4HG0A

Crystal structure of magnesium and cobalt efflux protein corc, northeast structural genomics consortium (nesg) target er40
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
232
structure length
232
Chain Sequence
DEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium and cobalt efflux protein CorC
publication title Northeast Structural Genomics Consortium Target ER40
rcsb
molecule tags Transport protein
total genus 44
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4hg0A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4hg0A02
2E3TA 4ESYB 3L31A 2VFUA 5MMZA 4PCUA 1N63C 2P3HA 3JS8A 2BVFA 2NQWA 1QLTA 2VFSA 2RC3A 2P13A 4O9KA 3FWRA 1VDVA 3HRDC 2YVYA 1QLUA 3S1FA 2BVHA 1MBBA 2PLIA 1FIQB 1E8GA 1WVFA 3PC4A 4IYSA 1W1MA 3W8XA 2UV7A 5AE3A 3L2BA 3KPDA 1AHZA 2P9MA 4FRYA 2EMQA 1N5XA 3TDHC 4L3VA 2W3RA 2YVZA 3FV6A 4BCAA 2RK5A 2BVGA 3SL7A 2W54A 3I8NA 1DIQA 3DQ0A 4GQYA 5FXDA 2QREE 4P1GA 2GQTA 2Q85A 1PVMA 4L28A 3AM9A 4IY2A 1FFUC 4IY3A 5IIPA 3TX1A 3B9JB 1DIIA 3OCOA 4DQWA 3LQNA 3BW7A 1W1SA 1E8FA 3S1CA 1MBTA 3ORGA 2QLVC 4FXSA 3KXRA 3PC3A 1Y5HA 1YAVA 3T4NC 1W1QA 3LAEA 2NYEA 2OOYE 3KH5A 2UV5A 3K2VA 4XLOA 1W1KA 1N62C 5G5GB 3S1EA 1ZXIC 3NVVB 1RM6B 1WYGA 2OOXE 4IY0A 1W1OA 1VAOA 4ML8A 2NYCA 2GQUA 2RIFA 1F0XA 2QH1A 2YVXA 1E0YA 4GQVA 1SB3B 1FO4A 2R2ZA 4P1OA 2Q4WA 2I0KA 3HF7A 1JRPA 4BC9A 3FNAA 2QR1E 1N60C 3AN1A 3EUB3 3NS1B 5LXQA 3NVYB 4BBYA 1T3QC 5K22B 5ADZA 2QRCE 3LFZA 4COOA 5HQXA 2OAIA 3OCMA 2O3GA 5AE2A 1I19A 5HHZA 1ZR6A 4JAYA 5FXEA 2OUXA 3DDJA 2AXRA 3LHHA 2PLSA 2YVSA 3NVZB 2W3SA 4ZOHB 3SR6B 3K6EA 4BC7A 5FXPA 1WVEA 1W1JA 2QPMA 1N5WC 4NOCA 1O50A 3FHMA 1HSKA 3S1DA 3GBYA 2R8DA 5K25C 2RIHA 1FFVC 3I99A 4MLAA 5KS7A 3W8ZA 2UV6A 1PBJA 3AMZA 1DZNA 3TE5C 2MBRA 3NVWB 2YZIA 2ZY9A 2EXRA 3NRZB 2W55A 4L27A 3PM9A 2PFIA 4IY4A 1AHUA 1V97A 4JB1A 4O95A 2QKNA 1AHVA 5AE1A 5HMRA 3LLBA 3PC2A 1W1RA 2P4PA 4ESYA 2VFTA 2D4ZA 3OI8A 5FXFA 2VFVA 2VFRA 4HG0A 5K24C 1E8HA 3DEDA 5K23C 4OALA 2YZQA 4PYTA 2VAOA 1XKFA 1W1LA 5G5HB 1UXYA 4L0DA 3W8WA 3ETRB 4UUUA 2UV4A 1N61C 3FWSA 3KPBA 1JROA 3C0PA 3KJMA 2QRDE 4GQWA 3LV9A 2O16A 3KPCA 2EF7A
