4HGPA

Crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from haemophilus influenzae in complex with transition state mimic
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
MQQKLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIKLFFLGKLEKETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACGTSFAVADAPIYVKNAVDHVLSTHGGKGAFREMSDMILQAQGKSSVFDTAQGFLKSVKSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
total genus 62
structure length 179
sequence length 179
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgpA00
1Z4OA 3RF6A 4KNWA 5AVRA 4Y2QA 4C4SA 2HEGA 4HGQA 1RRCA 2BDUA 1SWVA 1YMQA 2YJ3A 2FUCA 1L7PA 3FM9A 4L6CA 4UASA 2IYEA 2GO7A 3OTQA 4F71A 5AI5A 1U2TA 2G07A 4ZEWA 5ALDA 2HDOA 3W5DA 5AW6A 4G63A 3QLEA 5ALEA 4HGOA 4OD0A 4UAVA 4IFTA 2CFSA 4UM7A 5AKLA 4BNDB 5AKKA 5AVSA 2WF9A 1QH9A 3MPOA 2B0CA 2W43A 3UMCA 1T5TA 3PGVA 3A1CA 4NFLA 3I76A 1TJ4A 4CF4A 3ET5A 2B1QA 2EATA 5ALNA 3L8EA 2B8EA 3QU4A 4QJBA 3E84A 4UAUA 1J8DA 1QYIA 3PDWA 1X42A 3M9LA 4YCNA 5AW1A 1NF2A 3DDHA 5ALKA 3KOOA 3FZQA 2RBKA 2W4MA 4EZEA 2HSZA 5AKHA 1VJRA 2QLTA 4CF5A 3WGVA 4KX5A 3SD7A 3HYCA 3SLRA 2CFRA 3NIWA 5T41A 3WKDA 4CF3A 3KZXA 5ALXA 2RARA 1RKUA 3ET4A 5ALWA 1RC8A 1XVIA 3QU5A 2RB5A 4O8CA 3QNMA 2JARA 5AKGA 2ODAA 4EENA 5ALMA 2B82A 3PCTA 2WF7A 4UATA 1WVIA 1L8OA 3U7EB 1XPJA 4YCLA 3E58A 2I7DA 1RQLA 4GIBA 4IG4A 2OBBA 3WK9A 2GMWA 2IOFA 3QU2A 3U7GA 1U02A 3L0YA 3WK8A 4CNQA 5ALPA 2WF5A 3BWVA 5AW8A 5AW3A 1XP5A 2G06A 3UMBA 2Q4TA 1Z5UA 2PKEA 4JDPA 3SKXA 2C88A 5A3QA 2G1AA 3ESRA 2I33A 5AI8A 3W5BA 1ZJJA 3NASA 5AVVA 1ZD4A 1MH9A 2JAUA 3ZUPA 5AVQA 3QUQA 2AUTA 3WKBA 4RESA 1RLTA 4J03A 2X4DA 3ZTWA 4FYPA 3EF0A 4HYTA 5AICA 3KDPA 4UM5A 5ALHA 5AVXA 3L1UA 1NNLA 3ZTYA 3ZW7A 1Z88A 2W11A 5AM0A 3ZI4A 2G09A 5AVUA 2AGVA 2HX1A 1QQ7A 4MWOA 5AIAA 4NABA 5AHXA 3UMGA 1Z4JA 3J7TA 5ALOA 4DCCA 1ZD5A 3NUQA 3QXGA 4E88A 4Y2RA 5AK3A 5AKEA 5ALUA 5AI0A 1CQZA 3RFUA 2ZBGA 3L7YA 2MSNA 4FFDA 4F72A 2FPXA 1SWWA 2OA0A 2IOFK 3SHQA 2HHLA 4L6AA 3DAOA 1L8LA 4DWOA 3KC2A 4KN8A 1TA0A 4UMEA 3U13A 2JAOA 3SMVA 2RAVA 5AW9A 4OCZA 2YBDA 2YJ4A 4JB3A 2OYCA 1RDFA 4B6JA 1EK2A 1IWOA 2NO5A 5AM4A 2Q4RA 2O9JA 2IA5A 2VKQA 1RPZA 3AR3A 3R9KA 2WFAA 2YMMA 4BKMA 1ZD3A 3U26A 4GXTA 2B30A 5ALSA 1Z4LA 5JJBA 3NANA 3NAMA 3K1ZA 2WF8A 2GFHA 4UMDA 3SF0A 1YV9A 4YIHA 4YH1A 1VJ5A 2HI0A 4NAVA 2B8JA 3ZVMA 2YJ6A 2FDRA 3R09A 2G08A 4Y2XA 1QQ6A 3W5AA 1S2OA 1RMYA 3I1YA 3WK7A 1CR6A 3B8EA 1Z4QA 1KYTA 1Q91A 3B9BA 3QUBA 1Z5GA 5ALIA 2R8EA 3ZWKA 3OCYA 3E8MA 5ALRA 5AI4A 3ZWDA 3N28A 1U2SA 2C8KA 3IRUA 3FPSA 5AM3A 2FPRA 1O03A 1ZOLA 3EWIA 3HLTA 4J2TA 1RKVA 3AR6A 1LTQA 5A3SA 4NWIA 4QQFA 4AS3A 2ZG6A 3CZ4A 1Z4PX 2DQSA 3E81A 4EX7A 5AVTA 4C4TA 4Y2TA 4XE5A 2PQ0A 2CN1A 4ZEVA 3U19A 3QUCA 1ZD2P 4HGNA 5ALTA 1QQ5A 2NYVA 5AM2A 2B1RA 5IT4A 1EK1A 1N8NA 2HCFA 2WHEA 4FE3A 2G0AA 4EEKA 4BX3A 2AMYA 4Y2YA 5AKYA 2YMQA 3OCVA 4KNVA 3WKAA 2EARA 2IOHA 3N5KA 2CFTA 5AKXA 4BEVA 1S8OA 2NO4A 2EAUA 4UW9A 3M1YA 3EPRA 3FVVA 4RETA 4CE6A 4YCMA 2YY6A 5AM1A 3W5CA 3QGMA 3ZVNA 1Y8AA 3L1VA 4Y3UA 5AW7A 2GHQA 1TJ3A 1Z4KA 4AS2A 3P96A 4DFDA 3N8GA 1U7PA 1Z4NA 1L7NA 4OFZA 2I55A 5AVYA 5ALQA 1TJ5A 1L7OA 1F5SA 4UMVA 3ZX4A 2FPWA 4BEWA 5ALGA 3D6JA 3QU7A 4XOUA 3I6BA 5E0OA 2BY4A 3I28A 2ZOSA 1J97A 1L7MA 4MUMA 2Q5EA 4UARA 3EF1A 5ALZA 1LVHA 3NRJA 3DV9A 5ALJA 3AR4A 4BNDA 5AI6A 2C8LA 3U7FB 3CNHA 4YGYA 2FPUA 3SKYA 3VAYA 3WK4A 1K1EA 3PGLA 3L8HA 3KBBA 1ZRNA 4EX6A 3AR5A 4KYTA 3F9RA 2P9JA 5AK4A 4YIKA 3L8GA 4G9BA 3MMZA 4I9FA 1RQNA 5AVZA 4XPZA 1RMQA 2I34A 3AR9A 3ZU6A 4H1WA 1WZCA 3QU9A 2ZBFA 3IB6A 5AK5A 1WR8A 1TE2A 3FPBA 3ZVLA 5FP0A 2QYHA 2YMLA 3N07A 2C9MA 1RMTA 1Q92A 2P69A 4OHFA 4BBJA 4ZEXA 3A1EA 5A3RA 2HO4A 1T5SA 2ZXEA 2YMPA 3R4CA 2O2XA 3DNPA 4EELA 2FPSA 2ZBEA 5AI9A 1ZRMA 1RLOA 2WF6A 1YDFA 5AW5A 5AESA 1U7OA 3A3YA 4L57A 2GHTA 2YFYA 3WK5A 5AIBA 2YJ5A 2BDEA 1NRWA 5AKJA 2G80A 3WK6A 5IT0A 2HOQA 3KD3A 1Z4IA 1JUDA 2JGAA 2ZBDA 2FI1A 3TLMA 5ALYA 3UM9A 3MC1A 1N9KA 3ZX5A 3U7HB 3QYPA 3OCXA 3OCUA 1FEZA 5AVWA 4UU1A 4UMFA 3AR2A 5AM5A 3ESQA 2I6XA 4C4RA 2FEAA 1SU4A 1ZS9A 2D2VA 2R8ZA 4Y2PA 3WGUA 2R8XA 5ALFA 3QUTA 4KX3A 1AQ6A 4Y2SA 3ED5A 3AR8A 3OCZA 4HAIA 4PNHA 5ALLA 2AH5A 2JAWA 3L0BA 2OM6A 3GYGA 2MU1A 3WKCA 1YJ5A 2R8YA 3ONNA 2I54A 1WPGA 4HGRA 2P27A 5ALVA 5AKIA 5AKZA 3N1UA 3FGOA 4BX2A 5AW2A 3L5KA 1PW5A 4DW8A 2HF2A 3NALA 4AP9A 2WM8A 1O08A 4Y2VA 1RLMA 2C4NA 1YNSA 4BX0A 3OCWA 2PR7A 4BYGA 3L8FA 3QX7A 4UU0A 3L0CA 3S6JA 2HF7A 1RKQA 2FUEA 3WKEA 3BA6A 5AK6A 4Y2UA 4HGPA 4I9GA 5AW4A 5AW0A 5IS2A 3OPXA 1VFPA 3MN1A 1YS9A 2P11A 2YN4A 3AR7A 1Z4MA 3B9RA 4Y2JA 3A1DA 1T9ZA 3IJ5A 1L6RA 4NV0A 4XQ0A
chains in the Genus database with same CATH superfamily
