4HFWB

Anti rotavirus antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
EFQLVESGAEVKKPGASVKVSCKASGYSFTSYYVHWVREAPGEGLEWMGMINPSDGSTYYAQRFQPRVTMTRDTSTTTVFMEMSGLRSEDTAVYYCARGVVGATNEIDFWGQGTTVTVSSASFKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-26 Fab Light chain
publication title Human Rotavirus VP6-Specific Antibodies Mediate Intracellular Neutralization by Binding to a Quaternary Structure in the Transcriptional Pore.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 221
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hfwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hfwB01
2NXYC 3VWJD 1AP2A 5H37G 4OZFG 5J1SC 1Y6KR 5LWYH 4D9QE 4X80L 3VG0L 2MQ3A 2ZPKL 2HTLC 4ZUUB 1T4KA 4PJ8B 3SE3C 2FR4A 1QA9A 1TQBC 2AJVL 3OXSB 4UBDD 1J1OL 4MA3A 4OT1L 4WO4D 5EZLA 5D7LD 1OARH 4HK3J 5C0CB 4HV8B 4UIKL 2VQTA 1FVEA 1FN4B 3DV4B 3QEUB 3U30C 2E7LA 2FO1A 4JLRA 1FLRH 3WO4B 3GMLA 2FCBA 1KB5L 3BESR 1KLUB 4QHMB 3KVQA 1XGPA 3P2TA 3B8SA 4ONOA 4NC2B 2FX8L 1U3HA 4AL8H 4PJDA 5I8OL 4XNZC 5F93C 2RIKA 4XVJL 2FATL 3GHEL 2BNRD 1B6DA 5C0BE 1S8DB 4GW5B 4OV6F 1AGBB 2P47B 2FEDD 5CFHA 2XZQH 3LN5A 5TJWK 2H45A 3D5OF 4S1RH 2ILLA 2PO6C 5K59F 4GKZB 4CMMB 4JFEB 5C09B 3MOAH 3K0WA 4DVRH 2A2QT 4IRSC 5GHWH 5DJ6A 3W11C 1QP1A 2X6MA 3TBVB 2ZSVA 4JPIA 5DA0B 1QBMH 3A6BH 3BDYL 1QRNA 5E0QA 3F6LA 3TZVC 4F33B 3PP4H 3C8DA 3WNMA 3NMEA 3T65A 5MEQA 2AJSH 4G7YH 5IHLB 5F89B 4O51A 3KHOA 2BHZA 3I3BA 2VAAB 2W60A 3GM8A 4Q2ZB 4MDJA 3VGAC 4NO0B 3Q6GH 5BVPL 2UVFA 4U6XB 1BHGA 3GIVB 1CFVH 3D87B 1ZGLB 1U42A 3Q3GB 3QO1B 5CGTA 4MQ7A 4BKLB 5E94B 1YPZA 5T3XD 5DQ9B 4OZIF 5BZWB 3S35H 4UINH 1F8TH 1FAKT 4YPGA 3LH2H 5BS0D 3P9MB 4D0DB 5LVEA 3OKDA 2F54A 4PR5B 5GPRA 3WYRA 1JGDA 4IOFD 2XI9A 5I66A 5A2IH 3CGTA 4BQ6A 4F57H 5DVMA 4GW1A 4HCRL 2V2WA 5CEZD 1TTGA 4MJ6A 4F7CA 2BXZA 3RQ3A 2EIZB 5I8CB 1NGYB 1KCLA 5L7XH 1DBJL 4ENED 2DKUA 2APTA 4H8WC 2IGFH 2HFEA 2ATKB 2MTPA 3CC5A 4G43B 2P8PB 4NWTH 3VXRD 4L4VA 3RWIA 3NIFF 2LE9A 3QISA 1YJDL 3IU4L 4B53A 5I1IL 4QGTA 4BSVB 4Z76B 2AEPL 4N8VG 1ORQA 2DQGL 5E2JA 5HHQB 5D7JD 3D9AL 1NMCC 5J4MA 5IB4A 4KUZL 1CXFA 4XAKD 4UOJA 3RP1A 4GS7B 3WFHB 1GGIL 3UTSB 3L3JB 6FABH 3KPQA 1KYOJ 2VDKH 3ROOB 3VW3H 4K8RD 1A6AB 4FFVC 5IVXA 1I3GL 2DOCA 2PCPA 2VLLB 4F2MB 4LBEA 4C56E 1G1CA 2I5YL 1PAMA 2QR0B 3F65A 2WIIA 1OGAB 2NY6C 4U1NA 1IT9H 5H2BA 4BZ2H 5J0BA 2CH8A 4WHTB 3WS6A 3V6ZA 4YGVA 1WBYA 3WLBB 4YHLL 3K1DA 2EYSB 2IF7A 4ZS7L 3BPLB 1MIEL 3DX7B 1ES0B 3PL6A 3V95A 3U0TA 4DVBA 5I73B 2NTFA 2W38A 2IPKA 2DYPA 1A3LH 4KK5C 4RSVA 5HTSA 3P0YL 4UTBL 1FNSL 5I74B 3D48R 3GNML 1G7PA 1NDMA 2KPNA 3IU3A 3HI1B 1U3HD 4PJIE 2MSPA 4WI9A 4OF0A 1IRAY 5L8KB 2AJZB 3QG7H 3BYTA 5ELIA 1RURL 1EHXA 4Z5RA 4Z0XB 4XB7A 5EU4A 1RUQL 1AXSA 4RGNB 4M4PA 2A73A 5JIIA 4LSUH 4XMLL 3HNTH 1DUYB 4WI2A 4MS8C 3FN9A 4HUWA 3FN0L 1X44A 4ZUSA 1JVKA 2GT9A 3QXAA 3IKKA 2EDBA 4R4BB 3B3IB 3LIZH 4YHYB 3SCMC 1UXWA 5DXWA 1QRND 3V6BR 5CBAB 1U8OA 1Y0LB 4PS4L 3G9AB 4KKLC 1XGRB 3H0TA 1U8PA 1E4KA 4OLYL 1F00I 4X98A 2NZ9D 1HOCB 1MRCL 1AKJB 1U93A 2AKRB 5C7XL 2V5SA 1E6OH 1K85A 1IILE 4PLKC 5ACLA 5E08H 4M7LT 4MJ2A 4OFDA 2IBGA 3GSXA 5FHAH 4OZGF 3ILQC 5HDBE 3L9RA 2HFTA 5JORB 5IBTL 1FZJB 4LDEB 2V9RA 2X4SB 2F54D 2NY3B 4DN3H 3WNKA 1IAMA 4H8WL 3MTRA 3KYKH 4JKPH 4TOYH 4UT6L 1KULA 5K33A 1HNFA 1IEBB 1UWXK 2HN7B 5B8CA 4DOHB 1ACYH 4PJAF 3VD7A 5KSUB 4JRWA 1VEMA 4LCUB 5FGCE 3G5XB 4Y4KB 3RGVA 4F7MA 2AS5M 1CGSH 2CLVA 1KPUB 3ULUE 1RJCA 4ZQKB 4WW2F 1CE1L 4WFED 2X9YA 1JWUB 4L4VD 1N7ML 1MHCA 2WSKA 1KTRL 5DHVH 1X4XA 4FOMA 2DLGA 4FFWC 4HMCA 3ZT6A 4WI4A 4XPTL 2A6IA 1VENA 5JOPE 1N3NA 3B9KC 2OR9H 3QEQA 5KSAB 4RNRB 3RWEA 2QSQA 3DVIA 3LKPB 1U3YA 3BVNB 3CLFL 5E56A 3LEXB 1I1AC 4KKNA 3VXPB 5CEXB 1AD9B 4EBQL 3LD8C 1ZHKA 5CZVH 4PJHB 2C1OA 4KY1L 2BJML 5EZOH 2D31B 1D7FA 4Q9CA 5A16B 2HRLA 3GGWA 4PTTA 1NCCH 1G9EA 5JPMB 25C8H 3O3UN 4OGAD 3VGBA 3WIHL 1PQZA 3OF6A 1A4JA 3V4PL 3GBLA 1WFUA 4JN1H 4FTVA 4LSQL 3VGGA 3IDIA 2JJSC 3VRLF 1FL6A 1DQDL 5I30L 3VD4A 3PL6D 4LKXB 1DBAH 2DWEA 1T22A 3G9VA 3ESUF 1EFXA 2WP3T 3MJ7B 4L5FL 5IQ9A 5C0CE 1ZAGA 1KCSH 2PYFB 2DYPD 3ARDC 3GMRA 4PY7A 4XBPB 5D1XC 2GK0A 1VFUA 1V3LA 1BD2A 3LRSB 1X5YA 4U6YA 1LK3L 5CJOH 4NUJA 1B3JA 3DX6B 1N6VA 1QBBA 4Z0BL 1UJ3C 4KUCD 2EDNA 5FYLL 4R4ND 3O9WC 2CIIB 2XQYG 3VI4E 1INDL 1GVIA 4GRWF 1D9KA 3W39A 4O2CA 3TO4A 3LHPH 4Y5XA 3QPXL 1JBJA 3HZMB 1A14L 3UC0L 4NWUH 2J2ZA 4JFEE 5DMKB 1IQWL 4X4ME 1HILA 3V5KB 4CL7A 4XPGL 5JO5B 2NY7L 1R24B 4OTXH 4PLJC 5EOCJ 4EEEA 3U0PB 1CK0H 1RIUL 5C08B 2A77H 4JGMA 3G6AA 3MLZL 1GOFA 3NCBB 2YEZA 4JO1L 5DMIL 4AH2B 3ARFB 3BWAA 4DKDC 1KEML 5I75B 1EEYB 2YUWA 4XP5H 8CGTA 1AJ7L 3CFJB 1AR1D 4LPXA 3G5ZB 1LILA 1ZANH 4JFFE 1BJ1H 1LO4L 4EDXB 2WLZA 4UT7L 5EOTB 1T2XA 5CP7A 1VKXA 3LZFH 4U3CA 3KR3L 2CDGA 4Y19A 3P4MA 1OSZA 4KMTL 4NJAH 5K9JL 1SJXA 2NMSA 1FGNH 5EIIA 1JWMA 1LO5B 3SDAA 1CFQA 2F15A 3QUXA 3O4LB 4PJBB 3CXDH 1GH7A 3KS0J 5I1AA 2VNCA 4M00A 4X0KB 1G6VK 3CZJA 4NPYB 1KB5A 5FO8B 5DHVB 4P5TA 1BOGB 4OAWA 1OP5H 4PLNC 2XWTA 3DV6B 4X5LA 3BEWA 3VGDA 3O3EA 3BRDA 4M1CD 5DEFA 1ZLSH 3RGVD 2QL1A 1RJZB 3I3DA 3QIWC 2IQAB 2R0ZH 4J12A 1MH5A 3P0VL 4NNPL 