chains in the Genus database with same CATH superfamily
2E3TA 4ESYB 3L31A 2VFUA 5MMZA 4PCUA 1N63C 2P3HA 3JS8A 2BVFA 2NQWA 4DNSA 1QLTA 2VFSA 2RC3A 4BC7A 2P13A 3POPA 4O9KA 3FWRA 1VDVA 3HRDC 2YVYA 1QLUA 3S1FA 2Y3SA 2BVHA 2Y08A 1MBBA 3FWAA 2PLIA 1FIQB 1E8GA 1WVFA 3PC4A 4IYSA 1W1MA 3RJAA 3W8XA 5L6GA 3FW9A 2UV7A 5AE3A 3L2BA 3KPDA 2UUUA 1AHZA 2P9MA 4FRYA 2IPIA 2EMQA 1N5XA 3TDHC 3GSYA 4L3VA 2W3RA 2YVZA 3FV6A 4BCAA 2RK5A 2BVGA 3SL7A 2W54A 3I8NA 1DIQA 2J9LA 4GQYA 3D2JA 3DQ0A 2QREE 5FXDA 4P1GA 2GQTA 2Q85A 1PVMA 4L28A 3AM9A 3TSJA 4IY2A 1FFUC 4IY3A 5IIPA 3TX1A 3B9JB 1DIIA 3OCOA 4DQWA 3LQNA 3BW7A 3PQBA 2UUVA 4PVHA 3TSHA 1W1SA 1E8FA 5I1VA 3S1CA 1MBTA 3ORGA 2QLVC 4FXSA 3KXRA 4PZFA 3PC3A 1Y5HA 1YAVA 4PVJA 3T4NC 1W1QA 3LAEA 2NYEA 2WDWA 3D2HA 4BC9A 2OOYE 3FW7A 4UD8A 3KH5A 2UV5A 3K2VA 4PVKA 4XLOA 1W1KA 1N62C 5G5GB 3S1EA 1ZXIC 3NVVB 1RM6B 1WYGA 2OOXE 4IY0A 1W1OA 1VAOA 4ML8A 2NYCA 2GQUA 2RIFA 1F0XA 2QH1A 2YVXA 1E0YA 4GQVA 1SB3B 1FO4A 2R2ZA 3HSUA 2JA3A 4P1OA 2I0KA 3HF7A 1JRPA 2Q4WA 3FNAA 2QR1E 1N60C 3AN1A 3EUB3 3NS1B 5LXQA 3NVYB 4BBYA 1T3QC 5K22B 5ADZA 5K8EA 2QRCE 3D2DA 3LFZA 4COOA 2Y3RA 5HQXA 2OAIA 3OCMA 2O3GA 3VTEA 1I19A 5AE2A 5HHZA 1ZR6A 4JAYA 5FXEA 2OUXA 3DDJA 2AXRA 3LHHA 2PLSA 2YVSA 3FW8A 2W3SA 3NVZB 4ZOHB 3K6EA 3SR6B 5FXPA 1WVEA 1W1JA 2QPMA 1N5WC 4NOCA 1O50A 3FHMA 1HSKA 3S1DA 3GBYA 2R8DA 4PVEA 5K25C 2RIHA 1FFVC 3I99A 4MLAA 5KS7A 3W8ZA 5I1WA 2UV6A 1PBJA 3AMZA 5L6FA 1DZNA 3TE5C 2MBRA 2Y4GA 2YZIA 2ZY9A 2EXRA 3NRZB 2W55A 4L27A 3NVWB 3PM9A 2PFIA 4IY4A 1AHUA 1V97A 4JB1A 4O95A 2QKNA 1AHVA 5AE1A 5HMRA 3LLBA 3PC2A 1W1RA 2P4PA 4ESYA 2VFTA 2D4ZA 3OI8A 5FXFA 2VFVA 2VFRA 4HG0A 5K24C 1E8HA 3DEDA 5K23C 4OALA 3RJ8A 2YZQA 4PYTA 5AWVA 2VAOA 1XKFA 1W1LA 5G5HB 1UXYA 4L0DA 3W8WA 3ETRB 4UUUA 2UV4A 1N61C 4PWBA 4EC3A 4PWCA 3FWSA 3KPBA 1JROA 5D79A 3C0PA 3KJMA 2QRDE 4GQWA 3LV9A 2O16A 3KPCA 2EF7A
