4HG0A

Crystal structure of magnesium and cobalt efflux protein corc, northeast structural genomics consortium (nesg) target er40
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
232
structure length
232
Chain Sequence
DEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target ER40
rcsb
molecule tags Transport protein
molecule keywords Magnesium and cobalt efflux protein CorC
total genus 44
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4hg0A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4hg0A02
3OCMA 4IYSA 3LAEA 3FWSA 2P9MA 3PC2A 1W1SA 3AM9A 3NVWB 1FO4A 4FRYA 2OAIA 2VFTA 4O95A 1PVMA 2PLSA 4P1OA 3DEDA 4BC9A 2Q4WA 3NVVB 1WVFA 2OUXA 1QLTA 3L2BA 5FXPA 1AHVA 1FFVC 3SR6B 1W1LA 4DQWA 3KJMA 2GQTA 3W8XA 2YZQA 3I99A 2VFRA 1E8GA 1W1JA 5FXFA 4L28A 5FXEA 3GBYA 1I19A 1DIQA 3S1EA 4IY3A 4PYTA 3BW7A 4OALA 3LV9A 3LFZA 1N61C 2NQWA 4UUUA 1E8FA 4L3VA 2W54A 1W1RA 2UV4A 1N62C 2P4PA 3FNAA 2EXRA 4XLOA 4NOCA 1ZXIC 3AMZA 4IY0A 1W1KA 3FWRA 5ADZA 3W8WA 3FV6A 4L0DA 1AHZA 1FIQB 2BVHA 2RC3A 1T3QC 2VFSA 3KPDA 2BVGA 3TX1A 3SL7A 4COOA 2R8DA 1PBJA 4PCUA 2YVXA 1DIIA 3TE5C 3C0PA 1HSKA 1E8HA 4ML8A 5HQXA 1QLUA 3HRDC 3S1FA 5K25C 3S1CA 1JRPA 1N63C 5G5GB 3NS1B 2QRCE 2RIHA 4IY2A 2PFIA 3PC4A 2QR1E 5AE3A 3ORGA 1FFUC 1SB3B 2EF7A 5K22B 2OOXE 3KXRA 2W55A 3PM9A 1N60C 2AXRA 2ZY9A 3DQ0A 4BCAA 3NRZB 4IY4A 5K24C 2YVZA 2RIFA 2QRDE 2MBRA 5HHZA 3JS8A 3HF7A 3L31A 4BBYA 1W1QA 1UXYA 3AN1A 1MBTA 2D4ZA 5KS7A 5FXDA 1YAVA 3K2VA 4GQWA 2GQUA 2QPMA 3EUB3 1W1MA 2I0KA 2YVYA 5AE1A 2P13A 4MLAA 4GQVA 2NYCA 3KPBA 4ZOHB 1W1OA 1O50A 4O9KA 2O16A 2R2ZA 4P1GA 1JROA 3S1DA 2YVSA 4ESYB 1MBBA 3NVZB 5G5HB 2BVFA 2O3GA 2QLVC 1E0YA 2P3HA 2PLIA 4L27A 3B9JB 2VFUA 2UV5A 3OCOA 2VFVA 3NVYB 5AE2A 3LHHA 5HMRA 3FHMA 3LLBA 4BC7A 1ZR6A 4ESYA 3KH5A 3ETRB 5LXQA 2UV7A 3KPCA 3OI8A 2OOYE 3DDJA 2VAOA 2Q85A 1N5WC 2W3RA 3PC3A 3LQNA 1V97A 2YZIA 1Y5HA 1AHUA 1VDVA 1WYGA 2QREE 5IIPA 4JB1A 4GQYA 5MMZA 2QKNA 2EMQA 2QH1A 5K23C 1WVEA 3I8NA 4HG0A 1N5XA 2W3SA 4JAYA 1XKFA 1VAOA 2E3TA 3W8ZA 3T4NC 3TDHC 1F0XA 2RK5A 3K6EA 1RM6B 2UV6A 2NYEA 4FXSA 1DZNA