3CG4A 3OQPA 3JQRA 1P39A 3PFNA 1M1XB 5FUVA 4C4SA 5BQOA 3L7DA 5K3DA 4YONB 1W36B 2WICA 4RZHA 1NXWA 3RS4A 4HZGA 4JLAA 1CF4A 4K7JA 3MJDA 5C4IA 4O25A 1TB4A 5JIBA 2RKBA 1ZK3A 3WYNA 4CLDA 3D6FA 2XHEA 2BC9A 4X1KB 5LKRA 2J6CA 4RW0A 4IYJA 3KT8A 3C3JA 4FNAA 2VDRB 3HJBA 4PVCA 1J4AA 1WABA 3TEMA 5AT1A 1YZKA 1G9XA 3LXXA 1TO1E 1FU8A 3CXRA 4G63A 1X1SA 2HLNA 2GN9A 3QLEA 2V45A 2ZSEA 3V33A 2IH2A 3LBHA 4HGOA 4IJVA 3CQ9A 1CBUA 2OCDA 3M3DA 4PCVA 1TEXA 4G5FA 1YBAA 3BCHA 3COVA 3IV6A 2H2GA 1GILA 4IHJB 1M2VA 1HMYA 2AHOA 3TCXB 3C3YA 1KEUA 2BKLA 2R8RA 2YV5A 1E1RA 4BZPA 2DUNA 1CY7A 5JPCA 2QRJA 1UIRA 3N39C 5DBOA 2JLYA 5LDDC 4AG6A 3KKZA 1ORRA 4XEHA 4WOCA 2IXDA 1UXJA 1TW2A 3L8EA 5D1NA 3HDQA 3RIGA 4RTNA 3WWZA 2G17A 3C14C 3H9CA 1XJQA 2PT9A 1P4SA 1IJBA 4QGHA 1OJ7A 2Z2IA 4ZOCA 1P5FA 4A8JC 2H07A 1EZ4A 2VTVA 1AHHA 3IL2A 1OX4B 3ADKA 1NXXA 4I55F 4ZQBA 3F3SA 1M1NA 4QUGA 3RHSA 4E4TA 4ZZ3A 1PI3A 1C14A 2AW3A 1UWLA 1EFLA 3HDHA 2OGSA 2FLVA 5CT4A 1XROA 5FNVA 4DAOA 1PV2A 1M7GA 1KF0A 3CLSD 4XWGA 3MS7A 5AMXA 3HYCA 3RG8A 2IE0A 3A36A 2CFRA 3SKVA 5JNUA 1IYZA 1BE6A 4E1VA 2XB9A 3L2OB 4MEJA 5KOHB 1SBHA 3RWBA 1KU6A 1VJ1A 2XTNA 1G98A 1BHJA 1M0TA 3MT0A 4ZCQA 1TIPA 3COYA 5ELLA 2O8FA 4G8JA 4JI6B 4P5DA 1YKFA 3A2NA 1HEIA 2H9YA 2OBYA 5IUNC 2QR5A 3AESB 3FDZA 1M34B 4A03A 3I9NA 4WLFA 4JYCA 2D62A 3U49A 5J4KA 1DE0A 4YJ2B 4L0DA 2CBXA 2W2KB 4YRPA 1PT8A 3DBHB 3F6CA 3ZK9A 5CCXA 3JYNA 1ZI6A 2F3PA 3DFMA 1VC2A 1AXRA 3D6UA 3JX9A 4G41A 4GIBA 4UM8B 4EG3A 5A0TA 1X14A 1Y7TA 4V39A 3O8OB 5HUQA 3U16A 2J30A 4LXGA 1G3QA 4EUNA 4I8IA 1Z3IX 3WK8A 4CNQA 2DPYA 5ALPA 4JENA 2IS6A 1XTJA 1RRMA 1QCZA 1FZQA 1YQTA 2O59A 5IUKC 2WOJA 1BHO1 2FPGB 3LG2A 1JEYB 5LZ9A 2VDPB 5D2CA 3THYB 4JDPA 2JHCA 3OZ7A 3Q3HA 1SJ9A 4HB4A 2H51A 2IITA 1ZJJA 5AUOB 2XCQA 3S70A 3PHCA 3UK6A 2A5GA 4TXNA 1E0JA 1HLGA 1EDBA 2FSFA 5EQTA 1PRYA 3V7UA 5DHQA 4Y7CA 5AVQA 4H4EA 2CEKA 2YHSA 3ANTA 1JT9A 4RESA 3D7LA 3K31A 4WKPA 4GO1A 2J3QA 4EJMA 9MHTA 1UXKA 2XX3A 1RWOA 2QF7A 4I2VA 5CUQA 3OWHA 4HDQB 1RAAA 2BGGA 5KSZA 1LSSA 2NXNA 5A9SB 4M2LA 2ENWA 4CIAA 5A71A 4LZAA 2QTBA 2CDRA 1Y9ZA 1DC4A 1NOJA 3JQBA 4S1NA 4TTPA 1ISSA 1JFFA 1T2DA 4UHBA 5DM2A 5TC4A 2HLDD 3SPXA 3W7VA 4ENRA 4YRSA 3VSCA 2C7RA 2AOWA 2VP3A 4RMNA 2VK2A 1DJPA 1NYLA 1VIVA 2JJMA 4UU7A 2CDNA 3WDMA 2ACEA 2R00C 4CPDA 4JCCA 5IMBA 4D9BA 2Z95A 3ZWXA 1DO2A 4W9MC 4BS9A 5F5NA 1RI3A 1VDMA 3GFRA 4QYXA 5LZ2A 3TIIA 3THYA 3E3OA 1CJMA 3ZD7A 1SC4A 3I53A 4FWBA 4JI5B 3DDCA 4CTNA 3P71T 3PGJA 2QT0A 3F7TA 2DXIA 4ZAXA 4HLCA 2F8TA 5ALUA 3BGSA 1C81A 3BE5A 3DPUA 4FN5A 5KNDA 3MWGA 4PAGA 4HTAA 3UOGA 4FCTA 1YS6A 3OZTA 2FPXA 3IERA 1XDGA 1G291 5JCXA 5TQ0B 1FVHA 3EY9A 3P9KA 3H4MA 2H0QA 1R4ZA 2VF7A 1M75A 1X87A 4J0QA 3G5MA 2EGGA 3CN7A 4EB8A 1KYWA 4YN3A 2W6JD 5FI0B 2XQIA 1ZK1A 3EGOA 3QLUC 5ESWA 1L9KA 1YKSA 5JTUA 4IIDA 2VSOA 2BW0A 2OHXA 4IXMA 3DVSX 4J7XA 2OP0A 1NMYA 2WFLA 4PHCA 4C2UA 3NT5A 4UEWA 3PGMA 3RK0A 2ZRLA 3UJ6A 2OHHA 4MWDA 4MVJP 2HCTA 1JFSA 4RTQA 4W8OA 3BB3A 3EEYA 5EFOA 3RM3A 3CRRA 3T9AA 4BMCA 2YWJA 1Y6JA 1ZD3A 4FYWA 1E6MA 4AD8A 3VHXA 1PT9A 4L2IA 3MM4A 3U26A 2Z5FA 2ZT5A 1VPWA 4AI6A 1VQ1A 3QVXA 4HHEA 1P0IA 1R3DA 2NZXA 3OG9A 1SXJB 3C3MA 3FKSA 4EIWA 3UJ3X 3G79A 4BUZA 1LDNA 2YJGA 3DZFA 3N6XA 4RD2A 4EPYA 5C0OE 1U1CA 4PG6A 3L7IA 2JLSA 4YJ3F 4AMUA 4KQMA 4Q4HA 4EB6B 2IQ5A 5HOQA 1QS0A 4YT8A 5FF9A 4YBZA 4MULA 3NUGA 5C46F 4YAUA 1M1UA 5DV9A 1FP4B 3KYBA 2V6BA 1ZD8A 3D3KA 2AC4A 5ER6A 2VUSA 3BFJA 3B9BA 4NLLA 4BUCA 1E9DA 1OXVA 4UVGA 1UT5A 4BVEA 2BPOA 4M83A 1E7YA 1RBMA 2V7QD 4KO2S 1D8TA 2I7CA 5HF5A 3VO2A 5A5VA 5IF9A 1RCTE 1SUIA 2F00A 4WJKB 4EHLA 2HB6A 5TGTA 5ADUS 7MDHA 1SUAA 3O8RA 5AQEA 1VLJA 4UDXX 1SUDA 4WCDA 4DJEC 3A04A 1VRVA 4RTMA 1C7QA 2GM4A 3G17A 3ZGYA 4ARSA 3OJLA 3HCOA 4C3VA 4E31A 1H0KA 1MPTA 1SQFA 2HNAA 1NW5A 3ZGNA 4X54A 3IV9A 5I5EA 4I4TA 5HIAA 3M0EA 1BCSB 4PICA 1JJAA 3FNRA 3KFXA 1L8XA 3HABA 3H17A 4BPBA 1F9AA 4QQFA 4BP9A 3K7EA 2DHEA 3MRXA 5CX1A 4QBIA 5F3WB 2I8CA 2J4CA 5ETJA 1JF8A 1SCUB 1QVZA 1V2HE 1ZOSA 5C3UA 5JDCC 4KDRA 4J07A 4DMUB 4EYKA 5IYZB 3TGLA 2PYDA 4CQNA 2X3UA 3GJYA 3BHMA 3E5NA 3SIRA 5DHTA 4Z3KA 1CJUC 4BB9A 2H2HA 3QUCA 1ULAA 4KN5A 5LZ4A 2VNKA 1JFLA 1U0RA 3ELYA 2ZS8A 1TYEB 1YR9A 2RSLA 4IRXA 4X90A 1N8NA 1P1RA 2ZBQA 2ZRCA 3GCDA 4C06A 1MRSA 3ZY4A 2MIIA 1LNZA 1PLKA 2ZR0A 3R6LA 1LX6A 4Y2YA 1EDDA 1R0SA 1HDXA 1XP8A 2B2XA 2CJWA 3CKYA 4P92A 3VVLA 3VKWA 2J59A 3BK7A 1Z6QA 3JD2A 5CDTA 1AUXA 3C8HA 3KZCA 2HYIC 4IWXA 1Z2OX 3OLYA 3P4YA 1P6XA 1E4EB 4LC0A 1LFAA 4K9RA 3TRFA 2QB5A 3U40A 3ZGOA 4MUNA 2APJA 2P62A 2VP5A 4LVNA 9ATCA 4MYHA 4CEIA 4B7UA 2EZ4A 4N01A 2GLXA 4HNSA 4QUAA 4D4GA 3Q5GA 1MEOA 4YFVA 4L9AA 4AMZA 2YV3A 3IXMA 1Z34A 1DS6A 1RXEA 3HSSA 2BGIA 4EECA 2ZJOA 1TJ3A 1W36C 1CUJA 3BMOB 4OM8A 1T2VA 2JANA 4DSAA 3P96A 2B1IA 2HT6A 3TLCA 3MYRA 3UJCA 1Z4NA 4ZHSA 5BOSA 4HF7A 3ZDQA 3KLPX 1DTSA 3OT5A 2OLKA 1IEQA 2GNAA 1KI9A 4HUQB 4QFCA 2PX4A 3HVKA 3LUGA 2BMFA 3DZIA 3ERCA 3S3TA 3MCAA 5G1PA 4PQGA 3H3FA 3BE4A 3I5YA 7REQA 5JRJA 4C6SA 5LLTA 2NO1A 1NJ2A 3GQBA 4EYEA 1L7MA 1VKZA 3MINB 4FYVA 5JZOA 4DEYA 2YV1A 3OOHA 3W9BA 2C0CA 2HR1A 1USUA 2GS9A 1YA6A 4G5OA 4JA0A 1THGA 4A0GA 3SJZA 1RRGA 1ISHA 5CGQB 1RHQA 3COWA 1N1EA 1TKCA 2A14A 4QDXA 4ZMRA 1P61B 2HA3A 2J7PD 2I3GA 1C41A 1G66A 1E2JA 1MJFA 1T10A 4MVCA 1YZYA 5KNCD 3GAMA 1QYWA 1FLDA 1IMOA 1FFWA 1NASA 3DKIA 3KM0A 4JKOA 1TUBB 2CMFA 2HZBA 5IG2A 3GMSA 4YIKA 4ZDKA 2V6FA 1JSLA 1XLWA 3E1GA 5B58T 2BN4A 2ECFA 4P7FA 3QMPA 2YIMA 3GLGB 1FDWA 5CYFA 2PD6A 4WCVA 3DHYA 4YUXA 1ZR4A 2Q0QA 3RVSA 4CV2A 1XJWA 1U5CA 3FTNA 4JI4B 2FFAA 2YHBA 2FFBA 2RGEA 1J0XO 3EDOA 1NBMA 