chains in the Genus database with same CATH topology
2E3TA 4ESYB 3L31A 2VFUA 5MMZA 4PCUA 1N63C 2P3HA 3JS8A 2BVFA 2NQWA 4DNSA 1QLTA 2VFSA 2RC3A 4BC7A 2P13A 3POPA 4O9KA 3FWRA 1VDVA 3HRDC 2YVYA 1QLUA 3S1FA 2Y3SA 2BVHA 2Y08A 1MBBA 3FWAA 2PLIA 1FIQB 1E8GA 1WVFA 3PC4A 4IYSA 1W1MA 3RJAA 3W8XA 5L6GA 3FW9A 2UV7A 5AE3A 3L2BA 3KPDA 2UUUA 1AHZA 2P9MA 4FRYA 2IPIA 2EMQA 1N5XA 3TDHC 3GSYA 4L3VA 2W3RA 2YVZA 3FV6A 4BCAA 2RK5A 2BVGA 3SL7A 2W54A 3I8NA 1DIQA 2J9LA 4GQYA 3D2JA 3DQ0A 2QREE 5FXDA 4P1GA 2GQTA 2Q85A 1PVMA 4L28A 3AM9A 3TSJA 4IY2A 1FFUC 4IY3A 5IIPA 3TX1A 3B9JB 1DIIA 3OCOA 4DQWA 3LQNA 3BW7A 3PQBA 2UUVA 4PVHA 3TSHA 1W1SA 1E8FA 5I1VA 3S1CA 1MBTA 3ORGA 2QLVC 4FXSA 3KXRA 4PZFA 3PC3A 1Y5HA 1YAVA 4PVJA 3T4NC 1W1QA 3LAEA 2NYEA 2WDWA 3D2HA 4BC9A 2OOYE 3FW7A 4UD8A 3KH5A 2UV5A 3K2VA 4PVKA 4XLOA 1W1KA 1N62C 5G5GB 3S1EA 1ZXIC 3NVVB 1RM6B 1WYGA 2OOXE 4IY0A 1W1OA 1VAOA 4ML8A 2NYCA 2GQUA 2RIFA 1F0XA 2QH1A 2YVXA 1E0YA 4GQVA 1SB3B 1FO4A 2R2ZA 3HSUA 2JA3A 4P1OA 2I0KA 3HF7A 1JRPA 2Q4WA 3FNAA 2QR1E 1N60C 3AN1A 3EUB3 3NS1B 5LXQA 3NVYB 4BBYA 1T3QC 5K22B 5ADZA 5K8EA 2QRCE 3D2DA 3LFZA 4COOA 2Y3RA 5HQXA 2OAIA 3OCMA 2O3GA 3VTEA 1I19A 5AE2A 5HHZA 1ZR6A 4JAYA 5FXEA 2OUXA 3DDJA 2AXRA 3LHHA 2PLSA 2YVSA 3FW8A 2W3SA 3NVZB 4ZOHB 3K6EA 3SR6B 5FXPA 1WVEA 1W1JA 2QPMA 1N5WC 4NOCA 1O50A 3FHMA 1HSKA 3S1DA 3GBYA 2R8DA 4PVEA 5K25C 2RIHA 1FFVC 3I99A 4MLAA 5KS7A 3W8ZA 5I1WA 2UV6A 1PBJA 3AMZA 5L6FA 1DZNA 3TE5C 2MBRA 2Y4GA 2YZIA 2ZY9A 2EXRA 3NRZB 2W55A 4L27A 3NVWB 3PM9A 2PFIA 4IY4A 1AHUA 1V97A 4JB1A 4O95A 2QKNA 1AHVA 5AE1A 5HMRA 3LLBA 3PC2A 1W1RA 2P4PA 4ESYA 2VFTA 2D4ZA 3OI8A 5FXFA 2VFVA 2VFRA 4HG0A 5K24C 1E8HA 3DEDA 5K23C 4OALA 3RJ8A 2YZQA 4PYTA 5AWVA 2VAOA 1XKFA 1W1LA 5G5HB 1UXYA 4L0DA 3W8WA 3ETRB 4UUUA 2UV4A 1N61C 4PWBA 4EC3A 4PWCA 3FWSA 3KPBA 1JROA 5D79A 3C0PA 3KJMA 2QRDE 4GQWA 3LV9A 2O16A 3KPCA 2EF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3T A;  4ESY