4NN7B 4PRAB 3SJVB 2H2SC 3VFNB 5HVFB 1KNOA 3MC0A 3X3GL 5FB8A 3D2UB 5IP4A 4P2QA 2ORBH 2ZNWA 3NZHH 3S37L 3MRBB 3Q1SH 4E9LA 4AEHH 1A1OB 3HNVH 4BUHA 2PN5A 4XI5C 3RX5A 3ARVA 4IBLT 5GGRB 2VC2L 3QEQD 4HD9A 4X6DA 2DS4A 1JPST 4JJ5A 4XCFH 3GMPB 1NGQL 1FYTA 3PWPB 1E28A 1ZV5A 4KDTA 4A2MA 1U8NB 4ZFGH 3MOBL 2JE8A 1ND0B 4DCQA 3D25B 2EDEA 4XTRD 3UTSE 5B38B 2W0PA 5KVEH 1PKQB 3WHE1 3IYLW 5TF1L 4GKSA 5E8NB 3L7FB 4JHZA 1ROWA 1OGTA 3MLRL 3OF6D 3BE1L 4N9GA 2HTKC 1HHHB 1OGAE 4POUB 3BD5A 5KW9L 4OF5A 1OAXL 4FTVD 4YHZH 2WINA 3DNKA 3PWVA 1XR8A 4QRQA 4E41B 4OM0L 2C3GA 3AMKA 3QI9B 3STLB 2BOBB 4O2EB 1VACB 5INCA 1GHFH 1AIFA 3Q6FA 1T7WA 3GJFK 1EFXD 1QLRA 4OF6A 1HH6A 3TH4T 5E2TL 5FKAA 3LB6C 1BD2D 3FQXA 3LKSA 4HCRA 3TN0B 1H3UA 2BDNL 1MI5E 3RAJL 1FCGA 3RY5A 3L5JA 4JZOA 5F1NA 2IBBA 3TT1L 3B9AA 1MJ7H 1UQSA 1A6VL 3FZUC 3VFPB 1BEYH 4I0PA 4NCDA 1FGVL 4X8JB 4ZSOB 4YHNB 2FWOB 3K74B 1D9KD 3VXNB 3BJLA 2CO7B 4NZUL 3TO4D 5IKCB 2DQHL 4FQHB 1EMTL 4RGNE 5FOJA 4ZTPL 3VXOA 1YEDA 1G6RL 2XXMB 3SPVA 1D6VH 1RIHL 1OAQH 3O4OC 5C0AB 1BZ7B 3WJJA 3SGKC 5C0EB 4RA0C 1BQHB 1JF5A 5DDHA 5EH1A 3OX8A 5J3HD 3NGBC 4YK4C 5HYJA 3WDIA 1HKLH 3X12B 3SE3A 7CGTA 5IG7A 3RVVD 1PG7W 1G7QA 5D2NC 1CFTB 2XN9B 4TUJA 2AEQH 1GZPA 5E2WL 3W5MA 2Q6WB 4PV8A 3SKOA 3QUKA 1XGQB 4WDIA 4Y19D 5L6YL 3I6KA 1FAIL 3HB3C 4F3FB 5ID0B 2EKSA 3KLHC 1IGTB 1QZ1A 3P77A 3SDAD 5KANG 4MNGB 1I9IL 2GW5A 3FO9B 2CK0L 3ROLA 4JPWL 2E27H 3O6KH 3V0WL 4JKLA 3S5LA 1TCRB 3QUXD 1I3UA 4ZUWA 1TJGH 2LU3A 4X9GA 5CCKL 5TQ0L 5B4MD 1AD0A 3T77A 5JLZA 4TRPH 4X9FA 4N1CA 4H25A 1ZS8A 2FLBT 4MCZA 5IFHL 3BO8A 4WHYH 1RZGA 2FX7L 1QSFB 3SDCC 4P5TD 4U0RB 3TVMB 2PO6A 4NN6B 4HKJA 1U3JA 2ZUTA 4XH2B 1BF2A 1LNUB 2EICA 2QQLL 4CN6A 4IRSA 5EOCH 4DGIL 4NKOA 4Z78A 1N0XL 1KSRA 3T8XA 2CKBH 4YR6B 1AGCA 2NR6D 5IT2H 4P2QD 1UYWH 4H0GA 1JPFB 3TZVA 3T2QA 3B6SB 5JR1L 4YQXH 2DLIA 4R90H 3BRFA 5TDNB 2DTML 1U8KA 4R26H 3RU8H 2PF6A 4RFEB 4HEME 4HKBB 1PG7H 4JVPA 3VFMB 4L8SC 1FYTD 5B38G 1JFQH 3SHSA 1N4XL 1JHKH 2J8OA 1TETH 1CFNA 4WI8A 1N26A 5IOPA 4ZUVA 4JG1H 5ERWB 3BMVA 1Y18A 3L3HA 5D7IA 3HAEA 4PJHE 4N5ED 1FBIL 4QEGA 2B5IB 3KS0H 5JW4M 4NFDA 2NY4D 4GQPH 2R1WB 3CDGA 5EO9A 2C4FT 3WXWH 1T80A 2P5WB 2PXYB 2BSTB 4YPJA 3QQNA 4LNRB 4ODXA 1JPSH 3ALWA 5CS7A 4DQOH 4G8GA 4JRXB 1EERB 1YECL 1O0VA 2MHAA 1GGCL 3EJYD 3TNMB 5EO1B 4HZLA 5ADPL 1C08A 3HMXH 5AYUH 4BZ1H 3NA9H 4PFEA 4OKDA 4KK9D 2J7LA 1X5ZA 1QKZH 1P7KA 3VE0A 2KDGA 3NIDF 4J6RH 4HT1H 4I0PD 3VCLA 5C0GB 3B2VH 4GRLC 1AI1L 5FYKH 4U1KB 1JN6A 1BQHG 4NDMA 4B0MM 3IAPA 1U8QB 4GO6B 5L88L 2UWEA 1LO3L 2OS7A 2IALA 2NQCA 4HJGB 2NXYD 5F7LB 4O9HL 5F7MC 4WEBL 4U6VL 5HYJD 1RZIB 3KPNA 3F12B 4WW1A 3ARRA 2FIRT 4YEEA 1R3LA 4UOW1 1NCTA 1AC6A 5C0DA 1FIGH 3HS0A 4XAWL 1OP9A 3KPLA 5HHPA 5KZCD 1K9TA 4F58H 4LSSL 3P9LA 4X7SH 3WIHA 4X7FC 1JPGB 1MHPL 3BKCL 1T21A 2BVTA 3VXTB 2G5BB 2J6EL 5I16B 1UWEL 3IFLL 3O2WH 1UWXH 3A6CH 5D6CA 5IB2B 1HWHB 1S7UA 4ODVL 2AK4A 2BNQE 1FFOB 1UFUA 1OPGL 4HGMA 4I77L 2W9DH 4Q58C 1CFBA 5J12C 1RFDL 3U82B 1N64L 4PJBE 2PO6D 1QQDB 1XCQB 4F7TA 1T66C 4NCC2 1DR9A 4UU9A 3KYOB 4FXGA 4Q74A 3I6GB 4JEGB 4AG4L 4HPYL 4IRSD 2VZ3A 1BIIB 3HRZB 2V6HA 3OKNA 3W11D 3LV3A 1D5BA 1MCSA 4EI6B 3U6RA 3MLVL 3NIGF 5INDB 3T3MF 1U6AL 1SYVB 3SJVE 1MQ8A 1ZHNA 5D71H 3UYRH 5IB3A 3TZVD 4G6FB 3EOTL 2ZG1A 4MQXC 2J3SA 2L7UA 4F7PB 3DHMA 5DI8A 1DEEB 3ZT7A 2M1KA 4PJEA 4RMRA 1SBBA 1ZA3A 4PP1C 3DGGA 5LCVL 4QRPE 4X9BA 2GTZA 1VFAB 1XAUA 2DLTA 4ZTOH 3CFBA 3BMWA 4XMPL 3FQNA 1YPZF 5FDYA 4LLYA 5CSZB 2QHRL 2DLEA 4M93C 3NVQA 3UTTA 5BO1H 4K3EH 4X6EA 4XHQA 3I50H 5EOQH 3S36H 4M6NL 1HYSC 3UJTL 3SKNA 2VLRB 1FL3B 1PKQE 3C60C 2VXVH 4RFNC 2VISA 1BVLB 1HHKA 2VAJA 1NJ9B 1C5BH 4JRYA 3P0GB 3RL2B 4BSWB 4G8GD 1XT5A 1WCBB 2ZUYA 3F7PC 5SWSB 2KH2B 1EVTC 4OUUB 4JKWA 1YN7B 4MB4A 2AAVA 3HUJA 4L9LC 3RDTB 5BXFB 2KUTA 3O2DL 3DYMA 3D18B 2XPGB 1QEWB 3K2MC 2BXYA 1KFAL 4FQIL 3E6HB 3PIQA 4K07A 1PY4A 2VXTH 4U2YA 3BWUC 3OXRA 3B9KA 1WAAA 3VXQB 3V0VB 3AREC 1H9VA 2W65A 1B4RA 3QDGE 4ZSOE 5LQBL 5DVNA 4FFVD 5IVXF 2V2TA 1IGML 2DM7A 1EHAA 2ZOKA 3D39B 1DQJB 5IFAH 4F9LC 1WBZB 1P7HL 5CZXC 2NY6D 4WUKH 4C4KO 5C0AE 5CWSB 4ELMA 5I6XB 4P0DA 1JNJA 4M62H 4GRWH 3KXFB 1RZ8A 1M6OB 3MOQA 3C9NA 1DSFL 1JCKA 2C4XA 3KLDA 2JJSA 1JUFA 4MDIA 4F37K 1WZMA 4WHYG 2ZSWA 1K8IB 5BQ7A 1MHHA 4YZFF 2XN9E 5FHBH 1SJEB 4JM4L 3QXTA 4U31A 2AV7A 1QFUL 3ARDA 4M7JL 1EUTA 2DMKA 4KK5D 1QLFB 5D1XA 5CMAA 1Q9KA 3FT3B 4IRZL 5J11B 5CD3B 3EYVA 1PLGL 4OZGB 1A6TB 1MREL 2DQIL 4MXWH 1E4XL 2AK4D 1UJ3A 2VZUA 4KUCF 1P4IH 2V17L 3JWDC 3O9WA 4ZO9A 1J10A 1ZMYA 4OLXL 4KHXH 3T2NH 5A2KH 2D4DA 1EGJH 2AV1A 2VQ1B 1CDGA 4G6ML 4AYFA 1RIVH 4DGYH 4G8EB 4O4YH 3NCYP 3BPOB 4LCCC 4Y5YB 5HHXL 3UXFA 5K9KA 2JCCA 4PJAB 2OTWB 2EYRB 5F3HB 5HJ3A 5FYLD 1JWSB 2DWDB 2FD6L 2HJFB 1DANT 2CIKA 4WW2B 1FC1A 2DJSA 3MGTA 1OAUH 1GAFH 4U0QB 2V7HB 4KKLD 1XEDA 4U1HA 3H9ZA 2C3WA 5GGRY 3RUGF 3CFKB 4XCEA 2F9BT 5HHME 4OQTL 3QIBC 5E99H 3NCYS 3U7YH 1ZT4A 3MLYH 1U8MB 3EW3B 1RHFA 4PLKD 5F7DB 3RJQB 5TDPA 4LSDA 5FF6B 3ILQD 3I3EA 3IFNH 5F3BA 4Y5VB 3UTTD 4U33A 1LHZA 4GAJH 3OAYH 3VFRA 2GAZA 3ZMRA 2J8UA 3BISA 4HUVA 1S7RA 1MPAL 2DIJA 1DBKL 2OSLB 2VDLH 3H9SB 