1U28C 3MFYA 5EIHA 1L5NA 1TLLA 2C9CA 3AL3A 2B2CA 4OK5A 4U6SA 1MJGA 1QUFA 3WQQA 3TK1A 3P5BA 5B37A 2H0RA 3LUHA 4MZXA 5ICMA 4JL5A 3ECAA 1EBUA 1BFDA 3ZJTA 2ZATA 3LM8A 3G88A 3NLLA 2GKGA 1EG7A 3NOVA 4MIOA 1G2OA 4A5OA 1XNRB 3JZIA 2BR5A 1UXOA 2FPSA 4KRYA 8ATCA 2Q28A 2PU5A 1GNTA 1O9GA 1RLOA 2WF6A 1HQYE 2CL6X 4JN6B 5B2EA 3WGKA 4P7JA 2WAOA 5L8VA 3TPCA 2JD2A 4IZ6A 3REGA 1EWRA 2QMEA 1XZEA 3H2YA 4OAPA 3BGOS 3W7BA 2J87A 3WNZA 3V80A 5AIBA 4E5NA 2YWGA 2G77B 3WK6A 3MSXA 3JAWA 1BXZA 4Z9BA 1DAMA 4RHTA 5E2IA 1HORA 4OMDA 8OHMA 4FZRA 3A58B 2OMKA 1F8YA 2MDTA 2V9ZA 4UVHA 4YX9A 1Z6GA 3AUJB 3RC8A 4NU6A 3HJFA 3QYPA 3FPGA 1H2WA 4UU1A 4YT4A 4NS4A 1G21B 1B23P 1ESCA 1HDRA 3VX4A 4LYHA 4B8YA 1O95D 1PGOA 2PUCA 2FQQA 3NYWA 2JGRA 2UZIR 4UNSA 5DLDA 3RRMA 5B3JC 3D0KA 4R3UC 3RS5A 2CLMB 3U9LA 3EIXA 2FU5C 3QUTA 4DLZA 2ZULA 1HC7A 1SOMA 4G4JA 4LJKA 4JP3A 1O1YA 4DRXB 3TLGB 1U2DA 3Q11A 1K86A 4EJ0A 3ZE8A 5A6SA 1ECGA 2I4LA 3GJRA 3QFCA 1ZNQO 3FIUA 4PNPA 1OYWA 1I2DA 5AOVA 3NM5A 1A95A 1NN0A 5H82A 4L4YA 4FEAA 3BWCA 2W70A 1M76A 3IE1A 4BGVA 2JJ8A 3RWOA 2VAPA 1Z29A 3FGOA 4PWZA 1OF1A 4GECA 1CT9A 1JLMA 3WV5A 5BQ3A 2FEMA 3A3KA 3E7FA 2C29D 1NPTO 2JA1A 3UV7A 1M8JA 3LNCA 4P0QB 4GKJB 4FHEA 2RGWA 3LWBA 1JXQA 4ALJA 4ZCMA 2NACA 2QLLA 1MXFA 2O1SA 3AOEA 1K7EB 2YWXA 3FBTA 1EZZA 5JALA 4N8DA 4EVSA 1Y9JA 4LYYA 1YONA 2IIPA 4PC2A 3HUFA 4BYGA 2NG1A 2VFAA 3L8FA 3W8DA 5IK2D 2XSZA 5JXWA 2QT1A 5KDOA 2GA8A 5KTPA 4TLAA 5D3MA 3SFZA 4HNVA 4MI1A 4NK4A 4FLMA 3ANMA 4R9NA 1WNTA 2HLDA 5J9FA 3T0GA 2IU6A 4DJTA 1J1UA 4Q1AA 2FDXA 1X9GA 2VHVA 1KPIA 1E4OA 1SXJA 1E66A 3B9QA 3OLWA 4GLFA 4X94A 2PLFA 3AL2A 3D8NA 3V4SA 2DP4E 2AOTB 1EFDN 1T5IA 1HLDA 2VL7A 4KQ6A 1BROA 4EJSC 4G0UA 1N2CA 2PH5A 3H2ZA 4E7PA 3RIMA 3I1FA 1OUMA 4RY8A 5KHOC 3ROTA 4XR9A 3C7DB 4BO3A 2RK3A 1V6CA 3UHPA 2Q3CA 2YZNA 3GPIA 2BMVA 4RELA 4YDQA 2ZCVA 4FZ3A 3PTZA 1W6UA 1XZJA 2QUJA 2XQVA 5EE3A 3AVOA 2Z5LA 5JCOA 2E48A 1XVTA 2QTTA 5TF4A 9GPBA 1J20A 2ZSKA 2AC2A 2JCYA 3GJSA 5G53C 2CD7A 4RDXA 1LF0A 5EJ4A 1R6UA 2P8SA 1MB0A 2HU2A 2ZZNA 4Q16A 2JB9A 5BT9A 4MQBA 4ID3A 4LBWA 5IDYA 3RRBA 4PVDA 2O8DA 1G8YA 4NCKA 3W2EA 3ZE0B 4F7DA 4X1OA 4LBVA 5G41A 2RAUA 2HWWA 1I2CA 3HYRA 4QO7A 4D7AA 1DQPA 5JCJD 2WEKA 3I09A 1CYEA 3OOSA 4Q66C 2CHUA 4K03A 4WLVA 5K1ZA 4CLXA 3S40A 5I4IA 1VJGA 5HUHA 1R0XA 2F2TA 3SHWA 2GEFA 3DOHA 2EYUA 2LV8A 1LWNA 1XRRA 2X2FA 5EMMA 4YJFB 4I4TB 5AVSA 2GEDA 2R6DA 1OT3A 1A8SA 5C3MA 1XQ9A 2F9FA 2XNDA 3DO8A 4PSVA 2IS1A 2HIHA 2MYPA 3B3QA 2ZSBA 1UJBA 4B73A 4RH1A 1PFQA 1UKYA 3PA6A 4NIMA 4BLRA 2ZJ1A 1BW9A 1DKMA 2BMAA 1JR2A 4DJDC 2IBTA 4ZZ2A 1E3LA 4P3PA 1Y1RA 4QJBA 4JLSA 5L3ZA 4AZTA 4BASA 2A30A 1XD2B 2X77A 3Q1LA 1E8NA 1L5VA 4RQAA 1LPOA 4H31A 3KQTA 1E2DA 4MP8A 5ALKA 1HDYA 1SNYA 1HE4A 4P4SA 2NNLD 2H7YA 2D0PB 2ZIVB 2RBKA 1Z8DA 3CWCA 1G5QA 5JAHA 1PJ8A 4HH4A 4MKIA 3TKYA 3UAXA 1OTHA 3LT5A 5EIFA 2QLTA 2Z9DA 1TADA 1U8XX 3HCAA 4HQLA 3ZDFA 4JUAA 2XTMA 1ABBA 5DDIP 4ZRDA 2Z6AA 1RR6A 3A4VA 1V5FA 2C5FA 3K30A 2QZJA 4CLHA 4GDFA 1S89A 1ZGHA 4WY2A 5D8DA 4B35A 1JDZA 1RKUA 4EHFA 1N2CE 2CK3A 5HUJA 3CKLA 1DXYA 1WL8A 2PGJA 5CH8A 4EQ6B 4Q1CA 3QITA 2R7AA 4KK3A 1EA5A 4TVBA 3SFVA 4BTLA 5A5GA 1QRAA 1XA0A 1NY6A 5K0FA 1B7GO 1RJWA 5TE9A 4AZWA 4DCTA 2X22A 2BE7A 5EOVA 2DFLA 1V35A 3PCXA 3KYJB 1PR4A 1JLHA 2WF7A 2XQGA 4CJXA 6ADHA 5BUQA 4V1CI 5JSQA 2ECPA 1AKMA 1ZJZA 4EW3A 1LRJA 1BSVA 2Q46A 2FXVA 3D4LA 3IAUA 2FZ5A 3L01A 4JB2A 5D6OA 1ZVQA 2CUKA 2VBFA 3GVHA 2LIVA 4IINA 5DGDA 1YQXA 5JT1A 1U9IA 3Q9UA 2P4QA 2NYRA 2IOFA 1T1EA 4B0OA 6GPBA 2PK3A 1R9NA 3FTQA 4JEMA 2YJZA 3JQPA 3M5WA 3C4VA 3LOUA 4LC1A 2NUAB 5JAOA 1OIWA 5B1DA 3S4YA 2H4FA 1UFRA 1RCUA 1PTKA 1NUAA 4E03A 2G06A 1RXYA 3B6KA 3KZ1E 1KKMA 1US8B 5FA8A 4KXVA 5EINA 3WHPA 3RAFC 2C88A 3VPDA 1UR5A 4YVFA 4DWWA 2JFUA 5JBIA 3P8ZA 1QIDA 2QP3A 5F1KA 3HU5A 2YIVX 2PX0A 3GZ4A 3DJYA 1OXTA 2WHYA 2PGNA 3QV2A 4XH9B 5HTOA 1KJQA 1X8JA 3IQFA 5DH9A 2QUKA 5P21A 4X60A 4QGFA 1NMZA 2MSCB 2ONZA 1H2ZA 2ZYAA 3OU2A 1W88B 4Q7JB 2FA9A 3CWZA 5AICA 3STWA 3S2UA 3DOCA 2GKOA 2HBZA 1RJEA 4L4SA 3VH1A 2DKOA 2GJ8A 4HCJA 1GLVA 1BA3A 3TF5A 4KTTE 3OHMA 5DTMA 2LR0A 1WB5A 2OPBA 5JDCA 1KEZA 2QGZA 1TQ4A 2AVDA 1UL1X 1WBBA 3T7CA 5AVUA 1QIIA 1I3CA 1OOEA 2YIDA 2SKDA 3DWGA 4LBYA 3OJXA 3T0IA 3SY8A 1KR2A 2AN9A 2JAXA 3IGFA 3LIPA 3RYFB 3VR0A 1EVEA 3GCGA 3GV0A 3WP0A 3G85A 4PAWA 1L5HA 1JAXA 1VL8A 1XA3A 2JASA 3G89A 1E77A 3N9IA 1YI0A 3IEMA 2O5EA 2QYOA 4HDCA 4Q47A 2CV2A 4HLUA 2PMBA 1K7CA 2WZQA 4XX1A 3WAKA 4A8HA 3VPAA 1BU5A 1E6WA 1JX6A 1MMFB 1P2TA 1RWNA 1RYYA 4NE9A 5IAKA 5GWXA 4D79A 3MAAC 2QVYX 5HCNA 4PGGA 3SM3A 2MJLA 1NXQA 4L6AA 4PLYA 3KJQA 4QICA 1PO7A 1MJHA 2R6HA 4R31A 3KCQA 2WV7A 2YDXA 4GWLA 2ZUFA 1R8XA 1XU9A 3QRWA 1HNNA 1T4GA 2A5FA 3TMAA 2GHRA 2WMOB 3TCKA 5B7PA 3WTBA 5CVUA 3LSTA 3FMGA 5LD2B 1XU4A 2WT9A 2OQVA 1IBRA 5JH7B 3ER8A 1E1DA 4GX1A 4IRMA 2JHFA 4WNAA 1CVRA 1TKAA 2QZ4A 3MGCA 4CU2A 1AF4A 1E8DA 4RTKA 4NZZA 2O9JA 3HDYA 2CK3D 2R6R1 2FJ0A 4TKUB 4Q9KA 3O03A 4XIFA 2PZGA 2PXXA 4R1QA 1P7ZA 1V1RA 1GR1A 1CHNA 1PWEA 1Z4LA 1G3UA 1H6AA 3JPYA 2ZQYA 1XFAA 3Q3GE 4XM1A 3SIWA 3PJFA 4AECA 5KOYA 2XNKA 2HCBA 3RCBA 3AB7A 3G8AA 2FSVC 5T4FA 4BWVA 