4HG0A

Crystal structure of magnesium and cobalt efflux protein corc, northeast structural genomics consortium (nesg) target er40
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
232
structure length
232
Chain Sequence
DEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target ER40
rcsb
molecule tags Transport protein
molecule keywords Magnesium and cobalt efflux protein CorC
total genus 44
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4hg0A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4hg0A02
4O9KA 1W1RA 4ML8A 2PLIA 1T3QC 1MBTA 5AE2A 3NVWB 2OUXA 4L3VA 1N5XA 4P1OA 2P3HA 3AN1A 2VFRA 1WYGA 4BC7A 1DZNA 2BVGA 3S1DA 1PVMA 5K23C 3SR6B 2E3TA 2VFVA 2W3RA 2GQUA 1PBJA 1O50A 5G5HB 5K22B 3FWRA 1AHZA 5KS7A 3S1CA 3S1EA 3EUB3 2O16A 2YZIA 3K6EA 3ORGA 2NQWA 1W1LA 5FXEA 2P9MA 2QRCE 3S1FA 2I0KA 3B9JB 3PC2A 1N63C 5K25C 1E0YA 2YVZA 5AE1A 3HF7A 2QKNA 4L0DA 1SB3B 2Q4WA 2OOYE 2NYCA 3I8NA 1E8HA 1N5WC 2EXRA 3PC4A 3T4NC 1JROA 1VAOA 3AMZA 4O95A 4BCAA 3FNAA 4L28A 1UXYA 2RIHA 2W55A 3KPDA 2OOXE 5FXFA 3PM9A 3NVZB 3K2VA 2UV5A 4FXSA 1E8GA 4NOCA 2PFIA 4IY2A 2BVFA 3L2BA 2D4ZA 2VAOA 1W1OA 1N62C 1DIIA 4PCUA 1DIQA 1W1QA 3L31A 4HG0A 3OCOA 1MBBA 3C0PA 3KPCA 5K24C 1W1KA 1N61C 2VFSA 3SL7A 2EF7A 1W1JA 4IY4A 4IY0A 4GQVA 4OALA 5HMRA 3W8WA 2O3GA 1QLUA 3TX1A 2YVSA 5FXPA 1ZR6A 4IYSA 4L27A 2R8DA 3I99A 1Y5HA 1AHUA 4ZOHB 3LFZA 3ETRB 2YVXA 3BW7A 3NVVB 3TDHC 5IIPA 4IY3A 4UUUA 1YAVA 3LLBA 3NRZB 2VFTA 2QPMA 4XLOA 2W3SA 2YVYA 3TE5C 3OI8A 2UV4A 1HSKA 2PLSA 4ESYA 5LXQA 3KXRA 3GBYA 1FIQB 1WVFA 3LV9A 2UV7A 2P4PA 1N60C 3KJMA 5G5GB 3W8XA 2W54A 3LHHA 4GQYA 4GQWA 1I19A 3DEDA 2GQTA 2QLVC 2QREE 1V97A 1W1SA 5MMZA 4MLAA 3LQNA 1WVEA 5FXDA 1ZXIC 3OCMA 2RIFA 4COOA 2OAIA 3NS1B 2YZQA 2NYEA 5ADZA 2Q85A 2BVHA 4P1GA 5HQXA 2VFUA 4BC9A 5HHZA 4JB1A 1QLTA 2AXRA 3LAEA 3FHMA 1FFUC 1VDVA 2EMQA 3FWSA 4DQWA 2RK5A 4PYTA 2MBRA 5AE3A 3HRDC 1FO4A 4FRYA 2R2ZA 3FV6A 1W1MA 3AM9A 4BBYA 2RC3A 1AHVA 2P13A 4ESYB 1RM6B 1FFVC 4JAYA 2UV6A 3NVYB 3W8ZA 2ZY9A 2QH1A 2QRDE 1F0XA 3DQ0A 1XKFA 3DDJA 2QR1E 3KPBA 3KH5A 3PC3A 1E8FA 1JRPA 3JS8A
