4HGPA

Crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from haemophilus influenzae in complex with transition state mimic
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
MQQKLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIKLFFLGKLEKETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACGTSFAVADAPIYVKNAVDHVLSTHGGKGAFREMSDMILQAQGKSSVFDTAQGFLKSVKSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
total genus 62
structure length 179
sequence length 179
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgpA00
1Z4IA 4KYTA 4BNDB 2HHLA 2FI1A 1T9ZA 1QYIA 2YJ5A 1O08A 5AKEA 3N1UA 3NRJA 5AKLA 2EATA 2C8LA 3BA6A 4HGQA 3L7YA 4FE3A 1CR6A 4NV0A 4BX3A 5AW0A 1IWOA 4AS3A 2FDRA 3L8FA 3CZ4A 3AR8A 4UATA 1Z4MA 1NNLA 3B9BA 5AI5A 4NWIA 4XOUA 5ALMA 2HF2A 2AMYA 3L1VA 5AK3A 3RF6A 1WPGA 3U7GA 2HCFA 1VJRA 5AKKA 4DW8A 1ZOLA 4XE5A 2GO7A 1EK2A 5AM0A 3OCWA 3R4CA 2BY4A 4Y2XA 2GHTA 2QLTA 4XPZA 3E81A 3ET5A 2G06A 5ALZA 2WF8A 3M9LA 4HGRA 4KNWA 5AKJA 1TJ5A 4YCNA 1TA0A 5FP0A 5AW6A 5A3RA 2G09A 2ZG6A 4BBJA 2YN4A 4EENA 1Z88A 4AS2A 2IOFK 2W11A 2ZOSA 3QUCA 5ALYA 5JJBA 4MWOA 4EX7A 3SHQA 5ALGA 1TE2A 3FPSA 4EELA 2I7DA 5AKXA 2GFHA 5AVYA 2B0CA 5ALQA 5AM5A 2OYCA 3FGOA 3DAOA 3ZX5A 3OCXA 2B8JA 2CN1A 3MPOA 4G63A 1YJ5A 2YMLA 1QQ6A 2HOQA 1K1EA 4BNDA 2AGVA 2G1AA 2B30A 2GHQA 4E88A 4HGOA 4DFDA 1L8OA 2R8XA 2GMWA 2AH5A 3A1EA 2P69A 4PNHA 3ZVNA 1AQ6A 3QYPA 1SU4A 3B9RA 3EWIA 4L6CA 4GXTA 5ALVA 5AW7A 3GYGA 3OPXA 3QX7A 3U19A 3W5CA 3L8EA 2HX1A 3K1ZA 1YS9A 4HGNA 2RB5A 4RESA 3QU9A 1X42A 1RC8A 5AICA 1U7OA 3SD7A 4C4SA 2HF7A 5AM3A 2P11A 3L8GA 3PGVA 4KNVA 3FVVA 5A3QA 2ZBGA 3PDWA 4CF5A 5AK5A 1L8LA 2R8ZA 4HGPA 5AW2A 1RPZA 5AIBA 2IA5A 3AR2A 1QH9A 1RMTA 1MH9A 3PCTA 4OCZA 3NANA 3QLEA 3U7FB 2ZBFA 2C9MA 1JUDA 1L6RA 1RKUA 4MUMA 1SWVA 2RARA 4Y2SA 1L7PA 1Z4QA 1RLMA 5AW3A 3ONNA 3WK8A 5IT0A 3WGUA 2FUEA 2CFRA 2HEGA 2OM6A 1Z5UA 5AVXA 2YJ4A 5AW9A 3F9RA 3WKCA 3KD3A 5AW1A 2W4MA 3OCUA 3WK7A 2YBDA 1Z4NA 1RLOA 2NYVA 5ALLA 3ZWDA 3B8EA 3UMBA 2JAOA 2Q5EA 4Y2YA 3WK6A 1Z4OA 5ALRA 3OTQA 1J97A 1U02A 3N28A 2OBBA 3R09A 3I6BA 2PQ0A 3N5KA 2OA0A 1QQ7A 4BEWA 2D2VA 3WKBA 4EX6A 5AKHA 1Z4JA 2NO4A 2RBKA 4BYGA 3NUQA 5A3SA 3QGMA 4F72A 4UMDA 4QJBA 3P96A 4I9GA 5AVVA 5IT4A 2RAVA 2C4NA 2WF9A 5T41A 4B6JA 1N9KA 4ZEVA 3AR3A 2I6XA 5AM1A 5IS2A 3QU4A 4ZEWA 4BX0A 2YMQA 1WVIA 5ALSA 1Z5GA 3FPBA 2G07A 5ALTA 3QUTA 5ALXA 3UM9A 1RLTA 4Y2TA 2CFSA 3NAMA 3U7EB 4DCCA 4NAVA 4HYTA 3L0CA 3QU7A 2WF6A 3ZW7A 3AR7A 5ALNA 4KX5A 3EPRA 5AI9A 3UMGA 2JAUA 3DV9A 1PW5A 4UMEA 2HDOA 5E0OA 3QU2A 1T5SA 4JDPA 5AKYA 4UU0A 5ALHA 3NALA 3MMZA 1ZRNA 5AVWA 5ALFA 4UASA 4UMFA 4L6AA 2ODAA 3J7TA 3N07A 2C88A 1U2TA 2B1RA 5AM4A 3HYCA 3OCZA 4KX3A 2ZBDA 3QU5A 3WK5A 3M1YA 4Y2VA 1TJ3A 3N8GA 1ZD3A 4YIHA 3L0BA 1T5TA 1ZRMA 2IYEA 3AR5A 4J2TA 3IRUA 1RKQA 2MSNA 4KN8A 4BEVA 3W5DA 1LVHA 4UARA 5AHXA 2R8YA 3OCYA 1LTQA 1U2SA 2JGAA 4DWOA 2WM8A 1RMQA 3A1DA 3ESQA 4UW9A 4NFLA 4OHFA 2EAUA 2W43A 2B82A 1TJ4A 1XPJA 1WZCA 2NO5A 3CNHA 5ALUA 2I34A 5ALKA 1RQNA 1YNSA 5AVQA 4AP9A 1ZS9A 2P27A 3UMCA 3OCVA 3AR4A 5ALDA 1L7OA 3KDPA 3SF0A 4IFTA 3FZQA 4Y2RA 3S6JA 2YJ3A 1XVIA 2QYHA 4I9FA 3W5BA 2X4DA 2CFTA 3L5KA 3NIWA 4YCMA 2FPWA 4RETA 3QXGA 1YDFA 2I55A 3PGLA 3D6JA 4H1WA 3ZX4A 3WKEA 2VKQA 4EZEA 4C4RA 3DDHA 2WFAA 3ESRA 3NASA 3WGVA 3QUBA 4UU1A 2I54A 3KC2A 5AIAA 1NF2A 1Z4KA 3VAYA 4G9BA 3AR6A 1ZJJA 3ET4A 3L8HA 4IG4A 3KZXA 2G08A 3L0YA 4YGYA 3U13A 3ED5A 4YIKA 3U7HB 3ZI4A 4L57A 5AW5A 4UM5A 5AKGA 3ZWKA 1F5SA 4OD0A 3AR9A 4C4TA 1RKVA 1ZD4A 3KBBA 1L7MA 3WKAA 2WF7A 3IJ5A 2BDEA 2IOFA 4UAVA 1Q91A 3I76A 2P9JA 5ALIA 2FPSA 1NRWA 1RDFA 1VFPA 4YCLA 5ALEA 4F71A 3EF0A 5ALPA 4FYPA 5AVSA 2FPXA 4BKMA 1J8DA 1YMQA 3I1YA 2WHEA 2JARA 2MU1A 5AVTA 1YV9A 1ZD5A 3EF1A 3FM9A 5ALJA 3TLMA 3KOOA 5AW8A 4NABA 3IB6A 3ZVLA 2HO4A 3MN1A 1L7NA 1CQZA 5AK6A 3QUQA 1O03A 1EK1A 1U7PA 2FEAA 4Y2JA 4CNQA 1FEZA 5AKZA 5ALOA 3ZTYA 2FPUA 3W5AA 1SWWA 2YMPA 4UM7A 2YJ6A 2PR7A 3E84A 2G0AA 3E58A 4HAIA 4UAUA 3SKYA 1Z4PX 5ALWA 2BDUA 2FPRA 3SLRA 1Y8AA 3U26A 1S2OA 2I33A 5AW4A 4O8CA 1Q92A 2R8EA 2FUCA 1Z4LA 3A1CA 5AESA 5AI6A 2PKEA 3WKDA 4Y2PA 1RQLA 2HI0A 5AK4A 1QQ5A 5AM2A 3SMVA 5AVUA 3MC1A 3WK4A 3HLTA 4CF3A 3RFUA 2EARA 1VJ5A 3DNPA 2Q4RA 4FFDA 3WK9A 3ZTWA 3QNMA 3R9KA 3ZVMA 5AI0A 1RRCA 4Y2UA 2YFYA 3L1UA 2WF5A 4UMVA 3A3YA 1KYTA 2HSZA 3SKXA 2O2XA 1S8OA 2O9JA 2G80A 2Q4TA 4ZEXA 5AVRA 3I28A 2JAWA 4Y3UA 1N8NA 2B8EA 4XQ0A 2AUTA 2YMMA 1XP5A 3BWVA 4GIBA 4YH1A 5AVZA 2DQSA 2B1QA 2ZXEA 1WR8A 4CF4A 2C8KA 2ZBEA 4JB3A 1RMYA 4J03A 1ZD2P 5AI4A 5AKIA 4OFZA 4CE6A 4Y2QA 3ZUPA 2IOHA 3ZU6A 4QQFA 5AI8A 3E8MA 4BX2A 4EEKA 2YY6A
chains in the Genus database with same CATH superfamily