chains in the Genus database with same CATH superfamily
3OCMA 4IYSA 3FWAA 3FWSA 2P9MA 3PC2A 1W1SA 2IPIA 3AM9A 3LAEA 3NVWB 3TSHA 1FO4A 4FRYA 2OAIA 2VFTA 4O95A 1PVMA 2PLSA 4P1OA 3DEDA 4BC9A 2Q4WA 3NVVB 3HSUA 1WVFA 2OUXA 2Y3RA 1QLTA 2WDWA 3PQBA 5K8EA 3L2BA 5FXPA 1AHVA 1FFVC 3SR6B 1W1LA 4DQWA 3KJMA 2GQTA 3W8XA 2YZQA 3I99A 2VFRA 1E8GA 1W1JA 2J9LA 5FXFA 4L28A 5FXEA 3GBYA 1I19A 1DIQA 2UUVA 3FW9A 3S1EA 4IY3A 4PYTA 3BW7A 4OALA 3LV9A 3LFZA 1N61C 2NQWA 4UUUA 1E8FA 4L3VA 2W54A 1W1RA 2UV4A 1N62C 2P4PA 3FNAA 2EXRA 4XLOA 4NOCA 1ZXIC 3AMZA 3POPA 4PVKA 4IY0A 1W1KA 3FW8A 3FWRA 5ADZA 3W8WA 3FV6A 4L0DA 1AHZA 5L6GA 1FIQB 2BVHA 2RC3A 1T3QC 2VFSA 3KPDA 2BVGA 3TX1A 3SL7A 4COOA 2R8DA 1PBJA 4PCUA 2YVXA 1DIIA 3TE5C 3C0PA 1HSKA 1E8HA 4ML8A 3VTEA 5HQXA 1QLUA 3HRDC 4DNSA 3S1FA 5K25C 3S1CA 1JRPA 1N63C 5G5GB 3NS1B 2QRCE 2RIHA 4IY2A 2PFIA 3PC4A 2QR1E 5AE3A 3TSJA 3ORGA 1FFUC 1SB3B 2EF7A 5K22B 4EC3A 2OOXE 3KXRA 2W55A 3PM9A 1N60C 2AXRA 2ZY9A 3DQ0A 4BCAA 3NRZB 5I1VA 4IY4A 5K24C 2YVZA 4PZFA 2RIFA 2QRDE 2MBRA 5HHZA 3JS8A 4PWCA 3HF7A 3L31A 4BBYA 1W1QA 1UXYA 2JA3A 3AN1A 2Y3SA 1MBTA 2D4ZA 5KS7A 5FXDA 1YAVA 3K2VA 4GQWA 2GQUA 2QPMA 2Y08A 3D2JA 3EUB3 5D79A 5AWVA 1W1MA 2I0KA 2YVYA 5AE1A 2P13A 3D2HA 4GQVA 2NYCA 3KPBA 3FW7A 4MLAA 4ZOHB 1W1OA 1O50A 4O9KA 2O16A 2R2ZA 2UUUA 4P1GA 1JROA 4UD8A 3S1DA 2YVSA 4ESYB 1MBBA 3NVZB 5G5HB 2BVFA 2Y4GA 4PVEA 2O3GA 2QLVC 1E0YA 2P3HA 2PLIA 4L27A 3B9JB 2VFUA 3RJAA 3RJ8A 2UV5A 3OCOA 5I1WA 2VFVA 3NVYB 5AE2A 3LHHA 5HMRA 3FHMA 3LLBA 4BC7A 1ZR6A 4ESYA 3KH5A 3ETRB 5LXQA 2UV7A 3KPCA 5L6FA 3D2DA 3OI8A 2OOYE 3DDJA 2VAOA 2Q85A 1N5WC 2W3RA 3PC3A 3LQNA 1V97A 3GSYA 2YZIA 1Y5HA 1AHUA 1VDVA 1WYGA 2QREE 5IIPA 4JB1A 4GQYA 5MMZA 2QKNA 2EMQA 2QH1A 5K23C 1WVEA 4PVJA 4PWBA 3I8NA 4HG0A 1N5XA 2W3SA 4PVHA 4JAYA 1XKFA 1VAOA 2E3TA 3W8ZA 3T4NC 3TDHC 1F0XA 2RK5A 3K6EA 1RM6B 2UV6A 2NYEA 4FXSA 1DZNA