chains in the Genus database with same CATH superfamily
4O9KA 1W1RA 4ML8A 2PLIA 4EC3A 3GSYA 1T3QC 1MBTA 5AE2A 3NVWB 2OUXA 4L3VA 1N5XA 4P1OA 2P3HA 3AN1A 2VFRA 1WYGA 4BC7A 1DZNA 2BVGA 3S1DA 1PVMA 5K23C 3FW7A 2E3TA 2VFVA 3SR6B 2W3RA 2GQUA 1PBJA 1O50A 5G5HB 5K22B 3FWRA 1AHZA 5KS7A 5D79A 3S1CA 5AWVA 3S1EA 3EUB3 2O16A 2YZIA 3K6EA 3ORGA 2NQWA 1W1LA 5FXEA 2P9MA 2QRCE 3S1FA 2I0KA 3B9JB 3PC2A 1N63C 2JA3A 5K25C 1E0YA 3HSUA 2YVZA 5AE1A 3HF7A 2QKNA 4L0DA 1SB3B 2Q4WA 2OOYE 4PVHA 2NYCA 3I8NA 1E8HA 1N5WC 2EXRA 3PC4A 3T4NC 1JROA 1VAOA 3AMZA 4O95A 4BCAA 3FNAA 4L28A 1UXYA 2RIHA 2W55A 3KPDA 2OOXE 5FXFA 3PM9A 3NVZB 5K8EA 3K2VA 2UV5A 4FXSA 3POPA 1E8GA 4NOCA 2PFIA 4IY2A 2BVFA 3L2BA 2D4ZA 2VAOA 2UUVA 1W1OA 3RJAA 3VTEA 1N62C 1DIIA 4PCUA 1DIQA 3D2JA 1W1QA 3D2HA 3L31A 2Y08A 5I1WA 4HG0A 3OCOA 1MBBA 3C0PA 3KPCA 5K24C 1W1KA 3FW8A 1N61C 2VFSA 3SL7A 3FWAA 3RJ8A 2EF7A 1W1JA 4IY4A 4IY0A 4GQVA 3PQBA 4OALA 3W8WA 5HMRA 2IPIA 1QLUA 2O3GA 2Y3RA 2YVSA 3TX1A 1ZR6A 5FXPA 4IYSA 4L27A 2R8DA 3I99A 1Y5HA 1AHUA 3D2DA 4ZOHB 3LFZA 3ETRB 2YVXA 3BW7A 3NVVB 3TDHC 5IIPA 4PVJA 2UUUA 4IY3A 4UUUA 1YAVA 3LLBA 3NRZB 2VFTA 2QPMA 4XLOA 2W3SA 2YVYA 3TE5C 3OI8A 2UV4A 1HSKA 2PLSA 4ESYA 5LXQA 3KXRA 3GBYA 1FIQB 1WVFA 4PZFA 3LV9A 2UV7A 2P4PA 1N60C 3KJMA 5G5GB 3W8XA 2W54A 3LHHA 4GQYA 4GQWA 1I19A 3DEDA 2GQTA 4PWCA 5L6FA 2J9LA 4PVEA 2QLVC 2QREE 1V97A 1W1SA 5MMZA 4MLAA 4PWBA 3LQNA 3TSHA 5L6GA 1WVEA 2Y3SA 5FXDA 1ZXIC 3OCMA 2RIFA 4COOA 2OAIA 3NS1B 2YZQA 2NYEA 4DNSA 5ADZA 2Q85A 2BVHA 4P1GA 5HQXA 2VFUA 2Y4GA 4BC9A 5HHZA 4JB1A 1QLTA 2AXRA 3LAEA 3FHMA 1FFUC 1VDVA 2EMQA 3FWSA 4DQWA 2RK5A 4PYTA 2MBRA 5AE3A 3HRDC 1FO4A 4FRYA 2R2ZA 4UD8A 3FV6A 1W1MA 4PVKA 3AM9A 5I1VA 4BBYA 2WDWA 2RC3A 1AHVA 2P13A 4ESYB 1RM6B 1FFVC 4JAYA 2UV6A 3NVYB 3TSJA 3W8ZA 2ZY9A 2QH1A 2QRDE 1F0XA 3DQ0A 1XKFA 3DDJA 2QR1E 3KPBA 3KH5A 3PC3A 1E8FA 1JRPA 3JS8A 3FW9A