1JFSA 2J5BA 3TUIC 4DC1A 2NZ8A 2GPYA 2WD7B 2C97A 3AOEA 3CPJB 4O4LB 4US1R 4DANA 2QQ0A 4KNYA 3VKFA 4ZAFA 1PL6A 1G55A 4I8IA 4X97A 2X41A 1RJ9A 1Z0SA 2QF7A 4LYYA 1L5SA 1P5RA 1K6EA 2BGJA 5IHPA 3HI4A 3WRYA 2VRNA 3LY7A 1XALA 2CWDA 2FEKA 4TTJA 1TB4A 2E0IA 1ABEA 3CZ4A 4JOBA 4LOAA 4G0NA 1YZKA 2FV8A 5C18A 2OSBA 2H07A 5TS2A 4D4HA 4JBIA 1GFZA 2E21A 4QO7A 3FCYA 1M2VB 3KV3O 1A5BB 2WDZA 4J9UE 4UZFA 2PWBA 3WADA 4CUZA 3IYLW 3ZWBA 2W42A 2XCLA 1JWLA 3C1OA 2BGMA 1GFWA 2ECOA 5TMEA 4EB8A 1JF8A 1JLLB 2CJPA 2PQMA 4NEQA 4OJNA 4LDRA 3K0FA 1OXKB 4QRHA 1DWQA 4XGRA 2X2FA 2GZDA 1E9DA 2A2ZA 3LGXA 5LP6A 1H3EA 3HEAA 2CKMA 3LQKA 1Y6JA 3HKDB 4ER0A 5JQWA 2P91A 4HFNA 4CQJA 4TKZA 1XQ9A 5AOCA 3PEEA 2PX0A 3E23A 2ORVA 5AOVA 1A8PA 2PVCA 1TMYA 4FS3A 3SZMA 3WGNA 2V6GA 3K6JA 1WSBA 2RHWA 3M70A 4U5QA 3KYDB 2NVUB 3SEZA 5C1DA 5F2NA 1ZW6A 1EA7A 2ZWIA 3B1XA 4XWGA 4MICA 3I64A 2FFQA 1VSUA 3FJ1A 4ZOBA 4C30A 1GG9A 3ZW9A 2IDKA 5F1YA 2WJ4A 3BFJA 2JATA 4BNFA 1ESMA 5KSZA 3U4QB 2WKQA 2VJAA 1GT6A 1VLZA 3URKA 3W3AH 3CRNA 3PHIA 1CUXA 3P2OA 3VSEA 3TZEA 2FMHA 4KRGA 4G63A 3HR7A 3QRWA 1CD5A 3ME5A 5ULLA 4FHZA 1KO4A 2Y0DA 1ML3A 3A6LA 4KSCA 3I9LA 3JQEA 4S05A 4L9SA 3BWXA 2E9SA 4TSRA 1P2SA 5TVKA 5KYXB 1X7ZB 5J1TB 2I91A 1P3DA 5CD1A 1KPGA 1VP3A 3H3JA 3TSZA 1PJ4A 1R4MA 1KFBB 1BHO1 4QGBA 3MB8A 2ZBPA 1DEKA 3RV4A 4L8VA 1EXVA 2W83A 1SG0A 1T1IA 3IV6A 1NFQA 4N7JA 2F67A 4X1YA 4A7PA 1NN1A 4X45A 3V8EA 1SU4A 4BQFA 4PWYA 5K0TA 4GXTA 5CCBA 2GBLC 3M3HA 2YXBA 4J7CA 4Z5XA 3M2TA 5EHNA 4YJKA 1ZJWA 1YS9A 3AHCA 2Y0PA 3JSXA 3MM4A 3AIOA 4RESA 3CVXA 2OG2A 1XSEA 2ZJ8A 3OA2A 4IX1A 3IQEA 2P9ZA 4FFWA 1RKBA 1G21B 3M81A 1ZI9A 2HA0A 3EQZA 3JQFC 1NOJA 2YYZA 3CKMA 3QMWA 3BSFA 5CB8A 1RVV1 1YSCA 2EJVA 3CE6A 4BAUA 4CMGA 1JFTA 2RHJA 5TIIA 1ULSA 5HUQA 3EN0A 3DYBA 2IEBA 3EFOA 3OOSA 1IOWA 1EFVB 3FYUB 3HCBA 4HNHA 4LUCA 4ZVNA 3TNYA 1RQPA 4ENWA 2IBTA 4BAGA 3VNUA 3AL3A 2JBWA 4FQ8A 5NLLA 2ZBFA 3AV3A 5A0FA 3O92A 2FMFA 3ZCXA 1IYZA 2J3EA 5DTMA 3DPSA 4BFTA 1SCKA 1VLQA 3Q3JB 4R5HA 3WLTA 5AMXA 1KDZA 1F2VA 1T3TA 5EIHA 3C7KA 3W4KA 5EMNA 4I4NA 5TF0A 4KIJA 4WKBA 4IYRA 1N2BA 1RXEA 1ONPA 1ZGAA 5B12A 5F7XA 3GH3A 2AI2A 3RWMB 2PK3A 3JQAA 3EIWA 3VISA 5AW1A 1PKXA 1E2JA 2HBQA 5ALLA 1N2OA 1U2DA 1QZTA 3FF4A 2N3ZA 3PC2A 2VDVE 4JJGA 1LZLA 4MTLA 4C22A 4Q4HB 4PSKA 3JAKA 4EKDA 3D8UA 4Y2YA 1LDMA 5EZYA 5K4HA 3UWMA 1HG1A 1EM6A 1OTXA 1W4ZA 4TX1A 4YCBA 2DHRA 5HDBB 2BTQB 4NRDA 2VXYA 1ADFA 2EOAA 2CK3A 2XB6A 5EQJB 3MWFA 1PBTA 2PMKA 5KNLA 2EKBA 3F7OA 2J3LA 5KYWA 1ZRSA 3G0IA 3A37A 3CCFA 4NEGA 3UCEA 1MA0A 1G41A 5DHPA 5E38A 1A8HA 4BEWA 1IHOA 2ZUWA 5B5SA 4PXSA 1W47A 2WTEA 4WOPA 1I0LA 2P0EA 4ID9A 1Y7IA 3FHTA 1SXGA 4IIDA 2XUOA 5L3QA 3NBQA 1BGXT 2HBYA 2VP6A 3B6IA 1YB4A 3EC7A 4LPKA 4C3OB 1Q15A 4L72A 3NPMA 3F98A 3HMQA 3G0GA 3TQCA 1HA3A 1YC2A 5BN5A 5LDHA 3I32A 5BRNA 4Y6SA 1KU6A 4DE5A 3JR7A 1GUZA 3LLVA 4DSAA 1WBDA 3AVYA 3NHLA 5B7QA 1M8PA 2OZVA 3REFA 2GCEA 4FU0A 4EQ6A 1LB1B 3ED1A 2WYOA 3V1YA 5K6AA 1EWTA 1YR9A 4MR8B 4DWJA 4Q6BA 4LTMA 1UBFA 4RD1A 5FQOA 4BO9A 1GO2A 3ZW8A 5T8KC 2VA9A 4G37A 3OZDA 4BJHB 1AV6A 3KQLA 1B00A 3PTAA 4QUAA 2G70A 1SVSA 3B82A 4MVJF 4DF3A 5IKEA 4TYPA 1W4CA 2V7QA 3ITEA 4D26A 5ALNA 4O2AA 5JMTA 1U0SY 4I8DA 5BXYA 3OQPA 4R8SA 5K51A 3RSSA 2EZ8A 5KNBD 2IYUA 3G5TA 3STHA 2XB8A 2W2QA 4PLCA 4BP8A 1QFYA 1U3CA 3OPYB 1XZIA 3IOBA 1RWMA 5JS8A 3FNBA 1GEEA 4HDNA 1RXVA 2I87A 3MMZA 3N87A 1JYSA 3SYMA 2WU0A 2P5UA 1YC5A 2IXTA 2R8OA 4B1FA 5TLSA 1B3BA 4KQXA 2O23A 1LEHA 1DIOB 1A77A 4OH7A 3TBKA 1SK9A 2R6JA 3WWEA 5LBIA 2J9FB 3UKDA 5JNTA 4F11A 1SQ6A 3I6IA 1J1UA 3PTZA 3TRIA 2P4QA 1QUEA 3EVNA 2ZB2A 3OAAA 4IMJB 2ZRFA 3V8NA 4CXMA 2VHCA 1FX1A 3GWZA 2ZBDA 1H2ZA 1DV1A 3NGMA 3OIGA 1MO5A 1AZTA 1IVYA 1P31A 3QW2A 3SJBA 2HRBA 4H3KB 1R0YA 3D6UA 1SGWA 1FUEA 1C3OB 4YP6A 3IMCA 4GZMA 5TVGA 3CUYA 4H08A 3Q4GA 4BJ5A 4ZJYA 1WW8A 3L1IA 1ZD3A 5DJ5A 1U0TA 2IPLA 3IE0A 3L0BA 1UL1X 4U7DA 1ZRHA 4JP3A 5ED4A 3QY0A 1UADA 2HIAA 2Q1WA 3OMWA 4FLEA 4IY1A 1F8YA 3K09A 2I80A 2PKYX 1LWNA 3WIDA 1KYWA 4ZVRA 1KK1A 4ABYA 1GZUA 2W00A 2WWHA 2O3QA 3A1DA 2ZAIA 4ZKEA 3DBRA 1GJRA 4DR4B 2IU0A 4WUVA 5FWXB 2WYUA 5ESXA 1JJBA 4EIWA 3DPIA 3IAUA 1TJ4A 3CKKA 1ZHOA 4I7EA 5IRCD 3D6AA 1G2OA 5H59A 4PZUA 4NZOA 3FWKA 2EC5A 2DH5A 3P5SA 1X1QA 4FDLA 3TLCA 2HV8A 5EJIA 3KWFA 4NDAA 4CHGA 1IHUA 5A4KA 4J16C 1CEYA 2YJNA 5FUYA 3K70B 5AVJA 1SC9A 4H3VA 5BWBA 5L8VA 1SB9A 3LF2A 1JFLA 4KXMA 3M5DA 4QC2A 2WAMA 4M8LA 4KAXA 4IEFB 3FUXA 3CH7A 3U9TA 4RKFA 2OO5A 1O95D 2I6GA 3E0XA 3VYTB 1A82A 1Z8FA 1NC3A 4DZZA 3C2QA 3HCCA 3H65A 3FE2A 3RRZA 4R6WA 3GEPA 3N6RA 3NDPA 1VKHA 5IC4A 2CEAA 3NTVA 3WL7A 1U80A 1V8ZA 2PL9A 2WNIA 1E7SA 4WKCA 4C4ZA 1ZBQA 5CIWA 5IASA 5KTKA 1FDTA 2L69A 2YUIA 4TSFD 4U9IS 3AXTA 3RIMA 4IOKA 2V6FA 4P4NA 4X8OA 1R12A 4HN2A 1NF2A 5AJHA 3RUAA 1E96A 1XAIA 5B6PA 4US2R 1E60A 4HWOA 3VU8A 2QRMA 2FJPA 2ZUVA 2PYDA 4U6SA 3SOZA 4I5FA 2KM1A 3L0YA 2OAEA 2JI6A 4IJKA 3GCXA 3H2JA 2FB9A 1RI4A 1I2CA 1SZCA 2O2ZA 4UFOA 1A69A 2GB4A 5BQ5A 3DDSA 4QUHA 3FLAA 3W8DA 3MSCA 1ZSVA 3UH0A 4B4DA 1KP3A 1OGJA 2NV6A 2XBUA 5BN4A 4FMDB 5KYGA 2GKSA 3O9VA 2AV6A 2QX9A 3L7AA 2XZDA 4JEMA 4LVCA 4MQLA 3ZCUA 3OQMA 1QE0A 3AC0A 3Q3EA 2SKDA 4IR7A 1FFXB 5JXIA 2AK3A 4TV8F 1NLFA 3HFRA 2Q3EA 2XMRA 3CRMA 3PF8A 4OXNA 4B2PA 2A6PA 2TRSB 1E1QA 4WASA 3LY9A 3SOPA 2HU8A 4MAFA 3RUEA 4F46A 4N0QA 4NZPA 3VH4A 3W04A 2Q3BA 4E08A 1CUYA 1C0IA 2ZJBA 1Y8CA 2YINC 4P08A 5KINB 2UXCB 4LIPD 4EGSA 1LBHA 3FI9A 3DO6A 4DBLC 2ZJFA 5B2EA 2GYVA 5JS1A 2ET6A 3P2YA 4JV5B 4PEVA 1PZFA 3ORSA 2ZVQX 2DETA 1O9HA 3DEFA 1MNQA 1EA5A 1WB9A 1W0JA 2VHEA 4HZGA 2H65A 4B76A 5JCOC 1SUAA 