2G1PA 4CIBA 4TUYF 3LQ2A 3RFTA 1L4HA 3RRYA 5JZVA 4D99A 3TG2A 1EUDB 4YMHA 3ROZA 1RADA 2WUEA 1WUYA 2DHCA 3HUDA 3O83A 1NVVR 4WX2B 4YREA 3ZE6A 2HA2A 3I1YA 3P9PA 1Z12A 1WTCA 3VI4B 1DO0A 1VHTA 1ZLYA 2C5HA 2GASA 2WP8J 3C6BA 2YWHA 3N86A 4F12A 1SXPA 4K87A 3BC1A 1J2RA 4UOZA 1E1NA 5KTNA 1N5DA 3QLUA 2INGX 3KZVA 1E3EA 3TXYA 2YYAA 5TDHA 3E8MA 2OV4A 3MW8A 4X8LA 3P2EA 2H52A 1XK7A 1DT3A 4HH3C 2GYYA 5DP1A 1HBJA 2VT2A 1K6EA 4E5KA 3HJCA 3F9CA 2CHFA 5HMMA 1ACMA 1I3MA 2ONYA 5ECDA 4B3IA 3H11A 3A14A 2QA5A 5HWSA 3S1AA 1AT1A 5I47A 1Y1TA 2A0XA 4OATA 3U3DA 4UUNA 3CISA 5LSAA 5M5BA 4Y1RA 1RACA 2WWIA 2BZ0A 2CSUA 2V3VA 1JDBB 2C57A 4WNCA 4AMBA 2Y8EA 4L5YA 5KSPA 3BXPA 4DXAA 1Y7HA 3R0JA 4OJTA 5J1TB 5CDUA 3TW4A 3BRWD 1KYYA 2HADA 4JB0A 1KIMA 4I81A 4JEHA 2VBCA 2BEWA 2FE4A 2QN8A 4PZ0A 3B7PA 2BCEA 4U3JA 1SRQA 2AZMA 3LGXA 1TL7C 1B16A 2B5WA 3M2TA 3VPSA 3IAEA 5GAJA 3VH2A 3PZBA 4B4VA 1E0AA 1KVTA 1OZGA 5DOZA 3ZY3A 5JSUA 2IUUA 4ZOQI 2R4QA 3LC7O 3DHVA 2FMXA 3FUWA 3K92A 5AWFC 5FBHA 1DRUA 3UC5A 1IXZA 4AFNA 5JMOA 2H1HA 1O96A 1GXSA 1IB6A 4R9SA 4TRJA 2O2GA 3UWOA 4G0QA 4PN7A 1VSUA 4CTOA 3H7AA 1VMAA 3PQ5A 2DQKA 1G4AE 3TTSA 3L43A 2J9YB 2Q49A 5FLYA 2YXEA 2AC7A 1KSFX 5D5PA 5M34A 3SEZA 1FB5A 2FPPA 5IWCA 2WB4A 3IIJA 3R5SA 3ZWCA 4WA7A 4DPLA 3NXKA 1PBNA 2R1VB 1IHOA 1X0VA 4HP8A 4BB5A 1QAMA 1NY5A 2JVJA 2NQTA 3HKDA 2QAIA 4PSDA 2EAUA 4FJ2A 4RORA 2R5WA 2DFDA 3LFUA 1XU7A 3BL6A 1AF7A 1DCTA 5FCDA 4C43A 3E3LA 3SJBA 1P4HA 2BRUA 3FVRA 3B1JA 4YRQA 1WQ1R 1Y7IA 1QQTA 2Q29A 3L1VA 2V7EA 2OBNA 2GHQA 3PD7A 1MLDA 3BB1A 4KACA 1U7WA 1AGRA 1XTTA 2EFGA 3DH0A 3F8TA 3HZOA 3PYXA 4HQ6A 4NJMA 4P7BA 4Z9AA 3T7IA 2YN2A 5ARCA 3R7AA 1XZGA 1OLOA 5CVEA 4FNOA 2GYVA 2IY7A 4IAOA 3NWBA 4OHUA 2E5FA 5HK8A 4CG1A 1H9CA 2KBFA 1IBKB 4IIVA 2CL0X 3R4VA 2J5KA 5DM1A 5SZJA 1PNRA 2RG7A 1S2MA 1Z56C 2CFCA 2QTZA 3GFVA 5LP6F 3GT7A 4KDCA 2G9VA 3I9KA 2XMQA 3JYLA 2OFWA 4X66B 2HSGA 3DM9B 3GFQA 1FMCA 1T0PA 2P6MA 2HM7A 4E4RA 3QXXA 4RZQA 3EZFA 4F3KA 2UU9B 1C1DA 3ABIA 2Y1EA 5K03A 4XVQA 4XLTA 3CVJA 4NENB 3CSUA 3ZJ4A 2PX5A 4LOHA 4YMIA 5P8WA 4J49A 3RC9A 3EN0A 3GAZA 4WGFA 3EUEA 3CLRC 1SUWA 4OHCA 2ONKA 1H6DA 2ZRFA 4NJEB 4IKOA 1WKVA 2BVNA 4GDMA 4B76A 4EWLA 5DI3A 2G70A 3FWPA 4NH0A 4A8JA 3Q1KA 1CTQA 2SCUB 3C8ZA 1BKDR 4Q03A 3D3JA 3KBBA 3CX4A 1U4NA 2C2YA 4DSTA 3NDRA 1E79D 4R9VA 2UDPA 1GFIA 1UMBA 1VSQA 2CVQA 1BEZA 3H8SA 2RGXA 3P32A 4UUOA 1X9IA 5TNXA 1KGDA 4L74A 1G21E 2PZKA 2M6LA 1XN1A 4H7DA 3OJ0A 4RA6B 1AHNA 4ADSG 4U7DA 1P2SA 1KI7A 4QTUB 4TN1A 2P6PA 3KR1A 4Q3BA 2C9MA 1UK8A 1M2WA 3CSSA 1PR0A 1FX1A 5JV5A 4DWVA 4F96A 5C35A 1JHVA 4QSHA 5BQPA 5FX2A 1E1KA 1VB5A 2BISA 2D4HA 3PS9A 4OOFA 1E60A 4JA2A 3EVFA 3CF2A 1IB0A 3CR7A 4PO8A 5PGMA 1A1VA 1NXOA 3Q40A 1BXGA 1AUQA 3OCJA 3W5JA 5E9JA 3G0GA 4MUGA 4QT0A 1UJCA 2P7IA 3ESZA 4CMCA 5L4NA 1GZUA 2JF0A 3WRYC 2OXCA 1AXEA 2P9YA 4DA4A 4PLZA 3PDHA 1XEFA 2YYZA 3HMQA 2DULA 3C5WP 2C2XA 3FNFA 5IT0A 3AY0A 2RHWA 2WWWA 1J8MF 1SIUA 1TIKA 2VTDA 2W6PA 4G85A 1NQUA 1RI4A 4IVQA 1CZUA 5HJ5A 1I10A 3EC1A 1JEEA 1IEVA 1QV7A 1UH5A 3ETLA 4LY6A 3IPRA 1HSOA 2G5TA 3C97A 1KK2A 8ABPA 4BC1A 3ICQB 3VNUA 2A6PA 2YHAA 1CETA 3GT3A 3H86A 4QLOA 3TLBA 1KJJA 4KR9A 1NLFA 1UM9A 3MTAA 3SHVA 1KORA 5CHEA 3VMFA 1E7MA 2VOJA 5A4DA 1DLJA 3TL2A 2D2VA 3NHRA 2GZHA 3HB9A 6REQA 3HU2A 3RRXA 2Q4OA 1ULHA 4JJ6A 2Z9BA 4PNHA 4LCEA 2BGTA 2FB9A 2YUIA 1REQA 3PXDA 1PV1A 1YCFA 1YR8A 3K72B 4HAIA 4EATA 1UBRS 3I4LA 4HNHA 3RIHA 2HDNB 2IEIA 2PUJA 5CM8B 5K2OA 5EJFA 3GC6A 3U7QB 3BHNA 3SBEA 3WXBA 4WJZA 4ZVMA 1QFZA 2JGMA 5JY6A 2ORVA 3O5AA 4A7PA 4R8KA 4MS3A 4FGSA 4HX2A 5AKIA 1SXGA 1QYDA 3HR8A 3HU1A 4F21A 2WJPA 1OB5A 3L5KA 3MQ4A 1TUIA 4WK4B 3PT9A 4KAXA 1JL3A 3GT4A 3OWOA 4WCFB 3VYRB 3W2TA 2O0KA 2JLUA 1T8RA 3RAJA 3O7MA 4C03A 3KPVA 4OQMA 4DLSA 4LWOA 2W0SA 4CNBA 1XF1A 3AY3A 2XZOA 2G8NA 3INRA 7MHTA 5KAMA 1WY7A 2E21A 3VJRA 4MH0R 5DK6A 2Q3DA 3R40A 1N3YA 1PN3A 1KK0A 2W8BB 4H0FA 4YMSA 5FUYA 3QVOA 2XT0A 1A9RA 1BH6A 4X3PA 4F2GA 4YRLA 2VUIB 2B5OA 3NAZA 4BV3A 2XKKA 5G3YA 1GKIA 2VI5A 4BBPA 2HGSA 2IYRA 2HKIA 2AJTA 2JGKA 5AK6A 1I2BA 3N2LA 5TJ9A 3ON5A 2XLBA 5AW0A 5GZ6A 1JG3A 1N92A 2IXEA 1J1ZA 1SKAA 1K63A 4WUVA 1IJFA 1R0LA 3C2QA 3LVFO 1VJDA 1P2FA 4P53A 2G9NA 3RUEA 1PT7A 3ZV3A 4BV8A 3DOIA 4R2LA 3A1DA 4UDOA 1T2NA 1XD9A 5J40A 6PFKA 3OECA 4U1RA 5I8WA 4L4UA 4EBFA 5IKMA 2NXWA 3RF6A 4MV3A 1UBHS 2OKGA 1YHNA 3OVMA 4QDTA 5IJ9B 3TS1A 3UJAA 4Q01A 1MFZA 1WZIA 2MYNA 3WLSA 2GZ1A 1P3DA 1JAHA 4LMBA 4YAJA 3K71B 1IQPA 2PX6A 4S04A 2ZS7A 3TQRA 4KQGA 4XX0B 4FR5A 5H5JA 3UB2A 5KSWB 2VJCA 2ZR9A 3IB3A 1FMTA 1GPDG 4DYVA 3CNBA 2ROQA 4MKZA 3ZJUA 3V1NA 2DEUA 2MHCA 2H11A 3QNUA 1Y9DA 1COZA 2XB2A 4ZT7A 2DG2A 1GLNA 2JGDB 3SZLA 5BN4A 4WD3A 4AY5A 3JCZA 1PK9A 1TKBA 5CYPA 1UKEA 1PGNA 4YCSA 3QQPA 2JI8A 3Q85A 5BNZA 2E0IA 4BNDB 4F4CA 3LDHA 5B6IA 3U17A 3LW8A 1L1QA 1L4KA 1S3GA 4HDRB 4JJ7A 5FQNA 3OQVA 3DW1X 4P83A 2BGWA 4JJZA 5FYDA 4EJ2A 1SVKA 2IPMA 2C9OA 3AIMA 1XTQA 4UC0A 3S68A 5GONA 1LB1B 3TW0A 1VHWA 3PC7A 1TK9A 2P4SA 5ABPA 1MDBA 1ZK2A 2V74B 5DTIA 4E2XA 4I5EA 3MCUA 2B1QA 4G4IA 2X9VA 5JZ9A 3NETA 2QUHA 3PHJA 3C1AA 2BHNA 2NV6A 5KYUA 5FNZA 4NP6A 3UT5A 3D8SA 2ZI3A 