chains in the Genus database with same CATH topology
4O9KA 1W1RA 4ML8A 2PLIA 4EC3A 3GSYA 1T3QC 1MBTA 5AE2A 3NVWB 2OUXA 4L3VA 1N5XA 4P1OA 2P3HA 3AN1A 2VFRA 1WYGA 4BC7A 1DZNA 2BVGA 3S1DA 1PVMA 5K23C 3FW7A 2E3TA 2VFVA 3SR6B 2W3RA 2GQUA 1PBJA 1O50A 5G5HB 5K22B 3FWRA 1AHZA 5KS7A 5D79A 3S1CA 5AWVA 3S1EA 3EUB3 2O16A 2YZIA 3K6EA 3ORGA 2NQWA 1W1LA 5FXEA 2P9MA 2QRCE 3S1FA 2I0KA 3B9JB 3PC2A 1N63C 2JA3A 5K25C 1E0YA 3HSUA 2YVZA 5AE1A 3HF7A 2QKNA 4L0DA 1SB3B 2Q4WA 2OOYE 4PVHA 2NYCA 3I8NA 1E8HA 1N5WC 2EXRA 3PC4A 3T4NC 1JROA 1VAOA 3AMZA 4O95A 4BCAA 3FNAA 4L28A 1UXYA 2RIHA 2W55A 3KPDA 2OOXE 5FXFA 3PM9A 3NVZB 5K8EA 3K2VA 2UV5A 4FXSA 3POPA 1E8GA 4NOCA 2PFIA 4IY2A 2BVFA 3L2BA 2D4ZA 2VAOA 2UUVA 1W1OA 3RJAA 3VTEA 1N62C 1DIIA 4PCUA 1DIQA 3D2JA 1W1QA 3D2HA 3L31A 2Y08A 5I1WA 4HG0A 3OCOA 1MBBA 3C0PA 3KPCA 5K24C 1W1KA 3FW8A 1N61C 2VFSA 3SL7A 3FWAA 3RJ8A 2EF7A 1W1JA 4IY4A 4IY0A 4GQVA 3PQBA 4OALA 3W8WA 5HMRA 2IPIA 1QLUA 2O3GA 2Y3RA 2YVSA 3TX1A 1ZR6A 5FXPA 4IYSA 4L27A 2R8DA 3I99A 1Y5HA 1AHUA 3D2DA 4ZOHB 3LFZA 3ETRB 2YVXA 3BW7A 3NVVB 3TDHC 5IIPA 4PVJA 2UUUA 4IY3A 4UUUA 1YAVA 3LLBA 3NRZB 2VFTA 2QPMA 4XLOA 2W3SA 2YVYA 3TE5C 3OI8A 2UV4A 1HSKA 2PLSA 4ESYA 5LXQA 3KXRA 3GBYA 1FIQB 1WVFA 4PZFA 3LV9A 2UV7A 2P4PA 1N60C 3KJMA 5G5GB 3W8XA 2W54A 3LHHA 4GQYA 4GQWA 1I19A 3DEDA 2GQTA 4PWCA 5L6FA 2J9LA 4PVEA 2QLVC 2QREE 1V97A 1W1SA 5MMZA 4MLAA 4PWBA 3LQNA 3TSHA 5L6GA 1WVEA 2Y3SA 5FXDA 1ZXIC 3OCMA 2RIFA 4COOA 2OAIA 3NS1B 2YZQA 2NYEA 4DNSA 5ADZA 2Q85A 2BVHA 4P1GA 5HQXA 2VFUA 2Y4GA 4BC9A 5HHZA 4JB1A 1QLTA 2AXRA 3LAEA 3FHMA 1FFUC 1VDVA 2EMQA 3FWSA 4DQWA 2RK5A 4PYTA 2MBRA 5AE3A 3HRDC 1FO4A 4FRYA 2R2ZA 4UD8A 3FV6A 1W1MA 4PVKA 3AM9A 5I1VA 4BBYA 2WDWA 2RC3A 1AHVA 2P13A 4ESYB 1RM6B 1FFVC 4JAYA 2UV6A 3NVYB 3TSJA 3W8ZA 2ZY9A 2QH1A 2QRDE 1F0XA 3DQ0A 1XKFA 3DDJA 2QR1E 3KPBA 3KH5A 3PC3A 1E8FA 1JRPA 3JS8A 3FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O9K A;  1W1R A;  4ML8 A;  2PLI