3MBIA 4K40A 3ZVLA 3UAZA 1IVNA 3VJKA 3K53A 2HU5A 3WRWA 4OI1A 3T94A 3PE4A 4ZT6A 1NRXA 4ENUA 5HZHA 3ROQA 1KEKA 4D74A 5FFNA 4ND2A 5K3SA 5TQJA 2VRCD 3KWLA 1UMKA 4UM9B 1H3NA 3O73A 4CKXA 2BLNA 1H8HD 1L8XA 1ZICA 2I9KA 1F6WA 1JHQA 3QE2A 4YUVA 4Q9KA 3PLNA 2BMJA 3N2ZB 4JI3B 3IQGX 4B34A 4DQLA 1MNAA 3HDYA 5HK9A 2DFTA 3H1EA 2IHYA 3SHVA 2HK8A 4CIWA 5DK4A 3AL2A 3QE4A 2YOFA 1E0DA 3DOCA 5GQSA 1UOPA 3IBFA 4POAA 1PWHA 5GMOA 3TM4A 4ACAA 4D57A 4TWIA 4E11A 4MP3A 4ML3A 1N3YA 1CUIA 2OPHA 1CXZA 2W6OA 1I9GA 1IZYA 1JHYA 4GNRA 1K7XB 3MUFA 5J9FA 4BVKA 2DYKA 4F4JA 2YFKA 3UBTA 2QSYA 4D8WA 2ZS7A 4GWKA 1K63A 2H06A 2P9BA 2WPDD 3AIIA 4MA5A 2FVXA 4BQPA 4DCTA 5LU8A 1SCUA 4CF3A 1IK6A 1AS2A 2PSJA 4JC4A 2C4HA 4N1AA 1KMMA 4QOFA 1MTOA 4YDRA 2WY2D 4DSNA 1ZL2A 4D98A 4LYGA 3CVWA 5K01A 3M6IA 1GXSB 3DOOA 4B5KA 5IT9A 2YWDA 1TAQA 2OZLA 3H9CA 4OHYA 3T9CA 1XXHB 2POCA 1RRCA 3JQQA 1KIMA 3L1UA 4RPIA 4JP1A 3RW9A 3ZY3A 2EJBA 4JC0A 3R7LA 1FJHA 2PUVA 5K0BA 3G9XA 1G5FA 5EXTA 2WV7A 3GA5A 4DWWA 4R16A 2EW8A 2ZTSA 3FTFA 3P71T 1UJNA 1U8CB 1WUHS 1X3LA 3EGDB 4J6FA 2OUIA 5EEGA 4UUPA 5J2TA 1KI4A 3ZGNA 2CT8A 1U99A 2J07A 1XEXB 1SVIA 5G1NA 5TPZD 3L1KA 4OAQA 4C2AA 1KBQA 1QHXA 1IIBA 4Q3KA 1COWD 4XEUA 4MRNA 1KVTA 2B2CA 3GIDA 4N40A 5KOHB 1HPLA 1XZMA 2OBFA 5LQDA 1K86A 4WFIA 4HT3B 4NONA 5DASA 2ORYA 4IJQA 3PD1A 1G8FA 3D0OA 3VAZA 4EJ0A 1A9XB 1FTQA 4A10A 2TS1A 4M0EA 3S0JA 4RDHA 3ZDCA 1IJKA 1T2EA 2Q4BA 5EINA 2HFKA 2RJOA 4M99A 3SVZA 4RMNA 1XBTA 2NTYC 2ZJ4A 2R6ZA 3A25A 4NDZA 2HRRA 4BVJA 1U90A 1E4EA 1W1UA 3KQKA 4DN6A 2CXUA 1R6TA 3JVIA 4L7QA 4CLRA 4K9OA 1RJWA 1ODSA 1O8CA 1T6NA 4RFLA 1FLDA 1KARA 1U8ZA 3LX8A 4E09A 2XYHA 3JQ9C 4O1HA 3NKFA 1USIA 1W8IA 3KT0A 3B85A 4JLNA 5A5EA 1ZD9A 2CJYA 2Q5FA 2ZIXB 2DZDA 2DPXA 2W8BB 2OXFA 3BA6A 3PUIA 4U7HA 3QVXA 1DEOA 5AHRA 2FW6A 1ZNWA 2RGDA 5DDIP 1ZQ1A 1KVUA 4D97A 1E98A 3LQ4A 1CE8B 2H1WA 3PX3A 1RZ3A 2P90A 1ZGBA 2DC1A 2VJMA 4N0PA 4PZ0A 3A6JA 4B7CA 2J45A 4Q1VA 2FVYA 4LMAA 4G1FA 2AMYA 2C5FA 2C7BA 4J3JA 4WPGA 4G5OA 3LT5A 2OK7A 2WKPA 4QUJA 4U4AA 3SC2A 5EPUA 3LZCA 3K8QA 4LISA 1TVEA 3ONFA 2C9CA 4FKMA 5TPZA 5ICMA 1RACA 3MUNA 1EI9A 2JLAA 1UAAA 4LFAB 3VXKA 2BCJQ 2HJHA 2PJZA 3B3QA 4AF7A 4P9NA 4AUEA 1X1EA 2QTNA 4QUIA 2LP4Y 3D6TB 4PQRA 5JLJA 2O1XA 3WYDA 421PA 3V33A 721PA 5I9IA 4OMCA 4O4LF 4RK0A 2CBGA 1TJ5A 3L41A 3EXHA 4IDQA 4XR9A 5KCZA 2NZYA 4LQLA 5F98A 5A0VA 2ONZA 2G09A 2R4QA 4ZO4A 2BM9A 1JIUA 2H1HA 1CVIA 3PZRA 1TGVA 3QKSB 5D3MA 5JFOA 3IODA 2PEYA 1WXEA 1DNPA 2ZYVX 4G1BA 4O3MA 2WJJA 1P1HA 3PICA 4MW6A 3STXA 2OOKA 4NNOA 1UOOA 2PRJA 4O4HA 2HIGA 1GKLA 2HJGA 2PGNA 1RP7A 5ALQA 3ZWQA 2ZUSA 3DAOA 2AJCA 4ZVSA 4CW7A 4II2A 2LKDA 1RI5A 3OZSA 3X1KA 1F48A 1N3LA 2VYCA 3BF7A 4JJAA 3L7LA 3NGXA 1Y33E 1RYDA 3BIOA 2YWXA 2IK8A 2Q5LA 3CLRC 3ZU5A 1KOLA 2O7SA 4ASUA 5KYYA 5JU6A 2JHGA 4E5MA 4LDJA 1T4DA 3FTNA 1F38A 1XE3A 2HK6A 3IJEB 4R9UC 3RC1A 2JA1A 1JNXX 1SKUA 1KQ3A 3NTXA 4Y9DA 4E88A 3RQIA 1EB8A 1MJGA 4J7AA 1EU1A 2C2ZA 2R8XA 2QYOA 2ZEJA 3CZ9A 3QE0A 4H7KA 4R2WA 4A0QA 4AQDA 3DEAA 1PU2A 2DLDA 3M4ZA 4KWCA 5IF3A 5THQA 4LI3X 5LYJB 3KR1A 1C0PA 1Y3IA 3RREA 4RCVA 2YWJA 3PIDA 1P2UA 3UGQA 2IYSA 4QYIB 1XZFA 4WMLA 1ECFA 2EHJA 2G36A 3GYGA 3ASYA 1HYQA 3H8SA 1UKAA 3HJRA 1AA9A 2OZKA 3OPXA 1DI0A 3R0VA 1O9BA 4K26A 1KJ8A 4DEYA 1XZEA 2WVHA 2BGKA 5FLXA 2DQKA 3TW8A 2DM6A 1T8RA 1S7GA 4XVQA 3VNAA 1SEPA 1ZVKA 3ROXA 4JL5A 1LA2A 4XSVA 4A27A 4F4DA 3MTJA 1AUXA 3HYTA 5AK5A 4YQFA 1RPZA 3SU8A 4ADSG 4DLZA 5HKKD 2IA5A 1FK8A 3ISVA 4I4IA 5LZ9A 1RMTA 4FXOA 2XT9A 3VO8A 2O7QA 3NHWA 2I3DA 3U2QA 1D1SA 4ZGGA 2NSLA 4CKWB 3G0HA 2JZNA 3X1ZA 1Y34E 2Q99A 4BMSA 3AVTA 1SBYA 4FZVA 5FHRA 3NP9A 4BNYA 4H3HB 1NFRA 5FBLB 1RKUA 1ISGA 3H2IA 4LZOA 1REQA 2XE8A 2WILA 3A26A 2GQ0A 2ODEA 2UUPA 5AR1A 3W7VA 1RLMA 2OY0A 4ZOLB 3BMNA 2VXBA 4AMBA 4MJ7A 1CIJA 2CFRA 5EWMB 3TPFA 2V58A 1NLYA 2DR3A 1AUQA 1Z5UA 3WLQA 4BNNA 1OAKA 1H93A 1NUTA 4OKNA 5DHQA 2ORED 3TK1A 1D2AA 2NYVA 1FDUA 3ZWDA 1LBTA 3ADCA 1E3SA 1EB9A 3ONVA 4LRUA 4P4SB 3BMQB 2IVZA 3VSCA 4MGIR 5T41A 4PSUA 4ER6A 3RHZA 3KK0A 3ICQB 3UYKA 2ZRKA 1DT3A 1GP2A 4Q1AA 3RS0A 2FZGA 3TAHA 5CXQA 2JHPA 1AGYA 2H31A 1E32A 2LDXA 3I92A 3GN2A 3U0VA 5LYYA 1CFJA 2HQSA 3ROTA 3G8DA 5E1OA 4LZAA 2NXCA 2ZI7A 3MTGA 3T9FA 4UCFA 2WHRA 4L07A 6REQA 1W48A 2YXEA 1ZK4A 4MS4A 1MENA 4NMWA 1XZHA 3QXCA 1ULZA 5B3JC 4CMIA 1DL5A 3VH2A 4LDZA 4Z49A 1ONNA 2OCBA 1OTYA 2WF9A 5DGXA 4ZEVA 4N7MA 3GEBA 1V25A 2ZLBA 2GSWA 5F9HA 2DFVA 3UK0A 5FBQB 1UMCB 1GFIA 2PL5A 2GCPA 2C9ZA 4F3RA 4V2UA 1CJSA 1ORHA 1OMOA 2J33A 3EIHA 1CKEA 2JLUA 5KDLA 4PIMA 3NHYA 4GPEA 1KMHA 1YZ3A 2DWQA 2XI4A 5L4LA 5LMUB 5KJCA 1NNEA 3UW3A 4Y2TA 4AVYA 1H1DA 3P2JA 3OZXA 2OAGA 3UV7A 2P9GA 2R6DA 2Y0CA 3ICVA 3WLNA 3A7DA 2ZYRA 3MK31 5E6SA 4LSWA 2A78A 3BB4A 3FYCA 3LUBA 1R9GA 2IYLD 4J1SA 1WVGA 2AG8A 3G3EA 3I9JA 1R10A 2CL7X 4CKCA 3KYCA 5ERGB 2Q1SA 3N2KA 5C46F 3UMGA 1AUVA 4GWGA 7MHTA 5CP8A 1ECBA 2ZIGA 4YTEA 1D4AA 2NUAA 2Z30A 2XZPA 3D6NB 4JLAA 5E0OA 4KZKA 3ANNA 3H42B 1MPXA 4G25A 5K0EA 1WRBA 1NG9A 2JHAA 3NALA 5C31A 1J2UA 3UT5B 1R0KA 2G72A 2PZFA 2G1UA 4RF5A 1RQGA 3IHKA 1IBKB 2B69A 2YN2A 4D8XA 1HE3A 1P19A 2HTEA 3GFQA 3RKRA 3NYQA 5DM70 