1XEXB 3CSDA 2VWGA 3T7JA 1SVMA 1EWTA 5CFZA 2R5FA 1LJLA 3DDHA 4XIJA 1E9RA 3RSZA 4ZVSA 1DKNA 1C8KA 1QZ3A 4ENVA 5M29A 1N2EA 2VP2A 4X6LA 5GY7A 1F7VA 1H8HA 3A3PA 5FV7A 5JD3A 3NKFA 3OCCA 3T9EA 3L77A 5F12A 5BMVF 5EIWA 4QOFA 4IIEA 2JLQA 4RHEA 3QSYA 1Y3IA 1DLIA 1CUIA 1ZA1A 1I0LA 1WBJB 3K16A 4EITA 1CUUA 2WAXA 5EHGA 1XVIA 2X3YA 2H00A 4TVOA 4BNUA 5KEIA 1ZGGA 3A9WA 1O6CA 1OFVA 2P4HX 1VPDA 1EVIA 1Z83A 2YQ4A 5DNYB 2BGKA 3EEBA 5EZ5A 3ES9A 3CLKA 5IC4A 2A86A 5KOJA 1T4BA 2COEA 4ZJUA 2XYQA 1Z0FA 3A26A 1DX6A 1VRCA 1HYGA 2XIQA 1QP8A 2ZFUA 4R8LA 1MIHA 3QUAA 3EF3A 1XVAA 3ZH2A 4B6SA 5FPYA 1OI3A 2DH6A 1DBRA 4OM7A 4Y9SA 4YEDA 4EHAA 1GNQA 1OLUA 2C59A 1DC8A 4I66A 5TMEA 5DJ5A 3WZLA 3PXUA 2HL6A 4I50F 2EYQA 3WLHA 5HVNA 2F3QA 1QO0D 1W73A 1WE2A 2B37A 4YAEA 1DCKA 2E4WA 3NIGB 3U5ZB 1L5KA 1EP2B 1WSBA 2H54A 1UADA 1P44A 2PKEA 3G0CA 4W1RA 1X1CA 3LPCA 4UE3S 2Y0BA 4B3DA 4B2LA 2FR8A 4FW9A 4RU1A 2WT4A 4K9DA 4MR9A 4RF5A 3U48A 1TM5E 4MPRA 2O8FB 4LHEA 1PQPA 3FX2A 2PKWA 3SC6A 3QUQA 3WMXA 3NBXX 5IH3A 1VLHA 4ZI2A 4EI2A 4DCJA 4I8XA 4O2BA 2D3WA 3TL6A 4D3DA 2CLSA 2BFBA 4RK6A 4X1IB 2ZJYA 2WU4A 3CO0S 2PEYA 3DPSA 1BQ4A 2B78A 3IQHX 1V71A 2EP5A 1BHQ1 3KTDA 4UTRA 1KZ9A 2DPGA 5HFAA 1UPUA 3KXKA 4K6FA 4C9BA 4PG5A 4WINA 2O2DA 1IWPB 3BDIA 1DFHA 3KZNA 4ARZA 4BQPA 1JPVA 4C22A 1JGTA 2QTCA 3V7WA 4LJ6A 4Z4CA 5TX7A 1WXQA 1KXZA 2W37A 4UU8A 1VDZA 3KKKA 4CKZA 3NGXA 2OG1A 4LRQA 3ZI4A 3GRCA 2RIPA 4MNTA 1ZONA 2PNFA 1UKAA 3W34A 1EP9A 1NF3A 1XDZA 4EPVA 5D51S 1W34A 1QYXA 1QF9A 1ORHA 1Z5NA 3V8EA 1NDUA 3OE1A 3QI7A 2DU8A 1FVFA 2QRNA 4WY8A 4A6PA 1JG7A 4HY3A 4YO8A 3U3JA 4WZAB 621PA 2WSMA 4M8SA 5A6SB 1JB1A 1XZAA 4FFDA 4FE7A 4UUAA 3TQHA 1ZMOA 1E1QD 2I2WA 4UAGA 5LC1A 3P0JA 4NOKA 4NXNB 4FXPA 3DF7A 4F85A 2QE6A 1D6JA 1MG0A 2MYUA 3M33A 4TSRA 1U2ZA 3GK3A 4GEGA 5HM8A 4P98A 4WKBA 4I4NA 1C9YA 1PHPA 4DCNA 1GL9B 1EA7A 2PMWB 1A96A 3I34X 2W00A 2PZEA 1YQDA 3E8XA 2POCA 2WOOA 4N39A 4H7EA 5DMXA 5IAGA 4IJKA 4CN9A 3F67A 5CB4A 2R9VA 1JTFA 4CIYA 1Q1BA 4E2YA 1YS7A 2C94A 3GFFA 3PEUA 2WDZA 4UULA 1GADO 2CHVA 4HJXA 4CM8B 1DKPA 3NHJA 2YS6A 4OV6B 3HB5X 4AYXA 2ATXA 2IHUA 1W9MA 2VP4A 4TLDA 2NO5A 4RJTA 4MQFB 5IJ9A 3DM5A 4HAXA 1CRPA 2ONCA 2P2NA 2GK6A 3KQLA 4HADA 5AVKA 2DAPA 1PDWA 4WA8A 3QBJA 4RIGA 1Z47A 2RHLA 5B6JA 2A1IA 2C99A 2QPAA 4L15A 2ZUUA 4URYR 1BN7A 4OMUA 4M0MA 3IO5A 4QTXA 5IVPA 2QMYA 2W2LD 3WGJA 3E70C 3T5AA 1ZWLA 4HWKA 4ZICA 2NO6A 5BW5A 1UZAA 3PWZA 4WV3A 2QV0A 4PCAA 5DNEA 4QPZA 4NAVA 3TAHA 4TOIA 1KAEA 1KJ9A 3PITA 4RYLA 4BP1A 2X8LA 9LDTA 1R0ZA 2TECE 5EZYA 5I4BA 3RYCA 4PGFA 1IM8A 2HTEA 3G2PA 4W5QA 1XNQB 1ITZA 1YULA 4A0FA 4EA6A 1NJFA 1IQRA 3UK1A 2ZIGA 2N1BA 4I50B 1B26A 3CB2A 1E63A 3PUJA 1ZN9A 1P29A 1SCNE 2ZT7A 3QUBA 3ZQKA 2D1SA 1QK3A 3SC2A 1WY5A 3OCYA 1K6JA 1KH1A 4F56A 2BTOA 1JV2B 2GERA 1TCBA 1E5DA 3RVDA 1XMVA 4EKIA 2X14A 3O4FA 1OI2A 4M99A 4WN9A 2VPQA 5KNCH 1ODTC 4QHYA 1HPLA 3C3DA 3FR7A 1L1FA 1MA3A 3AWDA 3GL9A 5BN3A 1KSHA 3IBTA 1VSVA 2C8KA 4ZGWA 2VPYA 1PL0A 2DUWA 5KYXB 2QROA 4IJMA 3VNBA 3QX3A 3U9SA 3HYNA 3L8MA 3K32A 2H18A 1UDBA 5FT9A 4DN6A 3JY6A 4RL6A 1XZNA 4B3HA 4EG0A 4X95A 1T3GA 3Q7EA 1JQ3A 1R4NA 2PDAA 2RCNA 1MA0A 5CW1A 2CT8A 3QBTA 3VHLB 2GVZC 3IIIA 4NWIA 1AK1A 4NRDA 2JGEA 1PJTA 2BDTA 1S0UA 1H2BA 2CMHA 2NO0A 4JB8A 3U3RA 3HRKA 5F1YA 1QC5B 5CFRA 5HF8A 1JKXA 1SXJC 3DEHA 3EZ9A 1RBYA 3SYMA 4QUKA 5E7MA 3DA8A 4ZVTA 1VL1A 4XFDA 4HTFB 4YCBA 2OK8A 1EPUA 4LHYA 3R9XA 2DE0X 4B43A 1GZHB 3A6HA 4Z4EA 3O7WA 5EHNA 1G0NA 3RODA 3NS7A 4DC0A 1I7PA 4O33A 3FI9A 5BSFA 3BJEA 3P0HA 1PR5A 4JH0A 4ESOA 1PUXA 2IU3A 4H27A 1K8RA 1NULA 4E30A 5IXSA 1FZTA 4XWTA 1ZH8A 4D0NA 1CEEA 1EI9A 3GD7A 4X8MA 1ORDA 3E3AA 2A78A 2YMQA 4E4YA 1ICEA 5JMPA 3LHSA 4IFEA 1ZITA 1H85A 4AZSA 2MINA 3NBQA 1A69A 2QSYA 3ML1A 4RS3A 3R3UA 2AI1A 4RABA 4EABA 4EG6A 4BFCA 4K6HA 1S8OA 1U2EA 4BVKA 5CA1A 3NP9A 2BHRA 1A2OA 5D6NA 1T8TA 3G02A 3HFSA 3DTVD 3GCXA 3QVWA 4JWKA 1LSJA 4MUEA 3M4XA 1JJIA 4XVRA 5E6RA 4ZXFA 3I2GA 4BQIA 1SG9A 1P0FA 1DARA 4MA0A 4UQOA 8ADHA 3STXA 2CXRA 3ZVNA 4MIKA 4EJSB 2YRFA 1DBPA 5AW7A 3U4QB 1C1XA 4KJZA 1ZXBA 2ABWA 3HNOA 4EPRA 1HE2A 2JGIA 5TIIA 2GARA 3O93A 4DFDA 3PDIA 3JRXA 5J5CA 2IDKA 3ORRA 4BN0A 4CTJA 1RZRD 4L16A 3OFKA 4PZLA 1ACJA 2WKQA 3FFAA 4I4LA 2PYZA 2HIAA 4DAEA 4D0SA 5I9IA 2ZSUA 3NQ41 1Q3TA 1JQDA 1QKJA 1R50A 2ZRMA 3K2QA 3L7AA 4MUBA 4MVXA 3TIXB 3KVYA 2AN5A 4RAOA 1L7OA 5FL7A 4BO6A 1XZCA 2ZI5A 2X5JO 3HYLA 3ZX4A 4D3FA 4R2MA 1W59A 1NVFA 1W48A 1FXWA 4QOHA 2HTFA 2HWXA 1D9ZA 4JLPA 1G8JA 3MQFA 2IDJA 3U3XA 1ZIYA 2Q5EA 1KI2A 1JPUA 1QSGA 2BMJA 3HCFA 4L5JA 1Y1PA 3VTFA 1Y9EA 2O2JA 4CM9A 3TECE 5CW2A 1RIFA 5DRTA 2PO5A 1GPBA 1XL1A 3A70A 4JC5A 4MW5A 2RGRA 2YINC 4KIWA 2ATIA 3EOBI 2VK4A 3ZY6A 5B3LA 2EVWX 1GQSA 3EPPA 4N9QA 5D7BA 4L22A 1EAYA 1C1XB 1C8BA 1K92A 4N7MA 4V0KA 5J4YA 4TZKA 2GYWA 1P0MA 2RKWA 1PSWA 3DVQX 4KYTA 1CUDA 4RKEA 3ZOZA 3UGKA 3T4EA 5EMKA 2DMRA 3FCYA 1E2NA 1E79A 4OLBA 2YZMA 2GK4A 3ILVA 3IR6A 2IOYA 2O2EA 4GYWA 4LZOA 4MIYA 3ZHSA 5KJFA 5LIPA 1QU3A 4URUR 1FP6A 5C5IA 1QGOA 3CCCA 3IB6A 3ICCA 4G2TA 1RP1A 5GGYA 1C1YA 1JTEA 3FPBA 4JSRA 1L4LA 5FP0A 5MGBA 4HL6A 1PTJC 1W76A 2GA9A 1N3LA 3N07A 4ZV9A 3D6MA 