B;  3L31 A;  2VFU A;  5MMZ A;  4PCU A;  1N63 C;  2P3H A;  3JS8 A;  2BVF A;  2NQW A;  1QLT A;  2VFS A;  2RC3 A;  2P13 A;  4O9K A;  3FWR A;  1VDV A;  3HRD C;  2YVY A;  1QLU A;  3S1F A;  2BVH A;  1MBB A;  2PLI A;  1FIQ B;  1E8G A;  1WVF A;  3PC4 A;  4IYS A;  1W1M A;  3W8X A;  2UV7 A;  5AE3 A;  3L2B A;  3KPD A;  1AHZ A;  2P9M A;  4FRY A;  2EMQ A;  1N5X A;  3TDH C;  4L3V A;  2W3R A;  2YVZ A;  3FV6 A;  4BCA A;  2RK5 A;  2BVG A;  3SL7 A;  2W54 A;  3I8N A;  1DIQ A;  3DQ0 A;  4GQY A;  5FXD A;  2QRE E;  4P1G A;  2GQT A;  2Q85 A;  1PVM A;  4L28 A;  3AM9 A;  4IY2 A;  1FFU C;  4IY3 A;  5IIP A;  3TX1 A;  3B9J B;  1DII A;  3OCO A;  4DQW A;  3LQN A;  3BW7 A;  1W1S A;  1E8F A;  3S1C A;  1MBT A;  3ORG A;  2QLV C;  4FXS A;  3KXR A;  3PC3 A;  1Y5H A;  1YAV A;  3T4N C;  1W1Q A;  3LAE A;  2NYE A;  2OOY E;  3KH5 A;  2UV5 A;  3K2V A;  4XLO A;  1W1K A;  1N62 C;  5G5G B;  3S1E A;  1ZXI C;  3NVV B;  1RM6 B;  1WYG A;  2OOX E;  4IY0 A;  1W1O A;  1VAO A;  4ML8 A;  2NYC A;  2GQU A;  2RIF A;  1F0X A;  2QH1 A;  2YVX A;  1E0Y A;  4GQV A;  1SB3 B;  1FO4 A;  2R2Z A;  4P1O A;  2Q4W A;  2I0K A;  3HF7 A;  1JRP A;  4BC9 A;  3FNA A;  2QR1 E;  1N60 C;  3AN1 A;  3EUB 3;  3NS1 B;  5LXQ A;  3NVY B;  4BBY A;  1T3Q C;  5K22 B;  5ADZ A;  2QRC E;  3LFZ A;  4COO A;  5HQX A;  2OAI A;  3OCM A;  2O3G A;  5AE2 A;  1I19 A;  5HHZ A;  1ZR6 A;  4JAY A;  5FXE A;  2OUX A;  3DDJ A;  2AXR A;  3LHH A;  2PLS A;  2YVS A;  3NVZ B;  2W3S A;  4ZOH B;  3SR6 B;  3K6E A;  4BC7 A;  5FXP A;  1WVE A;  1W1J A;  2QPM A;  1N5W C;  4NOC A;  1O50 A;  3FHM A;  1HSK A;  3S1D A;  3GBY A;  2R8D A;  5K25 C;  2RIH A;  1FFV C;  3I99 A;  4MLA A;  5KS7 A;  3W8Z A;  2UV6 A;  1PBJ A;  3AMZ A;  1DZN A;  3TE5 C;  2MBR A;  3NVW B;  2YZI A;  2ZY9 A;  2EXR A;  3NRZ B;  2W55 A;  4L27 A;  3PM9 A;  2PFI A;  4IY4 A;  1AHU A;  1V97 A;  4JB1 A;  4O95 A;  2QKN A;  1AHV A;  5AE1 A;  5HMR A;  3LLB A;  3PC2 A;  1W1R A;  2P4P A;  4ESY A;  2VFT A;  2D4Z