2IFFL 5C9JA 2BC4A 3BDBA 5B38G 2Z4QA 1WUNT 4FXGB 2Y25A 3MNVB 3I02A 1NMAH 1MI5E 3N1FC 4NO0A 2MCPL 1T1ZA 2V2TB 5D7JC 4NO3B 1FN4A 2VH5L 1OARL 4YDJA 5BRZD 2ED7A 3DMMC 3RZCD 2P4AB 2GAZA 2HJFB 1CLOH 3LB6C 3O3EA 5KSAB 5GIRA 4E42A 1E4WL 2CRYA 5ESAB 5IB3B 3MPCA 5FOJA 4K9EL 4G9FD 3HR5A 5MI0C 1A0QH 4X5XA 3WDJA 2YXMA 1BVZA 5EPMB 4XVUC 1UFUA 4XP1H 4Y8DC 3TJHD 1XF5A 5JIPA 2EDKA 5KSBA 3ILPB 1EUUA 1FGVH 4PJGE 1ND0A 4XPHH 4ZPVA 3RVXC 3NTCL 1FL3B 5FB8B 3PWJB 2IWGA 4GSDH 3EOTH 2PTTA 1FFRA 2H2PC 4OZIF 1T80A 5ITBH 4U3HA 3QQ3A 4XXCA 3STZB 5KTEL 2CXGA 3D39A 4LNRB 3X3FH 4TRPL 1OSPH 2QKIA 3O4LA 4YHLH 2X1PA 3A67L 3QJHA 2EXWC 4KJPC 1ZA3A 4TSBH 4ZXBA 1GGUA 4L8BA 3WKNA 1RFDL 4M7KL 4NYLB 5KZCB 1HKLH 4HS6A 5FUZH 4NO0D 3HAEG 5ACZB 3FAXA 1MCWM 3NGBC 5D2LB 3VMPA 4FS0A 2CXKA 1KACB 1YY8B 3T1FA 2VR5A 4RRPA 3FTGA 5CCKL 2BFVH 1FO0A 2J88L 3TPUA 2I5YL 1S9YA 4PLNC 5BZWB 4PGEA 2WSKA 4QHKI 2BSRA 5B22A 1BP3B 4QXGH 1L7TL 3LV3A 4I0PC 5ALCH 3KHOA 4F33B 1H8NA 1A6UL 1D5BA 4KV5E 1WCBA 5HHOB 1BM3H 5IB2B 3S96B 1NGYB 4PRPA 1BAFH 5E24E 4S1SL 1F4YL 3T0EB 4RSVA 1AP2B 1DQLL 1QQDB 2UYLB 1JUFB 2Z92B 1LK2A 4TTDC 1CF8L 1KCSH 3EUUA 4JR9L 5DJXB 3TVMC 5HY9B 5I8EB 3FQWB 3CSYA 3O45A 1YN6B 3KS0H 1FJ1B 3CCHB 3D39D 3ZTNL 3MA9H 5J6HA 5C1MB 5I19H 3U0WH 3O4LD 1V3LA 3ZE1F 3OGOE 2VYRE 3ESVF 1NCUA 3F58H 4ZXBD 4MCYA 5ANMA 5ABDE 2APTA 2DQJL 2E6JA 2OCFD 2A9ML 4AQOA 5GRJL 1HWHB 5I1EL 1WT5C 5KSBF 2PW1B 4L3EB 1SJVA 1KCRH 4UT9H 1BVKA 2DLEA 1KLGB 2YEZB 4PJFB 1K4DB 2HP4A 3NIDE 4PY8I 4R97C 2PYEE 3F7VB 3L5WA 2D31B 3K8LA 1FFOB 1YJDL 1JPST 4N0YH 1JNJA 25C8L 1UWGH 5IK3B 4ACPA 5I75C 1KTDA 3LRSB 2Y6SD 2F53A 4AM0A 1U3ZA 1Q9WB 4XAKD 3EGSB 1SY6A 4PRPD 4QGTA 4P4RA 5IB5B 2DYPB 5TDOA 1X5XA 4JKLA 4BSVB 4R2GD 1BZ7B 3NFNA 3WIHL 2FX8L 3QUZA 4JM4L 1TZHB 1FNGB 1N7MH 4PIRF 4NKOB 3QG6B 3QYCA 4JRYE 3TFKD 4BQCA 2FX7L 2EKSB 3IDNB 4LRNL 4JFFA 5CSBA 2JLLA 3N9GL 2FLBT 4LGSB 4GS7C 1R24B 4W6XB 1NMCB 3KPLB 2QSCL 3GHEH 5T3XH 3N1GC 3O6KH 4DK6A 3OV6A 3PL6B 3DUSB 4UBDC 2MWCA 3O3AA 5D6DA 2EH7H 5L2JB 5HHMD 35C8L 5F7HA 2HMIC 2X4TA 3F6IA 4OLVH 4IOSD 5B4MD 3D0VA 2BERA 3LCYA 1JZ2A 1AO7A 2JB6A 3O9WA 4OM0L 2YKLH 1AFVL 1X4XA 3C8DA 1WVZA 1AGDA 4WFED 5DLMH 1B4JH 5EWIH 4N0UB 2DQCL 1B0WA 1L4IA 4JZJA 5D5ME 2EIEA 3C60C 5IB1A 3IFLH 3ZTJG 4JANA 3X12B 1FVDB 1OW0A 4QRSB 3ZKXB 2B4CC 3H0TA 5D7KE 1JYNA 2PR4H 1GPOL 3CGTA 1LILA 1CGWA 1ZVHA 3GBNL 4LVNB 1ZSDB 3ROLA 2J3SA 1MFCL 4M1CD 3WO4C 2X41A 3TZVA 1K5NB 1KN2H 3WYRA 4HH9A 5C08D 1BEYH 1XGQA 4FZEH 4PGZA 3QUZD 3R0NA 3VMNA 5FYJE 1ZS8A 4K94H 4NRXA 3SJVE 3V6ZB 1FNLA 4J6RH 1RUPL 2FBJL 3C9NA 4KI5D 5FM8A 1BFVL 1QYGL 4JFFD 5T33H 1I1FA 4OZFH 3QI9B 4P3CH 2GT9A 1FZJB 1WIOA 4K23L 1MCOL 3QDJE 5CBAA 4QWWD 3G08A 2NY5H 1INDH 3L7EB 4NQSA 3HNVH 4KQ3H 4XPBH 2D7TH 5DDHB 2O26U 3MC0A 4MJ4A 1ZVSA 2G9HA 4YHML 3UPCA 3UTSB 2XQBH 4YHPB 5A2IH 1AO7D 1JNNH 3HMXL 1KJMA 3O9WD 4KRPD 3QULB 4U1GC 1A1OA 4NQCE 1D6VH 4NQEB 4LNVA 4YO0A 3HG1B 3HCVA 5D71H 1YN7B 4PRHA 4QY8A 3TH4T 3UMTA 1DN0A 5D70H 3RBSA 3PGCB 1VPOH 3DXAB 2ARJA 1KN4H 1MQKH 1WLHA 3SE3A 1DBKH 2R1WA 1XR8A 4BFIB 1IGCL 1Y6KR 3DO3A 2FO4A 6CGTA 1VGKA 2DQHH 5BRZE 4LCYB 2D3VA 1S7SB 4NC0B 2UV3A 4OZHB 4B7LA 1Z9LA 5E2TL 4QXTB 3TZVD 1RZKH 2OSLA 3PUCA 1XGUA 4G9FE 2NY7L 5HGBB 5DRXB 4X7SL 4AL8H 5T1LB 1GRWA 1OCWH 43C9A 3C2AL 1F13A 1K85A 5D7IA 2ZUXA 5I17B 4CUCA 3CXDL 5DJDB 3HI6H 3LH2L 4GG6F 4MA8H 3AMKA 1HZHH 4OCRL 5AG9A 2GJ6B 3GSWA 3SE4C 4TYUA 1RUKH 2VXTL 3O6FB 1T21A 1KEGL 4G3YH 3TA3B 1WFUA 2ITCA 1N0XL 3KYKL 4XVTL 4Z7UF 4GT7A 4YFLF 4JKPL 4MJIA 2Z8VC 3MTRA 1RZ7L 3HUJB 3LMJL 5T5FL 3VFWB 4PRHD 1ITBB 1H5BA 1J9CT 4FFVD 3QWQB 1T1WA 4LARH 2ICWA 5AYUH 1MNUL 4ZD3L 5BW7C 4M7ZC 1E6JL 1E4KA 5FECA 3QH3B 3C5ZA 4F9LA 4WU7B 3TIDA 4WHTA 1LO4H 4R90L 2AXFB 5I8KL 3I6KA 3N06B 4KKCC 5GGUA 5HGDB 2DBLH 1AGFA 2P7TB 3GSQA 4IRJA 4UDUB 4JY5H 5TE4H 4QRUA 1S7TA 3ZE1E 5EZIH 3U1SL 5J06A 3Q1SL 3VCLA 4BH8B 1C5CL 3WUWG 2E6QA 4QT5A 1U0QA 3IU3A 3S37H 5CJ5A 1DN2A 1S5IL 4X6EA 5DK0B 4DTGH 3O3BB 1ORQB 3L3DB 4BSJA 5KSBE 4FQXC 4MAUH 1MWAH 4NRZB 4PGDB 3T2PA 3C6SA 5C7XL 3QEHB 4ISVA 4MJ5B 3ILQD 4MD4B 3LEVL 3B3IB 1QPXA 3UBXI 