3EGDB 3HXMA 2VJQA 3D9QX 4O5AA 4ZEXA 4DABA 3PEYA 1MPXA 1UBMS 1CR2A 4XB1A 2V7UA 4C01A 4IIHA 4YRIA 2J0VA 2OHVA 1O3YA 2IVFA 5LQMA 2ET6A 1P7WA 2E89A 4UFNA 2YMPA 4BNLA 4EG4A 4Y67A 4CF7A 4UPDA 2J5BA 4B5KA 2F3RA 1I36A 2Q3LA 3HB1A 3M3HA 1JXAA 1NNSA 2F17A 4YHHB 3T8YA 1SHJA 3BIOA 3JAKB 1X80A 4GD3Q 4ZARA 1VJCA 5KYGA 5DP2A 1WW2A 1QAOA 1SRRA 3VNRA 2QI9F 3KQQA 3P45A 5ECWA 3CJTA 3GLVA 2PWPA 3MGBA 2J32A 2AX4A 2GHTA 1EFRA 2CDCA 3IAS1 3F4KA 1RWKA 2WJJA 4H59A 2VNHA 4R4JA 2WD9A 3Q0IA 4D9EA 4JI8B 5KCZA 5DHPA 2GPTA 4GZ6A 1D1QA 3LXUX 4BU0A 2H7CA 3AI7A 3IAM6 5HE9A 3SF8A 2WTUA 4PCLA 5CB4F 3MWDA 1DEOA 1QYRA 1P0PA 2R2GA 1I6KA 3B1XA 4R2XA 1TQ6A 2AR0A 3A1WA 5HX7A 1PJ4A 1Y5RA 5AM5A 4W7HA 2CLCX 3RC3A 3LXRA 1E69A 1XXHA 1UP7A 2BJHA 2LWIA 1RHKA 2ZRQA 3IDZA 4RS4A 4V0QA 5DGTA 3WQRA 4AZ3B 3NTXA 1TF5A 3AEUA 4OQPA 2ADFA 5JU6A 3LZCA 5BR1A 5AH0A 1HT0A 3WO0A 1P60A 1W8DA 1W0JD 5BV1A 5KKNB 3RSLA 4FGLA 3I83A 3IAFA 2AKAB 3OMWA 4OUDB 1W4AA 1A9YA 2JFOA 1W4RA 4OHRA 2DHDA 5E0KB 4CLRB 4OGKA 4CODB 2FNAA 1Y9AA 2QWXA 3AW9A 2MU1A 4L4RA 1SK8A 3GJ5A 2VAMA 1WPGA 4I1RA 5KU7A 4EY4A 1A97A 4DJ5X 2OP1A 2OCPA 2UKDA 3RHFA 4Q7EA 1WB4A 3GZNB 3EIOA 1GUDA 3QWFA 4G9GA 5LP6B 1FS5A 1NM5C 1NOKA 3O1IC 3T1NA 3UOAB 4E14A 2P9HA 2Q2VA 3A6KA 1FRFS 3HNRA 3OFVA 3DVAB 4UUBA 3T7SA 1TMOA 1NMXA 3KYDB 1XDSA 3O3NB 1W5FA 4TZTA 1PG2A 1IPHA 5IKEA 2C4NA 1UAAA 3Q7TA 2A84A 1TF2A 2C3PA 3OCWA 4G0OA 4B87A 4RAQA 2OHJA 5G0VA 2DQYA 1K5HA 1S9HA 1Q0SA 3FWHA 2FZLA 3BH0A 1U7DA 1UMCA 2XUJA 3C45A 3KVNA 5BWOA 4RHYA 1W581 1BGVA 3S28A 3C6ZA 1JTVA 3WGHA 3WKEA 1GHTA 3M1AA 1QG2A 4KN9S 3IT2A 2Z9CA 1Q1GA 3CMCO 2FPIA 3NHFA 4DDHA 4FWIB 5FWYA 3HJNA 3V4FA 4EB0A 2QMZA 5KZMB 2QM0A 4I5GA 4H17A 4EEXA 3AVPA 1YZGA 4KXFB 3CJRA 1FBTA 2ZJAA 1B1CA 1J9GA 2R4UA 3OICA 3R3VA 1EDZA 4TS9A 4Y2JA 5F35A 3D3EA 3FH0A 3IJ5A 5K8TA 4N3GA 4F92B 1Z4OA 1ADBA 1Q15A 2ZJFA 5DCUA 4XI9A 5DSXA 3RDPA 3VHQA 4LOLA 4Y2QA 4CEHB 3U4MA 2UZ4A 3TTVA 4ZPXA 4RFSA 1RRCA 4EY3A 4TSFD 1TCAA 2QJOA 3PKZA 5KQPA 3AUYA 2FW6A 3OT4A 2HFJA 2WI8A 3PRJA 2B3TA 1QK4A 2C83A 4V0MA 3WADA 5LBTA 1DAFA 3UUFA 2PUAA 3FHLA 5LYJF 2H0AA 1K0UA 2XGSA 3PJGA 4ZTZB 3OQJA 3TH5A 3U3ZA 5IFKA 5AYVA 2XZLA 2X0FA 5FDFA 5DYGA 4WXMA 2HIGA 2I91A 3EB9A 2BM9A 4O0MA 3SQXA 1BVRA 4OD0A 5G0SA 2BE9A 1EJ2A 4OFBA 1Q50A 4PBTA 2IV7A 2OXIA 3UUWA 3HP4A 4X9XA 1LEHA 1CFZA 1CIPA 1P3JA 3I73A 4OTZA 4OXIA 2OFPA 3LLSA 4YFYA 5GP1A 2ZWIA 5IAJA 1YFJA 3GWZA 3CT6A 4D0RA 3EQ9A 2DT5A 5K4GA 3KYCB 3VYUB 3CJQA 2J8ZA 1LTHR 2NZ8A 5KYYB 2IS4A 5JATA 1TCUA 4C76A 1GGEA 3QVLA 1TJPB 5KVVA 3DVLA 4FNMA 5FLEX 3IHLA 2SKEA 1X2EA 4HQKA 2AB0A 2RFLA 3D4BA 4GKBA 2ZJZA 3LUCA 1JSZA 2L0XA 4EG1A 2RI1A 3EIFA 3HGTA 3P2OA 4RJJA 3IMCA 1A9OA 3OPYI 4WERA 1VECA 3M3PA 4GLLA 1D4ZA 3CLUD 4ML3A 3BSWA 3NI2A 4NH4A 2Q6TA 5IZCC 3GP8A 4BAGA 1Z38A 1WHTA 1XTPA 5FB3A 5KNDD 3MTEA 4RPHA 3P0FA 5K9ZA 3P94A 1AO3A 1RZRA 3KE9A 1A82A 3QMVA 3GGCA 4YJ3A 4RD6A 1XJ5A 1FNCA 1F12A 1PK7A 1GUYA 2CL7X 2WPNA 3D4OA 1A1SA 1LQ2A 4WADA 4D8XA 1QJ4A 2K4MA 2F67A 3S27A 1Y5NA 5BQFA 3VZQA 5IAOA 3T54A 2RB5A 2DFKB 3R3JA 4JHLA 1AHPA 2ERXA 1PZFA 3HFGA 3VKGA 4X7PA 1H2XA 4RMIA 5ALMA 1KA9H 1Q7RA 4P4LA 5FFMA 5LYJA 2LCQA 4DMKA 2QXTA 4F5YA 3H6HA 2FH5B 4V0LA 5CPBA 1LLDA 1CUBA 5JMWA 1V3QE 3RVOA 1JKFA 5KOJB 4EYOA 1C2TA 1VL6A 4KXLA 3UATA 2C97A 5HQJA 3DKVA 3ZQ4A 3E9QA 4UM9B 5BNWA 2F43A 5KU1A 3PJEA 3PXEA 3MJVA 3I45A 4RWEA 2CVZA 4OI1A 2XZPA 1T9BA 4N40A 1DWPA 3KJHA 2XD9A 4DSNA 2D3TA 3E7DA 3JTEA 3N58A 4BX9A 3Q8KA 2Q27A 5U4XA 1ORWA 4ZOLA 2B99A 4UBIA 2C2BA 3G9QA 4I3HA 2XAUA 3QX9A 2JDIA 3H8WA 1PUJA 2LZ0A 1NVVQ 3QEJA 4BECA 5J4HA 1VBKA 3CN9A 1WXWA 3FFXA 3FYUC 4KGDA 2H9IA 1NBIA 2I6TA 3L6CA 3OUTA 3UOWA 2FX2A 2I4TA 3FPEA 3JD4A 4R71A 5IANA 1N34B 4AZ0B 1KL7A 3FCSB 3D2LA 4MW6A 4BV9A 1GIAA 1U0EA 1S3IA 4DQXA 3ADBA 3KTAA 3DE4X 5D84A 5JVDB 2I99A 3MFQA 5LN1A 5DT2A 5CCBA 4YP0A 3ME5A 1J1IA 3Q6NA 5DE3A 2AN4A 4GT1A 4QXMA 4MICA 4PR3A 3RFCA 1FNBA 1CS0B 1GRNA 3PCRB 3TQCA 3DB2A 4KQHA 1NXSA 4TKVB 4NARA 1C9KA 1ZK0A 3KXPA 4U8GA 3GELA 3E5MA 3T35A 1S01A 3HB4X 2Q1SA 4LOKA 2QAGC 4QZVA 3EDMA 2SNIE 3OJFA 4P4UA 2XNSA 2UAGA 3GN1A 4IHJF 4EF5A 2RGUA 5F1OA 1OBFO 5KYVA 2HO5A 4FR2A 4AN4A 4EVRA 1EG2A 1ZM3A 3BZWA 3WB2A 1N6NA 3NIBA 4BKRA 4RLFA 5JZMA 3J7TA 4L50A 2VAXA 1WAMA 1LNQA 2ZIWB 3F49S 1G8MA 3VU0A 4ZIRB 2GPAA 2AYYA 5AKEA 3L0IB 5DTRA 5KYWA 1CQZA 5HCIA 1CP3A 1U1FA 1N8TA 3LVRE 4POOA 2BEUB 1PNOA 4F72A 3WYDA 1T34A 1V11B 3IVXA 1AC5A 3O26A 4DIOA 3SHQA 4QE3A 4CHGA 2W6JA 3FRIA 3HBFA 2H1CA 2FN3A 3NRBA 4KRXA 3FIJA 3DV2A 1GSOA 1DQYA 4N5NA 1HXHA 2GEJA 3URKA 3X2EA 1R8JA 1Y34E 2PZFA 1QH8B 1N2CB 3FJYA 4IWNA 1KDRA 3CCFA 4INAA 5C81A 2CWWA 5JAIA 1QGUB 4XD7A 4BVGA 4RIIA 1QHIA 2IHTA 4HOYA 1SXJE 2WE8A 4ES6A 3TTUA 3ZW8A 2BSQA 4WIAA 1DXQA 4N3NA 4B6JA 2VCEA 1G6OA 1D2HA 1ZSNA 3R1IA 3S2IA 1U0NA 3R8CA 2ZRKA 1D09A 2ACKA 3M83A 3N76A 3PUYA 4J16C 4L8FA 3VZDA 4AXXA 4F60A 1HTTA 2YVQA 3AJEA 4RZUA 3DHWC 5A5FA 3IUBA 4M0EA 3PSAA 5ES3A 1H8EA 3R9KA 2FVYA 3K5PA 2C7VA 1YB2A 2V6GA 1Y8RA 2ORIA 4YMTA 3T4XA 5U1PA 5HZMA 3PPVA 3GRYA 1F8GA 1N6KA 4Q3KA 4M9CA 5JFOA 1X7XA 3S81A 1UWKA 3ZEIA 4DLXA 3ISJA 2DTEA 2ECOA 5FO0A 2JIZA 5CT8A 