chains in the Genus database with same CATH topology
3OCMA 4IYSA 3FWAA 3FWSA 2P9MA 3PC2A 1W1SA 2IPIA 3AM9A 3LAEA 3NVWB 3TSHA 1FO4A 4FRYA 2OAIA 2VFTA 4O95A 1PVMA 2PLSA 4P1OA 3DEDA 4BC9A 2Q4WA 3NVVB 3HSUA 1WVFA 2OUXA 2Y3RA 1QLTA 2WDWA 3PQBA 5K8EA 3L2BA 5FXPA 1AHVA 1FFVC 3SR6B 1W1LA 4DQWA 3KJMA 2GQTA 3W8XA 2YZQA 3I99A 2VFRA 1E8GA 1W1JA 2J9LA 5FXFA 4L28A 5FXEA 3GBYA 1I19A 1DIQA 2UUVA 3FW9A 3S1EA 4IY3A 4PYTA 3BW7A 4OALA 3LV9A 3LFZA 1N61C 2NQWA 4UUUA 1E8FA 4L3VA 2W54A 1W1RA 2UV4A 1N62C 2P4PA 3FNAA 2EXRA 4XLOA 4NOCA 1ZXIC 3AMZA 3POPA 4PVKA 4IY0A 1W1KA 3FW8A 3FWRA 5ADZA 3W8WA 3FV6A 4L0DA 1AHZA 5L6GA 1FIQB 2BVHA 2RC3A 1T3QC 2VFSA 3KPDA 2BVGA 3TX1A 3SL7A 4COOA 2R8DA 1PBJA 4PCUA 2YVXA 1DIIA 3TE5C 3C0PA 1HSKA 1E8HA 4ML8A 3VTEA 5HQXA 1QLUA 3HRDC 4DNSA 3S1FA 5K25C 3S1CA 1JRPA 1N63C 5G5GB 3NS1B 2QRCE 2RIHA 4IY2A 2PFIA 3PC4A 2QR1E 5AE3A 3TSJA 3ORGA 1FFUC 1SB3B 2EF7A 5K22B 4EC3A 2OOXE 3KXRA 2W55A 3PM9A 1N60C 2AXRA 2ZY9A 3DQ0A 4BCAA 3NRZB 5I1VA 4IY4A 5K24C 2YVZA 4PZFA 2RIFA 2QRDE 2MBRA 5HHZA 3JS8A 4PWCA 3HF7A 3L31A 4BBYA 1W1QA 1UXYA 2JA3A 3AN1A 2Y3SA 1MBTA 2D4ZA 5KS7A 5FXDA 1YAVA 3K2VA 4GQWA 2GQUA 2QPMA 2Y08A 3D2JA 3EUB3 5D79A 5AWVA 1W1MA 2I0KA 2YVYA 5AE1A 2P13A 3D2HA 4GQVA 2NYCA 3KPBA 3FW7A 4MLAA 4ZOHB 1W1OA 1O50A 4O9KA 2O16A 2R2ZA 2UUUA 4P1GA 1JROA 4UD8A 3S1DA 2YVSA 4ESYB 1MBBA 3NVZB 5G5HB 2BVFA 2Y4GA 4PVEA 2O3GA 2QLVC 1E0YA 2P3HA 2PLIA 4L27A 3B9JB 2VFUA 3RJAA 3RJ8A 2UV5A 3OCOA 5I1WA 2VFVA 3NVYB 5AE2A 3LHHA 5HMRA 3FHMA 3LLBA 4BC7A 1ZR6A 4ESYA 3KH5A 3ETRB 5LXQA 2UV7A 3KPCA 5L6FA 3D2DA 3OI8A 2OOYE 3DDJA 2VAOA 2Q85A 1N5WC 2W3RA 3PC3A 3LQNA 1V97A 3GSYA 2YZIA 1Y5HA 1AHUA 1VDVA 1WYGA 2QREE 5IIPA 4JB1A 4GQYA 5MMZA 2QKNA 2EMQA 2QH1A 5K23C 1WVEA 4PVJA 4PWBA 3I8NA 4HG0A 1N5XA 2W3SA 4PVHA 4JAYA 1XKFA 1VAOA 2E3TA 3W8ZA 3T4NC 3TDHC 1F0XA 2RK5A 3K6EA 1RM6B 2UV6A 2NYEA 4FXSA 1DZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OCM A;  4IYS A;  3LAE A;  3FWS