1YEEH 2J2ZA 4J3WA 4Q6IA 4H88H 4BM7A 5IGXH 4MJID 5F21B 1UB5B 3GMLA 1E4XI 3U79A 3O4LE 5C6PB 1Z0NA 2ZSWA 2HVKB 2OL3L 4L5FL 1Z3GH 3GGWA 4LSVH 1QFWM 3NIGF 4X6DA 3S5LG 1EVUA 1RURH 4EKXA 1CICB 3SKNA 2DMKA 2OTPA 1OM3H 5E00A 5GS1B 4W70A 4YNYB 1JTPA 3P9WB 5DR5H 5GRZA 3C5ZD 3L3OB 4L29B 3ABZA 4R4BB 3LKRA 2PTUA 3EOBB 1UXWB 3VFPA 1TETH 5IM7B 4YDLB 1WBZB 4IRJD 3VD4A 2GSIB 4MQXC 4LSQH 4RQQA 3BEWB 3QDGE 1M71B 5F7YC 4AMKH 1EV2E 2E9WA 1TZGL 3AXLA 3CU7A 3VFUB 3HLAB 2FGWH 5HVFB 3EYSL 2NQCA 3UZEA 4QLRA 1IM3B 2AV1A 4XAKE 2VN4A 4WFHD 3TH3T 3V0AC 3NCCB 4PRPE 2FR4A 1UM4H 1IC7H 5FO8B 3SDCC 1OSZB 4XC1L 3VI4F 4C59B 5I1KL 1FBIL 4EUPG 1A6VL 1JGUL 4YGVA 3V8OA 5FCUL 5F71A 3RDTA 4Q2ZB 3ARBD 3HZKB 1IILE 1PZUB 1WWWX 3LN5B 1HXMB 2XWBB 3SKJH 1WBYA 5IHLB 1S5HB 3BUTA 3BAEH 3ZKNC 1DL7H 4C56A 1Q9KB 1G7PA 4ELKA 5F89B 4DJMA 4OLXL 3FO1A 2F54A 3BVNA 1KIPB 1OD9A 3AY4A 2H1PH 4Y2DA 3X11A 2FBOJ 1CGTA 4P59H 3Q5YA 4HQQH 4JDTH 1QRKA 1I7ZB 1OGAB 4YAQB 4WFEE 3T0EE 2A6JB 4P4KC 3ULVL 1W0WB 3F8UB 1DVFC 5J3HC 4O2EB 5D7LB 4LSTH 5FM4A 1OP9A 3FB8B 4EDWH 4EI5B 4HBCH 1A4JA 4P23C 5CJQH 4Q58C 4JLRB 1YZZA 5C0EB 4N0FB 3TYFB 1K2DB 1F8TH 1HHIB 2YD3A 2VISA 3HE6A 1BGXL 3TBVA 3ARGB 3G6DH 3MJ7A 5F7EL 3CVIL 4OZFA 3EYOB 5C08E 5T3XD 4P2OC 1RZJC 5DQ9A 1A6AB 1YEJH 1ZK9A 3I6GA 4HF5H 5E8EA 3RDTD 2NY1B 5FKPA 4JN2A 1GGIH 5E5RB 1DLHB 3MRLA 3O0RH 4DWHA 4A2LA 1TVBA 3CFCL 1IZJA 3MA7A 4XB8A 1G7LB 2MHAA 3FOMA 5EBWB 4PR5B 5IUSA 2QADD 5AZ2H 4HUWB 1MPAL 2AJXL 5EFIA 2C4FU 3Q48A 5DJAB 2F54D 5B39A 4P0DA 2P24A 5E5MB 3GHBH 1O5DT 1GZQB 4Y2DD 3LS5H 4NHUA 4NKDA 2X7LA 5E8OA 3L95A 5D9SA 1G9NC 5IMMB 3EYFB 4JFOA 5GZNC 5D4QA 2X4SA 1Y18B 2MCPH 3SDDC 4AH2A 3WD5L 5MERA 1IE5A 5GS0C 3BIKB 4MXQC 2B2XL 2GFBB 2VH5H 4GG6E 4PLKD 1OARH 4O9HL 2ENYA 4OF0A 2XKUA 4I18C 3U30B 3GI9H 3GMPB 1LNUB 3MV9E 5CWSA 1E4WH 2CO6B 4R4NC 3UTPE 1TDQA 2ZOLB 3Q6FB 4K9EH 4Z7UE 1IAIL 3GJEB 1TJHL 1C1EL 5D1ZB 2JB5L 1NFKA 5F7MC 5TDNA 5HYFA 3S4SG 5CZVL 3OXRA 4POYA 2ZG3A 3QO0A 5ESQA 3P30L 5BO1L 3RZCC 1EEZB 3L5HA 5C0BE 3RWDB 3O3UN 1J8HB 4MLSA 1ZGLM 3BW9A 1H3UA 3MRHB 4A6YB 3RKPA 4H25A 3W5MA 4LEXL 1YUHA 3NTCH 5ICXB 3S6CA 1KELL 1UVQB 4WW2A 2HLFD 4OAWB 1OAXL 3TT1L 1EJOL 5KTEH 3TJHC 4ZFOB 1IAII 3EO1B 4P2CG 3DX8B 1MY7A 3A67H 4I2XE 3GMRA 3SO3B 1IEAA 1H9VA 1RFDH 4M7KH 4QHNB 3VGAC 2XI9A 4PJ5A 3RKDD 1KIRA 5J57B 2GSGA 1N6UA 3BRFA 3QZWA 4YPGB 1JK8B 1VFOA 4GBXA 4LLWB 3C5JA 2YR3A 3UDWC 1FYTA 5LGJA 1CWVA 4ZNEA 2J88H 4WI8A 3CUPB 4WWKA 2I5YH 4YXHL 3BPLB 4KDVA 1OP5K 4NSKB 2E7BA 4QRTB 1BQSA 1FRGL 2DDQH 2FEEL 1CFVL 1L7TH 3KXFB 1DEEB 2PO6B 1A6UH 1NEZA 3INUL 4YHNB 1MWAA 5CIPA 3NIGE 2EYSB 1H3VA 1F4YH 1AXIB 1DQLH 4XPAL 1MRFL 3VXMA 5DUBB 1A6TA 3OAUL 4JJ5B 1DBAL 2E6PA 1CF8H 4JR9H 5DMKA 3RWGB 2WBKA 3MOAL 4RAHA 1A9BB 3V6FB 3ZTNH 2COQA 5DO2D 4KJQC 4CMMB 5IJVA 3W11C 3T08A 3JTTA 4U3CA 5TH2A 5J6GB 5FGRA 3GUTA 3CH1A 5CJ8A 2H26A 2A9MH 4ZSOA 4XXCC 1TJGL 3U9UB 5I1EH 4PJ5D 1NQBA 3OJMB 3ETBF 2DLFL 3L5JA 3VH8B 5HVWA 1HXYB 3VI4E 4GBXD 2FYYA 4ZXBC 3GSNB 1FYTD 2H2SD 4HK0A 1XGTB 2ICCA 4I0CC 1IGJA 4KMQA 4WNQB 1DJSA 5DS8A 5A3ID 1BF8A 1KULA 5SV3A 4JM2A 3KJ4C 5CD3A 5KVGL 3OKMA 3HPJA 5DRZB 4AEHH 5CSZA 1G0XA 1CFQB 25C8H 3P4OB 3CFDA 5DQJB 3O8XB 1QFPA 3IXTB 4NFDA 3CXHK 1K4CB 3CFEB 2F19L 4Q0XL 1BQHG 4OZGF 4PJEA 3IGAB 3VXMD 1NCBL 4WFHE 2K7PA 3WIHH 2FX8H 3OL2A 3OXSB 4G6FD 2AJUL 3MCG1 5IMOA 2Q7YA 2NNAA 1DUYB 1I7UA 2HJKA 2FX7H 2Y6SC 1CXLA 2PNDA 3ZHKA 4LRNH 5GPRA 3N9GH 2R9HD 4HIXL 1U8LA 5C0DA 4R2GC 3U36A 4EDXB 2G5BA 5MENA 3SGEH 4DKEL 35C8H 4CMHC 1GXEA 1I9RL 4X99A 1G7HB 4RMRA 4FQJL 2Q20A 1MVUB 4OCNC 3IXAA 4WEMB 5DI8A 1OGTA 4DUVA 4OM0H 4WU5A 5H37H 4IEFB 1Q94A 4UQ2B 2A73B 3T1WA 4HWEL 2DQCH 3M45A 4K7FA 4X9HA 3W9DA 1U8KB 2R69L 5BJTA 1R3KA 3BHBB 2P43B 3MGOB 4O2CB 1HCFX 3TNNB 5IV2B 3E0GA 3FT4A 1GPOH 5EU6B 5IQ9A 3VFOA 1HYSD 3GBNH 1JTOA 3O2DA 1MFCH 3WLBA 2G60L 1MCCA 1IEBA 3S36X 1CFBA 5DF0A 3KPMA 4FA8A 5TQ2L 3DBXA 4Y8AA 3TIEB 1JRHI 3IETA 3JWDL 1U41A 3FCTB 4CADB 1RUPH 2BVOB 1CGVA 2FBJH 4NO2A 4PJ9B 4M1CC 1BFVH 4P46B 4OF3A 1N4XL 4GKZA 3KYNA 1LGVA 5LGKA 5JDJA 2EECA 2IPUG 1MCOH 4JPVL 4K23H 2PCPA 5MEND 