2CVPA 3AM4A 4MV8A 3SF0A 1W8IA 3A1UA 3ABQB 4UBLA 3TBKA 2HI0A 2L2QA 4NESA 2XE7A 3ZHTA 5FPTA 2QUBA 5GINE 1NN3A 3H5NA 5AHOA 1X1QA 2G08A 4EG7A 4Z51A 5GIOE 2OD9A 3CPHA 1KS2A 3HDJA 1DWQA 1U4OA 2JFVA 1ZG3A 4OUDA 2WWTA 4KHPB 2OCBA 4MIEA 1ZEJA 1L5MA 2P5TB 5T6BA 1OA1A 1JYEA 2QXUA 3DUWA 2OSVA 1H6CA 5TARA 2CKDA 3RTEA 3V1YA 1XFDA 1O96B 1E2UA 2IDMA 3I52A 2H1SA 2VZLA 4KZPA 2IBMA 5ALIA 1XZ8A 4JROA 4PWYA 2OYRA 3TUJC 4RXMA 2I9KA 1MAVA 4MEBA 1ZR2A 5JXIA 4GVPA 5AI4A 5FUMA 1AN0A 3WIDA 2WY2D 5J1SB 5HFJA 3N28A 1NVMB 4KH1A 3QPUA 4BFSA 4US2R 1G8KA 3PWTA 5LWQA 3ZCVA 4KWIA 1NUTA 4UQLA 2X0EA 5FH9A 1WXHA 3FROA 3IVMA 4IDPA 4FDLA 1OD6A 3AWIA 1YBHA 3KR0A 2QL6A 2VHCA 4DANA 3IVRA 2EL7A 1Y4DE 3B78A 1MAAA 3ROFA 4EY7A 1A72A 5F7XA 1HNXB 4TYWA 2ZAMA 1RM0A 3I04A 5IJ0A 3QZUA 2GTIA 4CUJA 2H4XA 3THXB 1SBZA 4B46A 3TSYA 3AI3A 3NRCA 4R9UC 4WVFA 5KNCA 1X92A 2ZG6A 2R47A 2WHRA 1JAIA 3RSQA 4C1BA 1MF7A 4Z49A 3HVIA 1UT8A 3CX8A 3V2IA 4I9UA 5KKCA 5FBZA 2AUNA 4KKVA 1CJBA 3NHZA 2RH8A 3H0CA 3X3HA 1KAHA 2X0JA 2B61A 4QQ8A 5FLKA 1ESEA 4F86A 2JC3A 1XDBA 2JI6A 3OLQA 3EZLA 1U7TA 2Z3WA 4QFMA 2A3NA 2H5LA 3K0HA 3UCXA 5JSZA 3ZLVA 1FYXA 2V1UA 3BFVA 4RKRA 3VR5A 1KP2A 4GM4A 1AM4D 2XOKA 2H2DA 3O1HB 4YYZA 1BQ3A 1E92A 4KL8S 5HM6A 2ZIFA 3IUSA 1C9JA 1DO8A 4PLTA 2X1MA 5AKYA 4JBXA 2AWOA 1RPJA 3CPJB 4K86A 3Q41A 4RHUA 1MO3A 1GPJA 1L3CA 4N6NA 1JZQA 4Y6LA 5DFAA 5BQXA 2NTNA 3VR4A 1UBEA 3CVOA 3SR3A 4XJSA 1KI6A 5AXAA 5DM0A 2JKYA 3M6AA 2WTBA 4ZTUB 4BEVA 1G20A 4AJNA 2QPTA 1I1NA 2CSXA 1RCFA 2X9NA 3IHWA 4LDAA 4BLVA 3HJAA 2XEDA 3JYQA 4V38A 4IDEA 5FAKA 2ZRIA 3IDAA 1JHYA 3TDKA 1Y3AA 1EE2A 1BA2A 1B3RA 1YL6A 4GGPA 3KEFA 1GQ2A 2PE5A 3Q87B 1ADGA 3WYGA 1MB2A 4PQYA 1JDBC 1KDYA 4CQLA 1YASA 3AETA 1E9SA 2D1FA 3N5CA 2VRNA 1Z4KA 3QTBA 1K9SA 1IVNA 2ZDQA 3A6JA 1E3TA 2OMEA 4GPD1 5AJWA 5JRDS 4GUDA 4AJIA 2VDJA 2P3QA 4BP8A 4CN8A 3AZQA 3CE9A 2GPSA 3D5EA 3W3AA 4HLNA 2XCRB 3OE7D 1BWQA 3PSHA 3MTIA 2NU6B 5BV7A 1QWSA 4FZ5A 4BX8A 4GOMD 2M9MA 4BZXA 1QYVA 2V03A 5TGDA 2FPWA 1JEQB 1YO6A 2I7VA 3RARA 1XDDA 2J3JA 1XC7A 4JDUA 3RYFA 1P9OA 2A58A 1BCSA 3FHCB 1I0ZA 2OD7A 2V0NA 1WHTB 2XDQA 3EISA 3FWYA 3GA7A 5SY4A 4X62B 3AR4A 3VPGA 2QYTA 4PYQA 3HZZA 1XT6A 5JCZA 4DV2B 4YJ3B 4YGYA 3K09A 1YU6A 4IF4A 4ZVNA 4DY6A 3V1MA 2XMDA 1FRNA 2AW5A 1EVLA 1R5NA 3BBLA 3PNMA 3BMCB 1K1EA 3EXHB 1N0VC 1VXRA 3CRMA 3GRVA 5JQGF 1GPH1 5JS2A 3WVNA 4YDSA 2J5RA 3KB2A 5FUBA 5JJKA 3AR5A 4RDHA 2V65A 4O4LF 2HWKA 3UWKA 4IH1A 3JASB 3QEKA 1XJ0A 5B4VA 1SCAA 3ZWYA 2P41A 2QLMA 3HXTA 5CK5A 3WIUA 1YE3A 4PS0A 1XE3A 4RVFA 4TTIA 3SIPA 4YA6A 2YZ7A 2AQHA 3T1OA 1Y8CA 1B3BA 4MYTA 4DDKA 3TX2A 1QBGA 1US8A 3UGQA 1O58A 3IVCA 1Q92A 2GJAA 2FFQA 1S3FA 1M6HA 1RKXA 1EM6A 4LJ9A 4H3HB 3LCJA 3K6SB 4UHEA 3T52A 1E5TA 4CLOB 5I4KA 3NHMA 1KEWA 2GFIA 3AV3A 1MIOA 4R84A 3TTTA 4M89A 3SXUA 3SX2A 4JITA 3KAJA 2BBTA 4ND6A 4G8CA 4D1YA 1PVVA 5GADl 3BD7A 2I3DA 4RA9B 3P4UA 2WP0A 1Z8FA 1ZQ9A 2BZGA 3DXYA 3L4EA 5DXAA 1U80A 5CHYA 4ZD6A 3I9LA 2OV3A 2B9VA 3K09C 3NWJA 1APBA 4GLJA 3WK5A 1XMQB 4PFKA 3BFKA 5K01A 3VV3A 3BM5A 4OIMA 1ZSYA 1W1WA 3QOWA 4DRYA 2KJQA 1IK4A 1QHSA 5EMNA 4ZZIA 4LK3A 4O4JB 3LNTA 4K1XA 5BW8A 3IP5A 1NWHA 2ZTMA 1QG6A 1QB8A 4FMBB 1YZLA 3A6EA 3HN2A 2OHGA 4N6OA 2GRJA 1ZI8A 2P3SA 1QAQA 3OIUA 3UHFA 4B09A 3EEFA 4MJ7A 2X4GA 1J49A 1F1JA 2HK8A 1SOUA 2RGNA 3DHEA 3I8XA 3PNKA 4GPZA 4J2OA 3TYXA 2Q1YA 2FLKA 1SD5A 3MGAA 3MWDB 4RZIA 4BATA 3H11B 4Q4AB 4RPCA 1V7ZA 4N3BA 1EJ0A 1XKXA 5E9AA 3WJ7A 5KHAA 1E2FA 1Q0PA 1IWBB 4FS8A 4MW9A 3SHTA 2R60A 3WHKA 2R8XA 5ALFA 1K27A 3EDCA 1KZ6A 4C29A 3HO6A 3LQKA 5LQAA 2WMNB 1U5AA 1ZJYA 1TRKA 2BBSA 3JVDA 5JYBA 4PC6A 1COWD 1OFGA 2HA5A 2ZEJA 3AO0B 1GZVA 2Q5IA 3GYGA 4EK9A 1YHZA 3ZE2B 1J21A 4ZI3A 2FZ4A 2A1TR 5TMPA 2XBLA 1R8YA 2HXYA 1KO5A 3LYHA 3Q0EA 4KLNA 3W8RA 4B44A 5ALVA 3ZZ1A 4FS3A 2PSDA 2OV6A 4FDTA 4MVJF 3OPYA 3PKJA 2J1LA 3JSAA 1NTOA 3NALA 4D81A 1CHDA 2VF2A 2ZAIA 1N5JA 1KMIY 4K9KA 4F2WA 5GTDA 3NBFA 4G5XA 1O08A 1MO2A 1RLMA 3R0IA 4Y2VA 2JLZA 2YNMC 4Z0NA 1R2QA 4E11A 2WNHA 1YIDA 4I6JA 4UCQA 4X0EA 3WLMA 3ZJYA 3ZIUA 5FEUA 3A31A 1EM8A 2LTAA 2PH7A 4WBSA 1DQRA 1E2PA 2PGIA 6NULA 1RKQA 4C20A 4CMEA 4JEIA 1Z5WA 3QIAA 1QO0A 1WPRA 2FPPB 1UDAA 4TVKA 5CEFA 2OCGA 3MJRA 2EKDA 1M2VB 4D92A 4YJDA 1NQAO 1U3WA 2W2XA 3GJ6A 4FCVA 1ZN2A 4MYCA 1HX7A 3R5JA 4D4MA 2FPIB 2F8MA 2ZSFA 3FOWA 3MN1A 5FBWB 5FEMA 3T1VA 4AG5A 5E1DA 5KVQA 4LYDA 1Z4MA 1XR3A 1GCGA 6ABPA 3B9RA 3H1BA 4I3GA 1M2HA 1L6RA 3RJ9A 2IYQA 4E15A 5EHZA 2N42A 2FMHA 4LHSA 3WNCA 3M5DA 1VI2A 4CQLB 5EJ8A 1T6BY 4LVOA 1D07A 1NRIA 2V54A 1T6ZA 4IIJB 4OQXA 4OXQA 5DHRA 1M6VB 3FM9A 4LV6A 4B0PA 5LBUA 1GNPA 2RHOA 2NTEA 4LN1A 4QUHA 1OJLA 2IYEA 4W7SA 3VKUA 1MJNA 4UBJA 2OO5C 1UBSB 3OTQA 1SBNE 1OPXA 4S35A 2BFDA 4G37A 2I87A 4RJLA 2P1DA 4GMHA 3M49A 4H7PA 4UNPA 1D2GA 4AMVA 4FTWA 4AT1A 5H68A 4ALNA 2HK7A 3M5CA 3OEHA 5THKA 3PXAA 4JASB 5F7OA 4TSFA 3HFJA 3UJDA 4AUMA 1PEDA 2UZ1A 2XZDA 2BSAA 5EZYF 5KO2A 2J9GA 3FAZA 4LDQA 1D1SA 1ZUWA 1N5IA 3QHPA 2AA3A 2PT5A 4A8JB 2CLFB 3T3MB 3NV7A 2HK6A 3R5FA 3OIFA 2D7DA 1D4FA 1Z15A 3BMXA 2BIFA 2XA2A 2EATA 4QPCA 1EE9A 4QSMA 2B8EA 3WNVA 1Z2PX 4JJIA 2HRCA 2X1LA 3PPIA 3HJUA 3QHAA 