2C03A 4CEIB 2AR0A 1KYVA 4Y67A 2YVKA 3FRHA 2P6OA 3R6TA 3ICOA 3BC1A 4QYMA 2C2OA 2J9ZB 4X3OA 3TDKA 1AA6A 1KS2A 1O8BA 3SEFA 4A8PA 2QT1A 4EB3A 1VCNA 4YP9A 2XVYA 4MP6A 1U3VA 1JTFA 2ZB7A 3V00A 4YI5A 4L08A 1T8TA 5KNDH 4OBEA 4DJDC 1B8VA 1BRTA 4E6EA 2BFPA 2EGHA 2JFUA 4B7ZA 3IRUA 3FWZA 5HEKA 3E15A 4I2NA 3JQ8B 4AZ0B 3U3JA 1E1LA 2JI8A 2VJMB 3I4LA 3G8AA 1UMBA 3K09C 2NZWA 2QMOA 4RQTA 1N9GB 4UXHA 1Q1ZA 2QTAA 1X15A 2WSBA 4U7JA 2NYAA 2VPXA 3QIAA 1IJFA 2J59A 2VI5A 3NBXX 4M0MA 4R5MA 1MGOA 4YAOA 2C7OA 1MOZA 1DC6A 2EAUA 1JE1A 4O59O 5DFAA 5CIYA 1QMPA 3OIUA 4GMFA 4U1RA 4NDNE 1KJIA 4MRPA 5H9VA 4BVBA 2WT9A 4DMUB 1TC2A 3GGPA 4J1TC 3RRFA 2Z5FA 5BXQC 1XCJA 4D4MA 1DAEA 1PSWA 3SLKA 1M1ZA 4RHXA 4UBLA 5FWAA 3W06A 3ZGLA 1I01A 4ZZIA 4LXTA 5AOAA 4J9VA 4KO1S 5H80A 1DQYA 3L9WA 3PFGA 3PPWA 3KLOA 1H0RA 2AR7A 1R8QA 1B0PA 2CY0A 3MNFA 3NO4A 3T5TA 2GUWA 1CK4A 3C14C 3M34A 4FE7A 2V6BA 4ZGBA 3Q8LA 1TI7A 4IUCS 3EZFA 3SX4A 3UWDA 2BUAA 4TMYA 1LPAB 2WJWA 16PKA 4XQGA 5E6RB 5SZIA 4F8YA 5JJIA 1KY3A 4Y9RA 2VKQA 3DQPA 4JUFA 3GT4A 3RSOA 5AT1A 3ESRA 3GR6A 1YJCA 1NF3A 4YJHB 4YAEA 3WGVA 1JAIA 3AF0A 1USUA 3QHAA 4IDAA 1QO7A 3ROZA 1YR1A 2VL7A 1M8GA 2EZTA 3AY0A 3HJHA 3EEYA 1ODJA 1ORIA 4L6IA 1P5ZB 2G4LA 4B48A 3IHWA 4G9BA 3WL6A 1R88A 3ET4A 5CM9C 1PIWA 3KHSA 4ZN6A 3BAZA 4Q16A 3AF1A 3V4FA 2PXAA 1COWA 4IUYA 4K5QA 1GADO 2IE8A 1XCOA 3KXDA 3GLGA 1XX6A 1V47A 1NJ8A 3V2GA 3AHHA 3CWQA 4AY3A 4FNOA 5AW5A 4OIMA 3V4ZA 3NJ8A 4RZIA 3ZS9A 2A84A 2PEZA 3E9YA 4Q02A 4X20A 1RKVA 2BBWA 1XXHE 1QKIA 3GD7A 2JFYA 3K2IA 4IJVA 3TRFA 3IMGA 5BPFA 2PDAA 3ZHXA 2CLCX 3KBBA 2CHVA 2ZQ5A 5MHTA 2WF7A 2GKOA 4QU0A 3E8SA 3LM8A 4JD5A 1GN8A 2A14A 2Y27A 3OH8A 5A4JA 2GJ8A 5JMOA 3WYAA 3D1VA 4WUTA 3PYXA 3U49A 1J0DA 1QMGA 3REOA 2M1ZA 5I7WA 4CEJB 4JHLA 1CUUA 1C30B 3AY3A 5ALPA 1NI3A 1KY2A 4FX2A 4CFYA 4CV3A 3T4UA 3GJYA 2RK3A 4LC9A 1D4OA 1E2IA 3PF9A 2WHEA 3Q3CA 3Q40A 4GC5A 2XAUA 2UVPB 4JLWA 5FWNA 3F8TA 1G59A 2GM4A 2Z4RA 3FOZA 2COUA 3MMPA 3JD3A 4J7XA 5C32A 1TMGE 5EP2A 3Q9NA 3U5ZB 1ES9A 3ANSA 4I3FA 5AW8A 4ARAA 1ZXXA 2WEKA 4EQ6B 1TVMA 1K4YA 5K8UA 2PLNA 4XTCS 1L0BA 2REXB 2SNIE 3HLYA 2JS7A 1PQYA 4NBKA 5A4AA 1HWYA 3IUPA 3FETA 1BX0A 4G85A 5JSYA 4CLDA 1NVUQ 2GZSA 3G1TA 1KSJA 3C8MA 1OFHA 1VJCA 2EFCB 4CNQA 4Q3EA 1FEZA 4Q9IA 1U1GA 3GBVA 1BD4A 3E3NA 3LFUA 3P0HA 3RTDA 2ZWAA 5JBIA 1R64A 1JEQA 1AKUA 1U7WA 2ZI5A 1XU9A 1V96A 3PV0A 4LWOA 3S1SA 3JYQA 1TW3A 2G0AA 2JA2A 4OB8A 4A82A 2PUEA 3TWOA 1SOUA 4LXUA 4KVFA 4RTQA 1XVLA 5B2FA 2MWMA 5JY6A 1R5OA 3PRJA 1JDNA 1WSDA 1ZN7A 2ZVPX 5ALWA 4FLFA 4AM8A 1SBIA 1UBLS 2B7LA 1GGKA 1K08A 4CM4B 4OYYA 5HX7A 3F73A 3T3OA 4IGAA 2XA1A 3UZUA 1EE2A 2PZ8A 2P2LA 1L1QA 1XVTA 2R96A 2XRYA 1TM5E 2ZULA 3DNMA 1CUZA 3O4IA 4M0LA 4MJLA 3ANLA 5UKDA 3TLBA 1C7IA 1QIHA 3DMGA 1FSGA 2B34A 3U3KA 4DSUA 4CTOA 1IOVA 4MYUA 4PLVA 2IUSA 3PVZA 4TWAA 4JIGA 3CNNA 3RDPA 1RWPA 2R1VA 4G5SA 3IV7A 4HZUA 4GHWA 3SEAA 2Z9DA 4NZZA 1WZIA 1UZLA 1ENZA 3PUYA 4IO0A 2VC2B 1XUOA 1UFQA 2I1LA 1VJ5A 4TRMA 2DMRA 4ZGWA 1U0HC 3GROA 5BW8A 5L4NA 1PT7A 3PPYA 3QVKA 1PEDA 3JX9A 5B3JA 4MUJA 2QM7A 2GETA 5IM4F 4CGZA 4HFRA 3SC3A 1GG2A 1G4HA 4TYQA 5K8LA 2PX8A 1VLMA 4LJKA 2HA5A 5F23A 4IXMA 4JI6B 1RYMA 3N2KB 2IPAB 3A3YA 5DK6A 3TBHA 1HL3A 3WTCA 3KLMX 2PGAA 1M7BA 1MCZA 1G63A 3R7BA 4LRYA 2EFYA 1SXJE 4YLGA 3KOMA 1OH6A 4YWHA 1KOJA 1VL5A 2F8LA 2HQOA 1XTRA 2XQJA 3ABOB 5FEMA 4NF2A 3U7RA 3B53X 2WTMA 3EC2A 3HJGA 3UJHA 1N8NA 3M9WA 3ONEA 3AP1A 4XQ0A 5DCUA 3LVBA 3FCUB 4BQQA 3W2TA 1UBEA 5CDYA 4FNAA 3ICWA 1F7UA 2A0UA 3DTVD 5DBOA 1JDPA 4GDFA 1E2NA 2D8AA 2IPXA 2R60A 4Z3DA 4PPFA 4CLHA 1CUEA 3GEDA 5JQGF 4M1ZA 1NMSA 3L4SO 4ZXFA 3TIVA 4PSVA 5I45A 4KIGA 4C87A 1ACJA 4N0MA 4E32A 4K3UA 2W2LD 4M7PA 5DBGA 3AKCA 4EYGA 3CN9A 2GRUA 3KB2A 3CSSA 3ZXSA 4F85A 1A1VA 2LCFA 4JH0A 2EIHA 4G81A 1HRKA 2DULA 5D6NA 1ADBA 4W1SA 3KPJA 4OGWA 2P8JA 4JFRA 2IVFA 3HCDA 1QH1B 4P3NA 1ZWKA 2QK4A 2XAAA 2XT0A 3AYZB 1FFWA 1O95A 5T4BA 3G49A 1VCMA 1KAOA 4IIJB 4I6EA 3N7UA 3GLHB 1TCVA 1VMIA 5BWOA 4MR7A 1EAMA 1WPQA 5EJ6A 2VYVA 4X61A 2VR1A 3P9CA 3PQ4A 4U00A 3CRQA 3MJEA 1WETA 1P81A 1ZD8A 5KYNA 4Q00A 2Y9PB 3L8FA 3NYIA 1P5HA 2RG7A 2B99A 4E5YA 5LKAA 2FSIA 3CRVA 4UBKA 3AVWA 2XXAB 1OI2A 4EKYA 3TRJA 4IIEA 5ALMA 2QLNA 2GN4A 2X19A 3IE2A 5FRDA 2ZI4A 2B2NA 2VSXA 1MJNA 1JZSA 1TMKA 2WP0A 1RE0A 1YQQA 2ZJ3A 4H59A 4PANA 4XSHA 3F1LA 3KEMA 1Z5WA 2X0NA 1ESCA 3GU3A 1IPEA 5L45A 2GO7A 4UTXA 2YWBA 2PQ2A 4WL0A 2IIVA 1PR9A 5KNDA 1DC3A 4NJMA 1R5JA 2P9CA 4KACA 5FTNA 1J5XA 3MJDA 4PHTA 6CHYA 5FPQA 4HGRA 4QPPA 4QUDA 3OOHA 1TUEA 4ZVQA 1GG8A 2MYUA 2XWQA 3LCVB 1HMYA 3KOYA 4IIFA 3JWGA 2GM5A 4CR7A 2XCQA 4ITUA 2H1IA 2JIZA 3VI3B 1MJGM 2HDWA 4B4UA 4EDHA 1XDZA 3K0FB 3OOWA 4WGFA 3H9GA 3GLSA 3NYWA 1NZFA 4QBKA 4UBNA 4B32A 4TTIA 4LQ4A 1YDGA 2XJ4A 5L3ZA 3T34A 1IUNA 2A1UB 1I0IA 2A5LA 2I7DA 3RD5A 3K73O 1BSVA 3OZGA 1U2GC 2OYCA 1JEQB 2H18A 3SJZA 5JH7B 5BUZA 3QELA 1QONA 2B8JA 2OGWA 2AFIB 2XW6A 2PV7A 3EXG2 1JDUA 2HH9A 2NQ8A 4M0UA 3B1KA 4Z9BA 1QK4A 1XHLA 1XCPA 2AXNA 2QVLA 4HGQA 1MIOB 3AUFA 4RGBA 1FFAA 3ENKA 1TM7E 1JTVA 4IMIB 5K3AA 4PCLA 1NJSA 5BW6B 3AVUA 3KE9A 2ZE5A 4MWDA 4GPIB 4XUGB 3VR5H 2G1AA 1H2RS 