4HGPA

Crystal structure of 2-keto-3-deoxyoctulosonate 8-phosphate phosphohydrolase from haemophilus influenzae in complex with transition state mimic
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
MQQKLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIKLFFLGKLEKETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACGTSFAVADAPIYVKNAVDHVLSTHGGKGAFREMSDMILQAQGKSSVFDTAQGFLKSVKSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 62
structure length 179
sequence length 179
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgpA00
1Z4LA 3EF0A 1L7NA 4Y2PA 3WK6A 5ALOA 3W5CA 3L5KA 3L8GA 4F71A 5AM2A 3OCUA 1QH9A 3KD3A 4YCLA 3NRJA 2GHTA 2ZBDA 5ALDA 1Z4OA 1ZS9A 3ZWKA 2HX1A 3D6JA 1RRCA 4YCMA 1VJ5A 3EWIA 2R8XA 2EARA 4FYPA 5AI6A 5AVTA 5T41A 4CF4A 3QYPA 5AKZA 4QQFA 2WF5A 4FE3A 3KZXA 1YNSA 2C8KA 5ALTA 5AKXA 1XVIA 5AW6A 3SF0A 1NNLA 2PQ0A 4HYTA 2YMQA 1S8OA 4EX7A 3KBBA 3KDPA 3I6BA 1LTQA 1ZD2P 1S2OA 5AW0A 4Y2TA 3M9LA 2G1AA 3FPSA 3UM9A 4EX6A 4JB3A 1L7MA 5AI5A 5AKKA 3FVVA 3AR3A 3BA6A 2P27A 2R8EA 4CF5A 1RLOA 1EK2A 3AR6A 4G63A 4IG4A 4HGOA 5ALHA 3SMVA 4H1WA 4BEWA 1T5SA 2R8YA 5AVZA 1YDFA 5ALJA 4Y2XA 4DFDA 2DQSA 5AKEA 2BY4A 3ZVLA 3ZTYA 4L6AA 3U26A 2O2XA 5AKLA 2IOFK 4MWOA 4HGRA 4I9GA 4CF3A 2YMPA 2HSZA 2MSNA 5AW5A 3WK4A 2O9JA 2YJ4A 1NRWA 1IWOA 3AR9A 1U7PA 3NUQA 1WPGA 3ZX5A 2FPSA 3L1VA 3OTQA 5AKGA 1RMTA 3R4CA 1PW5A 1XP5A 1O03A 2YBDA 4C4SA 3NANA 2C4NA 2PR7A 5AVUA 5IT4A 1YV9A 2YFYA 2IOHA 3OCZA 3WGUA 1RMYA 2AUTA 2P11A 2OBBA 1L7OA 4KNWA 1VFPA 4EENA 1TJ3A 1YMQA 2ZBGA 2FI1A 2R8ZA 2IA5A 1RLTA 5ALXA 1SU4A 4XPZA 1U7OA 1QQ5A 3QUCA 3N07A 3AR7A 3GYGA 2HI0A 2C88A 5AW7A 2D2VA 4IFTA 3F9RA 2CN1A 3L7YA 3ONNA 5ALIA 1Z4QA 2WF9A 1QQ6A 4BEVA 3NIWA 2FEAA 2YY6A 4B6JA 5AW4A 4GXTA 3OCVA 3A3YA 1LVHA 3KOOA 2B82A 2HHLA 3ET4A 3ZU6A 1XPJA 2ZBFA 1F5SA 3SLRA 5ALPA 2MU1A 2JAWA 2W11A 5AIAA 3MN1A 1RDFA 5AKJA 1Q92A 1RMQA 3OPXA 3ED5A 4I9FA 4Y2VA 3HLTA 3OCXA 4UMDA 2IYEA 3ESQA 1Z4KA 1Z5GA 5AI4A 5ALFA 5ALVA 3ZI4A 4RESA 3WK8A 4QJBA 2ZOSA 3N8GA 5AVRA 2WFAA 1AQ6A 3QXGA 2EAUA 3UMBA 2FUEA 3R9KA 4UASA 3AR4A 1T5TA 4ZEWA 2CFTA 1U2TA 5AI0A 3A1DA 3HYCA 1Z4PX 1L8OA 3WK7A 3N1UA 5AK4A 2GMWA 5E0OA 3PGLA 4NABA 2W43A 3DNPA 4Y2UA 4CE6A 1X42A 5ALLA 3FPBA 4NV0A 2AMYA 2NYVA 2CFRA 1TJ5A 5A3SA 2I34A 5AW8A 4OHFA 3BWVA 4Y2JA 3L8EA 5AM5A 2HEGA 5JJBA 3ZVMA 1Y8AA 1Z4JA 3DDHA 4GIBA 5ALUA 1O08A 2GHQA 2QLTA 3WKEA 3OCYA 4G9BA 2ZG6A 2YJ3A 1RKQA 1L8LA 2HF7A 1N8NA 3UMGA 4JDPA 2G80A 2YJ6A 3QU9A 5AVVA 3N5KA 5FP0A 5AVYA 1ZJJA 1ZRNA 2G09A 2JARA 4NFLA 5ALRA 4NWIA 4BX3A 4RETA 2G08A 2YMLA 3IJ5A 1Z5UA 3PGVA 2AGVA 3M1YA 2YJ5A 3ZVNA 3L0CA 2BDUA 3MC1A 2G0AA 2WF7A 3EPRA 3I1YA 3RFUA 1JUDA 4EZEA 3QUBA 2JAOA 2HO4A 4Y3UA 2EATA 3WKBA 3WGVA 2WHEA 4NAVA 4KX5A 1RKUA 3W5AA 1Q91A 1ZD5A 2IOFA 3AR8A 1RKVA 1Z88A 2B30A 4BKMA 3U7EB 2FPUA 2I7DA 3NAMA 4KNVA 1QQ7A 5AI9A 3WKDA 5AW1A 4UW9A 5AVXA 3CNHA 3DV9A 3SHQA 1WR8A 1N9KA 3IB6A 2FDRA 1Z4NA 2HOQA 4EELA 2G07A 3EF1A 4OFZA 4F72A 4DCCA 5AICA 4Y2SA 1K1EA 4YIKA 2VKQA 5AM0A 2B8JA 2W4MA 4BNDB 4UARA 3I28A 3PCTA 4BX2A 3MPOA 2OYCA 1L7PA 2AH5A 3QUQA 2GFHA 3VAYA 2I33A 3QUTA 1YS9A 3W5BA 3A1CA 3ESRA 1EK1A 3I76A 5AK3A 1ZD4A 3SKYA 3L0BA 2NO4A 4ZEVA 3A1EA 4OCZA 3AR2A 5AVQA 4MUMA 3RF6A 5AKHA 2Q4RA 2RBKA 5AW3A 3DAOA 2ZXEA 2B8EA 1CR6A 5AVSA 4BNDA 1MH9A 3OCWA 5AKIA 3FM9A 4Y2YA 3WK9A 4PNHA 1Z4MA 3WK5A 2I54A 2ODAA 5AESA 4HGPA 5AW9A 1RQNA 1TJ4A 3E84A 4L57A 4UU1A 5ALYA 4C4TA 5AM1A 5IT0A 5ALSA 1KYTA 2B1RA 1NF2A 2OA0A 3E58A 3NASA 3NALA 1T9ZA 5ALMA 2JGAA 3U7GA 2ZBEA 5IS2A 1FEZA 3CZ4A 1SWVA 3IRUA 4HGQA 4KN8A 1RC8A 2RB5A 5AVWA 2WF6A 4L6CA 4DWOA 2RAVA 2WM8A 3KC2A 1RLMA 4AS3A 3WKAA 2C9MA 4XQ0A 1QYIA 3QX7A 4XE5A 4UMFA 1YJ5A 3QU7A 4O8CA 4KX3A 5AKYA 2OM6A 3SKXA 3QU2A 2JAUA 2YN4A 4YIHA 1Z4IA 3ZUPA 2FUCA 3WKCA 1TE2A 3ZTWA 4E88A 3K1ZA 4CNQA 4ZEXA 4AS2A 1RPZA 4UM7A 5ALNA 4OD0A 2BDEA 4Y2RA 4BYGA 4BBJA 5A3RA 4EEKA 2I55A 3UMCA 2CFSA 3E8MA 4UM5A 4BX0A 3B9BA 5AIBA 3S6JA 1RQLA 4Y2QA 3TLMA 4HGNA 5AW2A 5AM4A 3J7TA 3QGMA 2FPRA 3ZW7A 5AHXA 1L6RA 2NO5A 3U19A 2B1QA 3L8FA 1TA0A 3L8HA 1WZCA 3QNMA 2RARA 3SD7A 4HAIA 3L0YA 3QU4A 3U13A 3ZX4A 2FPWA 2P9JA 2Q5EA 1SWWA 4UMEA 2GO7A 2WF8A 5ALWA 4XOUA 1ZD3A 5AK5A 1ZRMA 2C8LA 3P96A 5ALGA 4AP9A 4C4RA 5AM3A 1U2SA 3ET5A 4UAVA 4FFDA 2QYHA 5ALQA 4DW8A 5AI8A 4YH1A 5ALZA 5AK6A 3FGOA 1J8DA 3PDWA 2YMMA 4UMVA 1CQZA 2G06A 4J2TA 3QU5A 3ZWDA 4YCNA 5ALKA 2P69A 2PKEA 3U7FB 3R09A 4J03A 2HCFA 3L1UA 2I6XA 4UU0A 3N28A 3MMZA 1WVIA 3E81A 5A3QA 3FZQA 1U02A 1ZOLA 1VJRA 3B9RA 4KYTA 3U7HB 2B0CA 2HF2A 5ALEA 4UATA 2X4DA 4UAUA 2FPXA 3B8EA 3AR5A 4YGYA 2Q4TA 1J97A 2HDOA 3QLEA 3W5DA