1X5YA 3QUZC 4Y5VA 4RMQA 3WN5B 4ORGA 1U2HA 2QQKH 1T04A 2ARWA 2FGZA 3FQUB 3NN8B 4OGAD 1QFWI 4YHMH 1CDUA 1K6QL 2ILLA 4KI5C 3V4VH 1T1YA 4RCAA 3RP1A 4U6VL 1N3NB 2CIKB 4PJEF 1HIML 1YNKL 1T20A 4OFVA 4QWWC 5D6DC 3VFRA 2WBJB 4QHUB 1XCQB 4OD1L 1O0VA 1TTUA 4MA3A 4HIJA 1HQRA 2NXYB 3X3GL 4U1LB 2XT1B 1IGCH 3O9WC 4IDJL 4KRPC 1XF3A 1IEHA 3P4MB 3KPSB 1G7QA 2VLKA 4F15C 1F42A 3DHJA 1IAKA 1UQSB 4JZJC 4X6BA 5DJ8A 5E2TH 1OW0C 2NY7H 5E94A 5A16A 4POZD 2ZWLT 4KROD 3DV4B 4K3EH 1S9XB 4X7SH 2GKIA 1F97A 3QUML 3TO2B 1FFQA 1PYWA 3C2AH 4U7SA 2QEJA 2GQHA 2HTLD 1I7TA 3CXDH 3NCYS 2H6PB 3LH2H 2CIIB 3TZVC 3BPOC 4OCRH 3TO4A 5IBUG 3RRQA 1E6OL 2A1WL 4GAYA 2VXTH 1IAOA 3UJIH 4LDLB 1LO3L 1KEGH 3BMVA 5CAYB 5EC2A 1C5BL 1N0XH 3KYKH 3B43A 4XVTH 3W39B 4LEOB 3DIFA 4JKPH 1EERB 4ODXA 1RZ7H 2D7PA 5EOQL 3VFTB 1HSAB 3LMJH 1F4HA 4OF8A 1LMKA 5T5FH 3MNZB 1B2WH 1U93B 2G75B 1IGFL 2WV3A 4U1IA 4Z7WA 5I1DB 3EZJB 1MNUH 4P9ML 5H2BB 1NDGA 3CMGA 3MRIB 4Y4HA 1JI2A 1MOEA 4NDMB 3TBSB 2HAZA 3CSBA 1QLRB 1G6RB 4R90H 5I8KH 2R0WL 4FFVC 2LQRA 4HC1A 1UZ6F 2VLKD 3V52L 3FFCB 4JEGB 5FFLA 1GC1L 1QSFE 1C08A 1JWMB 1ZAGA 4N8CL 3WIFB 2HYMA 3MO1A 3SKUD 3U1SH 1JN6B 3SE3C 3Q1SH 5GGRB 3QO1A 1C5CH 2A6KA 2R2BB 4HJJL 1NGWA 4Z6AT 4WI7A 4NIKB 4RGNE 2NW3A 1D5ZA 2AXGB 1S5IH 3FFDB 5CEXA 4W81A 1CIUA 2D9CA 2VSCA 4OUOA 4XPTL 4ZQKA 3PHOA 5IEKB 3QFJE 2VL5B 1NCCL 3WEXA 5DRWA 1FNEB 5C7XH 3BWUC 3TO4D 3LEVH 1YMMB 2AGJL 1RUAL 1OTSD 3C6LB 2IQAB 2V5MA 5KVMC 4WI6A 3MRRA 5C0ND 5C0FA 1ZWIA 4CU6A 2OL3H 4L5FH 5IWLA 2P5WA 5CFHA 3QP3A 3RBGA 3O11A 4HKXB 3C09C 4L9LC 1ZHNB 2BOCB 4LHJB 4LLYB 2FB4L 4Y4HD 4OZGE 1E0OB 2EE3A 5C09A 4MD5B 3SCMA 4HGWB 1DBML 1GOHA 3HE7A 1H5BC 3B9VA 3D69A 1FYTE 2ATKB 4ZNEE 3DVNA 2ICEB 2FHBA 5FYLH 1G7IB 2E7HA 1TZGH 1E4KC 1ZLVK 4NUGL 3C5ZC 4F9LC 1OQXA 5HPMA 1YPZA 2VLJA 3WIHA 5HYJA 5ENWA 3EYSH 4HMDA 3VXQB 2DKUA 3K4ZA 4Y0GA 1P1ZB 1ACYL 4XT1C 1RJYB 1YQVL 4IRJC 1RZ8B 1DDHA 3KPPB 1Y6MR 4NQXA 4PJIF 4N0CD 4BSWA 3DYOA 1O7VA 3G9VA 1IQDA 2HJLA 5I1KH 3X14B 5EUOB 1FBIH 4ODVL 4HV8B 3EDKA 4FQ2L 1JGUH 4J4PA 3L5XL 2AJ3A 4UDTB 5FCUH 1N2RB 4DN3L 3ET9F 5EN2A 4EJ1C 3V8CA 4IJ3B 4WTWA 5EOCJ 4LF3A 1PKQB 3VWKC 4ONHB 2P5WD 4FTVD 3C87A 1MLCB 2DM7A 2MSPA 4LASL 3RNKB 4OLXH 3IFOB 1A2YA 4FQHB 2XY2A 3T65A 4K7PY 2EDRA 2VDLL 1D5MA 2N56A 2OTUA 2KQMA 4ZSOE 4Q6IC 2GUOA 3CZJA 3AC0A 1VENA 5HVHB 4PJCB 1PLGL 2ZPKL 3RGVA 4WCYL 5C09D 3SCMD 5DVOA 2YRLA 3MNVA 3IAQA 3L5IA 1EO5A 3S36L 3ULVH 3HE7D 4ODWB 4U7MA 5DK3A 5I8CB 2CMRL 2NY4B 2MPAL 4NO3A 2JIXB 2EDEA 4U1KA 4A2MA 4LCCB 5DEGB 2HJFA 5KSAA 2VLJD 4TUOB 1ZLSL 4HUVB 5HYJD 4IIQB 2X70B 4HPYL 4AENA 4XNZB 2VLMD 1FNFA 3M17B 5DGQA 5JOFB 4OFKA 3VGBA 4RGMC 1BGXH 4HJGB 4XBEL 5F7EH 3CVIH 4PJEE 4PRDB 2AQ3A 5KS9A 5B8CB 4J4PD 3UTZA 4AK1A 1JGDB 2X4OB 1OP3H 3ROOA 1I1YB 2AV7B 3RIAK 4XNUL 5FB8A 3PWJA 4LBEB 1F4XL 4K55A 2AEQL 3DO7B 3CFCH 1KB5B 3VDBA 2ZJSL 4FFZL 2LABA 4LNRA 3RJQB 1G7JA 3CPLB 4HK3N 4CVZA 4GMSL 1MPAH 2AJXH 3RDTC 1PZ5B 1U8QA 5GSVA 1HI6B 4NKMA 4TTGA 2WANA 4GRLB 3FO2A 1I8IA 2Z8RA 2BDNL 2QHRL 3RGVD 3H9YA 4HD9A 4NYLA 5IF0B 4EIGB 3GKZA 3VXSB 3BH8B 5ACZA 2JTDA 3WD5H 5D2LA 3GM0A 1JZ3A 1OHQA 1JPSL 3RIAF 3PWNB 2B2XH 3AY4C 4TOYH 1NBZB 2ATPB 4Y2DC 3K7UA 1LEGB 4YZFF 4O9HH 2R1YA 5KANI 5KSAD 5HHQB 5FYKL 4JQIL 4KPHL 2DI7A 3OMZA 4F33A 4ELMB 1IAIH 3FRPG 1C1EH 2JB5H 4JPIB 1F2QA 3S96A 5CZVH 5HYQA 2VQ1B 4PLKC 3P30H 3SKMB 5BO1H 5IMLB 1QQDA 1WEJH 5TF1L 1DEDA 2UYLA 4J3XA 2AEPL 1JUFA 2Z92A 1HYRC 1A6WL 4KHXL 4PBVC 3OJ2C 5HY9A 3UTQA 3HE6C 2EDBA 3UXFA 3MLZL 1L0QA 4DFHA 1CDHA 1OAXH 3CCHA 3TT1H 2IG2L 1UZ6E 2DI9A 2EIZB 2NY5C 3NZ8B 4I8DA 3T8XB 3H9SA 4F7TB 2MJWA 2Q8AL 4EQ2A 1N8ZB 3PGDB 1DANT 1FG2B 3UTTB 2BHUA 5F97E 4QGYA 5D2NA 2HLFC 5KZCD 4YHZL 3T04D 3UYPA 3CVHL 1N5YL 2PW1A 3FONB 5KS9F 1R5VB 4L3EA 1T83A 4PJCF 3SQBA 2XTJB 2YEZA 4PJFA 1K4DA 3MJ8B 2Y5EA 4N8VG 2VDML 5E0QA 1RSFA 3BPNB 4YXHH 3EAKA 2J5LB 2W9EL 3F7VA 3U0TB 2OX5A 4YGAB 4OBSA 3RKDC 2VLKE 1A7BA 1EUTA 4XMLL 1FFOA 5MEQA 1FRGH 3DUUB 1CFVH 1RPQA 4FP8L 1X5ZA 1JPGA 2VC2L 1X5HA 1MHCB 3INUH 1QACA 2QR0A 1K8DA 3ARFB 4DUWA 3LZFL 2DYPA 5IB5A 4NGHL 5B38B 1A4KB 1BZ7A 3QEQB 4HULB 