A;  3OI8 A;  5FXF A;  2VFV A;  2VFR A;  4HG0 A;  5K24 C;  1E8H A;  3DED A;  5K23 C;  4OAL A;  2YZQ A;  4PYT A;  2VAO A;  1XKF A;  1W1L A;  5G5H B;  1UXY A;  4L0D A;  3W8W A;  3ETR B;  4UUU A;  2UV4 A;  1N61 C;  3FWS A;  3KPB A;  1JRO A;  3C0P A;  3KJM A;  2QRD E;  4GQW A;  3LV9 A;  2O16 A;  3KPC A;  2EF7 A; 
#chains in the Genus database with same CATH topology
 2E3T A;  4ESY B;  3L31 A;  2VFU A;  5MMZ A;  4PCU A;  1N63 C;  2P3H A;  3JS8 A;  2BVF A;  2NQW A;  4DNS A;  1QLT A;  2VFS A;  2RC3 A;  4BC7 A;  2P13 A;  3POP A;  4O9K A;  3FWR A;  1VDV A;  3HRD C;  2YVY A;  1QLU A;  3S1F A;  2Y3S A;  2BVH A;  2Y08 A;  1MBB A;  3FWA A;  2PLI A;  1FIQ B;  1E8G A;  1WVF A;  3PC4 A;  4IYS A;  1W1M A;  3RJA A;  3W8X A;  5L6G A;  3FW9 A;  2UV7 A;  5AE3 A;  3L2B A;  3KPD A;  2UUU A;  1AHZ A;  2P9M A;  4FRY A;  2IPI A;  2EMQ A;  1N5X A;  3TDH C;  3GSY A;  4L3V A;  2W3R A;  2YVZ A;  3FV6 A;  4BCA A;  2RK5 A;  2BVG A;  3SL7 A;  2W54 A;  3I8N A;  1DIQ A;  2J9L A;  4GQY A;  3D2J A;  3DQ0 A;  2QRE E;  5FXD A;  4P1G A;  2GQT A;  2Q85 A;  1PVM A;  4L28 A;  3AM9 A;  3TSJ A;  4IY2 A;  1FFU C;  4IY3 A;  5IIP A;  3TX1 A;  3B9J B;  1DII A;  3OCO A;  4DQW A;  3LQN A;  3BW7 A;  3PQB A;  2UUV A;  4PVH A;  3TSH A;  1W1S A;  1E8F A;  5I1V A;  3S1C A;  1MBT A;  3ORG A;  2QLV C;  4FXS A;  3KXR A;  4PZF A;  3PC3 A;  1Y5H A;  1YAV A;  4PVJ A;  3T4N C;  1W1Q A;  3LAE A;  2NYE A;  2WDW A;  3D2H A;  4BC9 A;  2OOY E;  3FW7 A;  4UD8 A;  3KH5 A;  2UV5 A;  3K2V A;  4PVK A;  4XLO A;  1W1K A;  1N62 C;  5G5G B;  3S1E A;  1ZXI C;  3NVV B;  1RM6 B;  1WYG A;  2OOX E;  4IY0 A;  1W1O A;  1VAO A;  4ML8 A;  2NYC A;  2GQU A;  2RIF A;  1F0X A;  2QH1 A;  2YVX A;  1E0Y A;  4GQV A;  1SB3 B;  1FO4 A;  2R2Z A;  3HSU A;  2JA3 A;  4P1O A;  2I0K A;  3HF7 A;  1JRP A;  2Q4W A;  3FNA A;  2QR1 E;  1N60 C;  3AN1 A;  3EUB 3;  3NS1 B;  5LXQ A;  3NVY B;  4BBY A;  1T3Q C;  5K22 B;  5ADZ A;  5K8E A;  2QRC E;  3D2D A;  3LFZ A;  