chains in the Genus database with same CATH superfamily
3C87A 1FYWA 1YKSA 4K9QA 2OHHA 3MJCA 2ZTHA 2RHOA 1QC5A 1QH9A 1KKMA 4KP7A 1VHQA 1OB5A 4NK5A 2A67A 4ZWNA 2IQ5A 5AR1A 4YRSA 3IT3A 5EKSA 2GM5A 4KITB 4DR1B 2WVGA 1UPAA 3IBFA 4EEZA 4KVAA 1I7DA 1ULSA 4CVNA 3FFBA 1U1EA 3OT1A 4CF4A 1QB7A 2PNJA 1NVXQ 5I01A 4IQFA 3W7AA 2Q8QA 5DX8A 1GRQA 4RE5A 2D1YA 2PLAA 2A4KA 2UUOA 4BOYA 2HQRA 1BOOA 1TYBE 2IPAB 4NG5A 1GAQA 3MF4A 2K87A 4JYCA 3FWZA 2R5NA 2ROQA 1NTRA 3AGPA 3IH5A 5HF8A 2GERA 1JSLA 1U0RA 2FW9A 3EJWA 4IDAA 1DIAA 4QUEA 4BIMA 3HVJA 5F2EA 3SZRA 5DDIP 2WUWE 2IF2A 1HDCA 3FLMA 1V11B 3R5FA 4B33A 1WCYA 4C22A 2W83A 4XVRA 4YRBA 3HEMA 4HMPA 3S40A 1YHZA 2G1AA 3A06A 1E6MA 3E9ZA 4X3OA 1CF2O 3FVVA 4U8GA 5FPQA 1NW6A 3MWDB 3NAZA 2AI3A 4XI9A 3W77A 2HRRA 4QU8A 4ZCPA 3R9XA 1NBEA 3QRWA 1RXCA 4IGEA 4NYIQ 3U7JA 3W05A 1N8SA 1P4AA 1T5LA 1U31A 1WP4A 2J5XA 2J9GA 2MOKA 2NU7A 1SURA 3KR1A 3Q41A 3CLTC 5DM2A 3ZDRA 3ENNA 4H1WA 2VF7A 1SHZA 1SKQA 4YQZA 4RXUA 3EQ8A 5DM4A 5TRTA 4FMDF 4ZMBA 3V7FA 1RYBA 5EJ2A 2JJ1D 3GCDA 1WE2A 4RPGA 5DI3A 4UTVA 5KKNB 3VUFA 3B2NA 4CIVA 2GSDA 1UP7A 3K94A 5K4AA 1T2EA 5HFAA 2WFMA 1PJRA 1NJ8A 1XVUA 3L1KA 2GB4A 2JH8A 4GQIA 4K8RB 1DJMA 4RMIA 1I4DD 3AP1A 1FRVA 4KAFA 1NRWA 1BJKA 4J90A 2AB0A 1ZUNB 4O4LB 3V80A 3TLZA 4AN4A 3JQ9A 4GX5A 5C1OA 1TZCA 1D6MA 5AKGA 1WUHS 4HDOB 2WJIA 4BKOA 5HX7A 3HKEA 4DR5B 4DA7A 1ZMXA 3C41J 4P84A 1UANA 2JC3A 1LDBA 2ZB7A 3OEYA 4QPZA 1YV9A 3EW7A 2YFYA 2QN7A 3I72A 4MW2A 3W4JA 4BNTA 1L7AA 4IICA 1CJTC 4CR6A 2JFXA 2WJ6A 1S8AA 2ZT6A 5JE8A 4UHJA 4UOEA 1CUBA 1CK4A 1JXQA 3ORQA 1ECPA 2RH9B 5FBQB 4Z1OA 2V0NA 1E3SA 2WWIA 3PWZA 1L7OA 4NPCA 4ZEOA 1ZH8A 2ZREA 4C87A 1EXWA 3IJEB 1KZHA 4AKTA 3PL5A 1HOXA 2FI1A 2PKQP 1X1AA 2A78A 1H3NA 4UBJA 5KNBH 2RIRA 4XIFA 3CQ9A 4MNTA 5DWQA 3RUIA 4OHVA 1KI1A 4DDHA 1KR5A 5EJEA 3P1JA 3BMQA 2XDYA 3I64A 1FSGA 1U9ZA 3BDVA 1BMDA 4KJXA 2J67A 2P90A 3IBGA 4L8VA 1A95A 3N07A 1Y9ZA 4MJ3A 4Y2HA 1R5BA 1HT1E 1RS0A 1TT5B 1E3QA 4BZQA 1MC1A 4D3DA 4CF6A 5IP5A 5K2MA 1K8ZB 2REQA 1WXQA 2E82A 4WBNA 3DV2A 1EXVA 1J0CA 3IS3A 4WXRA 1G8GA 1Z0FA 5TMBA 2XB9A 2OAP1 2ZJ0A 2DERA 4CTOA 3WLHA 5K0CA 3VOBA 3NDPA 1U2DC 4KDEA 3P9CA 2GN9A 1VLHA 3ZQ4A 3D6HA 4HDSB 4QPJC 2F3RA 2DKNA 4CU5A 1MV5A 4BNWA 5TQ0A 1FNBA 1SEVA 1ZONA 4EUFA 1NNUA 1U5BA 1MQ8B 5EPUA 4IDHA 3QPCA 4BMZA 2PJUA 1QAQA 4K9LA 1U0JA 3GLQA 4J16C 3T12A 4AJPA 4HRYA 4QARA 1OAKA 1PZFA 3SS8A 1JZSA 4CLDA 3ND9A 4DWJA 2O0KA 3WXBA 2X5XA 3ACCA 4DJEC 4CL2A 4NHEA 5LQUA 5CFMA 5DNVA 2WY2D 4CG1A 1FS5A 1NKVA 2FZLA 1Z8NA 3CEAA 2LKCA 4WLFA 4DLPA 2ZPTX 3WK8A 1ZA1A 1MW8X 3A3OA 1SKAA 2QL7A 2WFAA 3IBCA 4BQQA 1OA1A 1OFTA 2AZMA 3P0JA 4GPEA 4M89A 3R5JA 4YP1A 4V0SA 5EP3A 4GVLA 1YQUA 3H05A 3RU3A 2PX4A 4K9OA 2V6FA 4NYIR 4UFOA 5HKAA 2BJWA 2PFSA 1QYVA 2DBVO 4J0IA 1I7PA 1T3HA 2JI7A 3P9YA 1BD3A 4FOTA 3ICQB 4DV5B 3BGSA 1U2TA 1SVSA 1CRQA 3H8SA 4BJ1A 3MLAA 3KWLA 2BFEB 3OZGA 2W6NA 3A1DA 5KPDA 5T7BA 1M2JA 3L7CA 5HCNA 4BFCA 1SVUA 1DC4A 4FDUA 1NYQA 1WW8A 4MYSA 4QOGA 2X0EA 4A4DA 4E2ZA 2W0MA 4R41A 3BGWA 5GOZA 4XWWA 2IS4A 4ZVSA 4F91B 3DNPA 3TDKA 4C6RA 3FPBA 5JQGF 4D26A 3IE2A 1FSSA 2BSAA 2FWJA 1ZG3A 2I3GA 4A6XA 3VOAA 2GZHA 3LBAA 2J31A 1V7ZA 4KC0A 4XIJA 3EOBI 2ISSD 3MIZA 3USES 3WHLA 4INJA 3TLGA 4IFEA 3ZQJA 4YUYA 3ZVMA 2HEGA 4BGDA 1SUSA 1CLEA 1G19A 1YB5A 2GHQA 2P5TB 2IYFA 3QVGB 1E1NA 1MT3A 4UJ5A 1NW4A 3RPEA 1FFEA 1JQJC 2QTMA 4TMVA 4U3JA 4XJSA 5G3ZA 4ZI7A 1MEJA 4U7JA 1OMOA 4LA4A 4FC7A 3MWGA 3QJYA 2PL9A 3CW2A 3LLMA 3D8RA 5CT5A 1TTPB 2ZE6A 2F43B 5REQB 4EG4A 3OO1A 2UYOA 1VPWA 4JUBA 2ZYSA 1ETUA 3D3NA 3L01A 4U7HA 4NULA 4ZQEA 5CYPA 5F1PA 1ISSA 1YQQA 2OHVA 1OY1A 4FDTA 5A6SA 2ZI4A 2YASA 5EFZA 3KHUA 3LHDA 4W8GA 3SSNA 3EC1A 3WNDA 4BLRA 1HDXA 2BHSA 1SIUA 3PQ6A 4J6EA 2OR3A 5FI0B 1KKUA 1Q3KA 4C7XA 1HE1C 