4RNRB 4XPAH 1TZHA 2BCKB 3KVQA 1MRFH 3MRDB 1FNGA 2FECI 3OAUH 1DBAH 3QG6A 5LKNA 1VDGA 1RZGB 5J0BA 3QUKB 1R5WB 2B8OT 2EKSA 3IDNA 3RUGF 4X5WB 5SWQB 3QXAA 4P2RE 1R24A 3P4NB 4ONGL 3H9SD 1S9VB 3DUSA 2AKRB 4LCWD 4W6WB 5I9QB 3IFPB 4G80A 4WW2C 4P2YA 5FGCE 2C3HA 1REIA 3EYVB 3SDAB 2IALB 5E8NA 2FJHA 4L3ED 2X4UA 2Y36L 4EZMA 4Z7WE 5DO2C 3NZHL 3SDXB 2DLFH 4PJIE 3W9EB 4N0UA 4S1RH 1V3JA 5DD5L 3K3QA 2VWEE 4JRXA 1CDBA 3X12A 1FVDA 3DRTB 4CU8A 4UV4L 5IFHL 1XF4B 3T0AA 2CK0L 3MRBB 1ZSDA 3CXHJ 4GBXC 1OF2A 5JIKA 2P45B 2DAVA 4LLMA 4ELMF 1N5AB 2DYPD 4WWKC 1K5NA 5INCB 1RJZA 3TGXA 5I73C 4RFNC 2F19H 4Q0XH 5A3IC 1NCBH 2ADIA 3HAEB 3GMMA 4OT1H 1EEUA 1UM6L 5IG7A 1TQBC 2AJUH 2GITA 3HHRB 3WFDL 3IKCB 5GZOD 4Y5YB 3MV8B 3FN0L 1FZJA 4HIXH 3LPFA 3IYLW 5ID1A 4XC3L 5J8OA 4NM8L 4R0LC 1MAKA 2W0FB 4PJDB 4R7DA 4N0RA 1A22B 1AD0B 5DDHA 4DKEH 5KVDH 3O6LL 3E8UL 1I9RH 1ZA6B 2HFEA 4R26L 5J13C 1MQ8A 4P99A 4FTVE 4YHPA 3U82B 4D9RE 4FQJH 5EO9A 5GJTL 1R5IB 1YQ2A 4Y89A 1EH9A 2ADGA 1KCKA 4U31A 4NQEA 2R9HC 3HG1A 1YNTB 3LVEA 5H8DA 3T2OA 2DJUA 2HLAB 3ARYA 2V5YA 5ECJE 3T4YA 3L7FB 5FYLD 3TEUA 2IFGA 3PGCA 4HWEH 4JRXD 3DXAA 5C09E 5FK9B 3F7YA 1CDIA 3FJTA 2EXYD 2Z93A 4BFIA 2R69H 2Q3ZA 3GRWH 1U8MB 4WIQA 1CFSB 1I1AA 1ZV5A 1YMME 1JZ8A 2JK5B 1S7SA 4TVPL 4WRLA 1MCKA 2EC9U 4RISL 5HYJE 4IBLT 2XTLA 2R15A 4WO4B 2G60H 1VA9A 2VLME 4X4XB 2CKNA 1XR9A 3W5NA 3A6CL 4JM2C 2NZ9D 3KPOB 5HGBA 4PRNA 1CL7I 5TQ2H 1M7DA 1CDGA 5T1LA 1I9EA 5F9WB 2IPTL 3JWDH 5AWNL 2NXZD 1HYSC 5I17A 5L2KA 3WS6C 1AC0A 5DJDA 4NKIL 1N4XH 4IRSC 4I3GA 4P3DB 3LDBC 5BS0A 4MXWL 4MHHG 2V2WB 4XCYA 5E8PA 4APQB 1OTTD 3VXRB 3VXOB 1T4KB 4YZFE 1ED3B 1KJ2L 1NFDF 4P5TB 1RUQL 1T22A 8FABB 1K6QH 3ULVD 1PEZA 4GXVL 5D1XB 4F7CB 3HUJA 2VXUL 4NQED 3MACL 3VFWA 1MJ8L 1Q0XH 1HIMH 1YNKH 3G6JB 4OGXL 2A6IB 5DHYB 5CLTA 2XRAL 3MLPA 5EUKB 2GK0A 3SDXF 4HCRA 2LU4A 4ZUVB 3I6LE 2CGRL 2AJYL 2XV6B 4OGAC 3E3QE 2EH8L 1KPRB 3THMH 3FN3A 3MYJA 4HLZG 3X3GH 1I1AD 4IDJH 2XZAH 4JHBA 4Y4FB 5IVXB 1OAUL 2P7TA 5E6IB 3AU1B 2CDGB 3NOIA 2ZOKB 2Y7QA 4NWUL 3OG6B 4M5YH 1F5WA 4KJWD 1NLDL 5T1LD 3GMQA 5DK0A 3QUMH 2LV4A 1ORQA 2OXHA 3O3BA 3L3DA 5L2KD 5KS9E 1VFBA 4W68A 1JNHB 4HUKB 4PGDA 4K3HA 4MNGA 4NBYB 1OAKL 3OWEA 4M9OA 5BS0D 3VGDA 5BOPA 1JYXA 4CNIB 2ZUUA 4NPYA 2AK4A 4XVJL 1RJCA 3QIBA 5SWZA 4POZC 1E6OH 2A1WH 4KROC 1X4YA 1LO3H 3QCUL 4CW1B 2X9YA 4QTHB 1UB5A 4PJDF 1C5BH 4ZUWB 4C58B 2HTLC 5F3HB 5EU4B 3N85L 5EOQH 1C16A 2C1PB 4Z77B 1BIIB 4JO2L 1CICA 3E6HA 1IGFH 4Y5VC 3QFDB 5DJ0B 1J18A 5GS1A 2J8OA 2NTSP 4YNYA 4P9MH 5I1IL 2H9GA 2NX5A 3L3OA 1HILB 4L29A 2F74B 5BZDA 3QG7L 2H32B 3NBNA 4Q97A 1HHKA 1CE1L 3EOBA 3VRLF 1CQYA 5IM7A 1WBZA 5I74C 2R0WH 2GCYA 4NN5B 4HGKC 4MWFB 3RUGE 2X44D 3HNSH 3V52H 3BEWA 4WDIB 3BN9D 1XIWB 3SY0B 2WP3O 2BY3A 3MRGB 4CN6A 4N8CH 3HLAA 4HZLB 3K80A 3DX7B 3OAZH 4X6CA 5GXBB 1UCTA 4HJJH 5C6TL 4HFWA 4XBGB 1Q8MA 5ISZD 1KXVC 5C6WH 3EO0A 3OBAA 4Q9CA 1BLNB 2C3XA 1HEZB 1OSZA 4TUJA 1CDCA 2C7UB 5C0IB 1RZFL 1NCCH 1U92B 1QLFB 3IJHB 2AK4D 3MLXL 4YQXL 3MLUL 3QIBD 5SWZD 2GTWB 2AGJH 2EYRB 3LN5A 4MX7B 2XN9B 1RUAH 1T0MB 4XNMA 3V4UL 5F7FA 1Q9KA 3H9SE 4YEEA 4JPWH 5F89A 1D9KB 2NW2A 3PP3H 4MMZC 1CICD 4LCWE 4NJ9L 1X5KA 4X4MA 3TO4C 3RWFB 5D2NE 4ELME 2M2DA 5I2IA 4U0RC 5F93C 3G6JF 5DJCA 5CILL 2NX5D 5JPNB 1OTSC 2FB4H 3IJYA 1I7ZA 4BYHA 1W8OA 2JKXA 5KSUA 3QHTC 2A6JA 3D2UB 1MCQA 3MMEB 3RTQB 1NAKL 5I16B 2EIBA 4O2EA 4P57B 4PGCA 5D7LA 3FB8A 4HXAL 4JKMA 4JFDE 2HTKD 1KJVB 1EAJA 2YK1L 4QCIA 4Y4HC 3ZDZF 2BNQE 4NUGH 4EI5A 3G5ZB 5I1HL 1C7TA 3MOBL 2DQTH 2F8OA 1CU4H 3ZLQC 4YXKL 5C0EA 3I85A 4N0FA 1ACYH 5EU3B 5DHVB 2MQ3A 1YQVH 2WWKT 2KZWA 3ARGA 2BNRE 3EYOA 3U4AA 4NQDA 4WTZG 4GQ9L 1RK0A 2UUDK 1YECL 2EDLA 4FQ2H 1KOAA 3BT2L 5I6XB 3L5XH 4DN3H 2NYYD 1XH3B 3JVGA 4GRMA 5EU5B 1KTRL 1YDPA 2E3VA 4PR5A 5IHZB 4X6CF 3WUWB 4LASH 5F6HI 2V2XB 3MJ6A 4AYFA 4EN3B 1B88A 2VDLH 1INQB 3L6FA 1BFTA 1FLRL 3JV6B 4IMLA 1TNMA 3GRWA 1PLGH 2ZPKH 4WCYH 1J0IA 5IMMA 4FMFA 5IWLC 1B9ZA 5GGTL 3S36H 1Y18A 1A14H 1M05B 3X13B 2P5EE 1RZJL 2CMRH 4JRXE 5D7LD 3UTOA 2MPAH 3BIKA 3WFEL 3PV6A 1BJ1H 5FUCC 4EI5D 5DZLA 4NUJA 3QXUA 4F8TA 3B4NA 1ZLSH 3GMPA 