4COO A;  2Y3R A;  5HQX A;  2OAI A;  3OCM A;  2O3G A;  3VTE A;  1I19 A;  5AE2 A;  5HHZ A;  1ZR6 A;  4JAY A;  5FXE A;  2OUX A;  3DDJ A;  2AXR A;  3LHH A;  2PLS A;  2YVS A;  3FW8 A;  2W3S A;  3NVZ B;  4ZOH B;  3K6E A;  3SR6 B;  5FXP A;  1WVE A;  1W1J A;  2QPM A;  1N5W C;  4NOC A;  1O50 A;  3FHM A;  1HSK A;  3S1D A;  3GBY A;  2R8D A;  4PVE A;  5K25 C;  2RIH A;  1FFV C;  3I99 A;  4MLA A;  5KS7 A;  3W8Z A;  5I1W A;  2UV6 A;  1PBJ A;  3AMZ A;  5L6F A;  1DZN A;  3TE5 C;  2MBR A;  2Y4G A;  2YZI A;  2ZY9 A;  2EXR A;  3NRZ B;  2W55 A;  4L27 A;  3NVW B;  3PM9 A;  2PFI A;  4IY4 A;  1AHU A;  1V97 A;  4JB1 A;  4O95 A;  2QKN A;  1AHV A;  5AE1 A;  5HMR A;  3LLB A;  3PC2 A;  1W1R A;  2P4P A;  4ESY A;  2VFT A;  2D4Z A;  3OI8 A;  5FXF A;  2VFV A;  2VFR A;  4HG0 A;  5K24 C;  1E8H A;  3DED A;  5K23 C;  4OAL A;  3RJ8 A;  2YZQ A;  4PYT A;  5AWV A;  2VAO A;  1XKF A;  1W1L A;  5G5H B;  1UXY A;  4L0D A;  3W8W A;  3ETR B;  4UUU A;  2UV4 A;  1N61 C;  4PWB A;  4EC3 A;  4PWC A;  3FWS A;  3KPB A;  1JRO A;  5D79 A;  3C0P A;  3KJM A;  2QRD E;  4GQW A;  3LV9 A;  2O16 A;  3KPC A;  2EF7 A; 
#chains in the Genus database with same CATH homology
 2E3T A;  4ESY B;  3L31 A;  2VFU A;  5MMZ A;  4PCU A;  1N63 C;  2P3H A;  3JS8 A;  2BVF A;  2NQW A;  4DNS A;  1QLT A;  2VFS A;  2RC3 A;  4BC7 A;  2P13 A;  3POP A;  4O9K A;  3FWR A;  1VDV A;  3HRD C;  2YVY A;  1QLU A;  3S1F A;  2Y3S A;  2BVH A;  2Y08 A;  1MBB A;  3FWA A;  2PLI A;  1FIQ B;  1E8G A;  1WVF A;  3PC4 A;  4IYS A;  1W1M A;  3RJA A;  3W8X A;  5L6G A;  3FW9 A;  2UV7 A;  5AE3 A;  3L2B A;  3KPD A;  2UUU A;  1AHZ A;  2P9M A;  4FRY A;  2IPI A;  2EMQ A;  1N5X A;  3TDH C;  3GSY A;  4L3V A;  2W3R A;  2YVZ A;  3FV6 A;  4BCA A;  2RK5 A;  2BVG A;  3SL7 A;  2W54 A;  3I8N A;  1DIQ A;  2J9L A;  4GQY A;  3D2J A;  3DQ0 A;  2QRE E;  5FXD A;  4P1G A;  2GQT A;  2Q85 A;  1PVM A;  4L28 A;  3AM9 A;  3TSJ A;  4IY2 A;  1FFU C;  4IY3 A;  5IIP A;  3TX1 A;  3B9J B;  