1VB5A 4WZBE 5TQ2B 1FLAA 1NDQA 4HZUB 1ULUA 1A4IA 4LY9A 5CDFE 2UZ0A 4A82A 4YJ3A 1AY0A 3R3YA 2VDMB 4NBUA 4R84A 2JVIA 3WLRA 3U7EB 3UJ8A 3ZD9A 2FPUA 1ABEA 2DJIA 3WLQA 1SZCA 1PVDA 2OILA 3A7EA 3F3SA 1JDVA 1TU0A 1QQ7A 1WBJB 3FGNA 3LP5A 4H1VA 4RE6A 5TX7A 3GU3A 1ZKDA 3LV8A 3KV1A 3CF2A 4KGXA 1R6XA 4NV3A 3SHQA 1EAMA 5JNUA 1N9KA 1KRHA 3PEWA 1DG9A 3D64A 1ANKA 1OXVA 1K5PA 1ECCA 3E1SA 2G07A 3R4VA 2JFNA 3ITKA 1D1SA 1DPFA 4F72A 4KHZA 2FN7A 1IEVA 2I1QA 3INTA 3F5DA 4KQWA 4L5JA 4BQPA 2GK4A 2PD4A 2PRKA 4RL6A 5DYTA 5A7HA 2DMRA 5DBGA 3OE1A 1D4ZA 2YJZA 4YI3A 1E7QA 3AM1A 3HMQA 3NC0C 3RG2A 1IN6A 1SRRA 4J3FA 1F51E 3DPIA 4MV1A 1KZ7B 5FR2A 1O0SA 3DW1X 4O4IB 2K5UA 3WLKX 4WZ6A 3IAEA 4R2JA 1UXJA 4WE3A 1E92A 1L4GA 2AD1A 4M55A 4MUJA 5ERXA 1XV5A 4WN3A 1IPEA 5GJCA 4LEIA 1GKUB 3QP9A 4JAVC 4WLNA 2QPAA 4UZSA 1CP3A 2O23A 2XCQA 4A73A 4DZRA 3HVKA 2IEAA 1TZMA 3VSDA 3SF8A 2ARKA 5EOVA 2QENA 2VPYA 3D0OA 4NDAA 4A0HA 2HMWA 5ABPA 4DDWA 2PX5A 4ZRDA 4BN5A 1T6NA 3U60B 4JUIA 4OCZA 1YU6A 1XXHB 4P58A 4P8RA 2ZQ5A 1X15A 4PHCA 5AKHA 3ZUGA 2I2XB 4IJVA 1JILA 2XITA 4O02B 4FPXA 4U9UA 5DTQA 3UJDA 3E18A 4BZZA 5DGTA 2JBAB 2I6GA 4JOSA 4ER0A 3ID6C 3K9GA 4S1WA 1G59A 1EB9A 1ESZA 3FBWA 3IIJA 4BNMA 3QA9A 2IS1A 2HU5A 3IKJA 4Q4JB 1JVNA 1P2VA 1NJ1A 1XTKA 2BN4A 3ONVA 1OH5A 1O8BA 1IM5A 1UBCA 3ESAA 4TLMB 2B35A 1EMDA 1C7JA 3DFKA 1Y5LA 1W73A 4JYMA 4IIEA 1Z4MA 2C1ZA 1D03A 1TMYA 1QV7A 2IBTA 5I5EA 3E9YA 3PQDA 2ZRHA 5TV2A 3D8TA 3IPYA 4EF4A 3FNGA 3CPJB 1R0BA 2UZ1A 3OP1A 4FYHA 4DA0A 1VE6A 1XHFA 3NTVA 4KFSA 3MHTA 2DBRA 4OBEA 4UU1A 1P1CA 1HL7A 3HY3A 4NBVA 3V7YA 4PWZA 1P17A 1GKLA 2VYND 3M4JA 1M2GA 5FLEX 1OYVA 2WJPA 2RFLA 2JFZA 1DJOA 2W5UA 4HH4A 4UE6A 4WNIA 5BOSB 5ITZA 3MUEA 2C7VA 2H5IA 2X4IA 3CNLA 3LYUA 4HAOA 1G4UR 3A2LA 4BP8A 4L2IA 1N5IA 4XUDA 2DUMA 1VLLA 5K6AC 3OIUA 3K92A 1ADCA 3MUNA 4WLEA 1U9YA 4J1QA 5EQJB 4CCSA 4RK0A 1RLMA 3WKAA 4D0LB 1EFLA 5CEEA 1QLHA 3MK31 3G3EA 1SBYA 4GG1A 2MT9A 4GX1A 1F1BA 1JIKA 1T4GA 2QNRA 4EG3A 3LKVA 3L6UA 1YI1A 1XXLA 2C77A 2XUZA 2ZRGA 1GG2A 3GT4A 2LIVA 4DCSA 2WM2A 3E0QA 4Q9DA 2C9OA 3UJHA 2CJWB 3ED1A 2VUSA 3MRXA 3TE7A 4C78A 1BDIA 1JR3A 3ELWA 4P6VF 1PFGA 2FOIA 1WOMA 1USVA 4RWZA 3UUGA 3IMGA 4D82A 4E12A 4EECA 1ZH6A 5ALNA 4ENSA 4Z4QA 3UA3A 1HQDA 2AFIB 1YRBA 4DDTA 5JJIA 2PJDA 4IX9A 4Q7LA 2XCIA 2XQJA 1UMKA 3FKSD 4BYGA 2VJAA 4YUXA 1W34A 1SFRA 1CG6A 4XM1A 1YVDA 2YXNA 2PUAA 3QPDA 4F3NA 4MPTA 3GLFA 3FVWA 3PPXA 5CLFA 1XDUA 2O8VA 4B3XA 3DVAA 1JAZA 1JX6A 4MLPA 2QZJA 5T6MA 3TUJC 1Q0SA 2D1QA 1APBA 1CJCA 1T2CA 5DN6D 1R50A 4CDGA 1FJGB 1P1IA 4JH0A 5ESXA 2WZDA 2R7AA 4Q37A 4CM9D 1KEEB 4PFQA 4JJ7A 4BFYA 4XFDA 4DLBA 1I9CA 4D3XA 4GL2A 2YOGA 4H0NA 1T0UA 1VGVA 5CNMA 1IY0A 1UFOA 3RVJA 2YXEA 4K88A 1R4MB 2H17A 2VQ6A 3QE3A 1FYVA 2Q21A 3A58B 4E2WA 1WS6A 2BJHA 3OX2A 1ZEMA 4RTMA 3CX4A 3I4LA 2IZ1A 1G6HA 1EUDA 4XM0A 2C8LA 1ZNZA 4G07A 1OXMA 1JR4A 3D8BA 1H1LB 3DOFA 1UP6A 3JWPA 3N53A 3T9DA 3VU0A 1M6EX 4TKVB 3D6TB 1Y1LA 5T3UA 4ETIA 4EOGA 5AM3A 2CD7A 1P1KA 2CLMB 4I8XA 4AFNA 1J5XA 4XH9B 3MAGA 3FIJA 4JBIA 4PAGA 4QYWA 4DW8A 5AI8A 3NM6B 1TCCA 1OTYA 4Q93A 1J2EA 3PKZA 1JT9A 4RADA 3PFKA 4YB8A 5IH3A 3D8NA 1V6CA 4QYIB 3UT5A 3UZUA 3KPUA 2GTHA 2L19A 4R2IA 4B7UA 4DWWA 1CQZA 1J9EA 4YAOA 4C3UA 3I62A 3LWNA 4HAVA 5G0SA 2COKA 3V6LA 4K9SA 4RJ2A 3JQ9C 3VOTA 4CTNA 4YRAA 1WUKS 1X70A 3BIFA 4RY8A 1ZRHA 1DXHA 3COVA 4J9VA 1T6BY 4JA2A 1LPAB 4JC8A 3VNQA 1DQRA 2ZSEA 4XUEA 3VMMA 4TV9A 5LXTB 2DWPA 5ICMA 4NCBA 3HCOA 2WABA 2FR1A 1V48A 3GRKA 4FW9A 1EFTA 3ROTA 1KJYA 4PS0A 1PIWA 5JRDS 1UFKA 2HGZA 1CUGA 4TKMA 2XIJA 5CA1F 1E4EB 5JCJD 1U7ZA 1N2CB 2VZEA 2Q4TA 4EY3A 1ABFA 4DRZA 2HJRA 1S4QA 3MUFA 4MQUA 4ZAGA 3U44B 5A0VA 2QMOA 1Z4LA 4GXNA 1BXRA 1R4AA 3A1SA 2GPBA 1LDYA 2Q5JA 3PYMA 2YY7A 3T0GA 1M8JA 1Y1TA 3DM5A 2P8JA 2JBHA 1ND6A 3O9ZA 3ZU3A 5LP1A 2Y1GA 4YAUA 3NONA 1ENZA 1Q74A 2QTNA 3WMFA 2AKAB 2C1EA 1C7QA 3OUZA 1TNDA 3GGPA 4QBKA 1OPRA 2HA3A 4UDNA 4DR3B 5IK2D 4GLLA 3EIHA 3ISVA 3DE5X 4PRZA 1SAYA 4UBKA 4EBBA 5KUTA 1VB3A 1XSEA 3ONEA 2ZKIA 3GEMA 2BRUA 3F74A 3SQWA 2ES4A 1WY5A 3DDOA 1FYEA 5ALTA 1XVIA 5C1IA 3VR4A 3GUYA 4E2FA 1QRAA 3JQRA 3K0CA 4K9RA 4CMIA 1RRKA 2ZIAA 1KEKA 2VO1A 4DG9A 4LYEA 1VP9A 1KI6A 1RI1A 4EB8A 1OYOA 3I6BA 