4KV5E 2IPTL 3T0EB 4PJGA 5E7BA 1WICA 2OL3H 5GGUB 3DARA 3GJFH 2FB4H 4LL9A 2AP2A 4JRYD 1R0AL 2X4TA 2E9BA 1Q0YH 4TVPL 2BMKA 3X13B 4OGYH 4GG8A 5GRJL 1IARB 3AY4C 1Z3GL 2CRIA 1W8NA 3PWUB 1S7TA 2EE2A 3QIWA 1N2RB 4P46C 2HJLB 3P40A 2NZIA 2OMNA 4JZJC 1OP3K 3GSNL 1RZFH 4R8WH 5LBSH 3WN5A 3GMNA 4FFWD 5F71A 3EFDH 3SKJH 4APQC 4M3JA 1FSKC 1FLTX 4RBPK 4XPHL 4Z95L 1H5BC 4NQXB 3B9KD 2D9CA 2VIRA 4NRXA 1R5VA 4BELD 5EULV 5CD5C 3OKEA 4NKDB 1L7TL 1WZKA 2ARJB 1NC2A 2XZAH 3HC4L 3IJHB 4GRWB 1RUPL 1LQSR 4OM1L 1PGRB 3GRWL 3TBTB 3FAWA 3VXUA 2Y9RT 5D7SH 1M7XA 1MJJB 3KPSB 4I9WD 4FQJH 5DURB 5JUEH 3NH7H 3HZYA 3RTQB 4OF7A 4L3EB 3W81A 2ESVB 3NFSH 4HAFA 2DN7A 4ODSL 5JA9A 4NO3B 3CFCL 4RMTA 4J3UA 2B4CH 2WWMD 3G5VA 2HT2C 3UO1H 1L6XA 3IJYA 2N56A 5EBMA 1OLZA 1XGYL 3BOVA 4BA8A 4G8IB 5F7HA 3WL9B 3H2WA 5IVOA 2BNUB 1NCAL 3JWDL 1URLA 5C2BL 4P9ML 2BSRA 1X5GA 5F97E 2RFXB 3ARDD 5HGGS 2X4NB 5D1XD 3GMOB 1UWGH 3O2VH 2R1YA 3TBYA 3CH1A 3HC0B 2L4OA 1NFIB 4LLQB 2LQRA 3CVIH 1MLCA 3INUH 4U1LA 4C4KT 1MLBA 4AENB 1MCKA 3FB7B 2XQBH 4DAGL 2VL5B 2P8LB 5ITFA 5F88A 3R0MA 1FNGA 3O9WD 3KNBA 5F21B 3BPCB 4CVZB 3A67H 3ARBC 5I1HL 4V1DA 3SEPA 1ZLWK 1EAJA 3T4YB 1NFDE 4XVUC 3QCVH 1WJ3A 5D7KE 3WCYA 3ZSSA 3OR7A 4BQ8A 3O45B 4PLJD 1DLHB 1Z0NA 3TYGH 4FQQB 1AGFB 4QTIL 1M7IB 3X14A 3W9EA 4FABL 3S8WA 3ULVH 4EVNB 1NBZB 2XG5A 4RWYH 4R6UA 2YXFA 4I4WA 1QBAA 5D2NA 3P73B 3CFIC 3QNYA 3DLQR 1U92B 3PG2A 4WWKB 3RZCB 1GGYA 3FT2A 3D1MC 4N0CD 3CAFA 5L2KB 4OI7A 4I48A 4JFOA 1MQKL 4JREC 5GISH 1HHJA 5HGHA 4KI5C 2OL3B 3GJEB 3RNQB 2VLME 2Z93B 2AJXL 3OKOB 5I9QB 4WV1B 1PFCA 1N5AA 1Z9LA 2AXFB 4FFZL 3SQBA 1CL7L 1AHWC 1TZGH 2WBJC 1XZ0B 5MP6H 2J88L 3EGSA 3GI9H 4OFYA 4NCC1 4K3JH 2F8VA 5D5ME 3FHQA 1LE9B 3DIFA 5EC1A 4B7IA 2VLRE 3CSPA 5DUBA 2J6EA 1LDPL 2IBZX 1KC5H 1MCPH 3HE7B 2KZ1B 3OGCB 3OKLA 3GBML 1TCMA 3QIWD 4QHNB 1LO0L 2H2SD 4NNYB 3Q2CA 2X4OA 4NQEE 3IXAB 1VFBB 1LO2H 1IAIL 5IMLB 3QO0B 1QFWH 2Z4QA 4H20H 1EH9A 2E3VA 3NPZB 5FYKE 3C2AL 3MX0A 3PHQB 3D85A 2VDRL 2APBA 5JW4R 3PF2A 4AMKL 3M8OH 3NTCL 4YDKL 5TPWL 4X6DF 5KSBA 2XYCA 3MRIB 1UENA 1NC2D 4L8SA 1X5JA 4LLDB 1PZUB 4CAGA 1G7LB 3VXUD 5ADOH 1SMAA 3VFUB 4QXUH 2VABB 2Q76B 5D8JH 3M17B 3RWDB 3D39E 3PGCB 4E5XB 5DHYA 4K94H 1RUKH 2HTKD 1S3KL 3MLUL 5FM5M 1S78C 3QPQC 5DVLA 4KAQL 1RJYA 1P4BH 4TNWF 4QXTB 4QHKJ 5SX4H 3KXFE 4YDVA 4ACPA 4D0CA 1N0LA 3IDMA 1Q9OA 4QY8B 4AM0B 3MV9E 4JFYB 3U79A 3REVB 4BH8B 2ZCKL 1SEQL 4RMQA 5LKNA 3LB6D 1KCUH 3HZKA 2DQUL 1CICC 1H0DA 1INEL 2CDFA 1BAFL 2JB5L 4HEPG 3S96B 2E8ZA 4BFBD 1BECA 4Y4HB 5DQJB 3MREB 4MX7A 3ZYIA 5EU6E 4P5KB 4C59B 3HNSH 1S7VB 3EAKA 1X7QB 4WGVB 3FZUD 3HFML 4OZGE 3VXSA 1INQA 2YD6A 2F19L 4XZUA 5HDOA 3TC9A 2EZ0C 3DRTB 3O2DA 4V1DD 4PJ9B 4U49A 3O41A 4TNWK 5EZIL 3O0RH 1SEBA 5C8JA 3PWLA 1HWGB 5BVJB 1O5DT 1F90L 4LAJH 1IAKA 2CLZA 1EEUA 1YNLH 4P49A 3D69B 2VB5A 1JZ4A 5FM8A 3RWCB 3MV7A 1EO8L 2YBRB 4AEFA 3C5ZC 5CILH 2VXUL 2DQCL 4PJAE 1W0WA 2Z8VC 1HKFA 4HW6A 4YH6A 4YO0A 2R4RL 2AXJA 3MO1A 1H15A 1WISA 2VDPH 1BQLH 2ZUXA 3LKNB 1I3RB 1OVZA 4JPVH 1R5IB 1CLZL 1KT2B 1R5WB 5F7EH 3MUGB 4R7DA 2BY1A 4XRCB 4GAGH 2GY7B 1YQVH 3HB3D 5DJ0A 4HMDA 4AJ0A 3IJSA 3DURA 4U1MA 4U7MA 4UB0H 3IAGC 4D8PA 1J1PH 3FFCA 32C2A 3KLHD 2R23B 1FV1A 2BVQB 5SWQA 1I9RL 2CRZA 1U8LB 1KEGL 4ONHB 2XV6B 4RZCB 1N8ZA 2XKNB 3GSUA 5C0IA 4OFYD 5BS0B 5E6YA 4LLWA 4MJ5B 3L5WA 4N0UA 1C1EH 3MBXL 5GRVL 2IANB 3H9SE 4H88L 1ZA6A 3T0EE 3QB7C 4PJCA 1T2QH 3BKMH 1FFRA 1T1ZA 3MCLH 5DO2D 4GMSH 1FZOB 5GIRB 2VDQH 5HY9B 4QGYA 4BH7A 1DTUA 4X99A 4UTAL 3CPLA 3Q5YA 2ZUQC 4CUCA 4Y8DC 2M26A 1RZKC 4HKZB 3QWOB 1RHHA 1CE6B 4JQIH 3FOMA 1KJMA 1YEHL 4K9EH 1UZ6E 5F96L 3CLEH 1BBDL 2NW3A 1V7ML 3D85D 1T20A 3BIBX 1DVFC 5JPNA 4JG0L 3GUTA 4PRNA 1R3JA 2IG2H 3PUCA 5JHLH 1R3KA 2CJUL 2YK1H 2D4FA 4BQ9A 2HG5B 1UXSB 3MJ9H 4PYGA 3K3QA 1T7VA 3IXTA 3MRDB 4GRWE 3I6LE 2K9UA 3MLSH 5D7IF 3MACL 3CX5K 3VU2A 4OQTA 1SQ2N 3KPSE 3QJFB 5J9PA 4RAVB 5EUOE 4F80A 4RMWA 3C60A 3U0WL 3FT4A 3K4ZA 1XF5B 3IRZA 2ESVE 5I15H 2OTUA 3RHWK 2FR4B 1QA9B 4M7ZC 4UV7H 5C6PB 1LGVA 4YHOL 4EIZC 3TIEA 1JPTH 2EE3A 4L9LA 2FGWH 4U1SB 1G7JA 1NBVH 5E9DB 3K80A 1XF4A 5T1LA 1T1YB 5ICXA 4JLRB 4OCSL 4QCIA 5J06A 5DLML 3BKJH 2COQA 1XGPB 2R56L 2DD8H 5F1SA 1U3HB 1U3ZA 1YY9C 2Z31C 3ARGB 2NY1C 1ETZA 5DD0H 5EA0H 3G6JE 3VXSD 2BVOB 5F9JB 3WFDH 4TSBL 2BHYA 3S88H 3WDJA 3IFOA 3FB5A 3GSNA 4FZEL 4QKXB 1UM4L 1E6JH 4JGUA 5F9OH 3WE6B 3QXWA 2VZVA 3GO1L 3MRRA 3MV7D 4F9LA 5GGSB 2GKIA 3PHOB 1UCBL 2V9TA 2ZSVB 4OCYH 3UPAA 1QRNB 3CK0L 3GRWA 4UMGA 4XBEL 3DMMA 1IL1A 4DKFL 3MPCA 3EYSH 4JY5H 1N6QH 3T65B 3QFJA 5MEQB 4QTHB 1GXEA 1UB6B 4O51B 4XNXL 3THML 4ZO8A 2W60B 2E7CA 3VRJA 4MDJB 4TSAL 2YWZA 5HBBA 2DAVA 3FFCD 5BRZB 3MYJA 4EUPA 1HYRC 4KK8C 1YPZB 1IC5L 4EXPX 5CIPH 2APFA 3G5YB 5E2VL 4QXGH 5EN2A 4RWHA 4L8DA 1RZKL 3OKDB 2F54B 3O6LL 4GG6A 1JGDB 5CGMA 4JO2L 5CAYB 2H9GA 3RIAF 5F7FA 4BQBA 1T66D 4GW1B 5FEBA 4L29B 4LCCA 1OP3H 2V2WB 3C08L 4FHBD 4MJ6B 3V6FA 1G9MH 1F4XH 4NN5C 2B2XL 1HZHL 5GJTH 2HKHL 3VH8G 4FZ8L 2YPLA 4RBPH 4WWID 3CC5B 5D1QC 4F8QA 1OCWH 4L4VB 1AFVH 5IBLC 2XWJB 2B8OT 4MQXD 4LF3B 3DI2B 2EE6A 2NY5H 4KPHH 1IQDA 3T2OA 4LSTL 2NX5E 3QIBA 3BKYL 3MRNA 1T0MB 