2GCIA 3GX1A 3PNSA 2YV3A 4HGOA 2R6GA 2X4IA 2XGMA 3E27A 3INRA 5H3LA 4IQGA 5DOVA 4WZBA 4LJRA 3ZG6A 2V98A 4KXUA 4D0SA 2EGUA 3ZDBA 4L51A 1UEIA 4V0OA 2XKKA 4JNCA 1L4FA 2IPNA 3CZRA 3QX7A 3S3TA 3AUXA 4Y0NA 2Q3LA 1UH5A 3G2JA 3V1LA 3TZLA 1F12A 2DFPA 1KEZA 2ZT8A 4B35A 4EPRA 5EKXA 5C1OA 4DQUA 1BKDR 1UJCA 3WYEA 1XXLA 4C4SA 3NWEA 4MB6A 1NQAO 3F71A 2RHMA 4RIHA 1T8PA 2F00A 3H5IA 3PDWA 5AUOB 2ZJ6A 1O94D 2QMUA 5JPDA 1G2IA 3GUVA 3OP4A 3OLVA 4JX9A 1P75A 4MQEA 4ZCMA 3C5CA 1JHPA 2JAHA 1UJBA 1A5ZA 4B43A 4DMCA 3CSUA 4LVUA 3UMRA 4YYZA 3Q12A 1Q0SA 4KAFA 1OH8A 5FBKA 4TTRA 5FBRB 5EJEA 4LHZA 1Q0HA 4ZRNA 5K4AA 5E7QA 2PX6A 4F97A 5BWMA 1JUDA 1MVLA 4G0ZA 3EWAA 5CTJA 2Y77A 1ZUNA 3H5TA 2WIGA 3EXHB 3IVXA 1V8DA 4UFNA 4X1KA 3WLFA 2P1ZA 2V3WA 5D00A 4J0EA 4BX8A 3NOOA 2VKTA 4FFBB 4RPJA 5A05A 4TL7A 5JG7A 4A15A 3F3SA 1LDBA 5EFZA 3CX6A 5AW9A 4KPFC 3WKCA 1QZUA 1FQWA 2E18A 2GR9A 5HE9A 4BNIA 1ND6A 3AM1A 2IS2A 1CDOA 2Q9UA 1X3SA 4QPZA 2AOWA 2XCOA 5IHXA 3SYRA 1QB7A 1ZH0A 3KSRA 2JH3A 1G9XA 1L7AA 1UPBA 3BXPA 4RJKA 3HO1A 1Y7PA 4IXNA 3OT1B 3I37X 1MORA 3QVJA 5JFGA 3D59A 2IDZA 3UO8B 1P29A 1V7CA 1P39A 4JOCA 2D1TA 1AT1A 5IAAA 3C5EA 3O83A 5I7SA 2UZ3A 2OC4A 1GITA 1LDNA 2VZ0A 2QP3A 3EGIA 4WTOA 4A2QA 3ANMA 1ULBA 2HRCA 5G3YA 1JFRA 2B1IA 2NU8A 2VTDA 2Y76A 3BH0A 3GK3A 4HVAA 3FAKA 5J59A 4M76B 5CCEA 2JIZD 3I6MA 2ZZKA 2GLTA 3BTOA 4IINA 2V8OA 3ELYA 1DQZA 3F6BX 1OH5A 2BMWA 1FP6A 3DOJA 3W6UA 2HK7A 1O0SA 5CB0A 1M1NA 1E1RA 3NM6B 4X71A 4UOZA 5FFMA 3G2IA 3IIIA 1AO0A 4DM3A 1QYWA 3Q98A 3ROPA 1YOVB 4BO7A 3HJTA 1Q2UA 3ISTA 4PZ9A 1WZEA 3BPSA 1THZA 3PI6A 1EIZA 2QP9X 4A8HA 4AF6A 1Z2AA 5ARBA 3RABA 4ND6A 4W6ZA 2V7TA 5BT9A 1G64A 2Q5IA 1GCUA 3SK0A 2O50A 2IYZA 1W1WA 3ICPA 2BEWA 4QREA 1L4NA 5I6DA 3OQ1A 1CUGA 3DZBA 1PVOA 2V55B 4K6MA 4QGHA 1BD3A 2FMIA 3F8SA 4ZI3A 2ZFUA 4W8OA 2DECA 3K9CA 3ZWCA 4NPHA 3KSBC 2ENWA 3FNGA 4B0PA 1T9GR 5EKSA 2GD0A 3WVNA 3TZCA 3BFXA 4XM1A 5KAMA 4E4TA 4B2LA 3RWOA 4E03A 1XOIA 3HDQA 4GUDA 4HVTA 2JIDA 2YZ7A 2LBPA 3BWMA 1O4VA 3BYZA 3WNZA 1C3EA 1BVHA 3Q5GA 1H1LA 5CXXA 5DI3B 1EDDA 4S24A 4UAGA 3E5NA 2C4MA 3RU9A 3BDIA 1GPNA 1WMEA 3D54D 2Q6VA 1PQWA 1UBHS 2W0MA 2XUIA 3ILVA 3KJXA 1XKLA 3M4XA 3DZJA 4NU6A 2KJQA 3TEMA 3WLRA 3ZXYA 1MF7A 3C4JA 1JR4A 1YCGA 2HIMA 3ZBUA 1XMQB 4WINA 2Z8YA 1NIPA 3PCRB 3A4IA 4YT8A 2XV1A 4P7JA 4UU0A 5AKYA 2NYUA 4PM4A 3IP3A 3CUUA 4UOQA 1ORRA 2UDPA 1YE5A 3GRUA 1REQB 4RLSA 3R6LA 2WA1A 4JL6A 4UBJA 2DPMA 1H4TA 1Q50A 3BXEA 5L3RA 3PLRA 5C34B 1WD7A 3QLVA 4GOOD 3S7ZA 3KTAB 1CY0A 2WSLA 1DLJA 3Q3IA 4KGZA 2C88A 3OEEA 1U2TA 5ER9A 4OY3A 4C6TA 1N2CB 1A9ZA 3SS8A 3HYCA 5DMXA 4DQXA 3PCXA 1SXJA 1Z82A 1HKHA 4URUR 3D7NA 4D41A 3H5WA 1D6MA 2PUDA 3FCOA 2VP0A 4MMZB 1DSSG 4BS9A 4BXOB 5CW2A 3THXA 3Q0IA 2C2YA 1NVDA 3JS5A 4E5PA 1ESZA 2VFAA 1YZHA 5CEJA 5ICCA 3NJRA 3M3PA 5EIBC 4LZNA 3WO0A 1VM6A 1RCTE 2E5WA 1T5TA 1GY8A 3PSAA 4KO8A 1KMHB 2ATEA 2JI9A 4P8RA 1J0CA 3CLSC 3H0CA 1H4QA 1QQBA 3IXMA 1HSOA 4JJ6A 2PBFA 3A3NA 2XUJA 5AD1A 3ESZA 3RTCA 1NAIA 2PYZA 2W5UA 4DXAA 1NY6A 2FQQA 4DLUA 3HDTA 4GW3A 4B8WA 1VP9A 4BCDA 3BB1A 3AONB 5CEFA 3IP7A 2V7GA 4NFLA 5H16A 1P72A 3CEPB 4ND4A 5CK4A 2C57A 3NIFB 3RIXA 1SOMA 2C5AA 3ZOZA 2NO5A 3KEFA 1I3CA 3KDAA 5KTRA 4YV1A 3FR8A 4HLDA 1BE1A 3BXXA 3WV5A 4E7PA 2I34A 2Q6IA 1ECPA 1QYXA 1XLWA 3WE7A 4OXRA 2OECA 3VR4D 4YRSA 3U44A 1NNUA 5G4KB 5IMBA 4EHJA 1U31A 5AVQA 1QH8B 3E2PA 1RJGA 1NWCA 3MAAC 2WMDA 1BMFD 3WGOA 3IXLA 2JG3A 4JXXA 4S2UA 4KGXA 3U4CA 1CJCA 3FNRA 4QEKA 4L8LA 3D1LA 2XGSA 3NV7A 5ARCA 1NLUA 4GVLA 3DKRA 5EE3A 4WLVA 2CFTA 3F74A 1S1CA 4G0WA 4MPDA 1VI6A 2CYCA 2GJ9A 3PITA 1Z6AA 3FFTA 4FI3F 4KKVA 1XEFA 1ISJA 2RFLA 4GQBA 1E1YA 4H1WA 3CZQA 1N0WA 4EVIA 1U7DA 4HBZA 1EZ1A 1X7WB 3CMMA 3UB4A 3PKZA 2B78A 3KAPA 4EMSA 5HM8A 5TT1A 1B2LA 4KOAA 4PE5B 4X63A 4A1OA 2VJYA 4B3FX 3QUBA 3IPLA 5I7OA 4P0PB 3N58A 1WHSA 3WB9A 1Z5NA 3OZFA 4BNXA 3DEJA 4F5ZA 4Q6WA 4CU2A 4CEHB 2Q50A 3W5JA 2CFCA 2ZSFA 5JZMA 3H5LA 4J1QA 5FJJA 1A4XA 1M6EX 1PT8A 4XIYA 4OHUA 4CQMA 1K8YB 1DBWA 1EFCA 1Q0RA 1WMDA 1UK8A 3WQRA 4NQRA 3R24A 1OZGA 3PFIA 2VJDA 1EHYA 2IHBA 3TNLA 2SECE 2WKRA 4HAYA 5KNBA 4M38A 2G25A 1DIBA 2V1UA 1T34A 2V6JA 2ID7A 1LV7A 1DAFA 1Y6RA 1NM5A 2Y71A 1U2RA 3LDGA 3LY8A 3GNSA 5AOBA 1P4SA 1ZJYA 1ZH8A 1X7DA 4KO4S 3O8DA 5EWLA 1Y98A 3GGCA 1XQVA 2O3TA 5B1YA 3NC1C 1U4OA 5A0TA 4CM9D 3IV9A 3KKMA 2O8VA 1SUWA 4BMXA 5KX5A 3KKKA 3HZRA 4K9KA 2PAAA 4LXYA 3AV0B 4URZR 2ZVJA 1TZCA 2PZKA 3ACCA 1LI5A 3JQDA 5ALEA 1TZ2A 3TQOA 1MP0A 3PQ2A 2R8RA 4G01B 4XFKA 3TCXB 3TNDA 3ZIUA 1O95C 2ANBA 4R8KA 2CLEB 1XJ0A 3I42A 4TLMB 2RI0A 5EZSA 4KDRA 4IJ6A 4KAJA 2DUMA 2I65A 1EM8B 3KX2A 2VJQA 3RNOA 5L51A 3UH1A 1UMBB 3QF7A 1P2GA 3PXUA 4UREA 2GHIA 1SQ0A 3WQHA 4HEJA 1ZSNA 4RSMA 1V4VA 1P0IA 5IFKA 1J09A 1YNOA 2ON6A 3MN1A 4WBNB 4BU0A 3UATA 2BJHA 2H2WA 1NP6A 4M1MA 1W2WB 3RG2A 4BVFA 2GF9A 5AK6A 2Z6UA 2G63A 3QHPA 2RHBA 1HLPA 3C8ZA 4YP5A 4UNNA 1UCFA 4AUKA 4Z0HO 4JI4B 4TT8A 1JHUA 1F17A 4KBYA 1JDVA 2AJBA 1DQNA 1SWWA 4LYJA 4LYAA 3STWA 3GJ5A 3E84A 3U39A 3EQ9A 2WU3A 1JPVA 4OA5A 3UUGA 1AXGA 1QGUA 2P1DA 3HTXA 3SKYA 3O31A 4QZVA 3F3MA 5B7PA 2FPRA 3WYGA 2E7ZA 3TLZA 4B3MB 2QVYX 1U3DA 3H3XA 3V8VA 