3T7JA 1FFWA 5BXQC 3INYA 4TV8F 4B34A 2IUTA 1V1MA 1LI5A 3OJLA 2Q3BA 3P9NA 4GAEA 2NUAA 3H8JA 3LQ2A 4KVGA 4L7VA 4NE2A 1FL9A 3VMFA 2A7XA 4LJ9A 2VRNA 4YJGA 8ADHA 1N5OX 4YTEA 3AR3A 1A9QA 4QUKA 6REQA 3WLJA 3GFQA 1EK2A 2Q3DA 3QUSA 2ZYVX 1XHEA 2P62A 5FO0A 1A9TA 1U0NA 3AO0B 3H19A 1VKOA 4HGOA 1M33A 2BCJQ 2OHXA 3CLUC 5LMUB 5IUNC 3C6QA 4UBMA 3CUSA 1FFXB 4HV4A 1N1EA 3VR6D 1AGRA 1Q7TA 5IAAA 1F12A 5EQTA 1N2XA 4PX9A 3O92A 5BSTA 3AEQA 5C8XA 4D80A 4J2HA 2EW2A 3C7AA 3BWCA 2BY4A 4OUKX 3TZBA 5K01A 2KW5A 3U26A 1UDXA 3KZCA 3T38A 1RHMA 3Q12A 2OPHA 2GJ9A 1E5XA 1MUUA 4S1TA 2V1UA 4PC1A 4MR9B 3ODGA 1OD6A 4WADA 1J2YA 3ZZMA 5IJZA 4A8PA 4WK2B 1NJFA 2C9DA 2GN8A 3N2IA 3PU6A 4WZAB 1DCTA 2HK7A 3EPLA 1JDUA 1H0KA 3IVMA 4LF8B 3BH7A 1KY3A 1H1TA 2VL7A 1IWOA 2BTEA 4K0KB 1GQQA 2X4LA 1I33A 4KV7A 4RK4A 3EN0A 4EQ6A 3K1TA 2FPSA 2W6OA 3OTQA 4JBLA 1GXSA 4PQEA 3IP8A 3NHSA 5D3KA 2DBYA 3UOWA 4P08A 9LDBA 3AVTA 2RI0A 5BSUA 3X1JA 3BCRA 1HQYE 1UBFA 1PR0A 3DZKA 3VJKA 4PVDA 5E1BA 3WGUA 4GWKA 1L7DA 2P11A 2GFIA 1XDBA 2AG1A 3I6YA 1L4NA 1YI0A 4ZKEA 1O5OA 3WE7A 4EENA 4A0RA 3AERA 2FPPB 3BL6A 3GLKA 1BKDR 4CCYA 4JI8B 3EG5A 3ZNNA 1K27A 2X0IA 3VYWA 4IBOA 3U0BA 1ZM4A 1DB3A 1U1GA 1NVEA 3M81A 3OMLA 2DTXA 4LXIA 3W06A 1P9WA 2I87A 2ZIEA 4Q12A 3AHDA 3QUCA 4MEJA 2HMTA 2ZYUX 3N76A 3VTZA 2QM8A 4P4UA 4FK8A 4TTPA 3AR7A 3WYAA 3ECCA 1T1IA 2QV7A 2I29A 3M5DA 1MG0A 3PDIB 4IKOA 3FWNA 3BTVA 5J4KA 3AUSA 3F6SA 1Z4QA 2NTEA 1P19A 2VDRB 3UWKA 2V5UA 3NIWA 2FEAA 3QEMB 4ZVQA 3HK2A 1CEXA 3O38A 4B6JA 3H2SA 3GQBA 1I5RA 2Z5FA 4NLLA 3WGZA 1IZZA 4P4NA 1LVHA 1U3TA 1ZJ5A 4B7CA 4AKHA 4KUEA 2FQXA 4CT4B 3A32A 5L7YA 4YCBA 3ERCA 3SZGA 4QYXA 3KM0A 4KG7A 1ID1A 4YV1A 1QKKA 3B6JA 1OF1A 1SC6A 3SBOA 2Y2VA 1PZNA 1P7CA 4MWTA 5TGDA 4B4DA 1R0KA 1XYYA 1FFAA 3NRCA 3AWIA 2XZPA 4GSKA 1G2QA 1JEQB 3AUUA 1GU0A 2DGDA 1A9ZA 5BV1A 3VZSA 2JLUA 5BPFA 2XA1A 3OCXA 1QU2A 1SN7A 2IYSA 1I4OA 3IIEA 3L8ZA 1NNI1 4IGAA 2BUBA 1L1FA 1VG0B 3ZDDA 1HG0A 4PSCA 4HT3B 1GCOA 1CY6A 3EISA 3BMOB 4XWGA 1USIA 2J6IA 3LY8A 5ADWA 1Y8RB 1NTOA 5EZYA 2Q07A 3WHIA 4D4GA 3AJ8A 4DV2B 4TMZA 4CMHA 1YVRA 2DQYA 2Q8PA 2RK4A 3W5UA 1YUBA 1O54A 2HYDA 1O94D 4YK7A 3PT5A 4UHKA 4LF6B 4FZJA 1O87A 4GM0A 3UJBA 1C4OA 4XSVA 1YXMA 3BM5A 5FOSA 1CKEA 4HQLA 5AI0A 2Y0PA 2C4VA 4DDVA 4C7MA 4JLUA 3I5XA 7MDHA 2HSGA 3KWMA 4KOAA 5DYGA 1XO1A 1QGUA 2VDVE 5E6SB 3GCGA 4DCPA 4EYGA 5JS8A 3K71B 2W43A 4MQBA 4B74A 1ENYA 5LBIA 4BMPB 4H27A 2WVAA 2ZSIA 5THXA 2MSCB 1XDSA 4WKGA 3RASA 2CFRA 2XDAA 3MINB 2J5KA 4KO1S 4OXRA 3CUWA 3I53A 4E09A 5BW4A 2Q2NA 5H9VA 3SC6A 4DV3B 2WIBA 3LT5A 3MCUA 5B1IA 3ZJ5A 4CIXA 4A2PA 1PGQA 5IDQA 3O31A 3Q72A 5EVCA 2Q2VA 3GBPA 5BOVA 4JC0A 1Z4JA 3FUVA 3IEPA 4OY3A 1XT6A 3EEQA 1JR6A 2CLSA 3ASVA 1Z75A 5COQA 2XXAA 1U8YA 4TWAA 2IUUA 1GPWB 3TM4A 2VT3A 3U9TA 1PCXA 4G89A 3DUFB 4RZSA 2DLNA 2RJOA 5LFAA 4IP0A 2P41A 2KYRA 1TDJA 2QM7A 5JXHA 4GPIB 3QXCA 5JEEA 3EEYA 1SCUA 2BF4A 3P8ZA 4YP6A 4DZZA 4X65B 4POAA 1P9RA 1CHDA 3KKZA 4RFVA 4OLBA 2AG6A 1GARA 1CIVA 1PFUA 2VJOA 1PFYA 2YMLA 3M49A 3V4FA 4D9GA 2ZR0A 1QONA 1G9SA 1J09A 1DC3A 3FE2A 5DFAA 3PQ5A 1H3FA 5D3MA 5IM4A 1M5TA 1I4TD 4BMCA 4UHBA 1MAUA 1NYRA 2C03A 2AOTB 1FQWA 3K5WA 3QKTA 3NC4A 1Z16A 2IPNA 1T0PA 1E8DA 2EP8A 3MJEA 1B8UA 4Y7DA 2WU3A 2WTUA 1NU8A 1Q91A 3CW9A 2DF8A 4V03A 5C81A 4MJLA 3FUXA 2XNHA 2O2YA 3EPJA 1ILEA 5KAPA 4NTZA 4BKMA 3TLBA 1KH2A 3TCKA 2I7DA 2PT5A 2HDNB 2Z6QA 2CNWA 5DE3A 1FC0A 3PHCA 3RRFA 2G4VA 2V45A 1JHDA 3U3ZA 3MLEA 4DLNA 2ZSJA 3IXQA 4EHKA 1HEYA 3L41A 6Q21A 2GI4A 1M0WA 1RJFA 1NJ5A 1JG6A 2WIAA 2CVFA 3G5MA 3JQEA 2CXOA 4GOOD 4PSAA 1OJLA 4U2DA 1UMBB 1O95A 3IB6A 4GPAA 5ENZA 3I4CA 4D9EA 1D0IA 4EELA 1FXWF 3VHXA 3RYCA 2IP2A 4GYJA 1M7BA 1OU0A 2P9ZA 5TT0A 5DHRA 1TTTA 1EE1A 1U0TA 2ZI3A 3FDZA 4PE5B 4D4MA 5C80A 2J45A 2IU6A 3LSYA 3W78A 1LBIA 3FB4A 4IGFA 3H6GA 1C3JA 1H93A 3D6VA 3L04A 3TOZA 3VBEA 1IXZA 3FMIA 1Y89A 3RSHA 2C4HA 3S0JA 2ZUDA 5ECWA 2OFOA 1OE0A 2XT0A 2RGCA 1G6Q1 1ECLA 1E2FA 2N1BA 3PENA 3WQQA 4PLCA 1U2QA 1SD1A 1T5DX 5LQCA 3KXKA 5IANA 3QJ5A 1GPBA 4RY2A 1KY5A 3ZBQA 3F3KA 2BUAA 3QE0A 2VF5X 2ZTLA 1Z83A 1YOVA 1TK9A 2BWJA 2IU3A 3ADPA 3M4ZA 3MWEB 1H05A 3ORRA 3WLLA 4G5SA 3K0SA 1NX9A 4OAQA 1J6UA 1AQLA 3A4LA 4X6YA 4E32A 3PDHA 