5EC2A 3G04A 1FFNB 4MNQA 4PP1D 3WFCH 1IGIH 1Q0XH 3CDYA 3KPPA 2J5LC 2P7TA 1YMMA 3PWJB 1MFEL 4XCYA 4YBQC 5ACZA 1DL7L 5IVXB 1B0RA 3LKOB 2PCPB 1F02I 5E00A 1HYSD 4FQCL 5J89A 5DEZA 4K7FA 4ORGB 3C60D 5H2BB 4U1NB 1BFVH 5FXCH 4Y1AA 5DQDL 1RSFA 2FJGB 1SY6H 3V6ZB 4NBXB 1WBYB 3RFZC 4RCAA 4P2YA 4PJ5E 5HYSA 3AY4A 2OJEB 5DUPH 2X1XR 3O6MH 3HUJF 3PL6B 4KDVA 2DIAA 2B1AH 4C83A 5TDOA 4JZJA 5T1LD 1Q9LA 2DYPB 5T1MB 3U7WL 3BD4A 3C09C 4TVPD 1NDMB 4XPFL 1G7HA 3LKRA 5I1CL 3QQ4A 2KBGA 1ZLWH 4OLUL 3WO3B 1DZBA 2EYTA 4APQA 1H5BA 3F7QA 4Z5RB 1U95B 5EU4B 1WAAF 5TQ2L 4N8CL 2VE6A 4WRLA 4GUPA 3KGRA 2W9EL 2A73B 4M1DH 4MLSA 3KPRD 4KJYB 4NM8L 2AQ2A 3ULVE 3IF1A 4ZUSB 1KXVC 3QXAB 5ECJE 2XNAB 4GAYA 2R29L 5CZXD 2QQNH 4ZOCA 4CN4A 3GSVA 1UXWB 1U8JA 3W9DA 5IGXH 2GJ6A 4IIQB 2EE9A 4OJFL 3DMMD 1OSPH 3ISWA 3B2UC 1KIRA 3H0TB 3QFJD 5EUKB 3RUGB 4TUKL 1U8PB 3PGFL 2IBZY 1JHLL 4K7PX 2YKLH 4PG9A 1GPOH 4TSCH 3CX5J 5IM7B 1BQUA 4MQTB 1TVBA 3BEVA 4G6JL 3TGXA 3DVGB 3GB7B 5ESVA 4PGBA 1RMFH 1MY7A 3ECBA 2AGJL 1KJ2H 4R2GC 1REIA 2D0GA 1T0NB 3ARBA 5DJYA 3CDFA 3VG0H 4ONFL 5HYEA 2XKUA 1YEFH 3DO7A 5FA4A 5HVHB 2IANE 5JTWA 2JCCF 4RIRA 5DT1H 3KYNA 2R2HB 3HE6B 2OP4L 2X9WA 4MD5B 4F7MB 4AT6A 1C7SA 2CLVB 2YPLD 4A2LA 4U7KA 1LP9A 3N1PC 2ZJSL 5JW3H 4GKNB 4PJ7A 5I71B 5DJZA 4H5SA 5F70A 3QIBD 4MZ2A 3U4AA 4R0LB 2A6IB 3P11L 1BGXL 5E8DH 1UZ8A 3GMQA 3JWOH 1QHOA 4MNQD 3RWEB 1WITA 3ZE0F 4MXQC 3EDKA 1YMMD 3VGEA 2C1OB 4JE4B 1EBPA 1AHWA 4LCWA 1NUGA 2WBJA 1S7SA 2J8UF 4QHLA 3LQZA 4UDUB 1KCKA 2OBGA 1KTLB 4PTTB 4LSVL 4PJGF 1PQZB 1Q38A 3PJSB 1ITCA 4Y1AD 2HFFB 5FUOH 3T0WA 2VH5L 1JGVL 1XIWB 3JUYA 1UGNA 1WT5C 2VDOH 4FTVB 3RWHA 2IH1A 3IDIB 4LDLB 1JRHL 5FO9A 3TNNA 5IR1A 4NZDA 1AQKH 4XCCL 5DR5L 3IDJA 2BC4A 2VQUA 3GMRB 4MAUH 4Q6IC 1T1WA 1YEIH 2GK0B 4YFLF 3ZHLA 4BQCA 5L0QB 5E9DE 3ZE2E 4U6YB 2VDML 3CVHL 1HQRA 4YHPB 4APQD 5MENE 5HHVL 1T03H 1WZLA 2FX9L 2VDNL 2F58H 2H32H 3HPLB 5CD5D 1B90A 2OJZL 1MSPA 4MSWB 1D9KB 5EZJA 2X4RB 1CYGA 3TO4B 1TIUA 1UM6L 4N90E 2W0FB 4P4KC 4Z7WE 3KLAB 3SBWC 2BOCA 4M6ML 4FQ1L 4AEEA 1V8HA 1DBJH 12E8H 4PGDA 1KUMA 1ZLVK 5C70A 1MRFH 4K3DH 2YEZB 4GFTB 4X5WA 2HT2D 2GJ6D 2R0KH 5BZDA 3BWAB 4NRYA 5SV3A 4PRIA 2NY2B 1A6UL 1A8JH 1BVKA 1YJDH 4HQQH 5D93B 4PP2A 4TUOA 1T7YA 2E5EA 4KU1A 4A6YL 5ITBL 2M2DA 4AIZB 3VFSA 1WEJH 1ZTXL 5AG8A 2DQGH 1V5JA 5CP7B 3UTQB 4XVTH 1KJ2B 4Y19B 3MRLB 5ICZB 3TPUB 3ALXA 1OSZB 4ALAH 1CXEA 2LAGB 1AO7B 1DQMH 2R69H 3QRGL 2W92A 2J1KA 1R3HA 1CICA 5J6HB 3IDNA 1MFAH 5AZEL 5EIIB 1GGIH 1JWMB 1A9BA 1MAJA 3SDAB 5KOVC 1CFQB 3BIKA 1XR9A 4G8FB 5BRZE 3L3OA 4NBZB 3QJHB 2EECA 1KPVA 2JJWA 2ZKHH 3QUXB 4F9PC 4ONGL 2CGRL 1HSAB 4S11A 3LEVL 5HSFA 3ARBD 3MLTA 3G6DL 4NJ9L 5FECA 1KB5B 5LXGL 3K4AA 4P5TB 3IGAA 4XVUD 3L3KB 4Q0XL 1YEJH 2XWTB 1CGXA 1A7OL 1EFQA 5FOBA 5MERB 1FO0H 3CNKA 5KSVA 5DEFB 5KS9F 1K3ZA 3C5ZA 2QKIA 1MH5B 3WKMH 1MVUA 5MI0B 1OD7A 1KNOB 4PGEB 3VFGL 3Q5OA 3X11A 2WANA 4MHHI 4P2QB 1JGLH 4LQ1A 5HHNB 5F6HJ 1GZQA 35C8L 2CMRL 1J8HA 4TPRH 1A2YA 2WWKO 3VJ6B 4XNQB 4XP9L 1PD6A 5I1KL 4OD1H 4KI5D 4OZHF 4I1NB 3DX8A 4JJ5B 2FO4A 3MNWA 5E5MB 4GMTH 2VLKA 5FDWA 4BUGA 3GSWA 3ZKXB 1KOAA 4OD3H 3BPNC 4LCWD 4R97B 2Z8WC 4UDTB 2WBJD 4QF1A 3BIAX 4DCQB 3ULUC 4PRPB 2H1PL 4YE4L 2K1MA 4HIJA 4K71C 3OWEA 4GKSB 4JM2C 1XF2B 5L8JB 4NYLB 1OGTB 1UCTA 1MCOL 3WIIH 4FFYL 4N9GB 5IMKB 3HG1B 3PHSA 3SQOL 4X9HA 3HI5H 4OCWL 3PWVB 3B5TA 4J8RA 2GSGA 2WM0A 5INCB 3BT2H 1D5MA 3ZDYE 2H32B 3QUZC 3QZWG 1MRCH 1HH6B 1R3IL 2Q8AH 1GGBL 3O8XC 2K3TA 1KELL 4IDJH 5FKAB 2A83B 3UBXG 2ITDA 3BZ4A 1A64A 1BOYA 4ZUTA 1ZWIA 2JIXB 2I60L 5EBGA 3RGHA 5ISZA 5E2UL 3ZDZE 1TNNA 2HH0L 4IMLB 1DVFA 1TQCB 5F1NB 2DJUA 2V7NA 3DBXA 1UQSB 3V5DA 5KSBF 1T5XA 4HBQA 2WLYA 9CGTA 1MCCA 4EIGB 2XZCH 3QAZB 4L1HA 3UEZA 4DGVL 5K9QI 1QTYT 1QSEA 5GGSY 5BV7H 5CINL 3DX9B 5M94B 4IMKC 4XPAL 2NXYB 1DFBL 5DDHB 5IEHA 3SO3B 2XOTA 1AGDA 3WO4C 1S78D 3QPQD 3OJMB 4KKCC 3BP6A 5IG7B 1TQBB 1UM5L 4PRID 3E8UL 3T3PE 3HC3L 3L5XL 4KVCL 2DM3A 2DI9A 1GZPB 1J0JA 2Q86B 1WK0A 2Q8BL 4LLAA 3QUKB 4WDIB 3RUGE 5DHXB 3U30B 3BP4A 1NMAL 1HH9A 1CICD 5J1AB 5J1TC 5EBLB 4YXHL 2X05A 3P77B 4J1UB 2VLJA 1VADA 1SMOA 4DTGH 5EWIL 4KHTH 4KH2A 4XNZB 1G7MA 3ROLB 2IH3B 2XWBA 3P30H 1WQVT 4K55A 4M48L 2A9MH 5JLZB 4W4OC 4H25B 5EIQA 1ZS8B 1DN2A 3BO8B 5C9JA 4HULB 2PO6B 4HKJB 3V4PH 4GQ9L 3T4AA 1AGEB 1OM3H 4GJTB 4N5UA 4HWBH 4IRSB 3C5ZD 2XT1B 5BW7C 4XP1L 4NKOB 2NPLX 4XWGL 3T8XB 5HPMA 3QUYC 5I1GL 4R4FL 4XWOC 1RUMH 4MAYC 3BAEL 1A7BA 1FRGH 5GXBB 3BN9C 4DKEL 3TZVB 4JPKH 3ARXA 1J8HD 3ULUL 1X5IA 3NAAH 3KPMA 1H3XA 3VGAB 4XNMA 4FQLL 5IVNA 2VLKD 5CBEB 1CFNB 5IOPB 5C0FA 2QSCH 1Y18B 3QNXA 4YFLI 5D7IB 4JHBA 2R0WH 5T3ZH 1MJ8L 4HC1L 5MEOA 4ZO6A 3CDGB 5EO9B 2FGZA 5C0NC 2G75A 2X1OA 1DE4A 1WIPA 3DXAA 4LHUB 3SGDH 3GKWL 2ZOLA 1A3RH 1KEMH 5HGBA 1JK8A 5AD0A 4WFGE 4YHKH 2W59A 4UBDC 1VDGA 5SWZA 4ZPVA 1RAMA 4PB9L 2AJYL 4CW1B 2VYRE 4HZLB 4JFXA 3DOSA 3QXUA 1Q9WB 3F5WA 5D1QA 3O3AA 4QYOA 1NANH 4GS7C 5ISZD 1OF2B 2HVJA 5BOZG 5IFJA 5BV7B 4L8BA 2FL5A 1DVFD 1P7KB 4M03A 3VE0B 4KZDL 1C5CL 1NSNH 4HIXL 1NMCB 2MPAH 5I1EL 1A47A 4FG6C 1JNLL 3GSQA 3TWCH 2A6KA 3TF7C 3BPLC 1SBSH 4OSUH 4NDMB 1QSED 2W0KA 1CD0A 2PYEE 