1T9AA 1KFJB 4DV0B 3DBOB 3F7NA 1Q74A 2YHIA 1RP1A 4GDMA 4ZOCA 5DHSA 3T7KA 2HV9A 4BMPB 1OZHA 1GA1A 2GNOA 2HQRA 3EGCA 4ZVMA 5CFNA 2GESA 1QJ4A 5EWJB 4EG7A 5AESA 1BHSA 1W0KA 1GQQA 4IXWA 1YUBA 1A4UA 3G5LA 3GJ7A 3PIRA 5EY5B 1OXUA 5EGSA 3BGIA 4F92B 1QQ5A 1K7FB 5A1TA 3EFEA 4ZQFA 4PGHA 1XK7A 3IDSA 4IHJB 5E6RA 3UJAA 1U8XX 1UWVA 2D1YA 4PU0A 3VTZA 1BN6A 3I3SR 4O63O 1LSSA 2OM2A 3WK9A 3AF4A 3HB4X 4DIFA 5JIBA 5K8VA 3PXBA 1CX9B 3ZDZB 1L5ZA 3WZ2A 3HDJA 1A4RA 3DTNA 4MINA 5HZKA 3U3ZA 1DDIA 5CMLA 1PR2A 1LBIA 2I5PO 2NPIA 5CYFA 2QBYB 1EBFA 1YJXA 3LCMA 3I8XA 1G7SA 3L43A 4M22A 4DDVA 2REOA 1T3GA 5G1PA 4N6GA 1ONSA 621PA 1JQEA 1KJZA 3EGVA 3DEIA 4OJTA 3DE2X 4MQFB 3MEQA 4PG5A 4JX8A 2D5BA 1XLUA 5HJEA 2RK6A 2VTEA 3BZBA 3O2SB 3ZCQA 3CBGA 4CU5A 1JHRA 4FMCB 3UJNA 4PC6A 3IVCA 3FBTA 2FF5A 2OK8A 4ZCRA 3H9EO 2E1PA 3CFYA 4QG7A 3RSCA 1PJLA 1Z8NA 2Q7DA 4EG3A 2VBFA 2XZLA 2BHSA 4FN4A 1VXOA 1VE3A 1ANKA 4GPAA 4HQ0A 1YBVA 2QIPA 3AEUA 2J67A 4CF4A 2ZBEA 2OVFA 1OXBB 3H4MA 3FSRA 5BNTA 4S1OA 2OV8A 1ZGJA 4J0JA 3BRSA 4LJYA 1OU0A 3K5WA 4AJOA 1N34B 3R9XA 2O6LA 4ZAXA 4IQ4A 5FKJA 4TQAA 3BHIA 4K6GA 4OQMA 4YRQA 1ZR2A 1XZJA 3K9QO 4WK2B 3UOGA 4OATA 4RNCA 3NT4A 2PUGA 3A3PA 2J0UA 5BVHA 4FB4A 1P5FA 1E5TA 1X7ZA 4NX2A 3DB1A 4HNUA 1B93A 1J00A 2SKEA 2ZR7A 1KI9A 3Q3GE 1OX6A 4IZ6A 4EKEA 1DX9A 3MGGA 1NBME 3VZSA 3S70A 4YRAA 4RSHA 4BNUA 4NENA 1A7UA 1BKSB 4IZOA 4FE3A 3N8NA 1FDIA 4FILA 3MA0A 4X1IA 4CI9A 5JYBA 5CDUA 2AKYA 1SUEA 1YIAA 3QKRB 5JEEA 3V4SA 5CFPA 4C89A 5JI3E 5K0GA 3S7TA 2HY7A 3CA8A 1M1YA 2BISA 3EEBA 4QPDA 4J8PA 3ZDAA 1GYPA 3GLQA 1P3Y1 1EEHA 1PD1A 3L1VA 3RVJA 3UMSA 4BKRA 3LHIA 2ZJ2A 3ST7A 1VBNA 1XRLA 4XM2A 1QP0A 1E6WA 4F3TA 3WL8A 4DW8A 2FRXA 2HA6A 1J5EB 2H5LA 2ATVA 4JVNA 1EG7A 3AM5A 1CJMA 1KA9H 3H6GA 4XUEA 3ZHRA 1XT6A 1GIAA 3T1VA 1H8HA 1BGVA 3BJZA 1Q7CA 1TUGA 3F2IA 3WBJA 4DCOA 3RIEA 4F4CA 5CXUA 1YHNA 5I9LA 3MGBA 3TSWA 4PTLA 2O57A 1KPHA 1GSOA 1SIOA 2YWGA 3OQBA 4QUBA 3ICCA 4IDHA 2BMFA 1PJTA 4GR4A 2V5UA 1NVWQ 4N3GA 4TS4A 3SF8A 3UMFA 4JU9A 2CD9A 3K0AA 4FMBB 3GGDA 2H3EA 4PBRA 2V3CC 2IXAA 3T3DA 2B1GA 4HDSA 2PKCA 2VSOA 2IYTA 3L4BC 5PGMA 3UMVA 4G09A 5HJ7A 4X65B 3JD2A 1C3JA 5FB3A 1H2AS 5FNVA 2JLXA 1K5HA 5IAGA 3W34A 2A0YA 5AKXA 3OHSX 1J99A 2HMTA 3UGJA 2YS7A 1CP2A 3IDAA 4XJVA 3DXXA 4M53A 4C08A 4DKJA 4QEDA 3DC2A 3QPAA 2BKUA 1C3VA 4QT0A 2QUIA 4F56A 5J4LA 4M1YA 1UT8A 3GFTA 1EFHA 2FW9A 3GVXA 1PR0A 3VMFA 4N82A 3CRZA 4XJXA 1DKLA 2QZ9A 3D7MA 4GF5A 2C2WA 4KPGA 1NY5A 5B6IA 4RKQA 5KYYB 4UAJA 3TB4A 3TLXA 4G4GA 4PQGA 4B4WA 3VGPA 2AH5A 1OFTA 4JBNA 4PZPA 4F7DA 1B6RA 1T3LA 4C04A 4FB5A 4LS3A 2ZXFA 3LYLA 3STYA 4ACBA 2IUUA 4TN1A 4LG1A 1NOKA 3K8ZA 3P0IA 5HJ2A 5ADUS 3IE1A 3TLAA 3VC2A 1FLVA 3GUZA 4AG3A 3PR3A 1NBEA 4PCUA 2Q7XA 4U39A 3RLIA 5A03A 1QH8A 4NU5A 2KQUA 3FLBA 2VJNA 2ACKA 2Z1MA 2WTNA 5A3QA 3GDFA 3FNHA 4A8JC 1CCWA 4CF5A 4YXWA 4TTAA 3UYLA 3G8BA 1YJ8A 1JHDA 1YZTA 1TCCA 3AR2A 4E51A 3CPEA 3N0RA 2BM1A 1TM3E 3TQFA 3WWYA 1V71A 2KBFA 2VSFA 2I3ZA 2P3LA 3H8WA 5ENVA 1E2BA 4LYFA 2FUG1 4D9MA 1GZ7A 2I2BA 5B37A 4KYUA 2ZUTA 4XD7D 3R74A 4OQLA 4V3CA 2O3SA 3U7FB 2CHFA 1MV8A 1X87A 5IDYA 3KD2A 2H4HA 3EZGA 4G8CA 1O6FA 1HM5A 4LCJA 2D2EA 2A5DA 2R62A 1VG1A 1SC1A 2WTBA 1CRWG 1MAAA 3LUJA 5GJCA 4EHBA 4NCNA 3TX6A 2PXHA 4CUJA 1WOYA 3PA6A 3DDZX 5C53B 4EY6A 3UXHA 4MMYB 1RQXA 3C6BA 1YS6A 1JIXA 4OLBA 5JBNA 3T99A 1MQAA 5HVNA 1IFXA 1RRPA 5GPBA 2YJ4A 3U80A 3E03A 3T7IA 10MHA 3KD3A 2MOKA 3KQMA 3T3HA 5ITZB 4DOMA 4L2IB 2Z98A 4WESB 5EKTA 1IIRA 1D7AA 1R1DA 1X1AA 1A9OA 3E5RA 4N5HX 4QD3A 4NPCA 4Q7KA 5LZ5A 3TXYA 3I2YX 5YASA 4ZVTA 4QAQA 3ROFA 1ZM7A 5WRFA 2Q1UA 5FEUA 2GN9A 1N1MA 2I7VA 4RIIA 1OLSB 2Y67A 5AHKA 4P7KA 1JEYB 1Z38A 4OJKA 2CLFB 2ONJA 4CL3A 3GJSA 4YAFA 2X23A 1Z7WA 3EMVA 4C29A 1YIDA 5AUQA 1IHDA 2Q45A 5JZSA 5ALRA 5LWQA 5KJEA 1F2TB 3QKWA 1XLTC 3G2PA 1H8ED 3VO9A 1QQTA 2H2HA 1GGNA 5DEIA 2FEMA 3N9IA 1YR3A 2NTJA 3JD1A 1EFTA 3NEYA 4HFJA 1P45A 2WLSA 3S2GA 1NLMA 2C84A 1N6NA 2RIRA 3AJAA 1E6KA 2LTAA 3Q9LA 4WK6A 4WGGA 4Y98A 1SD5A 3R7WB 3SYKA 4BFXA 3I2KA 2Z58A 4GO1A 3LK7A 3X2FA 1G8YA 1YZLA 4BEBA 3AR3A 4X24A 3Q7TA 3LS2A 3MWKA 4IF4A 3SIPA 2NZUG 5ECDA 3TL2A 2OV4A 1NVBA 1PWYE 4OHCA 1K2WA 1PP4A 2V45A 1U8UA 2ZPTX 4Q9HA 5KYKA 4KQ6A 3MHTA 4BX0A 2O59A 3SXUA 2QUAA 4X8MA 5TY0A 3RB8A 4C7OA 1T43A 1TCBA 1CVLA 1KEPA 1VYUA 1HE8B 3FR7A 4TT3D 3COYA 1VGQA 1IQPA 2ZSDA 3BGWA 2UUOA 2AB0A 3GLFB 3PQ7A 3EEIA 2NUTB 3CEJA 3ISJA 3GT3A 4HYTA 3V1UA 4EDFA 4AJEA 1SKBA 3W2IA 1JAYA 1FW8A 1YRBA 3GWGA 3QFSA 2R9VA 3JATA 4NARA 4X41A 1JA9A 5ED0A 3IR6A 5ILQA 3AHIA 2PD4A 2VATA 3KWMA 1PX0A 4KX5A 1XQYA 2OXTA 4JI1B 2ES4A 1QGDA 2VRWA 3ZWMA 2AJDA 3IHLA 3DUFA 4R81A 2J9FA 2Q4EA 4EHLA 3ABQB 1JQDA 1JX6A 1QG6A 5E4JA 2Y05A 3LLUA 5LFAA 2AX4A 4LJAA 5TRTA 1QPBA 2I2WA 4LY6A 4RWZA 2PA0A 3K9WA 4OVKA 2ZGVA 2NU8B 3OTOB 2XDQB 2QZPA 3MFYA 3PHJA 4TQGA 4BFYA 5LCXA 3DR5A 3S5JA 5JAIA 1GSHA 1MO3A 4M3NA 2F9FA 4F45A 2QB5A 2LWIA 2Y4NA 1SG6A 4KIUA 3SAJA 2XB2A 4HS4A 3WGYA 4BTLA 3HP7A 1QGUB 4N0DA 5I51A 5B58T 1Z7BA 3OPYI 4R3NA 4ARBA 4ND1A 4W5WA 3ZYCA 5I7VA 4LJ6A 1CNMA 1WXDA 1CNFA 1E9AA 2WZBA 5IWCA 1A72A 3G0DA 1NE7A 5COQA 3BHNA 2Q0QA 2JEZA 3G85A 