2QAGA 1TO6A 4C0XA 1CRZA 4I4TB 1Z2DA 3HXKA 3L0BA 4WBNF 1H94A 3FTDA 1U8ZA 2EL7A 1XAGA 1U1FA 2H5LA 3RC9A 1QHNA 3AEKB 3TLEA 3C6YA 1E6LA 1PKEA 3MSXA 3M6IA 3V8RA 4IVPA 3FAKA 1NWHA 4ND7A 2FAXA 5IAKA 2WTXA 4CM6A 4AI6A 3U7IA 3AI3A 1BVRA 3E9MA 3Q9UA 4KR2A 4CEIA 2WBLC 1K7CA 4D3SA 3R76A 1F0KA 2CL5A 1DAMA 2NPFA 3L8DA 3E5NA 5I9MA 4EBFA 3AH8A 5AVSA 3L92A 3AV3A 2WMYA 2Q1SA 5EYPA 1AX9A 3WQRA 1NT2A 1OV4A 1XD9A 2A2ZA 3DBRB 2YZNA 4GOMD 2FX5A 4LBVA 1PUJA 4LQDA 4MUIA 4R2MA 5DTJA 4CN8A 4JDUA 1CZNA 4I1YA 1FFYA 3QKRB 3GLIB 4QBGB 4Q9LA 2WFLB 1FNDA 4DSOA 1G16A 3LTEA 2ODAA 3WSTA 2IGBA 1TJ4A 2VP3A 3NO4A 3PUIA 4LDZA 4WINA 5ALYA 1SCDA 1EG2A 4C4TA 3GLTA 4BP9A 1KYVA 1MHTA 4MGYR 2AW5A 3SBEA 5HPYB 3RANA 2AG0A 3NOOA 4OP1A 2FA9A 2VSYA 1GCIA 4DR6B 2A86A 1JR2A 3IAS6 2UUCB 3VSAA 4B87A 2VA8A 2VH2A 4YMIA 4D6XA 1N6LA 1V39A 4ON9A 3DLBA 1CQPA 2D3WA 2QPOA 1LBHA 1G2IA 2ZPAA 1KYIA 3BXOA 2NADA 5H8WA 2VJLA 3KNZA 3R0VA 2RAVA 2QQ5A 3U4IA 4P9NA 4R4JA 1F20A 4XGNA 3WFZA 1NI4A 4XQ0A 1RAIA 3IT0A 3LUBA 4A7PA 2CF6A 3AOEA 3JYQA 5DTMA 1FXUA 3OBBA 5LOVA 1TJNA 2XXJA 2PUHA 1GEEA 2ZRIA 3AINA 4N40A 4LGYA 1T6XA 5G4KB 1AKWA 2POCA 2YWBA 4BLVA 4DT1B 3PPYA 5B58C 4M8IA 4ILKA 3V2GA 3QU2A 5BWBA 3NJ4A 1EDBA 1S3FA 5ER9A 1SVMA 5HRCA 4WA8A 1VL1A 3DBLB 4BLTA 2H0QA 4RZHA 3FOWA 5HBGA 4D9HA 1HFKA 4Y18A 3CWCA 3ZWXA 2HJHA 4REQA 4YRZA 4ADSG 2A94A 3PNQA 1D2RA 1TFRA 2PYZA 4QODA 1W25A 2QRNA 4RCYA 3GEBA 3WZMA 3TMAA 2O8FB 2BZ0A 1EXDA 1KMHB 1WB9A 5F21A 4TSKA 2B25A 3JATB 3SJAA 4ZI7F 2VQEB 1CW2B 2BRUC 1LSUA 4EW1A 2G70A 3GLFE 3NIGB 2FOLA 1Y6RA 4EG6A 4D3FA 5E6UB 3LXMA 1DFIA 2LDBA 2W2OA 2IEZA 3GN2A 1PSZA 4JMPA 2K2WA 3K0CC 4P7JA 4YJ2B 2CHFA 3J7TA 4UDOA 5ILQA 5KYUB 1Y9DA 2H63A 5GGXA 5B1EA 5LQNA 4OQPA 4D46A 4DA4A 4K03A 1MT0A 2IHNA 3BSYA 3ZW7A 2ZBQA 5LKAA 3PR3A 5DULA 3KUXA 1Q3HA 2WILA 2E7ZA 1CB7A 2P30A 3HZRA 3L8FA 2ZCUA 3AJDA 5DK6A 5MGNA 3DKPA 2Y1KA 1K4KA 3QPVA 4IOKA 5D84A 4EMUA 2D00A 4YXWA 2ETVA 2GZ2A 1JJAA 1UQUA 3HP4A 3QU4A 5EA2A 3GRVA 4RIHA 4YJ3F 5EY5B 5C2JB 1E6UA 5E9AA 3ZXSA 2SECE 1EI9A 1NJSA 4FIDA 2PZ8A 4H6XA 1UJNA 4ZKDA 1G20A 4F93B 5J9FA 5BQOA 2E5WA 1LDEA 2BMAA 3CGWA 1X7YB 4F1WA 1K6JA 1UKCA 2V7QD 2HKIA 1M1NA 3KLNA 2K6GA 2QTWB 4K2AA 5K4HA 1T6YA 2O8CB 3L5OA 2ZR8A 3GVHA 3HE3A 2X2EA 3FOFC 1FRZA 2Y3IA 4DREA 3TJZA 5HJ2A 3WGLA 4GR5A 1HO3A 2W00A 4MWZA 5F5NA 1MAVA 1OGIA 4UQPA 3CX7A 2OK8A 3VU1A 4L8LA 3RYIB 1QVRA 2NPOA 2WHXA 5JS7A 4A26A 5TEVA 3O73A 1EFPB 4CM5A 1XA0A 4MKRA 4OA8A 1RYHA 1E5VA 2W6ZA 4J03A 3O93A 3QY0A 5EHXA 1HFWA 5FTKA 1CUUA 2HD4A 2ZT7A 1PQ4A 3GUCA 3DE2X 3IO3A 4D99A 1PHPA 3TECE 3UAZA 4CEJA 1MPTA 3KCQA 1PUXA 4TT8A 5JLJA 3B9RA 4YBRA 1YCDA 4DJJA 4ZZ1A 2AMFA 5ADUS 2WG2A 4QUJA 2XYVA 1SM4A 3REQB 2J6BA 1DRUA 1VRCA 5LB2A 5K0TA 1O6GA 4YT8A 5A71A 5JZBA 4D3YA 4PHGA 2ADMA 4OREX 1WKVA 4F71A 2MSWA 3FUWA 4QGGA 5DWDA 3T9BA 1TAGA 4YXFA 1VSVA 5AUOB 4TZ0A 2ZBDA 1DT3A 2R85A 2IZ5A 1ZXXA 1FRNA 4RAQA 5GMOA 2YN2A 5M29A 2XUKA 5KINB 3FNBA 4JT2A 4NX2A 4LJSA 2G9VA 2C92A 4ZODA 2V6MA 4YJHA 5FBHA 4L7QA 4WNAA 2H4JA 2Y67A 1H2XA 1D6JA 1D3AA 2Q0XA 4OKSA 3ZC3A 1DKUA 1VRVA 3O5AA 2JI6A 4QXQA 5DLYA 2ZYRA 4B6FA 5T4EA 2FR0A 3GLVA 4FE3A 2VR1A 3P2EA 8GPBA 3H3FA 1P61B 2R6JA 5BO5A 4R8KA 3ZU5A 4M60A 2HCJB 2WVJA 2XPCA 3C6MA 3K9BA 1BH2A 4PZZA 4ER7A 4CIWA 1UC9A 3CNOA 4I9NA 4KQMA 5IBRA 4EJ2A 2Z2IA 3BRSA 3UPTA 2ZU6A 3HJUA 3FFXA 1JZQA 2AR0A 4E5MA 4KXVA 4WNYA 3DZCA 1YU9A 3WGGA 4US0R 1GVNB 3MCWA 4OK3A 5F64A 1XWIA 3PVCA 2Z09A 1LJ8A 1CIPA 3LKZA 2NSYA 5LU8A 3I45A 1A9PA 1MB0A 2Y05A 2YTZA 3SYRA 2PLNA 3UAVA 2MMCA 9ABPA 5HVNA 3EPHA 1E3TA 1J24A 1V5FA 2Z30A 3BA6A 3JZIA 4HH0A 5BR4A 3F4KA 2A9RA 1LK5A 4DCVA 2GRAA 2Q3CA 2Q2WA 5FWYB 1EHYA 5ALHA 4W7SA 5JJKA 2B34A 3JWHA 2VPQA 1NVAA 3FSJX 3ZDAA 1PDOA 1BMFD 2BD0A 1RXEA 5IZ4A 3MT9A 2CNKA 5IM5A 3DA8A 4L50A 5K5EA 5EHZA 2B1IA 2E55A 4LSZA 3ZVLA 2AEJA 4EPWA 2DHQA 2BTQB 1Z13A 1JU4A 4HGRA 3QWBA 4PFKA 3PQ4A 4M8LA 3KQKA 1CR4A 3O90A 3BB1A 3TJRA 1N6NA 4QT0A 1KAHA 2Z57A 4CJXA 5HQTA 5CCBA 3N6XA 4L8YA 3L9XA 1AD2A 1UJ2A 5B1SA 5G0VA 1H2YA 1UXKA 2D1SA 4RGYA 3VNBA 1V11A 1Z7BA 2BAGA 3KZ1E 1M1UA 1AN9A 1AZSC 1PS8A 2GUWA 4GR4A 4LTMA 5AVUA 3WGTA 2JGDA 2O3TA 1G8HA 1ACLA 1RMYA 2E49A 3VV2A 4RH3A 4AG3A 5JY1A 2AN4A 