A;  2P9M A;  3PC2 A;  1W1S A;  3AM9 A;  3NVW B;  1FO4 A;  4FRY A;  2OAI A;  2VFT A;  4O95 A;  1PVM A;  2PLS A;  4P1O A;  3DED A;  4BC9 A;  2Q4W A;  3NVV B;  1WVF A;  2OUX A;  1QLT A;  3L2B A;  5FXP A;  1AHV A;  1FFV C;  3SR6 B;  1W1L A;  4DQW A;  3KJM A;  2GQT A;  3W8X A;  2YZQ A;  3I99 A;  2VFR A;  1E8G A;  1W1J A;  5FXF A;  4L28 A;  5FXE A;  3GBY A;  1I19 A;  1DIQ A;  3S1E A;  4IY3 A;  4PYT A;  3BW7 A;  4OAL A;  3LV9 A;  3LFZ A;  1N61 C;  2NQW A;  4UUU A;  1E8F A;  4L3V A;  2W54 A;  1W1R A;  2UV4 A;  1N62 C;  2P4P A;  3FNA A;  2EXR A;  4XLO A;  4NOC A;  1ZXI C;  3AMZ A;  4IY0 A;  1W1K A;  3FWR A;  5ADZ A;  3W8W A;  3FV6 A;  4L0D A;  1AHZ A;  1FIQ B;  2BVH A;  2RC3 A;  1T3Q C;  2VFS A;  3KPD A;  2BVG A;  3TX1 A;  3SL7 A;  4COO A;  2R8D A;  1PBJ A;  4PCU A;  2YVX A;  1DII A;  3TE5 C;  3C0P A;  1HSK A;  1E8H A;  4ML8 A;  5HQX A;  1QLU A;  3HRD C;  3S1F A;  5K25 C;  3S1C A;  1JRP A;  1N63 C;  5G5G B;  3NS1 B;  2QRC E;  2RIH A;  4IY2 A;  2PFI A;  3PC4 A;  2QR1 E;  5AE3 A;  3ORG A;  1FFU C;  1SB3 B;  2EF7 A;  5K22 B;  2OOX E;  3KXR A;  2W55 A;  3PM9 A;  1N60 C;  2AXR A;  2ZY9 A;  3DQ0 A;  4BCA A;  3NRZ B;  4IY4 A;  5K24 C;  2YVZ A;  2RIF A;  2QRD E;  2MBR A;  5HHZ A;  3JS8 A;  3HF7 A;  3L31 A;  4BBY A;  1W1Q A;  1UXY A;  3AN1 A;  1MBT A;  2D4Z A;  5KS7 A;  5FXD A;  1YAV A;  3K2V A;  4GQW A;  2GQU A;  2QPM A;  3EUB 3;  1W1M A;  2I0K A;  2YVY A;  5AE1 A;  2P13 A;  4MLA A;  4GQV A;  2NYC A;  3KPB A;  4ZOH B;  1W1O A;  1O50 A;  4O9K A;  2O16 A;  2R2Z A;  4P1G A;  1JRO A;  3S1D A;  2YVS A;  4ESY B;  1MBB A;  3NVZ B;  5G5H B;  2BVF A;  2O3G A;  2QLV C;  1E0Y A;  2P3H A;  2PLI A;  4L27 A;  3B9J B;  2VFU A;  2UV5 A;  3OCO A;  2VFV A;  3NVY B;  5AE2 A;  3LHH A;  5HMR A;  3FHM A;  3LLB A;  4BC7 A;  1ZR6 A;  4ESY A;  3KH5 A;  3ETR B;  5LXQ A;  2UV7 A;  3KPC A;  3OI8 A;  2OOY E;  3DDJ A;  2VAO A;  2Q85 A;  1N5W C;  2W3R A;  3PC3 A;  3LQN A;  1V97 A;  2YZI A;  1Y5H