4M1GL 1HSBA 5TFSH 1RK1B 3IDXH 2HT3C 1NLDH 4WW1B 3LS5L 5I74C 4XVSL 1R3LB 2HWZL 2YSSA 3S37H 5C0DB 5BMFL 5TE4L 4OI8A 2A0LC 3BSZH 3RVXC 2RCSH 3TEUA 4KZEL 2JB6B 2I9TA 2EDXA 3P9LB 2VZOA 1WLHA 4OQ1A 3MRPA 1QPPA 4RGNC 1S9WA 3G08A 3JXAA 3EFFB 4PGZA 4U1JA 1AO7E 4X6BA 5IHUL 2VZTA 4WFHD 5DRZB 3SDYH 2VLJD 5I76A 1YY9D 4DK3A 2CDEB 2NY1D 2C1PB 2YPVL 3NCJH 3RWGB 3RKPA 4YHYC 2N7BA 2Y7QA 1J05B 3SKMA 2P5EB 1QFPA 3U9PL 5B39G 4IOFC 2EXYC 3BE1H 4HFUH 3UJJH 4F7TB 1MAML 1NCDH 3FQRA 4FXGB 3CVHA 4OM0H 3CCHA 4LVEA 3OKNB 3LV3B 4JHAH 1VGKA 3SE9L 3SCMB 3U6RB 2AI0H 3HMWH 5DUMH 1DP0A 4TNVF 5C0BA 4P2OC 5DI8B 2FRGP 4G7VL 4M8QA 2NY3C 1C12B 1ZA3B 4NM4L 4MA7L 1HE7A 3IVKA 4ISVB 1EX0A 1S5HB 3QNZA 4HF5L 4KK8D 3OTTA 3FQNB 3TJEH 1Q94A 2XA3A 1ZOXA 4X6EB 1G6RH 4A6YA 3OKKB 4LHUG 3OG6B 4Y4KC 4W68A 4GG6F 4PRPE 3MR9A 5LWYL 2LU7A 1HHKB 5FM4A 3DXAD 5DJ2A 4TNVK 4ZPTA 3B9DA 1OTUD 3HG1E 1OARL 5GSVA 2BK8A 3EJZC 5SWZD 1J5OH 2Z8SA 3HUJB 3OR6B 6CGTA 2LV4A 5CJXC 3C8KA 5KSAC 3D0LA 2E9JA 5D1QD 1FLRL 2AXGA 1FAIH 3PQYE 4LIQH 1D6EA 1F6AA 4AL8L 1D5XA 3TIDB 3S3SA 5IJVA 4Y7MA 4HS3B 4DN4H 3PIQB 3L6FA 4KRNA 4XNYH 1F5WA 1MAKA 5AWNH 1U58A 3B9KB 5D9SB 5CCKH 4UT9H 2XZQL 4IRJC 3CIQA 1CCZA 1IGFH 3QUMH 1I1AB 2W65B 4S1RL 1ZLVH 2DBJA 4NO2B 4YBQD 3MOAL 1NBYB 2MWCA 4DW2H 4DVRL 3ZDXF 1DDHA 2QQLH 3MMEB 2HRPL 1AXIB 1MFBL 1JIBA 1GIGH 1ZSDB 3A6BL 1ORSA 1MNUH 4U3HA 3PP4L 3EZJB 1WT5A 4K2UH 2AJSL 4KQ3H 3W2DH 3U2SA 3PV7A 4HLZH 3S37X 1HXYA 2FSEB 4LFHD 1EAPA 5FFLA 3Q6GL 2ICWB 2RBLA 5F9WB 1CFVL 2AV7B 3TT3H 1KENH 2CO6B 4YX2H 4Q6IA 1PW3A 3MCKA 4XGZA 5CMAB 4NKMA 1Q9KB 5L9DH 1QR4A 3NFPB 3S35L 4Y89A 3TA3C 4UINL 4C56A 4ZFFA 7FABH 1F8TL 2AJ3A 4NKIH 1UJ3B 2ICCA 3HR6A 4D9QD 2KL6A 3O9WB 1RVFH 1RI8A 2EXWC 4NQSB 4RGOH 3MRCA 1CI5A 3B9VA 4F57L 1HK6A 3LN9A 2AV1B 2HKFH 4HMEA 3UDWA 1B88A 3ARFC 4X4XA 3ZKMC 3R1GH 4NQDE 5I75C 4LLVA 1QNZH 1X5AA 4OZFA 4QHKI 5IV2B 4P4KA 2JCCB 3BGMA 3L3IA 3SBWA 5J57B 5L7XL 4R96B 2QHLA 1P7QA 2K7PA 5E8PB 2RAMA 2FBJH 2IGFL 4OB5H 3MRHA 1IBGH 4PJIA 5C07E 3FOLA 3MNVA 2R0LH 4FXKA 1L0YA 4AQOA 3B2UD 1O7SA 3REWA 5C0BD 1ZVSA 2FJFB 4GLRH 3UTZA 4XCEB 1YY8A 1G6RB 4P3CH 4Q9QH 5AYQA 4LK4A 1ZT4B 5DTFA 1E4WH 1BJMA 2XTJE 3QEHB 1RD6A 4PD4J 1A02N 2A74B 6FABL 3VW3L 2VDKL 2XQYK 5F3BB 4FQ2H 2YA2A 3VFRB 2GAZB 3OV6A 2J8UB 1LO3H 1S7RB 4GXVH 4OCXH 4F9PA 3WUZA 1IT9L 1T7ZA 4BZ2L 4R2GD 3GMMA 4HXAH 5SV4A 4PJGB 1ZGLP 3MA7B 4X4YB 1N59A 1XF3A 2SEBB 3J7HA 3WS6C 5DSCA 2WV3A 5C0JA 1HEZA 4JHWH 3AS1A 5ESAA 4ODBD 2ADGB 3N9GH 4JN2B 1SM3H 4HUUA 4CVXA 3RIFK 4MWFA 4I2XB 4LSSH 3FKUS 4QO1A 3WSQH 3F7YA 1A3LL 1FNLA 4KTEH 4LGPB 2D0FA 3FO1A 1IGCH 3C5JA 4QRTA 3W0WB 3FRPG 1OAYH 1UWEH 3QG7L 5TGBA 5GRYA 4CKVX 1YYLH 4KI5F 2VIRB 4NRXB 1I8KA 1R5VB 5I1DB 3NOIA 3RVTC 4LSUL 4MXQD 1NC2B 1VHPA 3HNTL 3IT8D 3EOBA 4RISH 1D5IH 2UVEA 4M61B 3VXUB 2H2PC 2UYLA 2PW1A 3I9GH 4LRNH 2A6JA 3LIZL 3HZYB 4S2SA 5IB1A 2FNBA 1EPFA 2H3NB 4JM2A 4YJZL 3UPRB 5F7NC 4HFWA 3V0AC 1TVHB 5GS2D 3NZ8A 4P9HH 3MLVH 4PRHB 2Z92A 1I7ZA 2E6PA 3IJYB 3EOTH 4Y16B 3VFOB 4LVOB 4MB5A 1IC1A 5FA3A 4HC1A 1KJVA 4CU7A 4HHAA 3QUZA 1I7TB 1CQYA 5FYKU 5M95B 1E6OL 3DTXB 4N8VA 2CRMA 1ZT1A 5E08L 3CH1B 2PR4H 5FHAL 1MLCB 1MEXH 4C56D 3BH8B 1MLBB 3MFFA 2NNAB 4S1DC 2VUYA 1FNGB 3KYKL 1WV7T 4JKPL 4TOYL 3QH3B 4HS8H 3DUHA 1JL8A 4V1DB 3LN4B 4N0FB 3OXSA 2P5EE 3WXVH 1ACYL 4C55A 4P4KD 1A5FH 1YMHA 3O4OB 4IMKA 3MJ8A 5C0CA 3OSKA 3STZB 3OR7B 4HV8A 2OI9C 1P7QD 5KS9B 1FN4A 3DV4A 3N1QC 3QEUA 3IETB 4H0IA 4Z7QF 1CXIA 3NGBB 3UYOD 1KCVH 1KLUA 4QHMA 4ZAKC 5B3NA 1CDIA 5D2NB 3QNYB 3GEWB 3QFDA 1XCTA 1CBVH 1Z5LB 2AEIT 4I48B 2OR9L 4DJMA 4JFOB 1YDPB 3VMOA 4GW5A 1MJUH 4ZD3H 1HHJB 2V5YA 1T3FA 2D7OA 1WCQA 1YEEL 3FB6B 4ODTH 5T3ZE 5HGHB 4OZHB 3TESA 2CK2A 3GI8H 1LEKA 4NQVA 2MCG1 4U0RC 1N5AB 4NN6C 3TVMC 5CZVL 1EXUB 5EZOL 4CMMA 4JFEA 4X4MA 3MLXH 3KLSA 1IGMH 4EI5C 1LEGB 4MXVF 3MFGB 3O6FC 2CXKA 25C8L 3H3PH 3TBVA 4MMZC 5DZLA 4GRMB 2ZG3A 3DIFB 1JTOA 5EC1B 1K8DA 4LVNB 3SDCB 4JN1L 4W6WB 1LMKA 4F33A 3M1BB 4JFFA 3S4SB 5KVGH 1DBAL 3OKLB 5IK3B 5BW7A 4Q2ZA 3X3FH 1NAMH 3L3GA 1KCSL 2BHUA 3QUYA 1K3IA 3Q3GA 3QO1A 2Z4QB 2ZG2A 4BKLA 3CZFB 2F74B 5CJOL 1E27A 3ZE1F 4OFPA 5BZWA 4JFDE 5FGRA 1MCWW 3P9MA 4D0DA 1LE5A 1CL7I 4OLXH 2XA8H 5ILTH 2MQCA 4RDQG 2GCYA 4L8SB 1F58H 2PXYC 3L3DB 4HLZG 1T5WB 4QLRA 3U4EA 1YNTB 3LHPL 4G5ZH 3WFEH 5DFVC 1I7RB 1MCFA 2H8PB 4M5ZH 3NPSB 4NWUL 5HHXH 3ULUD 4Y5XC 3LEYH 1NGYA 4JY4A 3MODL 4JM2D 2QEJA 2IC2A 4OTXL 1MCEA 1X3DA 2FD6H 1CK0L 5I1JL 3AB0C 2XTLA 3QDMB 2A77L 4S0SD 4G43A 2ATKA 4JDZB 3EYUH 4NSKA 1W2KT 1RJYB 3L1OH 1F4YH 2C4FU 4XP5L 4XPBH 3MZGB 1UB5A 5F1KC 5JOPD 1IAII 4CJ1A 1ZANL 4ZFZA 2NW2B 1HHIB 1ZHBB 3L7EA 3IDMB 4BSVA 4D0CB 2RHEA 3C6LC 3LZFL 3QUZD 2AK1H 2IJ0C 1IC4H 4HBCH 4L4TE 5C92A 4NJAL 4WEMB 3BI9X 2OR7A 5GS1B 1H0DB 1FGNL 1QVOB 3UTSA 3L3JA 2V9QA 1P84J 1A6AA 3KYMA 5JW5A 4XC3L 3VDBA 1MWAH 4F2MA 3MUJA 2QR0A 1INQB 3CXDL 4Z7VE 1OGAA 1BX2B 4Q9RH 4GRLB 4WHTA 4NBYB 3O41B 4UOW0 1F3DH 2JK5B 1KPRA 1SEBB 3ILPB 5I17B 2VR9A 1KIPB 3DX7A 5C0CD 1ZLSL 2O26U 3MV7B 1ES0A 3OJVC 1K2DB 4KGJA 4ORZC 1W0WB 2HMID 4YO0B 4ZFOL 1MI5A 3S3PA 2ORBL 3NZHL 4KKCD 5DD5H 3MO1B 1CLOH 1H15B 3Q1SL 