2VZ9A 1GUYA 3G5TA 4HMOA 4OFXA 3MWDA 1WETA 3EGCA 3SN6A 1YK0A 4GM1A 4B6SA 1TCBA 2JCSA 5ADVA 5AFSA 2D2XA 1XN1A 2XKJE 3MJVA 2YWCA 3NT4A 4ZU1X 5T4FA 3M6MD 2JLCA 1LVUA 2IIQA 4BZXA 1JA0A 4J0KA 4DILA 1U7OA 4B3SB 1PJQA 3M83A 2KSQA 1ZHFA 1MZPA 3RAGA 3TFWA 1T2UA 2O8BA 5BR8B 2XUOA 3H9GA 3A0RB 4EFMA 3FOAA 3MJDA 3R7WB 1YA8A 4E30A 4IIFA 2H51A 4GLBA 4JI1B 5F7ZA 3HO6A 3K20A 3GFSA 3K70C 1Q2UA 3UKOA 3WGQA 1VIVA 2HLPA 1NXOA 2GRJA 2IX9A 3AETB 1QQ6A 3LPLA 4P98A 4RQTA 2Q4DA 1JFTA 1V26A 1AO3A 3PFWO 1N6PA 2H2GA 5DT2A 3UBMA 3OCVA 3MS7A 4II3A 4CV3A 1SC1A 1I4WA 4O4LA 5DMXA 4AY6A 2N42A 4KLZA 1SB9A 4FEEA 1U6JA 1ULBA 4HEQA 2X40A 3ZU6A 1XMIA 1AKEA 3A1WA 2L18A 3G9UA 4K40A 2NO0A 2A1TS 5KTRA 2FP3A 2JAWA 4ZAZA 3RVPA 2WYUA 4I8DA 4IIBA 3T5GA 3ZI0A 4DUPA 1AGNA 3TCNA 2GCGA 2I4TA 3KCNA 1WEKA 2W2QA 4X8OA 5E95A 2P0EA 1YJBA 2W0SA 3DO8A 4B3GA 3G2JA 1L4EA 1IOZA 5BY2A 1NW7A 2QVXX 1EQ2A 1ZH2A 1ZN7A 3FUTA 3LF2A 1D2HA 3DMYA 4TXJA 1B43A 2D3TA 4YCAA 1Z4KA 1RLJA 3E3OA 3R3XA 1JIXA 2CVPA 2HMUA 3G9ZA 3OHSX 4MUNA 4RACA 1MEOA 1AUVA 1OLOA 3S5JA 4D5EA 3JR7A 2XD9A 2UYGA 5A9RA 2VDKB 4GI2A 1TMOA 1T2FA 4TV9F 2FEKA 5CLLA 3EFBA 1N6OA 5HG0A 5KI6A 5IKEA 5IVHA 4MS1B 1IC6A 1TT5A 3RS9A 1NW5A 3K0FB 5GV8A 5E8RA 2J0UB 3ETEA 2YN0A 3VR2A 4EUKA 9MHTA 1RHJA 4P1ZA 5JSQA 3E9CA 1WWKA 3GDOA 4B71A 5LNK1 5CNJA 3DKVA 4DE5A 5K8JB 2AEFA 4TS4A 4LF4B 2X6QA 4WW0A 3GJ4A 1EVKA 4ZVLA 5HF6A 3UUEA 1JIJA 1F0PA 3U3RA 2VCHA 5AK4A 3I04M 4ID3A 2WHRA 2VJDA 1MC8A 4MB6A 4MCJA 3GUHA 1F4VA 4HDSA 2IY9A 4GQBA 4CDNA 1C0LA 1KPGA 1IMJA 2X6TA 4YACA 3ZXUB 2CT8A 1PU2A 1A27A 2JFBA 2FPLA 2WHPB 4GZ6A 4ID9A 2QAGC 2H1OA 3FY4A 1MENA 1QV6A 4GX0A 2HCTA 2PEYA 4G4SP 5J40A 1MO6A 4H9GA 4XEHA 3TEMA 3DLHA 4FT2A 3L8EA 3R77A 4IW3B 1GFZA 4MSUA 1JFFB 1PI3A 1UM9B 3G89A 1WCWA 2GX6A 2MINB 3OIDA 3RVMA 3LC2O 2E4WA 4DHWA 4BCDA 5ICSA 1ZL2A 4O0MA 4BVGA 3D7LA 1GUFA 3AF3A 1W48A 4IWXA 5FLXA 1N8NA 5IU6A 2O0JA 3WAKA 3RROA 1CRPA 1CC1S 2BEWB 2DY0A 3T1NA 1CIJA 4JXZA 3LPCA 2KX7A 2ZRBA 4PPYA 2BEUB 2HMAA 2BZGA 3O8RA 3GCZA 1KOFA 2Q29A 2R8BA 1YFKA 4U00A 2O8EB 3PRKE 4X94A 5FFMA 3TBKA 5HKBA 3TQIA 4A2QA 2BFEA 2YJ5A 2OM2A 3MC1A 4X8MA 1HKUA 4OK5A 3KQQA 3EARA 3DYBA 1P80A 1T91A 1JN0A 2JIQA 1MIHA 2HO4A 4OU5A 2ZUEA 3SDSA 4EGFA 3JXEA 1ZIPA 1LC0A 1FB5A 1G1AA 1JW9B 3LUJA 1RKUA 4X3PA 3RODA 1UPCA 5FHRA 3HXOA 1I1NA 2FKAA 3CVJA 3W5AA 4KMRA 3RR2A 1SKYB 3CYFA 2XKBA 6ADHA 2EF0A 3ZNPA 2VWHA 4G1UC 1TTHA 4JLKA 3TIFA 2C54A 4ZQIA 2IT1A 4UAJA 2P4UA 5MHTA 1WNTA 1Y7LA 1NQOA 1SUIA 4IV8A 1OZAA 2ZYGA 5AI9A 4OHCA 3CEHA 2NUPB 3WKDA 1T9CA 4BKRA 2HRDA 1DELA 5JO9A 2PM8A 3RS5A 3QVGA 1OI3A 4TLCA 4GOXA 3GFPA 1XTPA 3AOEC 1W87A 1RJ9B 2CSXA 3BE6A 3DMGA 4R54A 1S89A 1J25A 1EINA 3FPKA 4QSMA 4YUZA 3DM9B 3FUCA 3M6VA 1MQ9A 1ZBDA 2V1XA 3KDSE 8ATCA 2HCBA 3ROKA 3OEHD 1FMTA 2F43A 2YCBA 5REQA 1BKSB 3R7DA 1JKJB 2H2WA 5JFOA 1X9HA 3UT6A 1Y3HA 2QIOA 5JC1A 5CB8A 1QPGA 1M66A 3WLMA 1Y9AA 5TS2A 3WGYA 2ODQA 5CA0B 4BX2A 1XJ0A 1SUDA 1DEOA 1K5DA 2EKQA 3H3JA 3L40A 3L8MA 3UWSA 1MJGA 1I1HA 3ZGVA 3TRDA 3JV7A 3SWWA 3ZHUA 2CFOA 2YICA 5EIFA 1H6DA 5KEIA 4UQOA 3DBIA 1DIBA 5TQ2A 2WPDD 4W5QA 3LUCA 3P71T 4HZUA 3VAYA 4ICIA 3QUTA 4HKTA 4PQRA 4RMJA 4F06A 5LP6B 3K8YA 4O3MA 4F8EA 2JI9A 4DYHA 2QGZA 4C6HA 1Y3CE 1L5FA 2JK0A 1WHSB 1XWWA 4WY5A 5B6JA 4JEIA 1PVVA 5F7JA 1TD9A 3DHWC 3N86A 4Q9KA 4HVTA 1E2BA 2GN1A 4JYPA 4E1AA 2QVZX 4WH0A 1HTWA 1RAGA 2I4MA 5EJ4A 5LIPA 3OQOA 1HF3A 3MW8A 3R8FA 1NVGA 1B0UA 5EHNA 2HQOA 4NS1A 1YCFA 1PGJA 4HN9A 5KAMA 2OECA 3BXZA 1YULA 5HCIA 3RG8A 2RBKA 3VI3B 821PA 4HNAB 2PWPA 2HQSA 1GTVA 2F1OA 1MAWA 2IYXA 1W36D 1Q1GA 1P0QA 4OGFA 2HSDA 2G6BA 3JQAB 1MXHA 3WFIA 3FM9A 3AYZB 3TRKA 1WG8A 3WK9A 5MN6A 2ZIZA 3U3MA 3EFHA 5TSDA 4NBWA 5FTLA 4ZEMA 2I2BA 4NMLA 3CF6R 4O4IA 2CLKB 3CTPA 5AESA 2EBWA 1T3TA 2EFHB 2ZSAA 3LYAA 1EWKA 3Q7EA 5DT9A 5AW9A 2VK2A 3ITEA 1EGHA 4TYWA 3KDAA 3M6WA 3EFOB 2AOVA 1QCZA 2Q5LA 3VNRA 1TRHA 2HV9A 2X8BA 1SZPA 2LW7A 5CJ2A 5EZYF 3UENA 2UV8A 4CG2A 4H60A 1JH9A 3OE5A 1PR4A 4U7FA 3BILA 3HHEA 2VRBA 3NASA 4FEYA 1KPIA 1GNLA 4G37A 3DEIA 5DLEA 1BSVA 2JI8A 1BMTA 3VKUA 3IOYA 1PYDA 3WYEA 1XZJA 5DHTA 2PGNA 3IEVA 3OZFA 1RC8A 4KN8A 2YW2A 4QGAA 4GKVA 3VA7A 4HY3A 5DNAA 1P0CA 5EE3A 4B85A 2ZW9A 4LJYA 