1DII A;  3OCO A;  4DQW A;  3LQN A;  3BW7 A;  3PQB A;  2UUV A;  4PVH A;  3TSH A;  1W1S A;  1E8F A;  5I1V A;  3S1C A;  1MBT A;  3ORG A;  2QLV C;  4FXS A;  3KXR A;  4PZF A;  3PC3 A;  1Y5H A;  1YAV A;  4PVJ A;  3T4N C;  1W1Q A;  3LAE A;  2NYE A;  2WDW A;  3D2H A;  4BC9 A;  2OOY E;  3FW7 A;  4UD8 A;  3KH5 A;  2UV5 A;  3K2V A;  4PVK A;  4XLO A;  1W1K A;  1N62 C;  5G5G B;  3S1E A;  1ZXI C;  3NVV B;  1RM6 B;  1WYG A;  2OOX E;  4IY0 A;  1W1O A;  1VAO A;  4ML8 A;  2NYC A;  2GQU A;  2RIF A;  1F0X A;  2QH1 A;  2YVX A;  1E0Y A;  4GQV A;  1SB3 B;  1FO4 A;  2R2Z A;  3HSU A;  2JA3 A;  4P1O A;  2I0K A;  3HF7 A;  1JRP A;  2Q4W A;  3FNA A;  2QR1 E;  1N60 C;  3AN1 A;  3EUB 3;  3NS1 B;  5LXQ A;  3NVY B;  4BBY A;  1T3Q C;  5K22 B;  5ADZ A;  5K8E A;  2QRC E;  3D2D A;  3LFZ A;  4COO A;  2Y3R A;  5HQX A;  2OAI A;  3OCM A;  2O3G A;  3VTE A;  1I19 A;  5AE2 A;  5HHZ A;  1ZR6 A;  4JAY A;  5FXE A;  2OUX A;  3DDJ A;  2AXR A;  3LHH A;  2PLS A;  2YVS A;  3FW8 A;  2W3S A;  3NVZ B;  4ZOH B;  3K6E A;  3SR6 B;  5FXP A;  1WVE A;  1W1J A;  2QPM A;  1N5W C;  4NOC A;  1O50 A;  3FHM A;  1HSK A;  3S1D A;  3GBY A;  2R8D A;  4PVE A;  5K25 C;  2RIH A;  1FFV C;  3I99 A;  4MLA A;  5KS7 A;  3W8Z A;  5I1W A;  2UV6 A;  1PBJ A;  3AMZ A;  5L6F A;  1DZN A;  3TE5 C;  2MBR A;  2Y4G A;  2YZI A;  2ZY9 A;  2EXR A;  3NRZ B;  2W55 A;  4L27 A;  3NVW B;  3PM9 A;  2PFI A;  4IY4 A;  1AHU A;  1V97 A;  4JB1 A;  4O95 A;  2QKN A;  1AHV A;  5AE1 A;  5HMR A;  3LLB A;  3PC2 A;  1W1R A;  2P4P A;  4ESY A;  2VFT A;  2D4Z A;  3OI8 A;  5FXF A;  2VFV A;  2VFR A;  4HG0 A;  5K24 C;  1E8H A;  3DED A;  5K23 C;  4OAL A;  3RJ8 A;  2YZQ A;  4PYT A;  5AWV A;  2VAO A;  1XKF A;  1W1L A;  5G5H B;  1UXY A;  4L0D A;  3W8W A;  3ETR B;  4UUU A;  2UV4 A;  1N61 C;  4PWB A;  4EC3 A;  4PWC A;  3FWS A;  3KPB A;  1JRO A;  5D79 A;  3C0P A;  3KJM A;  2QRD E;  4GQW A;  3LV9 A;  2O16 A;  3KPC A;  2EF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...