1LNUA 3SCMC 1T66D 3D85A 4JO3L 3HE7C 3Q6FA 3S5LB 2Q7NA 4HPYH 1I1CA 1NFDE 3P9LA 2N7AA 1YYLH 3E1F1 4NQDD 4XBEH 1RZIB 1HSBA 2V5SA 1HOCA 3MUJA 4MJ2A 2VRAA 3RWDA 2MMXA 5E2WL 2NY6D 2NY1D 4M6ML 3MRHA 4A6YA 2J8UB 3FQRB 1G9NL 4XNUH 1UVQA 2MNUA 5I1JL 1F4XH 1ZVYA 2AEQH 3FHAA 4Y5XC 5GS0L 2ZJSH 1UT9A 5E6YA 5J12B 3EO1A 1S7UB 4J4PC 4GMSH 5T1KB 3BPCB 1P7KA 1XF1A 5F88B 2H8PB 2ESVA 3SN6N 1EJ6A 1BD2B 2BDNH 1H3TA 3H2WA 3BH9B 2CDEB 2IANB 5JZ7D 4QEGA 3VXUA 1P7QB 1T5XB 3PDOB 1G1CA 2HRPL 4YPGA 1B0GB 1JPSH 1WZ1L 3MV7B 1TZIA 3UPAA 4MQ7A 1MRCL 2VJXA 4QRPA 3PWPA 4WTXA 5CZKA 1EHNA 3RGVC 1GGBL 4NRYB 5FYKH 2DJSA 3D85D 3MUHL 4JQIH 4KPHH 1G6RH 3HC4L 4FFYL 4O51A 4OZ4A 3KXFA 4M93B 5J11B 5FGBA 4YHNA 1S78C 2O5XL 3KGRA 3IDYC 3RY5A 1TENA 1UYWH 3OKEA 1NUGA 1FYHB 4X9GA 5BV7L 5KSAC 2JCCF 5TF1H 2O5ZL 3B8SA 4OFDA 4MAYB 2AEPH 4L8DB 4U1NB 3QDMB 5I1LB 5FGSA 1DQML 4JJ5A 5L2KE 1A6WH 4KHXH 2YSSB 4J3TA 3MLZH 1A9BA 1N26A 2VXVL 3VRLE 5FO7A 5BS0E 3RWCB 1BVLA 5IVNA 2IG2H 1S9KC 1AC6A 3I9GL 2Q8AH 2ESVD 2BY2A 5J6GA 1SMAA 1FZOB 3CLFL 5F44A 5LQBL 4IMKC 4M5ZL 4PRIE 1IGIL 1TFHA 4C83A 4YHZH 5J9PB 3CVHH 1N5YH 3VXUD 2XWTA 4NZTL 3PDGA 3T3PF 2OR9L 3NFPB 4Y1AE 4QRPD 1P2CB 3GSNA 2DI8A 3MGAA 3PWPD 4HIHB 3BIAX 2VDMH 3MRFA 1G0DA 1KLUB 3FT3B 2DM3A 3WHXA 1OTUD 4IRZL 4WNQA 2W9EH 5DRZA 4XMLH 3KXFD 4D8PB 2EDHA 4H5SB 4XNYL 5B3NA 4FP8H 1CFQA 2VC2H 3P4OA 4B41A 1ZGLB 3V6OA 4WGWB 1K4CA 2DWDB 3LZFH 3CFEA 3IF1B 4NGHH 1FORL 3LHPL 5ISZE 3FB6A 3IGAA 2RIKA 3BGMA 4U3XA 4WFFD 4OF5A 4MNGE 1MFEL 3FAWA 4M3JA 1DUYA 2EIDA 5CD5D 1G1YA 3GBMH 2AK4E 3VD3A 1ZT1A 1F02I 4ONGH 1I4FB 3JZ7A 2ZKHL 4EDXA 4K3DL 5FCSH 3RVWD 3V0VB 3ZDZE 1K8IB 4C57C 1CLYH 4LMQI 3ZZ1A 3S4SB 4OCSL 2ZCKL 2CJUL 4KGLA 5HHNB 2UWEF 5D96C 3VWJA 2Y36H 4UIMB 5FF6B 3NZHH 1FO0L 4UQ2A 2A73A 1B6DA 4OZFG 5D2NC 1KIQB 1U8KA 5C07E 5T3ZL 3D3VA 3BHBA 4UV4H 4O2CA 3TNNA 1T83C 4ZYKB 5IFHH 1R3LB 3MRQB 5JDSA 2ZUWA 4ZAKB 1PQZB 5DC4B 2CK0H 4CBPA 3MLWL 3RPIB 1EBPA 4KTDL 4X6CE 2W07A 1A3RL 5JW4N 1AHWB 3VDCA 2Q86A 4BFEA 4X7EC 5B39G 4HS3B 4JG1L 2L7UA 3QRGL 1NC2A 3BKML 3NCBB 3TIEA 4QTIL 4P49A 2CPCA 1UM6H 4CADA 3FCTA 1CVSC 1KT2B 1KG0A 3MUY1 2VR4A 3WFDH 3CSPA 3HB3D 4PJ9A 3BP5B 4WV1B 3VRIA 1NUFA 1OVZA 2R0ZL 3IVKB 2EDQA 1L6ZA 4UOW0 3BJ91 3FN0H 3S35X 1UG9A 1CN4A 5GHWL 4XC3H 3OX8A 2DIBA 4NM8H 3WN5A 4LOUD 4KAQL 3O6LH 3E8UH 3DVGB 4R26H 3NN8A 1EHAA 2LTQB 5E2VL 3VG9C 4HX1B 1T03L 5GJTH 4F57L 4Q9BA 3VWJD 1N3NA 1NMCC 2J7LA 5GSRB 2CQVA 5DYOA 2MQ0A 2WBJA 5H35A 1XCQA 3HZVB 1FFPB 1RJLB 1INEL 2NR6D 2VABB 4V1DB 5EU7C 3D3VD 3WS3B 5DA4A 4U1LA 1FL5A 2JJSA 3U4EA 1DBBL 1SY6L 3QWRA 3P4MA 3MLRL 3KPSA 4PP1D 4TVPH 4XZUB 1UQSA 2AQ1A 1DLFL 5ICZB 4RISH 4J8RB 2HFGL 3ZKXC 2EXYC 4NCC1 4U6YB 2B5IB 1E4JA 2OI9B 3A6CH 3PJSA 3FB7A 3HI1B 5MEPB 1NC2D 1UENA 1AXSB 4PY7B 3TO2A 5CUSL 4RBPK 4NQDE 2IPTH 3VFMA 4PJ9D 4JRWA 4QYOB 1MH5B 5EBLA 4U05A 2H6PA 4NKIH 4L4TB 2DBJA 1ZT4B 1HHGA 5CS7A 3QZWG 4ZFGH 4MXWH 2NZ9C 3HZMA 3O3DA 3QWOB 4LK4A 3KPRB 1KJ2H 4UV7L 3W39A 2NXZC 1RUQH 2VKWA 3MJ9L 4IOFD 3VFTA 1LE5A 4GXVH 2FX9L 5AD0B 2AJVL 2VXUH 4U1SA 1C5DB 3VXPA 2I26N 3MACH 1BQHB 3MNZA 1MJ8H 3SQOL 2G75A 3UZVB 1A1MB 2PTVA 3KPTA 5DVLA 5FOBB 5F6IB 1NEZG 2WBJD 3MODL 4M7LL 4OGXH 4PV9B 5I1DA 4Y19E 1ZHLB 2XRAH 1OTTC 3MJGX 5H2BA 4KJYB 5FDWB 4Z18A 2AJYH 3MRIA 2JCCE 2NXYD 2EH8H 1QLRA 4HPOL 3ULVC 1G6RA 1UB6B 4X7TB 3QWRD 1IBGL 3VA6A 1OAUH 1OAYL 3ARXA 3KPSD 5EZOL 2VDOL 2FHFA 3MREA 4JPKL 3FFCA 4FQIL 1IL1B 2QLVB 4GUPB 1JWMA 3WIFA 3MQIA 4P2QA 4NWUH 4Q7DA 5GGRA 3GSXB 4GKOA 2R2BA 5TGBB 2IBZY 1I1AC 1Z2KA 4GW1B 1NLDH 3U83A 3OKNA 1EMTH 3TVMB 2JF1A 1G9ML 3FFDA 3G5XB 4B53A 2E9JA 4MGXA 4LPCA 4NOFA 1RVFL 1OAKH 1FNEA 3T3PE 3LB6D 2EDDA 5F6HJ 4X0KA 1EXUB 4KJWC 3UJTL 3V0WL 4XRCA 3VE0B 3ZL4L 1QD0A 2FDBP 3BJLA 1YMHA 3QJFB 5EZJA 3C6LA 3QCUH 3U48A 2IQAA 1PSKL 1XF2B 4FN0A 3MRMB 4JFXB 3N85H 4HUNB 1IC1A 3FO9B 2E5EA 4UU9B 4E5XB 2ESVE 4JO2H 2VQTA 4LLAA 5IIEB 5LWYL 2CO7B 1ZHNA 3D18B 4GKNA 5I1IH 1RAMA 3MLSL 4PJ7A 4R97B 1A0QL 1QHPA 3VXUE 5FYKD 4KC3B 2H2PD 1BOGB 1NAMB 3ME0A 1TQCB 3QG7H 4HGWA 2FZ3B 3EW3B 1AI1L 4KZEL 1CE1H 4XWGL 4Z0XB 3WV0A 1EZVX 2BX5A 3PWPE 