1MNAA 4MIYA 3GOHA 1XXHA 1U8XX 3DVLA 5JWOA 3L7IA 3EXIB 1RZRA 1CQIB 3PGKA 4LJ5A 5AQ1A 3M3HA 4BHTA 3THWB 4D8XA 3PK0A 1DC5A 4E2XA 4KBGA 5JAUA 4ARVA 1V25A 1UJ6A 4MVJG 3WJ2A 2IZ0A 3FZGA 5GJBA 2XODA 5KJEA 5JH7B 4Q4JA 1A2OA 2EJWA 3LDUA 1QNFA 5DYYA 1X1QA 3VYRB 3KE8A 2WWVD 3LQQA 3G23A 3ZE2B 3SQXA 1ADGA 4H2DA 1N2GA 1NKTA 3NKFA 3B5JA 3RUDA 3W6NA 4CM3A 4ENPA 3NGXA 2RBEA 2AJBA 4G0WA 3MA0A 2PBLA 3L7KA 4HSEA 4H15A 5CYOA 4EKGA 3CR7A 4GI1A 1ST2A 2ZJ3A 1ZMOA 4LYAA 1BROA 2FMHA 2W4QA 3WBKA 3GRUA 4Z3OA 1NBWB 4O63O 2R6ZA 2XWPA 2YQZA 4NH4A 4G56A 1YONA 1FW8A 3DL0A 2EFDB 2QUIA 1YQEA 2Y1FA 1N5KA 1KVTA 3MOGA 4HGNA 4RIIA 5AW2A 4NQZA 5AWFC 3G2MA 4LXHA 1KARA 1VIAA 3DE6X 1WEHA 3R5HA 2QD4A 4DSTA 5BOSA 1E1DA 3JD4A 5LJLA 1C7EA 1E32A 3HGQA 4K6HA 4D4LA 5IX8A 1W5BA 4KLRA 2OAQ1 3RCBA 2NO5A 3TD6A 1Y63A 3KQHA 4KO4S 3JQ7B 4G1BA 5JS2A 3W9SA 4EG5A 5LIRA 1ZJWA 2WD8A 4GPD1 5IM4F 2VQFB 3OJFA 3PD1A 4WOBA 3RLIA 3UGKA 4FLEA 2DFDA 1F8UA 3U13A 3M5PA 4D9NA 5FPHA 5LBUA 3EULA 1S1CA 4HOYA 4LHSA 1KEWA 1UBLS 5E4JA 3SC4A 4D3ZA 1IMOA 1ZRMA 1CEYA 2WKQA 2XMRA 4HTAA 5FOUA 5CFPA 2NXNA 5GIPE 3OZVA 4J76A 3RVKA 3ZDBA 1J1UA 3KQNA 3OCCA 2OBMA 4J0JA 4L16A 3CJTA 4D0GA 3JZAA 4EO9A 2AFIA 2HU2A 1RLIA 2QMHA 4IDPA 5CJJA 3WHPA 4AECA 4OX9Y 2O5VA 3W0LB 1UJ5A 2QUBA 3NT5A 3AB8A 4MV9A 4MHOA 1OI4A 1ZI9A 4FUTA 4YCNA 1HMPA 2FWAA 2I2WA 2IEDA 3ENVA 5JD3A 2P69A 4ZD6A 4J1NA 4TN1A 4ETNA 2QKYA 1B16A 1ELOA 3A4MA 1SIBE 2PZAA 4GRIA 4W99A 4QWWA 3VZPA 4DJAA 5F9HA 3BWDD 2ZVPX 3SG0A 3V32A 4DCMA 4PYOA 2QQ0A 5EWLB 1K7YA 3BUSA 4QDKA 3FZQA 2RGNA 1NQXA 2JGJA 2ZAOA 3STHA 3TS1A 4E13A 1KEEA 2O07A 1ZOLA 4QQNA 2P68A 3ILSA 2JHFA 1ULHA 4RA9B 4D98A 4KWTA 1J8VA 1L1RA 2HNKA 4DSAA 3U1VA 1QKJA 3HN2A 4ALLA 4DYDA 2C59A 2C96A 3OM0A 4G5QA 4MKGA 1QG4A 2C9CA 2IKQA 1C5KA 2C5LA 3K1AB 5BYKA 1YWGO 2ABWA 5L3SB 1UKYA 2PEZA 5INTA 1TQ2A 4R8VA 2PQ6A 3PC7A 3T7EA 3U7QB 4C0AC 1C3VA 1JKXA 3PHIA 3V5NA 1U3VA 3W5CA 5DNYB 3JQDA 4MYUA 1N5JA 1ZGJA 4MI9A 4ND1A 1C2YA 1M2HA 1H1LA 4TLBA 3TTYA 5AM2A 3OCUA 3ZCTA 3D7NA 5A5GA 1A5ZA 1XELA 2GHTA 3LGXA 4TKVA 3IXLA 3LUAA 1QIDA 2JATA 1DBPA 3ETDA 3LXXA 2ERXA 2A5JA 621PA 3PTAA 1J8QA 2CHEA 4EUHA 4TX1A 3AXTA 4Z99A 5ECYA 4JJZA 3KSMA 1QB8A 3GAAA 4QYIA 5CFNA 5AKZA 4OBBA 1SKMA 4QU0A 1KETA 4FEGA 1QP0A 4NOLA 5DP2A 3AG5A 3OFSA 3GLUA 3OWXA 1AK1A 4HDNB 5JHHB 1E0JA 1V9LA 3KJGA 1YNSA 3B2EA 3HZZA 2QL5A 4GEKA 4BNXA 2HXGA 5BRAA 5LZ7A 5BPHA 1JTFA 3HDGA 4TXNA 4TYPA 3KQLA 3CMCO 3ICWA 4TMTA 2CBGA 2ZJOA 4B2LA 2ZRJA 1JEOA 5LXTA 3CX8A 2B36A 1OB2A 4PX2A 1D4OA 2YNMA 1JQAA 1MX5A 3QVUA 2JS7A 4JYAB 2QD5A 5BW6B 4IV0A 5E7IA 1Q1ZA 3L79A 1CJUC 3UHFA 4X20B 2EJBA 1E4EA 4JY7A 2E37A 4YP0A 4DKXA 5ECGC 2JJ8A 1BN7A 1N2CA 2Z1NA 1E6EA 2HREA 4RVCA 5DBOA 5DZSA 5ADHA 5C52B 4US1R 2R8EA 3I0NA 4F4UA 3U44A 3VVLA 4Q82A 1ZCZA 5DF1A 4P34A 1CZLA 1L7VC 4H3VA 4A91A 3HCEA 4JQZA 1UBUS 4QJIA 3B20A 2FZ4A 1YFLA 4XYEA 2GA8A 3OC6A 4EH1A 1CWUA 1B41A 4YONB 2C42A 2V5AA 5ALJA 5IG2A 4I81A 2VUIB 2JDIA 1GNSA 2XGSA 4LRTB 5HE8A 3SEFA 1FMJA 1EH5A 1VSBA 3MTIA 5AKEA 1OX5A 3CUVA 1YI8A 3EGDA 2QA5A 3QA3E 4FFWA 4IIUA 5TMEA 4D7AA 4OAPA 1WV0A 5LOVF 3BQ9A 3ROZA 1SQ6A 2B7CA 3MWJA 5F2KA 1OA0A 4G3XA 3O9MA 4MYTA 5IFKA 1C7FA 4NQRA 3PRJA 3P4XA 4O1IA 1ZMTA 3HM2A 1ID8A 3L7MA 4EA7A 2C20A 2FRXA 2P3SA 3FYTA 4BNYA 3NHJA 3V00A 2F8TA 4BAGA 2R8RA 1IOWA 5H70A 2P4SA 1FFCA 4B3RB 4EEXA 3C5VA 1KJ9A 1Q7RA 4KPFC 1Z7WA 1XP5A 2AC4A 2HA5A 2YBDA 3Q7IA 4UXJA 1ZGCA 4C6TB 2XVYA 2XUJA 1HZJA 4FQ7A 5KNCA 1SZJG 4P36A 3HCDA 2CNOA 5IAOA 2M32A 4TROA 3OFVA 1BJTA 4DIUA 1SZDA 3LBFA 2C7BA 1TKRA 1IBRA 1QR6A 1UBSB 3GARA 4WASA 4OSOA 3WO0A 1E77A 1WD7A 4NYMQ 4DEYA 3ZE6A 5AXAA 4B6PA 2C5HA 4ZGBA 2DSTA 1C30A 3EA0A 2F3SA 4D41A 2I99A 1DSSG 2VPWA 5E7JA 4AF8A 4RJTA 5KZMB 1H42A 1F2UB 4BB0A 2O48X 4OH1A 1FFXA 3B7GA 3OU7A 4AVYA 3O94A 5EKDA 4A3SA 1K6EA 5M34A 3FHJA 4AXXA 3T7KA 2FKNA 4RTJA 2PA0A 4ZXPA 3AFGA 3BRQA 4OV6B 3OURA 2NXJA 4KRXA 2E18A 2C88A 1JECA 4EYKA 1KJQA 3HR8A 3MSCA 4CKBB 3STTA 3ONNA 4MR9A 5LQKA 1PEAA 3KKKA 1F0NA 2AIRA 4WZAA 4FSDA 1QDLB 3BSSA 4QJ4A 3T4EA 2BKLA 1KZGB 4KXMA 1BFKA 3A3YA 3I61A 2YZGA 3LHIA 2HHLA 1DTWB 1KEVA 2JLBA 1TADA 4I50A 1DBIA 1UQRA 1JQ5A 4QFBA 1ORVA 4YHBA 3UK1A 1BDMA 4LXTA 1D1QA 1KK0A 