3VG9B 3HI1A 4GW4B 4BFGA 43C9B 2WUCH 5C0RH 4AEHL 3VFVA 3HNVL 2AJZA 4D3CL 2NY0C 3H8NA 4R7DB 4GSDH 2EH8H 1IFHH 2AABH 4HGWB 2IPUK 3EKCA 3QIUC 1SJVA 1P4LA 4XCFL 1C5DA 1CDYA 3QDAA 3DYPA 3IJSB 2JKXA 32C2B 5D2LE 4ZFGL 3DYOA 4JFED 1FV1B 5SWQB 4LGRB 1UADC 4KDTC 3SDXB 5KVEL 3HLAA 1DCLA 3GSUB 3RWJA 4NOBA 5KVDH 4N5EC 2X70B 3L5WB 3S4SG 4JZNB 3CFDB 5CBAA 1ZA6B 2NLJB 4YHZL 4JFFD 5HGDA 2DMBA 5F8RC 4LIQE 5LAXA 5DMJB 3MLWH 2ADFL 4J3TA 5E03A 3RX7A 4X99B 3U9UB 1MUJA 3CPLB 1HOCA 2YOCA 3PV6A 1QYGH 3QUYD 4XWOD 2YRPA 3H7LA 2YRZA 5D1ZB 4WU7A 3BN9D 1CR9L 1FPTL 3F62A 4I2XE 5CLWA 1YYMH 1OP5K 5GZOC 3DUSB 4QXWA 1F6LL 3ETBF 3E3QE 4P2OA 5JORA 1T20B 1FZJA 2GTWB 3W0WE 5JPNB 3ZL4H 5IESH 1MJ7L 3GUTB 4ZNEE 43CAB 1BEYL 4QNPE 2AXHA 2C26A 4OUOA 4S1SH 5JQ6H 3EYOB 3FQUB 4M8VA 5EU5A 4RFOH 1R3KB 1LDSA 4QOKE 2HN7A 3ZT5A 3IXTB 3VD5A 4CU6A 2XXCB 1D6VL 1OAQL 4LCUA 5FV1L 3G5XA 4KKBC 3HRPA 4Y4KA 3RDTC 1FVDB 1HIMH 1KPUA 4RFNB 3FT4B 5C0ND 4QTIH 4F15B 1JWUA 1NDGA 4FABH 3EHBD 1EHLH 4PRHE 2D3VA 2AEQL 4KDWA 4XP4H 1MWAB 5DK3A 3LKQA 5JXEA 3TIEB 4JQVC 4L9LB 5CJXA 5KSAA 4RNRA 1EO7A 1XF4B 1CG9B 3BVNA 5JXAL 3LEXA 4NIKB 5ICXB 4QCIB 2H41A 5KAQF 2AJXH 5GSRB 1AD9A 1DQQB 3UTSD 2ED9A 1AH1A 4ZOEA 2R1XA 1OD9A 3FCTA 1OL0A 4PJHA 4X6CB 3PGDB 2E27L 2F53E 1TJGL 5HYFA 4LDOB 2X5PA 3V5HA 4POYA 1OGAD 4TRPL 5F7WC 1RULH 3MV8E 4IRJA 4YEFA 3AREB 4FG6D 1DLFH 5D72H 1TTFA 3KPRB 4M9OA 3WS3A 2Y23A 2BY3A 4ODUA 3ZSTA 2A6DB 2MCPH 5EOCL 5I1LB 4WJ5B 1NKRA 3QHFH 5GJSH 4PYHA 5FYJH 4OCLC 2HT3D 2CKBL 5IT2L 2PYFA 1NUNB 4XBPA 3VXMB 5KS9E 1MI5D 1UYWL 2FZ3B 2Y5EA 4YQXL 4R90L 5J11C 2F5BH 3NCEB 4NHUA 2A0LD 3QFJB 4R26L 3RU8L 3RVXD 3QA3A 5A43C 3JV4A 1RU9H 1WFOA 3O3BB 4QT5B 3SO5A 2HLFC 4RGND 1PG7L 1JFQL 1QOKA 1WIOA 1CS6A 1JHKL 1TETL 4OZHE 3MYJB 5GS0H 3TA3A 4WU5A 3HZMA 1J0IA 4JG1L 1CFSB 4XXDB 3SGEI 5EN2B 2V2XB 3V5KA 4L8DB 1FDLL 5KVMC 4RGMC 5DK2A 4GG6B 4XBGB 3U0PA 4I5BB 5EFIA 3WXWL 3EOYG 2EXYD 3ARFA 4YIQB 4G80A 2KZWA 1JPSL 3HZVB 3GZKA 1EEYA 1NGZA 4LCCB 4DQOL 2P46B 1EK3A 3CFJA 4X6FA 4Z8FH 4B5EA 2R2BA 5EOTA 3CXHK 1P2CA 2YPLB 3HMXL 5AYUL 2APVA 4BZ1L 1JZ8A 5EU7E 1MCWM 3NA9L 1DANU 1C7TA 2DQUH 2BNQA 4Y5VC 4P2OD 2AJUH 1QKZL 1IQDB 1HINH 4M5YH 3IKCB 3QIBB 1J0YA 1V3JA 4J6RL 1D5ZB 3T08A 4HT1L 2NY3D 2DICA 5EC2B 5DRNB 2Y1VA 3G04B 4J7RA 1S9VB 3B2VL 4PJBA 2J12B 4MNQB 3T0EC 4DZ8B 2EDQA 5FYKL 3HA0A 3KPPB 1ODAA 4NPYA 1Z6JT 3DETC 3D3VB 5DHVA 1FNAA 4KKAC 3E1F1 1B0RB 5DFWH 1H3GA 3LSOB 1BBJB 4G9FB 4JFHE 4JFZH 5CJBA 3EDFA 4Y4KD 2VOTA 3RA7H 5LGJA 8FABB 1RJZA 3M07A 2IQAA 5DWUH 4NQCE 2ITCA 3SJVA 3VFNA 3FQWB 4FMFA 2X4QB 1MVFA 3QDME 1A7PL 3MA9H 3AC0A 1XFPA 2GFBA 2KQMA 5IJKC 5H35A 3EJZD 5HYSB 4HSQA 4F58L 5GGRA 4P46B 4QRPA 4C83B 4X7SL 5TDOB 5KSAD 1ZGLM 4W81A 1OW0C 1B4JH 1BJ1J 1Q9LB 2A9NH 4EZMA 5M7QA 4G9DB 3GMPA 3A0OA 5A2JH 4QRRB 3O2WL 1FE8H 5DRXA 3LKRB 3CUPB 4XCNA 5B38A 1FSKB 1PKQA 2W9DL 4HIEA 1H5BB 5E8NA 2VE6B 4IRJD 4O58H 4GXUM 4WENB 2VMFA 2YWYA 1CU4H 2ED8A 3CH8A 3SDDC 2HAZA 4OZ4B 3WBDA 2O5ZH 2YR3A 3STLA 2BOBA 1I4FA 4PJXE 4EN3C 1U8JB 4NO5A 4JO4H 3TM6A 5D71L 4LP4A 1PKOA 2G60H 3UYRL 1W72H 3C6SA 3TH2T 3WNLA 4FNLH 5F96H 1KIRB 4AIOA 1MHEB 3LOWA 3DHJA 5GGTH 2FDBP 2IMMA 4X5XA 5E7FA 5TE7H 1EZVY 1Q72L 4ZYKA 3QDGA 4HX1B 4ZSOA 2B20A 5GGVH 4PBXA 1DN0B 2FWOA 4GAFB 1OB1B 1CIUA 4ZTOL 2R4SH 2GUOB 5IKCA 1TVBB 3BEVB 1ZT7B 3TA3D 5BO1L 2Y06H 3MQIA 5EOQL 3I50L 3S36L 2EDHA 4LHJB 3MACH 5ESVB 5C0AA 1BZ7A 4KGLA 4PGBB 1JNNH 1FJ1B 3SDXE 2EXWD 1JGEA 1BQHA 2VXVL 3ECBB 3QWRA 1P6FA 3ARBB 5E8EA 1C5BL 3ARFD 3ZKMD 4OLWH 4KQ4H 4MJIE 3QEGH 5JIHA 3DO7B 4WCYH 5FA4B 3AU1B 5ALCH 1CFTA 2XN9A 4KJQC 4PREB 4WWKC 1V7NH 5FUCE 3RZCC 1GYAA 3LCYA 4LPUA 4OKVB 2HLAB 2O93L 3TYFB 3NACH 4PJIF 5E1AB 4PJFE 5DD3H 4X7TB 4ZAKA 1IGTA 2BNQD 1HDMA 1K6QH 4I3RH 3FO9A 5HHOB 2A1WH 4N0RA 1TCRA 4KTDH 3CSYB 3CU1A 3L95A 1UZ8B 3GMQB 4JREB 2VZ1A 1HI6A 5E5UB 3FMGH 4ZFOA 1NCBH 1PYWA 3TVMA 1G0DA 1CQKA 1MCJA 2DRUA 3QDJB 1LNUA 3H6JA 3UX9B 5IFAL 4M6OH 4J3VA 4EI5A 3OB0K 4ODHH 1WWCA 5E6IC 3O6FA 4WUKL 2UZIH 3SJVD 4HXBL 2QJDA 4YR6A 3W82A 1FP5A 4YXKH 2XY1A 4M62L 5HYSG 2GITB 3B6SA 5J8OA 2WWMC 2WAHA 2YD8A 3KJ4C 3V4VH 3BJ91 5FHBL 3TNNB 4QRPD 5IR1B 4RFEA 5HI4C 1K4CA 2BC4B 5AUMB 3VFMA 4RAUA 4MA1B 1MCRA 2IAMC 4EKXA 3MCG1 3QCTH 1N6UA 1MRDH 1UJTA 4MXWL 3MBEB 3N06B 1ED3B 1P4IL 4LLMA 3ESVF 5EG6C 1VEOA 4LQFH 4X6CE 4UI2A 4BK4A 3T2NL 2R1WA 2BVPA 5JHDB 2B39A 4WHDA 1EGJL 3RVTD 1SJHA 5FGSA 5IQ7H 2OTPA 1RIVL 4DGYL 1WZ1H 2PXYA 5EZJB 1W72B 4O4YL 3LS4L 4LNRA 1FVCA 2H2PD 3NFNB 2J8HA 3KPRE 3ULUF 4U05A 4XB8A 4DZBB 3TNMA 4YC2C 5ETUA 3P4OA 5EO1A 5C09E 3HTLX 5J6GA 5IIEB 4W6XB 1JRHI 1OAUL 1GAFL 3T2PA 3WUWB 2ADJB 4KROC 2C3VB 3AS0A 3VXME 4BYHA 4PRIB 1U8HB 4PP2B 4TUOB 2DTSA 4Y4HC 5E99L 4O2FB 1TJIH 3U1SH 3U7YL 3C6LA 3GFUA 5C0GA 3QDGD 3MLYL 4N0CC 1J1XH 5E4EC 3ULVC 2X44D 4PJ9C 1UH2A 1CICB 3ARYA 4YFEA 1KN4H 3IDNB 4PRDA 3IFNL 1V05A 1CD8A 2LTQC 3BP7A 4LVHB 4Z6AT 4GAJL 3BIKB 2P1YA 4S1DD 5C0AD 3EYQD 2FLRT 2VDLL 3RPIB 3QWRD 5FO7A 2OL3L 2FB4L 1ERNA 2H26B 3HI6H 1Q0YL 4D0BA 3IGAB 4OGYL 5DC4B 2XN9D 5FOBB 1NGXB 2YXMA 4MGXA 5KSVB 1UKQA 3C5ZB 2APWA 2QKIB 5KG9B 2EDOA 4LKCB 5D96B 1S9YB 2FIKA 4Z7UB 