4ND1A 3BCUA 1MAUA 2NSDA 1ISJA 4IR7A 4KIUA 5JSZB 3PK0A 5IM4A 3AT1A 4CCYA 3FBWA 3FNQA 5E1BA 1YDMA 1OBVA 2A7XA 1BKSB 4WFIA 3T3GA 1SU8A 3VGJA 3W7AA 1FTWA 1IY9A 1ODJA 3EZXA 3LL4A 1NBWB 4GG1A 5F2NA 1ABEA 2O0JA 3AP1A 4HWRA 1I7LA 1UEXC 2Y1CA 4MPDA 3L6BA 4BBZA 1N7HA 1GPYA 2NO7A 4NEQA 4ICIA 4JXJA 1V1MA 2NSHA 3BE8A 5T41A 2Q0XA 1VLVA 5ISMA 3KZXA 4E5UA 4NOMA 1RC8A 1OTYA 3FLAA 3TOCA 4P7GA 1QONA 1ZX1A 5DCWA 4EI9A 3FB1A 1WB6A 4MVJG 2WC1A 1RAIA 2NU9A 1SY7A 4I4IA 5BOSB 2F9LA 4E12A 3WG9A 2V0GA 3QLTA 3UTCA 4UTVA 2VNJA 5HJ2A 2FG5A 2QN1A 4C4PA 4BQNA 1FVXA 1KO7A 3Q98A 1E2LA 1IN5A 4MDHA 4V2UA 5KREA 5C52B 4OUKX 4E1BA 4L85A 1FYWA 1H9AA 1P31A 1GRQA 3I9FA 3PFKA 4E08A 2CZCA 2F1HA 5CITA 2AFVA 5IRCD 3T94A 1EBBA 1SH7A 4MW1A 1FDIA 1B4DA 1S96A 2X8BA 2CV0A 1T5LA 3SQOA 3SKXA 4BO0A 3U4HA 1QE0A 5IDWA 2JIPA 1AUVA 4Q1VA 4I1OA 3ZHCA 5AXBA 4DVGA 3E9NA 4NQZA 3SBDA 3WLEA 3A4NA 2JKVA 1P0CA 4BMVA 1Y98A 3GNQA 4C6TB 4DMCA 1PWXA 1VKOA 1KBZA 4IOMA 4F9EA 5C5EA 2UVPB 3LVQE 3VU8A 2II6A 1RPTA 4IQGA 4L5BA 4OQLA 4WLNA 4DE5A 3EA0A 4EGSA 3QXJA 1W2HA 1G6HA 4HYTA 4NAUA 4Q3EA 1FC0A 3GDOA 5FTWA 1I1OA 3LPMA 4AJ9A 4YQEA 2CCGA 4WY5A 1VP9A 3NDJA 1PDOA 1GNSA 3DXZA 5G3ZA 3BREA 1RYHA 1W88A 4GICA 3I39X 4MQFA 3ZIAA 4BZQA 5JI2E 2QL9A 4V3CA 1GXSB 3FLEA 2REBA 3C3XA 2G0TA 3ZTYA 4D9MA 3IH5A 3PIDA 1P1IA 4DRZA 4GOXA 3CONA 4U7FA 2O2CA 1Z16A 4ZT2A 5MFZA 1M2JA 1WSWA 3FYHA 1N32B 2Y6UA 1ABFA 2Z4SA 3G3EA 1BTOA 521PA 2VYFA 2ZKLA 3B12A 1J9ZA 3GBSA 2YKGA 1LUAA 3UJ8A 2FUG1 2CYCA 2NZ2A 4C4XA 3BEDA 2EJTA 2Y66A 3E18A 1JDNA 1RRPA 2EBHX 2MMGA 3CZ5A 4KPUA 4ZO9A 5AUNB 1AB5A 3PFGA 3N8KA 1I7QB 1YZUA 3W0LB 3VM6A 3A27A 4KV7A 1BX3A 3RS7A 4MWBA 2PAAA 3RT9A 4LXIA 4R1SA 3T5CA 2WWVD 2PL9A 1T9GS 4GL4A 3N0VA 3R6GA 5CT9A 4ER7A 1HFJA 1ZUIA 3B82A 1NLUA 1IHYA 2AFIB 2EEZA 3P9ZA 4N7JA 3WRXA 2AQIA 1ISMA 1HG0A 4YRDA 1LDYA 2R48A 3OF2A 2D0DA 4KHZA 4X61A 3HK2A 3GEPA 1U6IA 3IP9A 4U2EA 2RAVA 2PQMA 2PAFA 3LQRA 3OPMA 3OKCA 2MSWA 2V9CA 3D6NB 4X97A 5A4FS 1JQBA 1ODFA 3WGTA 1L2TA 4RY2A 2NW6A 4U7PB 3THWA 3J7AC 2VCHA 2A0WA 3F5SA 3D2AA 1IWOA 1SBIA 4ZJYA 2BMEA 4DOMA 2X7JA 1T0IA 3P9YA 5FWNA 3QP9A 4F9TA 2COKA 2H3HA 3RVJA 1M5RA 3DTTA 1GZ7A 1RPZA 2AXQA 3QWHA 5JYCA 1E2EA 1L1EA 1DU4A 2A8YA 2XBUA 2J09A 2IP1A 2OZVA 1K2WA 3KLBA 5ILGA 2AJBA 1BO6A 2XB8A 4R16A 4R54A 4EZIA 4F1JA 3E7WA 4EDHA 7AT1A 3BXOA 2OQ2A 1I6LA 3E23A 4UMDA 1C3EA 3CE6A 1C9NA 3EMKA 1YA8A 1YV9A 3FG9A 3FR8A 4PLCA 2XIJA 3FF4A 3ORSA 3W5HA 1YB7A 2DFTA 1Y1SA 4KB5A 3WWYA 4AWXA 4BFLA 2BH2A 1NT4A 2J3DA 5TEVA 1UDRA 1J23A 1G8FA 4G67A 5LOVB 2HQOA 5AJZA 1DMSA 2HU8A 3I42A 2XT9A 3WHIA 1AUOA 1KAMA 1H5QA 5TQJA 3B7WA 1G0OA 3MMPA 4G25A 1U2GC 1M1YB 2CNOA 1WXFA 2QXYA 4BVFA 3K6RA 4TWJA 5K3AA 1ODCA 2AOUB 5E4YA 1UOPA 2FCRA 3B6IA 5T4EA 3E4DA 4IXTA 5HTKA 3NBKA 1D2CA 3FSEA 2EF0A 2W6MA 4UE6A 3KJIA 4PHTA 5K3FA 1A04A 2QM8A 1YUNA 4MPJA 3MT7A 2TYSB 2AZDA 2R97A 3CRVA 3CVUA 5T3YA 3VR4D 3TLAA 3V4RA 2O7QA 4CCYB 3AEKA 3DYVA 3JQ7B 3IXQA 1FXSA 2X6QA 3L79A 3PHBE 3NBZC 4Y0NA 2C5AA 4AJPA 1FMJA 4YECA 2QI9C 2VYCA 2Z1DA 3C5EA 3Q3CA 4W1PA 5IWAB 4KVGA 5LPNA 4M1MA 3U9TA 4KTVE 3ZXIA 3EQ7A 2XT6A 2ZI6A 1RJDA 4AS3A 2HPAA 4OXXA 4UNQA 4DIUA 1A2QA 2GBCA 3GJQA 3PUVA 3A28A 3HO8A 4P34A 1BOOA 2WSSD 3EARA 3O8BA 1AGXA 1MQ9A 1SCKA 1LBSA 3U81A 2QAJA 2QJFA 2XYGA 1F48A 1NW7A 2ZXFA 4FMDF 3FN4A 4CEJB 4W5HA 2AQKA 2CN1A 3VYSB 3X1MA 4YRGA 1TAGA 3Q6MA 1E5XA 4MWEA 4OIFA 4Z9YA 1B14A 1YZTA 3H1AA 1M1YE 2D4AA 1RJGA 5FOSA 2UUAB 2JJ1A 1UP6A 2ACWA 4IO1A 1QHHA 5JJLA 1CXZA 4HDSA 4HS9A 4NPAA 1COWA 4GKKB 2IHBA 1OX5A 1GGJA 2D8MA 3DW3X 4EKDA 4JT2A 1EB8A 4FFSA 4ZYXA 3NNSA 5ESXA 3DOOA 5DYIA 2DPXA 4IV0A 2QRKA 4Q9AA 3RG2A 2B4KA 2BKEA 1GCIA 2ISQA 4CMBA 2EWVA 3A0UA 1DV2A 3SBOA 4MWTA 1NM5A 4YBRA 1YB6A 2CFTA 3JRNA 5AKXA 5ULLA 1JH9A 4M0UA 4JJ8A 4MKHA 4PZZA 1XEWY 1KE1A 3TOZA 1NJ8A 2PCLA 4B6GA 1JHQA 3MLBA 5LYJB 2EFCB 2VA8A 4CE6A 4MUKA 2W83A 5TMBA 1NG9A 3I4CA 1DHRA 1Y8AA 4Y3UA 1KQGA 3TNDA 3RS9A 4XRGA 5FR1A 3LFTA 4WN3A 3SZOA 3N8GA 1GYRA 2W2NA 3ZDYB 3I6IA 3HBAA 1CQIB 3LAWA 3PUZA 4ZMBA 4H7JA 2J67A 1KO8A 2MSKA 3VSDA 3DGEC 3A4YA 1NW8A 3OFNA 5TPWB 5DTJA 4KXUA 2ZUWA 4MUFA 4OP2A 2VUHB 1EM8B 2DVMA 2QRMA 5DCYA 4YPVA 2RBGA 2HU7A 4CL0A 3SSMA 4IJQA 1DCMA 2HV9A 2GETA 5BRJA 5CJJA 4MHTA 4RVGA 1JEQA 4J0FA 1IMJA 1C30A 2NU8B 4UARA 4UVDA 1LW7A 2QSJA 4RVCA 3AYXB 1G64A 1ICIA 3HMKA 2PJDA 1FW6A 4U39A 1A5ZA 4AJEA 3H99A 4MWSA 1VE6A 3DFKA 1C1DB 1ZJ4A 4RIEA 1P2DA 2M1XA 3TTWA 5J23A 3DF9A 3QVUA 3KTOA 3NDPA 3WK4A 4C4YA 2Y1XA 3GLHB 4LXHA 4M1ZA 5FHQA 3NEYA 4IW3B 2IHZA 3AJAA 1F8FA 3REQA 1ZRNA 2H1IA 2WHPB 3R5KA 4PFQA 4LE0A 1CZNA 3SYLA 1H0RA 5K05A 1ZUNA 5CDFE 2FOLA 2G4CA 3DUFB 3OZVA 4IF6A 4LOIA 4MS3B 5KTKA 5LNK6 4RMGA 2HUNA 4WZBE 5MN5A 3JQ8B 2X0KA 1JLRA 3FOZA 4MCHA 3K96A 1M74A 1Y48E 3G1UA 4GP7A 4CR7A 5LUBA 1KKUA 2Q5QA 1W93A 1RM3A 3HN7A 4HDMB 4WBNF 3QBVA 3HZRA 2PKRA 4LY0A 3RSOA 3HDTA 4Z7OB 1OV4A 2UV8A 3FDXA 3HB0A 2GUWA 2QYHA 3D7NA 1KWGA 1JEYA 1FTGA 3UW3A 3K0SA 2HMVA 4JJFA 2FF7A 4KFTA 4J0KA 2OESA 4DV7B 3D1VA 1DEKA 2XF2A 3BHIA 1Z2CA 2RC6A 1CP2A 3SZ3A 3BGVA 1KGSA 1M8PA 3MCZA 3OIWA 3DNPA 1G5RA 1UOEA 1HLPA 1OC4A 4TUYA 4FFVA 2JFNA 5KIAA