5FAAA 3FFCD 4OIBA 3G04B 3OGCA 5I75B 2BVQB 1EFXB 5J89A 4G6KL 1G7IA 2PN5A 1FVEA 4P2QD 4QOKA 2VLLA 3GEWB 5MHSE 3NAAL 4PGJA 2G2RB 4BQ6A 2YZ8A 3RWHB 4HHAB 3VXQA 5I1CL 4PJHA 5CKGA 1RJYA 5C6TH 5CKAA 5DXWA 4AT6B 5J1AB 1ETZB 1RZ8A 4F7MA 3C5SA 4H0GA 2UWEE 3BN9C 4LIQE 3RQ3A 3X14A 5EUOA 1RZFH 1BJMA 2D03L 5JO5B 4EI6B 5FA3B 3MLXH 4YQXH 3MLUH 4M1GL 3HZYB 5FUZL 3DLQR 3C6LD 2PETA 3V4UH 1HH6B 1F3RB 4HKZA 3L3JA 1RMFL 1MLCA 4CDGC 1U8HB 2VZTA 3KYMB 1XCTB 3RNKA 5L88L 4XH2B 4Y4KA 5KVFL 5E99L 2P8MB 5HGGS 1RU9L 3EDDA 2F8VA 1EX0A 2CR6A 1ZLWK 4CN4A 2OQJB 2O93L 1XZ0B 5CILH 1F2XK 4NZDA 5EG6C 1ZHKA 3TPKA 1JE6A 3OKOA 3OF6A 1BAFL 1CICC 3DRQB 1NAKH 5I8CA 4KVNL 2JIXA 5IBUB 1H0DB 4LCCA 4WUUB 5GS1C 4E9LA 4DZ8B 4QOKD 1ORSA 5HYEA 4HXAH 5DEGA 2YK1H 1P6FA 4LVHB 4MA7L 4Z7VA 1J0ZA 4OD2A 5I1HH 5DTFB 3OTTA 3S35L 4KZDL 4IIQA 5B3JF 2X70A 4KK5D 1WCQA 3IDGB 4YXKH 3F62A 4YDLC 1BIHA 1LDPH 4IM8A 3M17A 5JOFA 3SOBH 2W9DL 3IJSA 1RIVL 5EIVA 1BFOB 4PJXB 4HJGA 2ZUVA 1KB9K 3CFJA 4ZUUB 2DQFA 2W65B 4GKSB 5GJSL 1I1YA 4FFWC 4ZTOL 4X6FB 3BT2H 5C0CE 5KVEL 4FG6C 4LBEA 4OTXL 3BQUB 1GOGA 3TBTB 1SYVA 1O7SA 2A38A 2F5BL 1SEBA 1U3YA 2EDXA 5ID0B 3CPLA 2CLZB 4Y4KD 5DK2B 3BP7A 2APXA 4PJHF 2GY7B 3EKCA 4X83A 3DVFA 1RI8A 3IDUA 2NYYC 4GRLA 3LKNA 1FLRH 4EVNB 4U6XB 4OV6F 5IJKA 3VXSA 3OF6D 5GGTH 3BH8A 3JWNC 4PD4K 4MJ6B 3LKOA 2NY4D 3EFDL 4HH8A 2JIXD 1RZJH 4UQ3B 4X4YB 1MI5B 3P0VL 4GXUN 1CZ8L 1QKZL 3WFEH 3D3VE 1NBZA 2ATPA 1LEGA 2YD7A 4GAFB 4HIEB 2HMID 2VZUA 1DTUA 2FO1A 1MCSA 4FABL 3LKSB 3KJ6L 1EVTC 3QXVA 4JO3H 1MJ7L 5DD1L 4GAJL 1JWSB 3L1OL 2ZNWA 4JPIA 2D9QB 1BX2A 2VQ1A 1IKNA 3BZEB 4XTRD 4KUZL 1XT5A 4EI5C 5IMLA 3CMOL 3PWVB 2EC9T 4U7KA 3T2NL 1KCVL 2R2HB 1X3DA 4UZGA 1U8IA 5E2WH 5DURB 4M6MH 1T66C 1PKOA 3GJFH 1I9JL 1G9NH 2N7BA 1KJ2A 4PJGB 2IH1B 4I48A 3ARGC 4G8GE 5I1JH 5ICYB 2OP4L 4AEIH 5GS0H 1EBAA 3I2CL 3PWLB 3R0MA 1MJUL 2EIZA 5IFAH 3T8XA 2GIYA 2NY1C 4F7TA 1JI1A 1J5OH 3JVGC 3UTTA 2X05A 1UZ8B 4XP6L 2V9RA 1LO5B 2VL4A 3VXSD 3FONA 4LP4A 3T3ME 5K9QI 1R5VA 4L8CA 3AVEA 4TVPD 4P5MB 4JY4A 2HRPH 5J1TC 1DQQB 2ORBH 1MRCH 4CVUA 1FP5A 1Q9LB 5GGSY 1GGBH 3RWEB 3TESA 3CFIC 1LO0H 1RD6A 2H32H 1SBSL 5JZ7C 3HC4H 3DUUA 4FFYH 4EXPX 4MSWB 4DKDC 1LVEA 4I9WD 2O5XH 5DFVD 1NBVL 3F12B 4WY7L 2D7TL 3ARFA 4ZO9A 3ISWA 5BV7H 5D1QA 3U30C 1A4KA 3QEQA 3WL9B 2O5ZH 3NCJL 1DQMH 5D1ZC 1FVCB 1RZGA 4KK9D 4TVSa 2DL9A 3QUKA 2R23B 3SGKA 4G7YL 3BYTA 2VXVH 3OKLB 1A5FL 3QCVL 3P4NA 4IHOB 4CVXB 5DJZB 2V9QA 5FKAB 3I9GH 1S9VA 1MQKL 1FZMB 3CC5B 4AIOA 2AKRA 1DBKL 5ILTL 3RWIB 1LP9A 3CU1A 3ULSB 4LHUA 5HDBF 5E9DA 1S7XB 1CCZA 3CLFH 5LQBH 1SHMA 4M5ZH 5KN5B 5JXAL 5DD6B 3MRKB 2IALA 4MB3A 3QQNA 1QRNE 4NNYB 4UNVA 1NH6A 2D7QA 4ODBD 2VXQH 2FJFA 4NZTH 2XWJB 1QR1B 1IKFL 2OR9H 2V7NB 3W81A 3RWJB 5C0AD 1N6QL 4E41A 3H6JA 4PTTA 4XB7A 4F2MB 4IRZH 2XY1A 1WICA 1ROWA 1XF4A 1DBJL 2FJGB 1QFHA 5ERWB 4MA8L 2OJEA 4XNYH 3ARTA 4P2QE 5F7DB 3W0WD 3CH8A 3MBEA 4HWZB 3ARFD 1AGCB 1CIDA 4RZCA 5H37G 5MP6L 5D1QD 5TFSL 3BPLC 1CDYA 3QEQD 4R7NB 1OTUC 3LHPH 4F9PA 1I3RA 4FQPA 2QQQA 2DICA 3KG5A 2HT3D 1CD1A 2BVTA 2R56L 1SJHA 2C3GA 4KKCD 5FGBC 2I9LB 4IDLA 3IKCA 1MFEH 1ZLUK 2VDKL 4PYHA 4Y5YA 3VGFA 4U4BA 4LSUL 4PJGF 1QVOB 2P8LA 3B9AA 1T6VN 1N64L 4L4VE 4PJAA 2ZKHH 5EIQA 4O58L 1LO4L 2W0FA 1HHHB 3ESUF 1AD0A 3ZT6A 3K2UL 4LHUD 3BO8B 3C08L 5E9DD 5BMFL 2FL5B 3IU4L 1ADQL 4OJFL 3WFHB 3JBG7 4OCSH 5B3JE 1R5IA 2ZCKH 2CJUH 4DVBB 3FB5B 4P4KB 1JP5A 2V7HB 3EDFA 3ARZA 4ZS6C 1YNTA 1FO0H 2HLAA 4MMXC 1KENL 5DGRA 3LEXB 3FT2B 3L3GB 2VSDA 5DZNA 4S11A 5FK9A 2I25N 5D72L 1KPVA 4E41D 5D5MB 5T3ZH 4OKDA 1U8MA 5HXMA 4G9DB 4JE4B 4L3CB 1CFSA 1JHTA 2CDFB 2P42B 5I66B 5FA4B 1UGNA 1JV5A 3OAYK 2JK5A 1LP9F 4FQCL 1H3XA 3MBED 4M4RA 1RV6X 1DZBA 1UJ3A 3EOYG 4KTDH 4WO4A 5A1AA 4PJHE 1U9KA 1A3RH 4OIAA 4U1HB 2YD1A 2WWKO 3DHMA 3ZSTA 4L1DA 4NKQB 4JG1H 4LKCB 5IHBA 4LSVL 3JSSA 3BKMH 3QRGH 5EC1B 4QTIH 1Z5LB 3K4AA 1QSEA 1DVFA 4M8QA 2BVEA 3SJVB 4PUBL 3V6OC 2R0ZH 2FATL 4GQPH 3AGVA 4CDHA 4XCNB 3ZYZA 1YYML 2V2WA 5GHWH 4APQA 2MKWA 4PPTA 5JW5B 1II4E 1T4KA 3QDJB 1ED3A 1EA9C 5L0QB 4KAQH 4P5TA 4TNVK 5E2VH 3HB3C 5GRWA 1T03H 3G5YB 5D1XA 