A;  1AHU A;  1VDV A;  1WYG A;  2QRE E;  5IIP A;  4JB1 A;  4GQY A;  5MMZ A;  2QKN A;  2EMQ A;  2QH1 A;  5K23 C;  1WVE A;  3I8N A;  4HG0 A;  1N5X A;  2W3S A;  4JAY A;  1XKF A;  1VAO A;  2E3T A;  3W8Z A;  3T4N C;  3TDH C;  1F0X A;  2RK5 A;  3K6E A;  1RM6 B;  2UV6 A;  2NYE A;  4FXS A;  1DZN A; 
#chains in the Genus database with same CATH topology
 3OCM A;  4IYS A;  3FWA A;  3FWS A;  2P9M A;  3PC2 A;  1W1S A;  2IPI A;  3AM9 A;  3LAE A;  3NVW B;  3TSH A;  1FO4 A;  4FRY A;  2OAI A;  2VFT A;  4O95 A;  1PVM A;  2PLS A;  4P1O A;  3DED A;  4BC9 A;  2Q4W A;  3NVV B;  3HSU A;  1WVF A;  2OUX A;  2Y3R A;  1QLT A;  2WDW A;  3PQB A;  5K8E A;  3L2B A;  5FXP A;  1AHV A;  1FFV C;  3SR6 B;  1W1L A;  4DQW A;  3KJM A;  2GQT A;  3W8X A;  2YZQ A;  3I99 A;  2VFR A;  1E8G A;  1W1J A;  2J9L A;  5FXF A;  4L28 A;  5FXE A;  3GBY A;  1I19 A;  1DIQ A;  2UUV A;  3FW9 A;  3S1E A;  4IY3 A;  4PYT A;  3BW7 A;  4OAL A;  3LV9 A;  3LFZ A;  1N61 C;  2NQW A;  4UUU A;  1E8F A;  4L3V A;  2W54 A;  1W1R A;  2UV4 A;  1N62 C;  2P4P A;  3FNA A;  2EXR A;  4XLO A;  4NOC A;  1ZXI C;  3AMZ A;  3POP A;  4PVK A;  4IY0 A;  1W1K A;  3FW8 A;  3FWR A;  5ADZ A;  3W8W A;  3FV6 A;  4L0D A;  1AHZ A;  5L6G A;  1FIQ B;  2BVH A;  2RC3 A;  1T3Q C;  2VFS A;  3KPD A;  2BVG A;  3TX1 A;  3SL7 A;  4COO A;  2R8D A;  1PBJ A;  4PCU A;  2YVX A;  1DII A;  3TE5 C;  3C0P A;  1HSK A;  1E8H A;  4ML8 A;  3VTE A;  5HQX A;  1QLU A;  3HRD C;  4DNS A;  3S1F A;  5K25 C;  3S1C A;  1JRP A;  1N63 C;  5G5G B;  3NS1 B;  2QRC E;  2RIH A;  4IY2 A;  2PFI A;  3PC4 A;  2QR1 E;  5AE3 A;  3TSJ A;  3ORG A;  1FFU C;  1SB3 B;  2EF7 A;  5K22 B;  4EC3 A;  2OOX E;  3KXR A;  2W55 A;  3PM9 A;  1N60 C;  2AXR A;  2ZY9 A;  3DQ0 A;  4BCA A;  3NRZ B;  5I1V A;  4IY4 A;  5K24 C;  2YVZ A;  4PZF A;  2RIF A;  2QRD E;  2MBR A;  5HHZ A;  3JS8 A;  4PWC A;  3HF7 A;  3L31 A;  4BBY A;  1W1Q A;  1UXY A;  2JA3 A;  3AN1 A;  2Y3S A;  1MBT A;  2D4Z A;  5KS7 A;  5FXD A;  