4L3OA 1FNSA 1H0HA 1D04A 3GGOA 3TLYA 4CMEC 1NXWA 3AO0B 3UY4A 3PJGA 3LL4A 1F8FA 1RQRA 4CLRB 5T67A 4O1IA 2F1HA 1WV1A 4KVGA 5CAEB 3FNIA 3L4JA 1JJVA 4P82A 4BPRA 4UQPA 5JZOA 5DISB 2I66A 4E07A 3WJ1A 4BNHA 1EFLA 3G82C 4KN8A 4JVSB 1Y81A 1UC9A 3SNHA 4M1OA 3OCYA 4FFVA 4R2HA 1WTCA 1D9XA 1VECA 2PR2A 2YV1A 3NI2A 3GFGA 2VP5A 3M9XA 4M1KA 4PG4A 5IARA 3TSYA 4BNMA 3JALB 4CV0A 3PWKA 3VI4B 3NMUF 3PNVA 2FGKA 2XVMA 3KJZA 3DOUA 1GG5A 4LBWA 3RS2A 1UIRA 3FBWA 4BP1A 3RSZA 1S5PA 1TRKA 1B1CA 5HQJA 2XYGA 3SC6A 4BTEA 3OKCA 4FYMA 3F6SA 4TLDA 2QE7A 4L1KA 2ECKA 1FRFS 2KWIA 1LSUA 1WL8A 1FRQA 3ZLVA 1QR6A 3NHAA 1WCWA 3JRXA 1V7ZA 4MQ6A 4ARUA 3AR4A 1L7OA 3IHTA 4LGMA 4NESA 2RSLA 3AJDA 4TTVA 4BJ6A 3OPNA 3EOAI 5ER6A 1Z0DA 1KRHA 1A5SB 4PC3A 4K9MA 2YOHA 5HKAA 3B6MA 3MWGA 4PCAA 1KY5A 1NX6A 1XDWA 2A88A 3MZ0A 4W1PA 3P2IA 3BT7A 1TQ2A 2BUBA 2R5NA 4IOLA 2QD3A 1OX4A 2O1SA 2YL2A 4QBTA 3U3OA 2ZM5A 1BW9B 1R66A 2PZBA 1WMAA 2XLBA 3Q8WA 4ZC8A 5JCZA 2R1UA 1C14A 1YL5A 6ABPA 1DG1G 4NV1A 3OY7A 3MWDA 5JC8A 1GKIA 1C80A 1DC8A 3GUCA 2CV1A 1VE1A 1JXQA 2CXRA 2M1XA 3UJ8A 4RXUA 1S0UA 4QICA 3ZZ1A 3A8TA 3FDZA 2BFMA 4G2NA 3LVRE 1OBFO 4OU4A 3X44A 1DG9A 1AHHA 4QOJA 4RW0A 4X7PA 1TUBA 3D7RA 1XYVA 3MTEA 1A8IA 3RC9A 2BZ1A 3ZH2A 5ESRA 2VHYA 2WFLB 1DRWA 3U13A 4Z7JA 1XD2B 2MYPA 4RJIA 4HQOA 5CPFA 3RARA 3N7AA 3F3KA 4CIBA 4AY6A 3ZE7A 1Z0ZA 1ZAKA 3IA7A 1XCLA 1XLVA 2NT3A 3HDVA 4AIIA 1Y48E 4L57A 1FP4B 4WKPA 5EC8A 4AYXA 1FSFA 2X5NA 5E1DA 4J43A 4JOQA 3VHLB 2N75A 3LPLA 4U0KA 1NJ5A 3KALA 3IVAA 4Y6OA 2BI4A 1GQOA 1QWOA 5DEOA 4B17A 3NVMB 3QK7A 4ZI7A 1XU7A 5MN6A 1ABFA 4FOSA 4UU7A 3KKZA 5KI6A 1L7MA 2P78A 1GN9A 3F96A 4R0NA 5LNK1 3TIIA 3OJEA 1XJCA 3NC0C 4KQ2A 4QL3A 2VP9A 1OZ0A 4WXYB 4CTKA 1FLAA 2FWAA 4BBPA 3BSWA 1OZFA 4WSOA 5ALIA 4D0LB 5ILOA 3RTAA 1NRWA 2CV2A 3W0LB 4LZLA 4PQEA 5J63A 2IEIA 2V7XA 4MVJI 1TRHA 3CN7A 2GEJA 3T4PA 2OHJA 4U2FA 4F6RB 3D8SA 2VHUA 4UE3S 4BFLA 1ZVQA 2Q27A 1OB5A 3LQYA 4JXJA 3QFCA 4M0KA 3LA8A 3KS9A 3I5UA 3VNRA 3ZQUA 3NHPA 3FNFA 4HI0E 3OZAA 1G5IA 2P9YA 3D3JA 5ALJA 1IVSA 1OFUX 2NAPA 2P9FA 2HTFA 3FOAA 2DT8A 1PVVA 2FZ4A 3EZXA 4F2HA 1CLUA 5G53C 2N1MA 3RRXA 1XZNA 1N5KA 4RZ3A 4D6XA 5HRUA 1O5TA 5MFZA 2JFFA 5C35A 2CV0A 1M0WA 4EHIA 3IC5A 4YONB 2VSQA 1M34A 1FVHA 3PGMA 4FCVA 3L4KA 1HTTA 2BHTA 1P44A 2YC4C 4Q1BA 121PA 4HXEB 4F91B 1V5EA 1U28C 4K1XA 1LRKA 1FSSA 4ER7A 5C1PA 1AZWA 1LW6E 4YJ3A 1VIMA 2JGLA 4S2EA 4E33A 3UOWA 4Z53A 2XVZA 3UK2A 3I9KA 4M83A 4TV9B 2O2GA 3SFVA 2FK7A 3NCTA 4LHXA 4MVJD 1YWGO 1Z4PX 3L7KA 2BDUA 2ASVA 1TM2A 1FRNA 3U26A 4C01A 4BO3A 4MH0R 5ADVA 4V0NA 1F0NA 5MDHA 1EWKA 2JLBA 3E9CA 4FWBA 2AF3C 1S4QA 5JRJA 2ZUDA 1I3MA 2NADA 5DO9A 5A6VA 2WUEA 5A71A 3ZY5A 3QKTA 1FB5A 3A2LA 3E18A 5DX1A 3SNKA 3WKDA 2OBNA 4AP5A 3QLVC 3TQRA 4LXIA 2PZJA 4AICA 3H8JA 2R6R1 3ENZA 4H7DA 1N0HA 5GONA 3REQA 3G17A 3MC1A 3WTBA 4BE7B 4F93B 5KHAA 2PV0A 1QLJA 3CH5A 3ZTTA 3WLKX 1VYHA 1IUPA 1AX9A 4NP6A 1J49A 1N0UA 1NTOA 1VB3A 2PZLA 2PX4A 3SPXA 3A6KA 4JVOA 5EA2A 1EMDA 1FQOA 3SR4A 1PGPA 4XYEA 4B7AA 2D0OB 4L15A 3SX2A 5F1KA 2G5CA 1YL7A 4O2BA 4CMJA 1GTG1 4RJ2A 4D82A 1Z3CA 1M6VA 2F2TA 1JHZA 3AZQA 3L7NA 4IHJA 2OORA 4LCBA 4JP2A 4PCVA 1Z34A 2B6HA 2GYWA 3RFVA 2JIMA 4HDQB 4JR2A 3PUHA 4Y6QA 3S1AA 4ANFA 4HVLA 3I28A 2B36A 2DPGA 3NRBA 1ZNZA 1GPMA 4V0LA 3CIFA 1QQAA 4OUDB 4B8YA 4BB5A 2NVWA 3PC7A 2BH2A 1ULHA 4RDCA 3SQXA 4RZQA 3R3UA 1PQUA 4MLCA 4N12A 5D1HA 4Q4JB 5EMLA 5BP7A 2YFQA 1VPWA 1H2WA 3OVMA 1ZI8A 1Z25A 4V24A 3V8PA 1Z6QA 2XXJA 4EABA 3CJTA 2VLIA 1SA0B 2MSWA 4LTNA 5SZKB 1ODLA 3W4JA 3K1JA 5FOQA 3NTOA 4MQUA 5DW3A 3ZZUA 4X5OA 1ODTC 3VNSA 3OQNA 3HVHA 1FSPA 1JN0A 4GE0A 1XMSA 4RPHA 4TXMA 1Z6XA 2FCAA 3KVNA 3VQTA 2YY6A 4D3ZA 3WDMA 2CFOA 5FDFA 1HR0B 2YV4A 3P4YA 3M1AA 4BCBA 2FX5A 4MRSA 4WBNA 2QPAA 2VQSA 2P3SA 1TMOA 4AO8A 4B2IA 3I09A 3B2EA 1E58A 1O08A 1NVGA 2ETVA 4NU8X 4W7HA 1FLNA 4L7VA 1DQSA 3T5GA 2E89A 1OVGA 2HWWA 3CNBA 4DLNA 1W36D 2VF2A 4BP9A 5B4UA 1JDJA 5JI2E 2QYSA 3IBCA 3IQHX 5TC4A 2AMFA 4TM8A 3UAGA 3QV1A 4F3KA 3COWA 1X7YB 2O2EA 2BYTA 1UQUA 4FQ5A 4HZIA 4IHJF 3RROA 5AW0A 3RE1A 1B0UA 2XHZA 1SVNA 5L6MB 1W94A 2QAIA 1RADA 1V9CA 3E5HA 4X93A 3DGFC 4P92A 2JD2A 1XAGA 1ZMOA 3ETNA 4D81A 4EFLA 1NNLA 3PNMA 3V6LA 1OWNA 2WTAA 4DWVA 2HZ7A 1N3BA 4JUIA 3IR7A 4R7GA 1AF4A 5A3VA 2OCGA 3RFTA 2BFNA 2DUUA 3RNLA 1KVRA 1P2TA 2QVXX 2R1TA 1Q0PA 2CE7A 3JYOA 3OCWA 3R4CA 1NX9A 1R0XA 1AG9A 4XLLA 5LA6F 1BQ4A 1D3AA 1D4ZA 2I7XA 2YNMC 4K1LA 5KQMA 3K16A 1GUYA 2DCMA 3N0VA 4P1ZA 4YNBA 3VHRA 3WFJA 5K99A 4FMCF 2QV7A 1TA9A 1P6UA 1Y63A 3GHYA 4A73A 4KNWA 5HQTA 1BCSB 2RCNA 3PL1A 3PXXA 5TNXA 3Q8KA 2ZK7A 1W581 2BE9A 3DJYA 4YCSA 3SJ7A 4UZEA 3UEOA 4NCAA 2ZSEA 5CURA 3FKSA 2YN4A 2ZTMA 3JZDA 3EEOA 4C2BA 3ZV4A 1A50B 1L5HB 2B20A 3D4BA 3J80A 4QFDA 1TC1A 1GYRA 2C9OA 2P3OA 2QMQA 3I34X 3WL4A 5IFLA 1FUKA 2EVWX 3JPYA 1YDMA 3JRNA 2X5KO 4KQ9A 4MWOA 4WBXC 4A5OA 1U5BB 3O8QB 4AJLA 4ARVA 5J1SB 1W29A 1MHPA 4D46A 4KU4A 4ZMBA 3SZLA 2P68A 1IXKA 4U8GA 5GGXA 9LDTA 1XTKA 3NWOA 5EE9A 2FR0A 2AKAB 4F84A 3EWNA 1PTJA 1Y8QA 1BX3A 1PJ2A 2EU8A 3SQWA 3ELWA 2BD0A 5CFLA 4ZYYA 2VQFB 2F8TA 3JWEA 1JZTA 3LX5A 2XB4A 4TUYB 2FH5B 3MUOA 1NMYA 4TTSA 1DTWB 