4F7CA 4F57H 2YXFA 4ODUB 3UCRA 3QIWB 4MNQA 4P2OA 2GJJA 3VFNB 1KNOB 3KPNB 3MRCA 3QNXA 4NQCB 2X1QA 4UOJA 4LOUC 3P77A 4ZUVA 3TBWA 2C4XA 1INEH 5BVJB 2F15A 3OR6B 2AI0L 4EEEA 1CXFA 3BSZH 3VWJC 4LPXA 5IVXA 5IW1A 1DBBH 3NIDF 4KWUA 2CUMA 4DGIL 1ZGLP 1T2JA 3AU1A 2DD8H 3V4PL 4XHJD 1DLFH 1MCJA 2ZOKA 2OR7A 4LLDA 4WO4D 4TNVF 5HGHB 5BRZB 1DQJB 1ZTXL 2HFGH 4JJHA 2B7DT 3GJFA 3DGGB 3BP6A 3DROB 3LY6A 5HVGB 1T2XA 1C12A 4G9FB 2BSTA 4YE4L 1D6EB 5CUSH 1QSED 1DVFD 4PP1C 3FZUD 2HVJB 5T1MA 2ZSVB 1JNHA 3ARSA 3ZO0A 4NM4L 2P8PB 2CLVA 2R2EB 3EDEA 4GH7B 1F6AB 1WTGT 4CNIA 2QTEA 3GB7A 3CZFB 1V7NL 4PJBA 4XX1E 4KVCL 3UBXG 4P5TD 3S3PA 1JHKL 1KV3A 4CW1A 2DQGL 4LQ1A 4UV7H 4QTHA 5JNYB 5J1SC 1U58B 4ZUWA 4PJ9C 3HNTL 5F3HA 1BECA 4PBXA 3MJ9H 5D1XD 5CBEB 2C1PA 4Z77A 1BIIA 4MNQD 2FX9H 2AJVH 4P2OD 5IW6B 1BF2A 3BESR 4NZRH 4HBCL 3MODH 4M7LH 3MZGB 3WN5C 2HT4C 2I60L 2PW2B 2ZG1A 4MCZB 1HILA 4H20L 1BPVA 2F74A 1TTGA 2H32A 2Z4QB 3G6DL 4IOFC 1CGXA 4HPOH 3O2DL 4TVPE 5DSCB 3HR6A 4ZO6A 1EO8L 1IBGH 4NO0B 5D5MF 2DQEH 3RVVC 4Z78B 1OAYH 1B3JA 4MWFA 4AIZB 2WBJC 5EZOH 2VDOH 4JPKH 4WDIA 3OKKA 1FN4B 4FQIH 1UH3A 4YDJB 3OR7B 3VU2A 1VEPA 3U6RB 2MOVA 2NXYC 5GIRB 2JJSC 4DGYL 5IW3A 5I76B 4HXBL 5HDBE 4XBGA 3HR5B 5ESVA 1UM5H 5H94A 4ALAL 1BLNA 2VLRA 1G9MH 1HEZA 2CRMA 2I9TB 1ONQB 5GS0D 4YLQT 1XF5B 2C7UA 1I3GL 1QZ1A 1RVFH 5KSBB 3H7LA 1U92A 1QA9A 2JJUA 3IJHA 5JLZA 2VDQL 4J12A 1ND0B 4ZPVB 3EYQD 5L8JB 3U0PB 3BFOA 2EYRA 2H3NB 2O61B 4R4ND 3UJTH 5C92A 4LSRL 3V0WH 1F00I 4PP2A 3CFBA 3ZL4H 5CGYC 4AQ1B 1FNAA 5SV4A 2W0PA 3QQ3B 1PSKH 3ZDYF 1KGCE 5C0GA 1D9KA 5GGVH 1C7SA 2DTML 3IT8D 3O4LB 2IBGA 4NC1C 3RWFA 1XEDA 3GI9L 4Z7NF 4HUUB 4X7DC 2YA2A 5LWYH 1M4KA 5JPNA 2ZUQC 3BDYL 3CDGB 1UACL 3MLSH 1VKXA 2X4QA 2YD4A 3EFFB 3UZQA 3D2UA 3MMEA 3V2AR 3RTQA 1AI1H 4KZEH 4XWGH 2YBRA 4X4ZA 4PLOB 4M7JL 5GQBA 4P57A 5A2KH 3WFBL 2X9WA 4JGUA 1OQOA 5C0AE 4YDVA 4G6KH 3TPUB 4Y16B 3G5ZA 1MHEA 3NAAH 3U2SB 3QDGB 2BSRB 3K1KC 2RJMA 1S9WA 2XQYG 2RB8A 3DECA 4KFZC 5I1CH 3LV3B 5EU3A 5JOPE 5CLWA 3W0WE 1D5BB 4W4NA 2CKBL 2VLRD 1WSST 3REWB 4YDKL 4YR6A 1NDMA 4PRPB 1MF2L 3BE1L 4PYGA 1A7NL 4BK5A 1UXSA 1KJ3L 2WMPA 3GBLA 5JORB 3L3KB 3V95A 2D03H 1IGML 4M1GH 1LK2B 4X7CC 2W59A 4PREA 5HHVH 2E27L 4TN9A 4CMHB 3TNMB 1A3LL 1FHGA 3CSYB 4YHOL 1YEGL 3U7WL 1D9KD 4ZO7A 1RMFH 5IHZA 3LN4B 4OCXL 4LAQL 2BY1A 1LP9E 3D1MC 4MS8D 1X5JA 1NKRA 2V2XA 5D93B 3WUWA 5KVFH 5L88H 1PY4A 5E99H 5E9DE 2ID5A 5B21A 1J87A 5F9OH 1RU9H 4PRAB 4G6AD 4MCYB 2Q76A 5DQDL 3C6LC 2DDQL 3DYPA 3JV6A 3QPXL 1FGNL 4HC1L 3D2UD 4W6YB 1GVIA 3RTQD 2A0LD 2YOCA 1M05A 1U8PB 3X13A 4JFPB 4JZOA 4LSSL 4CGTA 4KJQD 4KVNH 3ZKSD 3W11D 4RMSA 2B1HL 2YD8A 4E41E 1WFNA 4MZ3A 2EYTB 1KC5L 2ITDA 1YNLL 1KCUL 4OFPA 4MA7H 2W91A 3UX9B 3S35H 4KZDH 1EGJA 3QHFH 4XNXL 4ODTL 5L8KB 4J1UA 1NCWL 5CINH 1KB9J 4GRWH 2W9DH 2VXSH 1RIVH 2J8HA 4L4JA 2M26A 4AM0B 1RZIA 1PGRB 3TLRA 5TDOB 5C08B 1TTFA 2J8UA 4KK5C 5GJSH 4ZTOH 5AEAA 5HYSB 1PFCA 4OI8A 2VDPL 4NWTH 5KVEH 4OTXH 4NP4L 1S7QB 4LVEA 4NNXA 2Z9TA 3S34H 1NUDA 2F5BH 4PJAE 4JFFB 1U3HB 3S8WA 4DOHE 2A77L 1S7UA 5T1KA 4F7PA 3BPCA 1D5IL 5F88A 5ELIA 3O3AB 3RHWF 4AJ0A 4AEHL 4XP4H 4IJ3C 4MB5A 5CEZL 5T3ZD 1NFIB 3GSRA 4PD4J 5TDPA 3BH9A 2OJZL 2CDEA 3D0VB 4G8IB 5E95B 2JB6B 2IANA 2X09A 3O9WB 4KRPB 5LXGH 4Y4KC 1URLA 3PDOA 3TP4A 3EFDH 1B0GA 2DOCA 3DSNA 3MV7A 3IS0X 3P0VH 1CZ8H 1QKZH 1R3JB 5IB1B 2DM2A 1CQKA 5HVHC 4JANB 1EAPA 1F11A 3QEGL 2K9UA 4GG6B 2A74B 3UYRL 4FABH 1TNNA 3KJ6H 4HWNA 2WINB 1MJ7H 2NY4C 4GAJH 1AQDB 5DD1H 3MV9B 3L1OH 3ROLB 4LCCC 4Z7UB 1HHJB 2DLHA 3DTXA 5I15L 1IAIM 4KUZH 3TZVB 3CMOH 3BKYL 3BPOB 1KCVH 3RNQA 4IIQC 3T2NH 4L8DA 4U1NA 1J8KA 3I3DA 1PBYA 5I1LA 1QSEE 4XNZC 1I9JH 1EK3A 4NRXB 4XHQA 5C0BB 3M8OL 2YSSA 5INDB 1WWAX 2X4NB 4M4PA 3C9NB 3BMWA 3MJ9A 1P6AB 4OQTL 2OP4H 5MEOB 1FZKB 1I1FB 2YS4A 4XTRC 2KPNA 2YC1A 3I2CH 2GT9B 5DZOA 1MJUH 5T1KD 4OM1H 5CBAB 4HUMB 1T3FB 3G08B 1JHLL 3SGEI 15C8L 4NQSB 3DJ9A 1FZOA 4YDIL 1N59B 4XP6H 4I2XB 3QUYB 3OJVC 5J9PA 1MFDL 2IAND 1KJMB 2F53D 1P69B 5HGAA 5E5UB 3KWWB 1A1OB 3HCVB 4RAUB 3MV7D 2YD2A 3JUZA 5KOMC 1DN0B 3NFPA 1MIML 4GRLC 3NPSB 4HIHA 2ARJB 2HFTA 