1YAV A;  3K2V A;  4GQW A;  2GQU A;  2QPM A;  2Y08 A;  3D2J A;  3EUB 3;  5D79 A;  5AWV A;  1W1M A;  2I0K A;  2YVY A;  5AE1 A;  2P13 A;  3D2H A;  4GQV A;  2NYC A;  3KPB A;  3FW7 A;  4MLA A;  4ZOH B;  1W1O A;  1O50 A;  4O9K A;  2O16 A;  2R2Z A;  2UUU A;  4P1G A;  1JRO A;  4UD8 A;  3S1D A;  2YVS A;  4ESY B;  1MBB A;  3NVZ B;  5G5H B;  2BVF A;  2Y4G A;  4PVE A;  2O3G A;  2QLV C;  1E0Y A;  2P3H A;  2PLI A;  4L27 A;  3B9J B;  2VFU A;  3RJA A;  3RJ8 A;  2UV5 A;  3OCO A;  5I1W A;  2VFV A;  3NVY B;  5AE2 A;  3LHH A;  5HMR A;  3FHM A;  3LLB A;  4BC7 A;  1ZR6 A;  4ESY A;  3KH5 A;  3ETR B;  5LXQ A;  2UV7 A;  3KPC A;  5L6F A;  3D2D A;  3OI8 A;  2OOY E;  3DDJ A;  2VAO A;  2Q85 A;  1N5W C;  2W3R A;  3PC3 A;  3LQN A;  1V97 A;  3GSY A;  2YZI A;  1Y5H A;  1AHU A;  1VDV A;  1WYG A;  2QRE E;  5IIP A;  4JB1 A;  4GQY A;  5MMZ A;  2QKN A;  2EMQ A;  2QH1 A;  5K23 C;  1WVE A;  4PVJ A;  4PWB A;  3I8N A;  4HG0 A;  1N5X A;  2W3S A;  4PVH A;  4JAY A;  1XKF A;  1VAO A;  2E3T A;  3W8Z A;  3T4N C;  3TDH C;  1F0X A;  2RK5 A;  3K6E A;  1RM6 B;  2UV6 A;  2NYE A;  4FXS A;  1DZN A; 
#chains in the Genus database with same CATH homology
 3OCM A;  4IYS A;  3FWA A;  3FWS A;  2P9M A;  3PC2 A;  1W1S A;  2IPI A;  3AM9 A;  3LAE A;  3NVW B;  3TSH A;  1FO4 A;  4FRY A;  2OAI A;  2VFT A;  4O95 A;  1PVM A;  2PLS A;  4P1O A;  3DED A;  4BC9 A;  2Q4W A;  3NVV B;  3HSU A;  1WVF A;  2OUX A;  2Y3R A;  1QLT A;  2WDW A;  3PQB A;  5K8E A;  3L2B A;  5FXP A;  1AHV A;  1FFV C;  3SR6 B;  1W1L A;  4DQW A;  3KJM A;  2GQT A;  3W8X A;  2YZQ A;  3I99 A;  2VFR A;  1E8G A;  1W1J A;  2J9L A;  5FXF A;  4L28 A;  5FXE A;  3GBY A;  1I19 A;  1DIQ A;  2UUV A;  3FW9 A;  3S1E A;  4IY3 A;  4PYT A;  3BW7 A;  4OAL A;  3LV9 A;  3LFZ A;  1N61 C;  2NQW A;  4UUU A;  1E8F A;  4L3V A;  2W54 A;  1W1R A;  2UV4 A;  1N62 C;  2P4P A;  3FNA A;  2EXR A;  4XLO A;  4NOC A;  1ZXI C;  3AMZ A;  3POP A;  4PVK A;  4IY0 A;  1W1K A;  3FW8 A;  3FWR