1RZFL 3D0VB 3VXTA 4R8WL 5A2LH 5LBSL 4QHUA 3WDHA 4ZAKD 4O00A 3HCVB 4FA8A 1ZHLA 3MRQA 3WN5C 1GZQB 3SKJL 4HKXA 5IB2A 3WJLC 4CVUA 5I1CH 4HJ0C 1J8HB 3MRGB 3VI4F 1CGYA 2CKBA 1NGWA 3QIUA 3TO2B 2Z8RA 1NFDA 2XZAL 1A7NH 4YBLB 2FO4B 3MNWB 3TVMD 1XCQA 2VLKB 5FDWB 5D7SL 3GSWB 5GRWA 3KYOA 3I6GA 4FQJL 3D3VE 4UILH 5F6IC 4EI5D 4QF1B 5JUEL 1BIIA 3NH7L 3HRZA 5ID1B 4HIJB 3O6FD 4OLVH 3FB8A 3NFSL 4LEOB 2P48B 5F72S 4G9FE 3ZDXE 5IHZB 1BFOB 4EI6A 5INDA 1SYVA 2EEDA 3UO1L 1GC1C 5HHMD 4OJFH 3OAYK 4J8RB 1A6ZB 4F7PA 1DEEA 2GSGB 3T1FB 5DRWA 1D5MB 4CJ0A 1I8IB 1RZJH 5JIKA 3V2AR 4K94C 1CDHA 1UWGL 3O2VL 2NXZC 1VFAA 4J3XA 3BZ4B 3CVIL 1BLNB 4ZUTB 1ZWIB 3RL1B 3INUL 1CVSC 3N0PB 5CSZA 5ISZB 2EKJA 3NABH 2XQBL 1DVFB 4QRRE 4UQ3A 5KJRL 1FNHA 4JO3H 4F8TA 3DBXB 5D5MA 3HR5A 2VLRA 3V5DB 2HVKB 1FL3A 1A7QL 3IDGB 1XH3B 2BY0A 3A67L 1BVLA 1S7QB 3QDHA 3B5HA 3HMXA 5FYJE 2PXYD 3UP1A 4N9OB 3QCVL 5DFVD 1U41A 4BSWA 1WCBA 5IVZB 1QSEB 4OV5B 2QV2A 4HIHA 4NQEA 3RDTA 2CKNA 3WUWG 1WWBX 3TYGL 3BW9B 2R8SH 1MFNA 4RQQB 3KPOB 5IEHB 3ULVL 4LASH 1AGDB 3D18A 1P9MA 3O11A 2XPGA 5T5NF 4RWYL 3UJIH 5AAWA 1Q8MA 4M7ZB 3MRJA 3E6HA 4JR9H 4O5LH 4J2XA 4HWZB 3C6LD 4JQVA 3VWKC 1MF2H 5GISL 3VXQA 3V0VA 3BP4B 1HH9B 3FO2A 3V52H 1QBLH 4M3KB 1VADB 2Z31B 3D39A 5MP6L 1WBZA 3A6OA 3GI9L 2XWBB 3UTOA 4K3JL 1L7IH 1EBAA 4P3WA 5CWSA 3WFBH 3KXFA 3MV9A 1KC5L 1MCPL 4U1IA 1F3JB 4V2BA 3QT2A 4KRPC 2YUXA 3MROA 5DO2C 1K8IA 3F7VA 2IEPA 4DOHE 5HPMB 1LO2L 1S7WB 1QFWL 1QLFA 4H20L 3FQTB 3ME0A 3FT3A 1X5XA 3RBGA 4WTWA 5EU6A 5CD3A 5KVFH 4P5MA 1OAKH 4G3YH 1UT9A 1U8IB 4OZGA 3M8OL 2NY0D 1MFCH 2ZUUA 4XNMB 5HHOE 3QIUD 4LPTA 1F45A 2I25N 5F9AC 1GC1L 5D7KD 5E8OA 2V5MA 4K9EC 1MFDH 3DPBA 5ADOL 4QXUL 5C0FB 5I19H 2QQQA 2VJXA 3QDJE 3QNXB 4PJAA 5D8JL 2EYRA 5F3HA 2QQKH 1UG9A 1DEDA 4K94L 1RUKL 4EOWH 4WUUB 1DE4B 1KN2L 1P4BL 2ATPA 4J23A 4F7EB 4ODWA 1IKFH 2IADB 1EHNA 3CFKA 5FK9A 1F2XK 4P4RA 5SWZB 1TDQA 2XRAH 4NN5B 2VLMD 4XNUH 1RJLA 4KXZI 5HI3C 2D7TH 4OGXH 5I18H 1ZTXH 4YHIB 1KCUL 3F5WB 1U8MA 5D1QB 5TE6H 3O3AB 3UCRA 5GZOD 4NZRL 4Y5VA 4QRUB 5IFJB 2F5AH 3BZDA 4HWUA 2CRYA 1MIMH 3HNSL 3GSOB 2IPUG 2VR5A 5E1HB 1JZ7A 2VLRD 2OSLA 3H9SA 3OZ9H 3UMTA 3T0EA 1IEAB 1YA5A 5GGUA 4Z7NE 2J5LB 4Q9BA 3GSQB 3O0RL 3UTPE 2BRQA 5JHDE 2AQ3A 4L3CB 3OAUH 1YNLL 3X13A 1TZHA 1JV5B 4XP6H 3T1WA 1HSBB 4KKBD 2HYMA 4NQED 4S10A 5CILL 3RDTD 1J11A 2DLFH 1N2RA 2HJLA 4PIRF 1IVLA 3LDBB 5FYKD 1PEWA 1G0YR 2G2RB 4OCMC 2VDPL 1BQLL 4WFFE 2YSSB 4JPVL 2X4PB 5IJKA 5C08E 5F7EL 2DQDH 2VWEE 4GAGL 2Y5TA 4NQXA 2I9TB 4EDWH 3MRPB 1OW0A 2B0SH 5GQBA 4UB0L 2ARJA 1J1PL 1MCQA 3G08B 3C09B 4PJHF 5JOEA 4TQEH 4IS6A 1I7UA 3KPSA 3KYAA 3D39D 5EUOA 3WEXA 4PJDF 1I1FA 3AAZB 4OZIB 1YEKH 4J4PC 1FZMA 3LPWA 3CJJA 2ESVA 2Y7QB 1EJOH 2CXGA 3VFTB 1C1EL 4NO3A 3VDAA 2LABA 2IFFH 5EDXA 2ZNXA 3EO0A 1T2QL 5F1OB 3BKML 3O4LE 3I2CH 3QXDB 2ZCHH 3MCLL 3MV9D 4GMSL 2VDQL 2E7MA 3SDDA 5DD1H 3E6FA 3H42H 3CVHB 3U46B 3WL9A 4CNIB 2WUBH 2BNUA 3V6OE 5HD8C 1KG0B 3PP3K 3BHBA 1EDQA 1VGKB 5EO0A 2RFXA 4EN3A 1EGJA 2X4NA 4JQIL 5BOPA 2E6JA 4OFIA 3HC0A 5EU6D 4K9EL 3CLEL 4Z7UE 3QHZL 1YUHB 4D2NA 3G6JA 4YNYA 4X7DC 5C0BB 2LVEA 4ESKA 1CIDA 1FNEB 1L9NA 1W0YT 2VL5A 3BDBA 2EH7H 4M8QB 4P3DA 2J4WH 2IG2L 3OB0H 1M71B 2HLFD 1BREA 5JHLL 4MD0A 1P1ZA 2YK1L 1J88A 1PDKA 4D9RE 1IM3A 3MJ9L 4OD2B 3T4YA 1Q94B 2NY5C 3MLSL 3EYFB 3PWPE 4A6YB 2X7LB 3BP5B 1NGPH 3HE6C 3D6GA 4JDTL 4FQQA 5T33L 1AGFA 1BJ8A 1PZ5A 3MR9B 4R2GB 5I15L 3PNWA 3BZEA 1NEZB 2BERA 2DIBA 5DJ2B 4EVNA 1IM9A 4ZPTB 1LD9B 4UV7L 5I71C 3P73A 5ESQB 5GSVB 3GBNH 2CPCA 1GJIA 4WWKA 1IKNC 3RZCA 1JPTL 4R0LC 2FGWL 5KAQG 2Q7YA 3MXWL 1NBVL 2FBOJ 3C8KB 4E41E 3OPZH 3D0LB 2OL3A 1AQDB 3RNQA 2Z93A 3GJFA 4Z77B 4M6AA 4YGAB 1OQXA 3RI5F 3BKJL 4FXLA 2DD8L 5DMGC 3OQ3B 4C57C 3FN3A 4C58B 1F6AB 1D5XB 2X2YA 5DD0L 5IF0A 4PG2C 1EEQA 3L6FB 5EWIH 5EA0L 1XZ0A 2R9HC 1U58B 3AFLA 2VUOA 1FH5H 4PJBF 3H9SD 3WFDL 5T1DH 3T0ED 3S88L 3CSBA 2VITA 2Y07H 4LARH 3DETD 1JZ3A 1E6JL 4KKAD 5F9OL 3IDYC 3AS2A 1DDHB 4TVSa 5GGVY 1I9EA 5E6IA 4WY7H 4QHNA 3P4NA 4OCYL 3IXAA 3WHXB 3QO0A 4WTZG 1SYSA 2DI8A 2NX5A 2GQHA 3EYSL 1DBMH 4JY5L 1N6QL 4U1GC 3PHQA 3DMMC 5H8DA 4GBXC 4X7EC 2O5YH 3BUYB 3VI3E 3OKMB 1HXYB 1UH3A 1EAPB 1OWWA 3VDCA 2ARWA 5DJAA 5IMMB 4LLDA 3I6LD 1MOEA 4XGZB 4JKMA 1CZ8H 2IAMA 4CGTA 1G7LA 3KPSD 4LLUA 3VFUA 4C56B 4HIIB 3TFKC 4QXGL 1CDBA 2AJ3B 2EDLA 3OHXB 4JANA 5IW6B 2Q76A 2PTUA 5CUSH 3M17A 1Z2KA 5FV2A 3RWDA 2ESVD 4MNGE 3MRCB 1NMBH 2XFXA 1ONQA 1PJ9A 4PJ5A 4LLVB 4QXTA 3SDDD 3JTTB 5DJCA 2M8XA 4OZFB 2DQEH 5D93C 5JNYB 3RKDC 4OBRA 1QSFE 3REVA 4BH8A 5GJTL 4G6KL 4ZDHA 2L7JA 1P7QB 2VR4A 4CMHC 4EN3D 3V7AG 3KJ6H 1OCWL 4PJIB 1AFVL 5FCUH 4FXKB 3S96A 2ID5A 2YN3A 2NY5L 3REWB 2FJHA 1UKTA 4Y4HA 3UTZB 3K4DA 1YY8B 3K1KC 4P5KA 2I07B 5J56B 1S7VA 2VXSH 1X7QA 3BFOA 3WFCL 5DTFB 1XGUA 1AE6H 1Q0XL 3CFEB 1VPOH 1CT8A 2BRRH 4PJ9A 5DD6B 5BVJA 1T1XA 1EIBA 3D69A 4Y4FC 4M1GH 4M9PA 1NEZG 1F11B 5A1AA 2OYPA 1BFVL 3JWOC 3UZVB 3GMMB 5MI0C 1NPUA 3MUZ1 1SY6L 2FYYB 1IM9D 1N59B 1XF3B 1EVUA 5DSCB 1FFPA 4NGHH 4IHOB 3LKNA 4WUUE 4YDIH 1T04A 1R5IA 4KJQD 4KK6D 2P5WE 3GSRA 4N1HB 1HEZB 4WWKD 5DUPL 1AXTH 4DFIA 2P49B 3RZCD 3MUGA 4NHCH 