A;  1T3Q C;  1MBT A;  5AE2 A;  3NVW B;  2OUX A;  4L3V A;  1N5X A;  4P1O A;  2P3H A;  3AN1 A;  2VFR A;  1WYG A;  4BC7 A;  1DZN A;  2BVG A;  3S1D A;  1PVM A;  5K23 C;  3SR6 B;  2E3T A;  2VFV A;  2W3R A;  2GQU A;  1PBJ A;  1O50 A;  5G5H B;  5K22 B;  3FWR A;  1AHZ A;  5KS7 A;  3S1C A;  3S1E A;  3EUB 3;  2O16 A;  2YZI A;  3K6E A;  3ORG A;  2NQW A;  1W1L A;  5FXE A;  2P9M A;  2QRC E;  3S1F A;  2I0K A;  3B9J B;  3PC2 A;  1N63 C;  5K25 C;  1E0Y A;  2YVZ A;  5AE1 A;  3HF7 A;  2QKN A;  4L0D A;  1SB3 B;  2Q4W A;  2OOY E;  2NYC A;  3I8N A;  1E8H A;  1N5W C;  2EXR A;  3PC4 A;  3T4N C;  1JRO A;  1VAO A;  3AMZ A;  4O95 A;  4BCA A;  3FNA A;  4L28 A;  1UXY A;  2RIH A;  2W55 A;  3KPD A;  2OOX E;  5FXF A;  3PM9 A;  3NVZ B;  3K2V A;  2UV5 A;  4FXS A;  1E8G A;  4NOC A;  2PFI A;  4IY2 A;  2BVF A;  3L2B A;  2D4Z A;  2VAO A;  1W1O A;  1N62 C;  1DII A;  4PCU A;  1DIQ A;  1W1Q A;  3L31 A;  4HG0 A;  3OCO A;  1MBB A;  3C0P A;  3KPC A;  5K24 C;  1W1K A;  1N61 C;  2VFS A;  3SL7 A;  2EF7 A;  1W1J A;  4IY4 A;  4IY0 A;  4GQV A;  4OAL A;  5HMR A;  3W8W A;  2O3G A;  1QLU A;  3TX1 A;  2YVS A;  5FXP A;  1ZR6 A;  4IYS A;  4L27 A;  2R8D A;  3I99 A;  1Y5H A;  1AHU A;  4ZOH B;  3LFZ A;  3ETR B;  2YVX A;  3BW7 A;  3NVV B;  3TDH C;  5IIP A;  4IY3 A;  4UUU A;  1YAV A;  3LLB A;  3NRZ B;  2VFT A;  2QPM A;  4XLO A;  2W3S A;  2YVY A;  3TE5 C;  3OI8 A;  2UV4 A;  1HSK A;  2PLS A;  4ESY A;  5LXQ A;  3KXR A;  3GBY A;  1FIQ B;  1WVF A;  3LV9 A;  2UV7 A;  2P4P A;  1N60 C;  3KJM A;  5G5G B;  3W8X A;  2W54 A;  3LHH A;  4GQY A;  4GQW A;  1I19 A;  3DED A;  2GQT A;  2QLV C;  2QRE E;  1V97 A;  1W1S A;  5MMZ A;  4MLA A;  3LQN A;  1WVE A;  5FXD A;  1ZXI C;  3OCM A;  2RIF A;  4COO A;  2OAI A;  3NS1 B;  2YZQ A;  2NYE A;  5ADZ A;  2Q85 A;  2BVH A;  4P1G A;  5HQX A;  2VFU A;  4BC9 A;  5HHZ A;  4JB1 A;  1QLT A;  2AXR A;  3LAE A;  3FHM A;  1FFU C;  1VDV A;  2EMQ A;  3FWS A;  4DQW A;  2RK5 A;  4PYT A;  2MBR A;  5AE3 