A;  5ADZ A;  3W8W A;  3FV6 A;  4L0D A;  1AHZ A;  5L6G A;  1FIQ B;  2BVH A;  2RC3 A;  1T3Q C;  2VFS A;  3KPD A;  2BVG A;  3TX1 A;  3SL7 A;  4COO A;  2R8D A;  1PBJ A;  4PCU A;  2YVX A;  1DII A;  3TE5 C;  3C0P A;  1HSK A;  1E8H A;  4ML8 A;  3VTE A;  5HQX A;  1QLU A;  3HRD C;  4DNS A;  3S1F A;  5K25 C;  3S1C A;  1JRP A;  1N63 C;  5G5G B;  3NS1 B;  2QRC E;  2RIH A;  4IY2 A;  2PFI A;  3PC4 A;  2QR1 E;  5AE3 A;  3TSJ A;  3ORG A;  1FFU C;  1SB3 B;  2EF7 A;  5K22 B;  4EC3 A;  2OOX E;  3KXR A;  2W55 A;  3PM9 A;  1N60 C;  2AXR A;  2ZY9 A;  3DQ0 A;  4BCA A;  3NRZ B;  5I1V A;  4IY4 A;  5K24 C;  2YVZ A;  4PZF A;  2RIF A;  2QRD E;  2MBR A;  5HHZ A;  3JS8 A;  4PWC A;  3HF7 A;  3L31 A;  4BBY A;  1W1Q A;  1UXY A;  2JA3 A;  3AN1 A;  2Y3S A;  1MBT A;  2D4Z A;  5KS7 A;  5FXD A;  1YAV A;  3K2V A;  4GQW A;  2GQU A;  2QPM A;  2Y08 A;  3D2J A;  3EUB 3;  5D79 A;  5AWV A;  1W1M A;  2I0K A;  2YVY A;  5AE1 A;  2P13 A;  3D2H A;  4GQV A;  2NYC A;  3KPB A;  3FW7 A;  4MLA A;  4ZOH B;  1W1O A;  1O50 A;  4O9K A;  2O16 A;  2R2Z A;  2UUU A;  4P1G A;  1JRO A;  4UD8 A;  3S1D A;  2YVS A;  4ESY B;  1MBB A;  3NVZ B;  5G5H B;  2BVF A;  2Y4G A;  4PVE A;  2O3G A;  2QLV C;  1E0Y A;  2P3H A;  2PLI A;  4L27 A;  3B9J B;  2VFU A;  3RJA A;  3RJ8 A;  2UV5 A;  3OCO A;  5I1W A;  2VFV A;  3NVY B;  5AE2 A;  3LHH A;  5HMR A;  3FHM A;  3LLB A;  4BC7 A;  1ZR6 A;  4ESY A;  3KH5 A;  3ETR B;  5LXQ A;  2UV7 A;  3KPC A;  5L6F A;  3D2D A;  3OI8 A;  2OOY E;  3DDJ A;  2VAO A;  2Q85 A;  1N5W C;  2W3R A;  3PC3 A;  3LQN A;  1V97 A;  3GSY A;  2YZI A;  1Y5H A;  1AHU A;  1VDV A;  1WYG A;  2QRE E;  5IIP A;  4JB1 A;  4GQY A;  5MMZ A;  2QKN A;  2EMQ A;  2QH1 A;  5K23 C;  1WVE A;  4PVJ A;  4PWB A;  3I8N A;  4HG0 A;  1N5X A;  2W3S A;  4PVH A;  4JAY A;  1XKF A;  1VAO A;  2E3T A;  3W8Z A;  3T4N C;  3TDH C;  1F0X A;  2RK5 A;  3K6E A;  1RM6 B;  2UV6 A;  2NYE A;  4FXS A;  1DZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...