4N0YH 2B1AL 1M7DB 4Z9KB 4CADB 1HCVA 4JRXE 3VFWA 4CVXB 4MWFB 2JELH 3FTGA 1JGUH 3S34H 4LGSB 3IS1X 3FO1B 3C5JB 4PB0H 1UKSA 4QRTB 1U8LA 5H94B 3WJLA 4ONHA 4R97C 1I1YA 2XKNA 5IEKA 4ETQA 1TJHH 3FJTA 3EOAB 4MJ5A 1I8KB 2EC8A 3ZLQC 4HGKC 4M1DL 1FCCA 2IANA 5LG1A 4R7NB 5HY9A 1J12A 4OCRH 5HYQB 5CKAA 1JF1A 2UYLB 2PW1B 1S5IH 5E6ID 3NBNA 2A6JB 4K71B 4S2SB 5IB1B 2QQNL 5K59E 4YDJB 4I18C 1ADQH 5IGXL 3NZ8B 4PGCA 4LP5A 3I02B 2DBLH 4L8CB 1I7ZB 1OSPL 2NX5D 3VH8A 5DYOA 3EO9H 1AY1H 2YKLL 5DJXA 5EORH 2VKXA 1GPOL 3QUZB 4HHAB 5HI4D 4L1DA 1G7IB 4TSCL 1KJ3H 3O8XB 4H1LH 4HAGA 1ZT1B 2VERN 2O5XH 3QAZC 2IAMD 2VO5A 2PTTA 1VCAA 5IB5B 3MFFB 4KV5F 4CU8A 1OWRM 2NYYC 1RMFL 3QJFA 5TH2A 4RAVA 1KJ2L 4Y2DC 1U2CA 3TV3H 1IAOB 3GK8H 4OZIE 1ITBB 3SO3C 5J13B 5IROC 4JCLA 5GRUH 1XF5A 3BZFB 4BFIA 1I9JH 4PJ5D 1YEFL 1TPXC 5I8EB 1QR1A 5DT1L 3EDEA 4MCYB 4LSPH 3TBWA 3PXJA 3PWNB 1YMHB 4P23B 3AMLA 3MJ8B 3U4BH 3TLRA 1IC7H 4U1SA 5E9DA 5CJ5A 1T1YA 2EDYA 4FQPA 5JW3L 4NT6A 4BZYA 5MENA 4KROD 5GS3A 3LY6A 1HXMB 4K3HA 3ARGA 5JZ7C 4Y4HD 1MCIA 3VRIB 3QFDB 1XCTB 2CLRA 5GGQH 3V7AE 3VWKA 3NIFE 5E8DL 2B1HH 2BVOA 1E0OB 3JWOL 5F9JA 1I3VA 4YXLH 2C7UA 3H7BB 1T3FB 4KVNH 3ULVD 4PJ9D 1LEKB 5DMYA 2V5RA 1TFHA 2IWGA 4NQVB 4Z7WA 1JE6A 4IEFB 3WE6A 1A7RH 4MYWB 4FQXC 1QPXA 2ICEB 2HRPH 2ADIB 5GGSA 3PHOA 1MFBH 2P42B 4YFDB 5FUOL 4ZXBB 5IWLC 3F58H 2EO9A 1K8DB 5CEYB 1T83A 5KANI 2VDOL 4JFFB 1G1YA 4P2RB 3WIFB 1NC4A 1J86A 4QTHA 1IEHA 5T3XH 5I8KH 1UB6A 4UQ2A 2XTJC 4NP4H 1AQKL 3L3GB 4MAUL 3QUYB 4MAYB 5SWSE 1YEIL 4J3WA 4OLZH 1PX4A 1NFKA 5BRZA 4NZJA 1E27B 1T03L 3G5YA 4HJ0D 5CEZH 3O3DA 2F58L 2JTDA 4PLOB 1LE5B 1NFDF 1A4KA 5IMOB 2GCYB 2IAND 3U4EB 4L29A 5HI5C 1CGUA 3BUTA 2OZ4H 2C9AA 1A9EA 3RBSA 4JY4B 5C6TH 12E8L 4R3SB 4HPOH 3P4LA 3R8BB 5HXMA 5E5RB 4H1LB 1KXQE 1MRFL 1KTDB 4K3DL 1NLBH 3VWJB 2R0KL 3N85H 4NSKB 4JAMA 2ERJB 2XWJA 3MJ9A 4HQQL 4P57A 4HS6A 4XMKH 1SVCP 4LF3A 1UB5B 5BV7C 1X5LA 4X83A 4RRPG 1KXTB 4LSRH 4ZFZB 3PABB 3L7EB 2D03L 4WO4B 1WEJL 1T0MA 4K8RH 3BN3B 2EEAA 5I0ZA 5D7LB 2QSTA 4XVTL 4ALAL 1FFNA 3RNKA 5DK0B 1DQML 3MGOB 2R69L 3DVFA 4GXUN 2NXZD 1I8MB 1BZQK 5ANMB 1MFAL 3LQAH 5FCSH 2Y72A 3PWJA 3U48A 1FG9C 2WP3O 3KYMB 3LKOA 4OF8A 5JW5B 3U36A 2ZKHL 5D5MF 2X4UB 4ORGA 3FO0H 2BNRB 3BH9B 3AXLA 3PP3H 4K23H 4YUEH 2FJGA 2LVCA 2IQ9H 1CGWA 4KRMB 1KPRB 4TTGA 3MXVH 1YEJL 4AEIH 3IFPA 1U91B 3DUUA 1FO0L 4FP8H 5DEGA 3T0XA 2OJEA 3WKML 5T5FL 5E9DD 2QTEA 5T1MA 3PDDA 1MI5B 5MEND 5ABDE 1JGLL 2D0HA 5ICYB 3ARGD 3VFVB 4TPRL 1U0QA 3DO3A 1FL5B 4HWEH 3VWKD 4GKOA 1Q1JH 1U95A 4OD1L 2MOVA 4PUBL 4Y88A 1P4LB 1C5DB 3SOBH 4N90D 4GMTL 4I13B 1JZ2A 5KN5A 4KJYA 4TULH 4OD3L 4JFQB 2WMPA 3HLAB 1IGJA 4M43H 3RWJB 2XNAA 4J4PA 2VTFA 2OX5A 5KTEH 1OQOA 3SE8H 5CHNB 3QCUH 1P5VA 3QYCA 3WIIL 4ERSH 4NZTH 1EEZA 1RUAH 4NQTA 3QP3A 3HI5L 5GRZA 3TP4A 4IIQA 5HGDB 2O61A 5LAXB 5CIPA 1NC4D 5EUKA 3RUGA 4QRSA 4KRPD 1F4WH 4JB9H 2DQTH 1MUJB 2YC1A 3BT2L 2CD0A 1G9NH 3VA2C 4HUXA 2Q8AL 3PV6B 4IDJL 1FZKB 3VRLE 4WU7B 5IM7A 3SY0B 1EJ6A 5BRZD 2BCKA 5CJQH 3VXRB 4MD4B 3DVGA 1B2WL 1BZ9A 1S7XA 1U2HA 1T89C 3KWWB 3GB7A 4P2OB 1K4DA 4D9LH 3QULB 1GGTA 1KBGH 5MHSE 2DB8A 2Y4SA 3S35X 3LMJL 4HH9A 4PY8J 1T0NA 5EU5B 3V4UH 2P8MB 5D7JB 2HJKB 2XZCL 3V8CA 2W07A 1NBQA 5BV7L 4X9IA 5CP3A 4H1LG 1CF8H 1H3VA 1L9MA 2R2HA 3HE6A 3EO1B 4MD5A 5T5NG 1GGUA 2HFGH 4XC1H 1CXKA 2X40A 4S1QH 2NTSP 3R06A 1AP2B 1NDGB 4L3EE 4GKNA 4NUGH 2BZDA 1T4KB 4OCNC 4MA3B 3AROA 1IKNA 1WC7A 4UNTA 4R0LA 5EZLB 3FL7A 3LKQB 1NCWH 5HI3D 4HUKB 4YWGH 5E70A 4OGZA 1FVEB 4I3SH 1YEEH 1SY6A 4Q7DA 3GMLB 2R1XB 4CDHA 3FCTB 4DTGL 5DGRA 3MSPA 4KHTL 4PG2A 3E2HC 1VESA 5CGYC 5HDQH 3P30L 4PJDB 4LEXH 4UDUA 1DQLH 1A0QH 1FG2A 1KTLA 1CTOA 2A9ML 3V5HB 1TNMA 1UA6H 3PJSA 4IRJB 1QFWM 2HFFA 1XIWA 2OLDA 4MNHA 3BGAA 3LN5B 3WS3B 5C9KA 4ODUB 1OM3L 1K5NA 4HWBL 2GSIA 2A38A 2UWEF 5F9WC 1KGCE 2DQJH 4UV4H 5DJ6B 3DSFH 1RUML 3GIZH 5DC9B 1UZ6F 4JDVA 1FRGL 1BP3B 4JPIB 4JPKL 1NL0H 2E9IA 4O02H 5D70H 3QZWA 5AZ2H 4NHUB 4YHPA 3UBXA 3NAAL 4K7PH 4GBXA 1KB9K 3QA3B 4UUJA 3JV4B 3HPLA 4JQXC 4MSWA 4X7CC 1T7XA 5L2KE 1RZ7H 2PYEA 2X4RA 2EO1A 1F13A 5DJ8A 1YEGL 4MQ7B 3TA3B 2QSCL 4WU5B 2W0FA 5EUOF 5IW1A 3KLAA 2YD3A 3OBAA 2R0WL 4OIBA 5T3ZL 2BVYA 1UACH 2Y36H 4OIIH 4J4PD 1A6WH 2DM4A 4LCIH 3EDDA 2N1KA 3L5IA 3MODH 4YPGB 5DK2B 5ALBH 4MVBC 5I1JH 5A2FA 5EFIB 1SHMA 1NAKH 4LCYA 3ET9F 5I66B 4G80B 2YA1A 1A3RL 4YHKL 1NGZB 1BFTA 4X6FB 5HD8D 4AIZA 1OTUC 2R2BB 4F7CB 4P2RE 3T0AA 3UTQA 5EBWA 1KJ2A 5ICZA 3MRLA 3TPUA 1F97A 1AO7A 1P2CB 1QLEH 3OGOE 5J6HA 2HFEB 4HK3N 2BNQB 3RWIB 3G6JF 4ZS6C 4G8FA 5IHBA 4XC3H 3QJHA 1X5FA 1NSNL 2DJ4A 3MJGX 1ORQB 1HSAA 4PJEF 2P4AB 3ULSA 2MPAL 4ZNCD 3RIAK 3TWCL 1ZEAH 4LAQH 1IE5A 1SBSL 4OSUL 3L3KA 2P44B 5IB4B 1FFQA 4Y4FA 15C8H 3KPQB 5TFSL 5MERA 4M7LH 3IDXL 4YHMH 3HE6D 5LJYH 5LGJB 1M1SA 2PETA 2ITCB 4LBEB 2YMXH 5FUZH 2WIIB 1NLDL 4PGEA 3MRFA 1JZ5A 2DKMA 4LU5H 3ZTNH 1BFSA 3E3QC 4YDLC 3BGFC 1OAZL 4YGVB 5HHNA 2GFBB 3GHBH 2OXHA 4NRZA 4JVWA 3CMOH 5H35B 3BSZL 1UEMA 2RCSL 3VJ6A 4D3CH 4XNQA 4QRPB 1TMCB 2VXQL 5T1KA 3U0TB 5D7LE 2MKLC 4DVBB 2PNDA 1L4IA 5GZNC 4U6TA 5E5MA 2NTFB 5DMGD 2IPKB 3SDYL 1KLGA 2ZCLH 3K2UH 2XICA 5ANME 5DRXB