A;  3HRD C;  1FO4 A;  4FRY A;  2R2Z A;  3FV6 A;  1W1M A;  3AM9 A;  4BBY A;  2RC3 A;  1AHV A;  2P13 A;  4ESY B;  1RM6 B;  1FFV C;  4JAY A;  2UV6 A;  3NVY B;  3W8Z A;  2ZY9 A;  2QH1 A;  2QRD E;  1F0X A;  3DQ0 A;  1XKF A;  3DDJ A;  2QR1 E;  3KPB A;  3KH5 A;  3PC3 A;  1E8F A;  1JRP A;  3JS8 A; 
#chains in the Genus database with same CATH topology
 4O9K A;  1W1R A;  4ML8 A;  2PLI A;  4EC3 A;  3GSY A;  1T3Q C;  1MBT A;  5AE2 A;  3NVW B;  2OUX A;  4L3V A;  1N5X A;  4P1O A;  2P3H A;  3AN1 A;  2VFR A;  1WYG A;  4BC7 A;  1DZN A;  2BVG A;  3S1D A;  1PVM A;  5K23 C;  3FW7 A;  2E3T A;  2VFV A;  3SR6 B;  2W3R A;  2GQU A;  1PBJ A;  1O50 A;  5G5H B;  5K22 B;  3FWR A;  1AHZ A;  5KS7 A;  5D79 A;  3S1C A;  5AWV A;  3S1E A;  3EUB 3;  2O16 A;  2YZI A;  3K6E A;  3ORG A;  2NQW A;  1W1L A;  5FXE A;  2P9M A;  2QRC E;  3S1F A;  2I0K A;  3B9J B;  3PC2 A;  1N63 C;  2JA3 A;  5K25 C;  1E0Y A;  3HSU A;  2YVZ A;  5AE1 A;  3HF7 A;  2QKN A;  4L0D A;  1SB3 B;  2Q4W A;  2OOY E;  4PVH A;  2NYC A;  3I8N A;  1E8H A;  1N5W C;  2EXR A;  3PC4 A;  3T4N C;  1JRO A;  1VAO A;  3AMZ A;  4O95 A;  4BCA A;  3FNA A;  4L28 A;  1UXY A;  2RIH A;  2W55 A;  3KPD A;  2OOX E;  5FXF A;  3PM9 A;  3NVZ B;  5K8E A;  3K2V A;  2UV5 A;  4FXS A;  3POP A;  1E8G A;  4NOC A;  2PFI A;  4IY2 A;  2BVF A;  3L2B A;  2D4Z A;  2VAO A;  2UUV A;  1W1O A;  3RJA A;  3VTE A;  1N62 C;  1DII A;  4PCU A;  1DIQ A;  3D2J A;  1W1Q A;  3D2H A;  3L31 A;  2Y08 A;  5I1W A;  4HG0 A;  3OCO A;  1MBB A;  3C0P A;  3KPC A;  5K24 C;  1W1K A;  3FW8 A;  1N61 C;  2VFS A;  3SL7 A;  3FWA A;  3RJ8 A;  2EF7 A;  1W1J A;  4IY4 A;  4IY0 A;  4GQV A;  3PQB A;  4OAL A;  3W8W A;  5HMR A;  2IPI A;  1QLU A;  2O3G A;  2Y3R A;  2YVS A;  3TX1 A;  1ZR6 A;  5FXP A;  4IYS A;  4L27 A;  2R8D A;  3I99 A;  1Y5H A;  1AHU A;  3D2D A;  4ZOH B;  3LFZ A;  3ETR B;  2YVX A;  3BW7 A;  3NVV B;  3TDH C;  5IIP A;  4PVJ A;  2UUU A;  4IY3 A;  4UUU A;  1YAV A;  3LLB A;  3NRZ B;  