1F4AA 3FT3A 5SWSE 5IJKC 4S2SA 2Q8BL 1SBSH 4MVBD 2FO4B 2V5TA 2Y5TB 2FRGP 3ZDYE 1NBVH 4FQQB 3D6GA 2QQKL 4WY7H 2X1XR 4HDIA 2YPKA 4NQUA 1WBXB 4Z7NE 5BCAA 2CD0A 4NZJA 3V4VL 1XGRB 4N8PA 1W72B 2Q87A 1QOKA 3NCJH 1CXEA 3ARDB 2APWA 4JFHD 5D7IB 2IPKB 1WIUA 5DFVC 2ZNXA 1IKNC 4G7YH 2R1XA 1A5FH 3QCVH 2OMBA 4KI5F 1I4FA 2A6DB 4K71B 2P44B 5JUEL 5ILTH 4WHDA 2ZCLL 3V0VA 3C09B 4I5BA 2WUCL 1IAMA 1K8IA 4JQVA 5DC0A 5DD0L 5I0DA 5JHDA 5LBSL 4KK9C 5A2LH 2Y4SA 1J88A 4MJIB 2RCSH 1SJEB 5JXAH 2PXYB 3V7MA 1RQ5A 3ORJA 3EYUL 4G42B 5FF6A 2YRPA 5DJ2B 1H5BB 5CMAA 4NT6A 2QQLL 1T1WB 2ICWB 3F7PC 1IKFH 4DGVL 1KIQA 4K3EL 3HPLB 2Z91A 1N6QH 1AJ7L 3UP1A 1F6LL 1UWXK 5DEZA 3MRQA 3QA3B 1DBJH 4QRRA 2A2QT 1AGFB 1PQZA 3RPIA 4JVPA 4KMTL 5SX5K 3GM8A 3CX5K 4QRUB 3UJIL 4L9LA 1OWWA 5MP6H 3BPNC 1AHWA 5TFSH 1QO3A 4QT5B 3FQTB 4HS3A 3MROA 3Q0HA 2E8ZA 5CP3A 2R56H 4X6EB 3KDMA 2OYPA 1B2WL 2IADA 4NFBA 3BP5A 2VDKH 4WV1A 3IVKA 2SEBB 3RVUC 3ARFC 4LSUH 4ZMAT 4I3RL 5D1QC 4YHIB 4ENED 1N64H 1VFMA 3QDAA 2HT3C 1VB9A 4O58H 3ARBB 4ZDHB 4D3CL 5JHDD 5D7SL 2JJVA 3K2UH 3V5KB 3C08H 4Q6IB 3DVGA 3WNMA 5BMFH 3OB0H 4PGBA 4Z0BH 3IU4H 1ADQH 4L9DA 4HX1A 4OJFH 4WGVB 3SGKC 4MQSB 5KJRL 1ES0B 2ZSWB 3VXTA 4QKXB 4WI5A 4X6DB 5GSRA 1QEWA 4ZODA 3SKNB 2R4SL 4G43A 1KENH 3I75B 4QXUL 4QRQB 3UO1L 5E00B 3HZVA 4M6OH 1FC1A 5I9QC 1FFPA 1HQ4A 1RJLA 4V1DA 4O02L 5DJ6B 3ECBA 3QNZB 5D72H 3SDAC 4TPRL 3H8NA 3PG2A 1FAIL 4NC2B 4L3AA 3AS3A 2IGFL 4QRRD 5CIPH 4YBLC 3VWKA 4WUKL 3HC3L 2WIIA 3KNBB 4XZUA 3V5HB 1NJ9A 3OZ9L 2D7NA 4FQCH 4LMQE 4RQQB 5T1DL 5IT2L 5BQ7A 1LEKB 2YN3A 4RWYL 4J8RA 3AXLB 1CT8B 3D39E 1MUJB 4OLYH 5J56B 4LRIA 5HI5D 2FCBA 4KHTL 5MEPA 3WKML 5IOPB 2AV1B 3MRPA 1CS6A 3I50H 3MBEC 1MH5A 1S7VB 4PUBH 2FATH 3AB0B 4L4TA 4N5UA 5D7IF 1YEHL 1QBML 1YYMH 4F9PC 5JTWA 3QWOA 4YX2L 1X5LA 3D25B 4P9HC 4Y5YC 2I07B 4HLJA 4ELKB 5AD0A 1UJTA 1C5DA 5FYLL 4OF6A 1NCAL 2QADB 1WAAA 2EDNA 4NO5A 1MCHA 1ZHLA 5T3ZE 2DF3A 4V1DD 4KJYA 5FDWA 2A9NH 2JELL 3X11B 2APVA 2AJSH 5DVKA 1X5AA 1IZKA 2OLDA 2AI0H 4JZNB 1UB6A 1P4LA 4X7TA 2HN7A 3VWKD 2L0DA 2FIKB 4DGIH 1KYOK 3F7RA 3EOAA 5C2BL 1IL1A 1FCCA 3V4PH 5GS3A 4ZO8A 2ZZUT 3ZE0E 3LRHA 5TE6L 1ZTXH 3PQYA 4O4YL 5F1IA 1A4JB 4TUKL 3QQ4B 4H1LG 4UB0L 3V9FA 5LVEA 3ALXA 2VAAB 3KPQA 4YE4H 5HHME 5ANME 1U95A 2FSEB 3G5XA 3TBVB 1MFAL 1KF9B 3MJ7B 1UJ3C 3KYOB 4XHJC 1X5IA 3WNLA 1I1RA 4JDZA 4OZFB 1MEXL 4L4TD 4WO4C 4BZ2L 3I6GB 1LHZA 4NM4H 5E8EB 5TF0A 1TJIH 4MYWB 4U6HA 2NZIA 1W72L 5LCVL 4GRWF 1EXUA 4JN2B 5FKPB 1MCNA 1V7NH 4LCUB 2NY2D 2XICA 4KVCH 4DKFL 1NGXB 1JHKH 2DQGH 5AUMB 3FZUC 1TVBB 4XVSL 3HNTH 3MRMA 4JFXA 2MHAB 4E5XA 1JZ5A 3GK8L 5EFIB 1PW3A 2BVPA 4APQC 5B39B 4WWID 4X6DF 3D18A 2I60H 2FIRT 4NHUB 4P5TC 3L95B 2F53E 3P4LA 4H20H 5CP7A 1IARB 1NAMA 5D1XC 4JFOB 3RX5A 2FZ3A 4WFGD 3O2DH 4Z0XA 2O5YL 2X4SB 4LP5A 1EO8H 1ZT7A 3OHXA 4U1MA 4X98A 3G04A 2BVQA 3MX0A 5CHNB 3PQYD 4PG9B 4KI5E 3ARVA 3LRGA 4JFFE 4C56D 1QSFB 5BVPL 2Q3AA 4DGYH 4OFIA 4C54A 4HXBH 2LFGA 5K9OA 2R29L 4ALAH 5TDNB 3OXRB 4RGNB 3IKKA 5DMJB 3O81A 5ESQB 5ADOL 4BUHA 4YHYC 1EEQA 5C9KA 1AO7E 1I3GH 4JQXA 5TQ0L 4EI6A 5FA3A 3T0BA 2VDQH 3QFJB 4JFHE 1YUHB 2QJDA 4LSRH 4WW2B 3IFNL 1HH6A 2VB5A 3DV6B 4TOYL 5J7CC 4I1NB 4HCRL 2EZ0D 1XCTA 3BP4B 4UNUA 3RVTC 2DTMH 2RGSA 2P8MA 3OKDA 1NMBL 3EYQC 3F5WB 3GMRB 2OQJA 2WIMA 1RIHL 3P3YA 3TWCL 3A0OA 3EZ8A 3BDYH 1UACH 1IM9A 5M94B 3HE6D 4DEPB 5HJ3A 2D0GA 4D0CA 4OZGB 2GSGB 5JMRA 4LLQB 3QZWB 4M7JH 4ZOBA 1WEJL 5EOCL 3RI5F 3WFBH 1H0DA 1RHFA 4X80L 4XP9L 3C5JB 1FYTB 3PHSA 4U2YA 2L7JA 4LSPL 4X9IA 3B5TA 3RL2A 1CVRA 3IDGA 1JGLL 1RY7B 2IH3A 4NN5C 1NEZB 2CKBH 1BFOA 4PJXA 5DT1L 1X5GA 5BV7C 3WSQL 4YDKH 6FABL 1MF2H 4HG4K 3BE1H 1A7NH 4QHMB 1KJ3H 2W65A 1Q9OB 1I8MB 4X6FA 5KG9B 5KSVB 1IGMH 3LD8C 4PRHE 1A6TB 1GCFA 4NN6C 4XCFL 2NY0B 3A6BL 4G6FB 2E27H 4K7PX 1ADQA 3BQUA 4LU5H 1A3LH 3TBTA 4YHOH 3MZTA 2WNGA 1YEGH 4M61B 3U7WH 4BJLA 2AEIT 1MFBL 2CLZA 1QR4A 4OCXH 1CYGA 4LAQH 1Z6JT 5JHDE 3O4OB 2E7LC 2WP3T 4F80A 5CEYA 5TH2B 3BZ4B 1T1XA 5DQDH 4V2CB 1IM9D 1RUML 3QPXH 4EVNA 1FGNH 3CK0L 4ODHL 4U6XA 4HC1H 3LQAL 4ZSOB 1GGCL 3IDMA 4U1JB 1D9KC 4OCYL 1X44A 1BWWA 4MS8C 4DZBB