2DF8A 4KQJA 5AK0A 2AMLA 1JVNA 3NH6A 5DE3A 1XDDA 4OQFA 1D8TA 4RZSA 1LUAA 1X0XA 3OTHA 4MCAA 3V4RA 4DLXA 3WA6A 2AEMA 1VYVA 4XYGA 1N75A 2QA5A 3EK2A 3LF1A 1NW5A 3ZE8A 5CFZA 3ER9A 4OMDA 2QD4A 3DUWA 3EWIA 3UG7A 1K7SN 3OZVA 3QPBA 1SB8A 1WULS 4I81A 3TTYA 1KZYC 1UKZA 3W5CA 4MUKA 3ZI7A 4IV5A 4H1TA 4HFMA 4I6JA 1K9SA 4M6WA 1AB5A 1J2RA 2HAEA 4GUAA 2ZYTX 4B7UA 1CRPA 3ECSA 3RODA 3CUSA 1GXSA 3WNBA 2EFDB 5LMCA 2G1PA 1A9RA 2JH9A 2GAJA 3MAJA 3KVVA 1FYFA 2I71A 2JFZA 2BHRA 2CJXA 2KLBA 4XWTA 2YNMA 3UV6A 5EZ6B 1SA0A 1TK2A 2R8ZA 1EXMA 1JMVA 3NOXA 4FC7A 4DB4A 1IQ0A 1PNTA 4RVDA 3N6XA 1KEWA 4Q0MA 4G2TA 1JQJC 5JALA 3IQDB 3P45A 3EJWA 4HRXA 5H7XA 4IAOA 1V43A 4HG2A 4A6EA 3AEKB 2Y66A 1WW3A 4C5BA 2GTHA 3GBSA 4MYDA 1JRLA 4RK6A 2XVXA 1MAUA 1WCV1 3QELB 3SICE 1JSRA 3KPWA 4PX2A 4BU1A 4DMKA 2F7SA 2NU7A 1W0JD 3CV3A 3GJ8A 1T1SA 5FOXA 2E2WA 2FTKE 1OWMA 4KQ1A 4RPGA 1TOAA 5T5QA 3UJPA 4RQUA 3WK8A 4D0NA 1BXZA 1MUUA 4PYKA 1N2CA 1SUPA 3VDXA 4M7WA 1HO3A 1Z74A 4MYHA 5IAJA 5IABA 4FSHA 1C1DB 4YAGA 3AMVA 1NW3A 3MXOA 2VRBA 3CE9A 3ENWA 2C2HA 2QROA 3F1KA 1PWXA 1Z13A 2AZTA 1GPAA 2NQ2C 3KHTA 4WERA 1MXFA 2FP4B 3I2GA 2GILA 5B1IA 4DCJA 4BZQA 1PQ4A 1BHJA 3DAHA 1JIJA 1YVEI 3VOSA 4BV9A 4KR2A 1Y7HA 5ELMA 1YRWA 4LVNA 5T8KA 3QX3A 1T35A 1NQ5A 4Q7MB 4GXRA 4PYMA 4FM9A 4KH1A 5E0KB 1AK9A 2J7KA 2RC6A 1NULA 3X3HA 3LVQE 3WRXA 2N1BA 4EATA 2BFBB 2WJIA 4BBZA 3O1JC 4C0WA 1OQAA 3UICA 3W5IA 3ZWVA 2HREA 4RTKA 4KMRA 3I6BA 3LO5A 4HGZA 4OFWA 2ZIUB 3HP4A 4C06A 5I8WA 4GI5A 1BA2A 1QQ7A 5FNVB 4MI6A 4BV2A 2A7QA 5H3HA 1Z4JA 3DKIA 2CFIA 4KXFB 1Y0BA 2MINB 2HJ9A 1LPMA 3BTUA 3EYWA 2D7CA 3FPAA 4JLMA 4QJBA 1N7HA 4KMMA 1UAYA 4BKOA 5LMNB 4DQ0A 4M9RA 1PZGA 4P93A 2X0IA 4RVUA 3JYLA 1SN7A 4AX4A 4B79A 2PZAA 3I30X 1EUDB 1BTOA 2A1TS 1H69A 3K9NA 4RIFA 2ZM6B 1XMXA 2P62A 3HUFA 3B7PA 4INZA 3EPLA 3PWZA 2A1TR 5I01A 5FPSA 1B76A 1V5GA 4XUDA 3PI7A 4KBGA 3ITNA 3EVFA 1NNI1 2W70A 2V65A 5JV5A 3PXAA 4H1HA 4L78A 1A88A 4CKEA 2D7JA 3IRVA 4RV9A 5LD2B 3B1YA 4WKGA 2VDWB 5U4QA 1KL7A 3S8YA 3PEYA 1DIRA 4KKXB 2O48X 3GAAA 1KRWA 1CF2O 3HFGA 2G71A 1IPFA 3S2IA 3HQ4O 4EWLA 2HLHA 3ZHCA 2PD6A 4M36A 3Q7QA 2X0FA 5IANA 2VNSA 4K6KA 2HDOA 1GV1A 2XT6A 1Y1QA 3CEMA 3R3YA 4HB3A 4PV7A 4QNNA 2H1FA 3A3KA 3UMJA 1AMNA 2YV5A 4REMA 1G20E 1Q0ZA 2PS1A 4O33A 1VIVA 1R5NA 1I6MA 1SBCA 5HQ3B 4X7RA 5FTKA 5B58C 3WFZA 2FSUA 3C6QA 3I9V6 3GPCA 1UZNA 5DBHX 4L6AA 4LHVA 5J58A 3H75A 1W5EA 1U8AA 3KXLA 3ZWNA 1RWQA 1MKYA 3QVWA 4REOA 4KHZA 1OXVA 1PWZA 1QC5B 2CC2A 4GPBA 3GDOA 4RF2A 1WBBA 4JXZA 1LFDB 1OHHA 5FOVA 4MDEA 3VH1A 4PZLA 1VHTA 3SC4A 3T1YB 4YN3A 1UC5B 1Z07A 2GYUA 2EF0A 3NHKA 3F8WA 4IILA 2EHDA 3ILSA 5HCUA 5TPWB 4MAMA 1Z63A 3QIVA 4IIYA 4JP5A 4QDJA 3UV3A 3QKUA 1M2HA 3IKLA 4ND7A 4DLKA 1J1IA 3RAEC 5FD8A 2RBEA 1DADA 3QVGA 1TKCA 2RE8A 5L53A 2CVQA 1NJ1A 3KT6A 3DZ8A 1WLSA 3F46A 5I4IA 4OHBA 4RHYA 1JHMA 1VI5A 2JGAA 2WB4A 3AUTA 1B42A 4ZDJA 4US0R 2B4QA 1WQ4A 3K8OE 1H4VB 3MCVA 2P2YA 2NV0A 1DFIA 1SBTA 1T0HB 1CY4A 3V55A 1C30A 2HXSA 3C3JA 1FYVA 1UJ6A 2QI9C 5FBWB 5IDVA 3WV4A 1OBHA 2ZE6A 3E7XA 2PBLA 3M5PA 1COZA 2YWFA 1ZK0A 4R9NA 3SIXA 1NN3A 2EGGA 3W9SA 2O5CA 4PO1A 1MLDA 3WGHA 3GEMA 4HNAB 3VO2A 2JFNA 1Q57A 1HZZC 1SQ5A 4YROA 4GAEA 1Z36A 1L7BA 2GPAA 3G2LA 4O4HB 1ZMBA 3S55A 2C3UA 1MD9A 1Q7TA 3O90A 4I1SA 2GEDA 3KEGA 3WISA 2WK1A 5JO0A 4ZEOA 4EH1A 5C4IA 3LYAA 5CCDA 1IY8A 4EYQA 4Z4QA 2N0SA 3DAPA 2H7YA 3KJFA 2MCFA 3F9IA 4TV9F 3QKSA 5TE9A 1Y8QB 3L5KA 4MVCA 3GQVA 3NIWA 1H2HA 4OG2A 3PGLA 3CLUC 4CTJA 2QKYA 2H4WA 5IU6A 2QTMA 1X80A 3HKEA 2O2IA 4QJ3A 3QA9A 1VJ0A 1XCMA 3G89A 1EWVA 4P3XA 1LSOA 4DIMA 5KYUB 1XL1A 1KQNA 1DBPA 5LOVF 3AVXA 2AEJA 3L7OA 1NZJA 4YMSA 3KC2A 2QJWA 5FUWA 5AIAA 3ODGA 1L3IA 2W2KB 1BRMA 1C1DA 5MN5A 4XB2A 1NVMB 3O26A 1RYNA 4IW3B 1MO2A 3FZGA 4MS3B 1WTAA 4P35A 5KJFA 5BSTA 5DX8A 4UBIA 3KSMA 3GG9A 2ARKA 4R1QA 1KWKA 3VZDA 1JLMA 3P9ZA 4BHTA 2IJGX 2VJBA 3B1ZA 5EZ5A 1ZK1A 3DOHA 2VPYA 4PQYA 3BD7A 3QVUA 1TJPB 3ANYB 3K4HA 1CS0B 2X8JA 5AKGA 3TR5A 4OP1A 3SE0A 4Y1EA 3QFTA 1PFVA 3KT3A 3QSYA 4N3CA 1VA4A 3SFTA 3TLKA 2I9PA 2PLWA 2JGDA 2J9XB 3MELA 2H3HA 1UBOS 2PD3A 1YRQA 1QHFA 3IJ5A 3LUHA 4KXLA 3TAUA 1ICIA 2ZBQA 2WTXA 4FYWA 2VH2A 4RYDA 2E4WA 3I73A 3TI7A 4LJ9A 4C2UA 3EVBA 4PZEA 2XZTA 1TO1E 3CF0A 2E4VA 3TI9A 3ZHYA 2ZRDA 1C9KA 1P9RA 3ENVA 1I30A 3FWYA 3G1UA 3KKOA 4I46A 1ATZA 1E6UA 1Q7EA 2E4ZA 4PS0A 1E4EB 3UC9A 3L5OA 5C52B 5K3FB 1ARZA 3IAS1 4RGQA 3W7BA 4HR7A 4DMGA 1IHXA 3OD1A 2VN8A 3L06A 5AVTA 1WP4A 1YV9A 2EEPA 1SKYB 8OHMA 2DQYA 5K05A 4ZJUA 3QFRA 2R4TA 3O3NB 4P6VF 3GPLA 1K75A 3I9NA 2HLDD 3IB6A 1JDBB 5GV7A 3IO5A 1I80A 2XNKA 3LRPA 4EECA 2DR0A 1T0UA 2AEEA 2QAGB 4M1EA 4WCFA 4ESHA 2XODA 4PPNA 1SFRA 3ESDA 1YB1A 2A35A 4EI9A 1RAHA 4RE5A 1XB2A 3G6KA 5I7EA 2WJAA 4F4FA 1KR5A 3OZWA 4AL4A 5IVPA 3IPCA 2IODA 2VRCA 4OL0A 3T6KA 4LV8B 4OK3A 2UU9B 2ZYUX 5CB4B 3QVGB 2K87A 3UGKA 4FUQA 3RYIA 1BDMA 1JG6A 1JU4A 1PZMA 3GYBA 3LW8A 5DTQA 1FMTA 4BLRA 2JKZA 2OORC 8ABPA 3DKVA 4MCIA 1YUMA 2ID8A 2D59A 2M98A 4NNJA 1QLWA 1O6BA 4KRYA 4L5YA 3IP1A 3TL6A 3L7CA 2KSQA 4E7OA 2WSIA 4PFQA 1XD9A 5JR3A 3DBHA 3P2EA 5I4KA 3LDFA 4FI3C 1SCJA 3D3KA 4U2CA 1Z08A 3DFFA 2P4UA 3F6RA 3OU7A