2VFT A;  2QPM A;  4XLO A;  2W3S A;  2YVY A;  3TE5 C;  3OI8 A;  2UV4 A;  1HSK A;  2PLS A;  4ESY A;  5LXQ A;  3KXR A;  3GBY A;  1FIQ B;  1WVF A;  4PZF A;  3LV9 A;  2UV7 A;  2P4P A;  1N60 C;  3KJM A;  5G5G B;  3W8X A;  2W54 A;  3LHH A;  4GQY A;  4GQW A;  1I19 A;  3DED A;  2GQT A;  4PWC A;  5L6F A;  2J9L A;  4PVE A;  2QLV C;  2QRE E;  1V97 A;  1W1S A;  5MMZ A;  4MLA A;  4PWB A;  3LQN A;  3TSH A;  5L6G A;  1WVE A;  2Y3S A;  5FXD A;  1ZXI C;  3OCM A;  2RIF A;  4COO A;  2OAI A;  3NS1 B;  2YZQ A;  2NYE A;  4DNS A;  5ADZ A;  2Q85 A;  2BVH A;  4P1G A;  5HQX A;  2VFU A;  2Y4G A;  4BC9 A;  5HHZ A;  4JB1 A;  1QLT A;  2AXR A;  3LAE A;  3FHM A;  1FFU C;  1VDV A;  2EMQ A;  3FWS A;  4DQW A;  2RK5 A;  4PYT A;  2MBR A;  5AE3 A;  3HRD C;  1FO4 A;  4FRY A;  2R2Z A;  4UD8 A;  3FV6 A;  1W1M A;  4PVK A;  3AM9 A;  5I1V A;  4BBY A;  2WDW A;  2RC3 A;  1AHV A;  2P13 A;  4ESY B;  1RM6 B;  1FFV C;  4JAY A;  2UV6 A;  3NVY B;  3TSJ A;  3W8Z A;  2ZY9 A;  2QH1 A;  2QRD E;  1F0X A;  3DQ0 A;  1XKF A;  3DDJ A;  2QR1 E;  3KPB A;  3KH5 A;  3PC3 A;  1E8F A;  1JRP A;  3JS8 A;  3FW9 A; 
#chains in the Genus database with same CATH homology
 4O9K A;  1W1R A;  4ML8 A;  2PLI A;  4EC3 A;  3GSY A;  1T3Q C;  1MBT A;  5AE2 A;  3NVW B;  2OUX A;  4L3V A;  1N5X A;  4P1O A;  2P3H A;  3AN1 A;  2VFR A;  1WYG A;  4BC7 A;  1DZN A;  2BVG A;  3S1D A;  1PVM A;  5K23 C;  3FW7 A;  2E3T A;  2VFV A;  3SR6 B;  2W3R A;  2GQU A;  1PBJ A;  1O50 A;  5G5H B;  5K22 B;  3FWR A;  1AHZ A;  5KS7 A;  5D79 A;  3S1C A;  5AWV A;  3S1E A;  3EUB 3;  2O16 A;  2YZI A;  3K6E A;  3ORG A;  2NQW A;  1W1L A;  5FXE A;  2P9M A;  2QRC E;  3S1F A;  2I0K A;  3B9J B;  3PC2 A;  1N63 C;  2JA3 A;  5K25 C;  1E0Y A;  3HSU A;  2YVZ A;  5AE1 A;  3HF7 A;  2QKN A;  4L0D A;  1SB3 B;  2Q4W A;  2OOY E;  4PVH A;  2NYC A;  3I8N A;  1E8H A;  1N5W C;  2EXR A;  3PC4 A;  3T4N C;  1JRO A;  1VAO A;  3AMZ A;  4O95 A;  4BCA A;  3FNA A;  4L28 A;  1UXY A;  2RIH A;  2W55 A;  3KPD A;  2OOX E;  5FXF A;  3PM9 A;  3NVZ B;  5K8E A;  3K2V A;  2UV5 A;  4FXS A;  3POP A;  1E8G A;  4NOC A;  2PFI A;  4IY2 A;  2BVF A;  3L2B A;  2D4Z A;  2VAO A;  2UUV A;  1W1O A;  3RJA A;  3VTE A;  1N62 C;  1DII A;  4PCU A;  1DIQ A;  3D2J A;  1W1Q A;  3D2H A;  3L31 A;  2Y08 A;  5I1W A;  4HG0 A;  3OCO A;  1MBB A;  3C0P A;  3KPC A;  5K24 C;  1W1K A;  3FW8 A;  1N61 C;  2VFS A;  3SL7 A;  3FWA A;  3RJ8 A;  2EF7 A;  1W1J A;  4IY4 A;  4IY0 A;  4GQV A;  3PQB A;  4OAL A;  3W8W A;  5HMR A;  2IPI A;  1QLU A;  2O3G A;  2Y3R A;  2YVS A;  3TX1 A;  1ZR6 A;  5FXP A;  4IYS A;  4L27 A;  2R8D A;  3I99 A;  1Y5H A;  1AHU A;  3D2D A;  4ZOH B;  3LFZ A;  3ETR B;  2YVX A;  3BW7 A;  3NVV B;  3TDH C;  5IIP A;  4PVJ A;  2UUU A;  4IY3 A;  4UUU A;  1YAV A;  3LLB A;  3NRZ B;  2VFT A;  2QPM A;  4XLO A;  2W3S A;  2YVY A;  3TE5 C;  3OI8 A;  2UV4 A;  1HSK A;  2PLS A;  4ESY A;  5LXQ A;  3KXR A;  3GBY A;  1FIQ B;  1WVF A;  4PZF A;  3LV9 A;  2UV7 A;  2P4P A;  1N60 C;  3KJM A;  5G5G B;  3W8X A;  2W54 A;  3LHH A;  4GQY A;  4GQW A;  1I19 A;  3DED A;  2GQT A;  4PWC A;  5L6F A;  2J9L A;  4PVE A;  2QLV C;  2QRE E;  1V97 A;  1W1S A;  5MMZ A;  4MLA A;  4PWB A;  3LQN A;  3TSH A;  5L6G A;  1WVE A;  2Y3S A;  5FXD A;  1ZXI C;  3OCM A;  2RIF A;  4COO A;  2OAI A;  3NS1 B;  2YZQ A;  2NYE A;  4DNS A;  5ADZ A;  2Q85 A;  2BVH A;  4P1G A;  5HQX A;  2VFU A;  2Y4G A;  4BC9 A;  5HHZ A;  4JB1 A;  1QLT A;  2AXR A;  3LAE A;  3FHM A;  1FFU C;  1VDV A;  2EMQ A;  3FWS A;  4DQW A;  2RK5 A;  4PYT A;  2MBR A;  5AE3 A;  3HRD C;  1FO4 A;  4FRY A;  2R2Z A;  4UD8 A;  3FV6 A;  1W1M A;  4PVK A;  3AM9 A;  5I1V A;  4BBY A;  2WDW A;  2RC3 A;  1AHV A;  2P13 A;  4ESY B;  1RM6 B;  1FFV C;  4JAY A;  2UV6 A;  3NVY B;  3TSJ A;  3W8Z A;  2ZY9 A;  2QH1 A;  2QRD E;  1F0X A;  3DQ0 A;  1XKF A;  3DDJ A;  2QR1 E;  3KPB A;  3KH5 A;  3PC3 A;  1E8F A;  1JRP A;  3JS8 A;  3FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...