2Y1OA 4K86A 3THXB 3VQTA 2C3MA 5HF5A 4UULA 4BATA 3U9LA 4BPRA 1JYSA 2WIJA 3EVAA 4KAXA 5G0WA 4Z3DA 3A4TA 5AKJA 3V1UA 4KHPB 3E70C 4FSHA 3F98A 2DQZA 3FCAA 3VR4H 2HPVA 2GA9A 3JD3A 2V7UA 1ZOPA 4I3GA 4F3YA 1QHYA 1FDRA 2FPPA 3URKA 3QV2A 3GAFA 4GW3A 4OG2A 2ONJA 3R5XA 3X1ZA 5FUMA 2WTAA 3ORSA 3I23A 4EGAA 1WQ1R 5EVJA 2ODBA 4KH0A 4ZVOA 1TQ8A 3GPIA 4KIGA 2AJCA 1M3SA 4M38A 4O59O 4L8GA 2ZIXB 3JARB 3JVIA 4B7AA 3VR3D 4B8ZA 3F8TA 5HBRA 1QRUA 3CEJA 2YX1A 5B4UA 4LF9B 2YYAA 5DPMA 1TF5A 3U2QA 4XVUA 1ODCA 3C43A 1FTQA 4IPTA 1BVUA 3VUEA 1A7AA 4DR7B 4L07A 3ZCUA 3WGIA 2F3UA 1Y8QB 2Z9BA 3PDIA 2JLYA 2BGMA 4ZEWA 2YIJA 2VAWA 3DEHA 4M36A 4QXAA 2FVXA 1K06A 4R1SA 1HM5A 1LK0A 2XAUA 3QEMA 3DL4A 5E3JA 4D8WA 4P0PB 3ZV5A 2CL7X 3KRTA 3HB4X 4UHDA 3OFND 5A03A 1G5IA 2GO1A 3QXXA 5C31A 2G1PA 3U40A 2XI4A 2ZJ2A 1A1SA 2IHKA 3IODA 1DKPA 4NABA 1EYZA 2YBEA 4PZEA 4C76A 4EL5A 3FNIA 5IUKC 1Q6YA 3IBSA 1JBEA 1S3SA 4IDCA 5CUQA 2NYVA 1VYUA 4B40A 2ISQA 1A9YA 3GPCA 4KACA 1T4CB 4IMRA 2HA6A 3FDFA 1JEQA 3WTBA 4BMSA 3KT0A 5LYYA 1TK2A 1IBCA 2D0IA 4ZIRB 4R9VA 1YJCA 5AM5A 1HE8B 1DXYA 1G3IA 2P35A 4L4SA 5A2GA 2CLFB 4KO3S 2IIVA 4AKEA 4R51A 2QW0X 5IBPA 2C97A 2HU8A 4DXAA 3Q6IA 1EUQA 1D09A 1ADYA 1QAMA 3BMOA 3LH5A 1XMJA 2ID9A 4JITA 3DAFA 3NCTA 1FDTA 1YR8A 2B69A 2DT5A 1PSWA 3QVXA 4TKLA 3QU9A 4B8YA 4D43A 2R97A 4XVQA 3BX1A 3HO1A 2GVZC 4Y6GB 4BX3A 5DRTA 5B6PA 1J2UA 1W4ZA 3RK1A 3WGNA 3TSCA 2AGVA 4RHYA 1TUBB 3HFJA 3SK0A 1SXJD 4FYWA 5E6SA 3FD8A 4RCVA 3ZY5A 3GT7A 4QJ3A 4BNNA 4YPVA 2IW1A 5HM8A 2EWVA 2B98A 3D2AA 3D7KA 3Q3HA 4X71A 1QGYA 4RH1A 1N34B 2GZ1A 2R7MA 1F2TB 1YNOA 4F86A 2I91A 3ZBUA 4QASA 1EBFA 4GOND 2O06A 5D6OA 1Z22A 3MINA 3CSUA 3U49A 4LFBB 5CH3A 5FUYA 3BXHA 3AL2A 2OWEA 3UV7A 1WDKA 2NNLD 2A59A 3DEJA 1V0JA 4S2EA 4DMFA 1KJZA 1X8JA 2VUUA 4URYR 5JAIA 5L3QB 2HPHA 3KQMA 1SXIA 1SVNA 3JD1A 4QHSA 3HRIA 1T0IA 3NH9A 1W88B 1GHTA 4WMLA 5AVXA 1UKAA 1TLTA 1N75A 1R10A 1PYOA 1GGEA 4OO3A 3PA6A 1E9DA 1RWVA 1UC4B 1Z4NA 2F17A 2HOQA 3DUFA 3HJGA 3PRYA 4HL6A 4ACBA 5C7IO 4U8HA 5LWQA 4TWRA 2EJUA 4YALA 3PVZA 3UW3A 4YAWA 4D4HA 1F7UA 3R6DA 3VC1A 1BHQ1 4I6JA 3A4NA 2X9QA 4K9MA 5HTKA 2ZETA 1DAIA 4BNDB 5AJZA 4FWIB 3F8SA 1LSJA 5FI3A 2OVFA 1EVEA 3C1TA 5KQMA 3AJEA 3PWTA 4FGWA 5SZHB 1X74A 4NZZA 3BMNB 4D9IA 1KAMA 3R3HA 4R98A 1WUYA 1EP9A 3FYCA 4OAOA 3QG1A 2P1DA 4LBZA 1QG6A 4HLNA 3UHOA 4UCWA 2C2MA 2AOTA 2I9PA 3O1LA 1KU0A 1YR7A 2I33A 3EH1A 2AF4C 1JIIA 2O2HA 4KLAA 1KVSA 3S2GA 3WNCA 1D5WA 4LXYA 3OIVA 4F3CA 4OHXA 4MUXA 1VG1A 4I4IA 4QVGA 3UCEA 5A02A 2D2EA 2OTCA 3NIFB 4UDXX 4JJIA 1XCMA 4N5NA 5KU1A 2YHSA 3HDJA 5KHLB 1U98A 3AZQA 4NCIA 3G0IA 1EQAA 2X9GA 2Y6VA 2ZWPA 5H80A 1YAJA 2DWOA 2FPMA 2J5QA 1XRRA 4WNCA 3SX0A 4LOHA 4DZTA 3JAMA 5FBKA 5KOIA 4S12A 3VZCA 1DOZA 1GTSA 1UMBA 4O4LF 3QHPA 4Q7KA 3DOOA 5TPWB 4KRFA 4LY3A 2AYXA 2YUTA 4ZN6A 1BXZA 2YY5A 4LZNA 2J7PD 2E4XA 2ZXEA 4UUMA 2I6FA 3H86A 2QAJA 3N74A 1TAUA 5JROA 2W2NA 1LQ2A 5L6MB 2EW1A 4UCXA 3KOUA 3SYLA 4HWOA 5E0KB 3SQDA 3K9HA 1RC0A 1HG1A 4C7KA 4JVNA 1IEQA 2QVCA 5DGIA 2BBWA 8ABPA 4RQBA 1DWQA 2OD7A 3ABZA 3OTGA 3BH0A 3EEBA 4DJ5X 1FSZA 3KKNA 4Y6OA 1IQPA 1E3DA 3E84A 2NZ2A 3MJRA 5EP1A 3DT8A 1NF8A 3MWEA 1ZBQA 4EA6A 4IJWA 2H4HA 3KXLA 2DUNA 2AN5A 1Z6GA 4IGKA 2ZU0C 5E2IA 1KMQA 1E7SA 1KJ8A 3UMFA 1DIRA 2ORED 1ZVJA 4M0KA 1BXGB 1DAFA 1GZ4A 2RGNC 4V24A 4M88A 3P26A 4I4TA 5AOVA 3VHLB 4ZZ3A 2AEMA 3AX6A 1GL7A 4CLHA 3LCCA 3NBFA 1N7GA 3AEKA 3UH0A 4PPQA 4HTFB 1J90A 5BRNA 2PNFA 2ZVQX 1EBUA 3BJIC 3D7SA 3S8MA 4CCAA 1VL6A 2QYSA 4KQKA 2WJVA 3GXOA 2X0FA 3Q2OA 4LV8B 4MR8B 4PG8A 5LWHA 2C9MA 4JOQA 2W6IA 4BTEA 1MFPA 3BJRA 3L82B 3CONA 1XNRB 2X3YA 3RT7A 5JSUA 4JB8A 3P9SA 2P40A 3C8DA 4EMBA 2ZTUA 2Y2UA 2A1TR 5DO9A 5ENVA 4YR9A 3DBRA 3L46A 3SSMA 1S8NA 3SFVA 2X5NA 4JL8A 3DYIA 3RIHA 2Z4SA 3QKRA 5B5SA 3GLIA 2BKXA 1YE8A 2R00A 2WFLA 3LUPA 1IK4A 1JBQA 1XTVA 3N7TA 5SY9A 5EWJB 2LCIA 1YRYE 1AE1A 3BDAA 1DDIA 3AP2A 2BDEA 2ZYAA 3C7TA 4HN2A 4RHTA 4E07A 3AXSA 2JIZD 4DLXA 5KTNA 1Z5OA 5ES3A 4AWAA 4C0JA 4DXHA 2IHBA 3MJHA 1NW8A 1NUQA 2VUTA 5MDHA 1WPQA 1M5RA 3OJOA 3A31A 4FILA 2ONCA 3TTWA 2GESA 4GE3A 4JCOA 1I0LA 1YCHA 4JS0A 1PD1A 2OESA 3E7DA 2P9TA 3VH1A 1SU6A 3DWGA 1QS0B 4AURA 4C7BA 1F06A 2QW1A 5CAEB 2YNMC 4K6GA 3AYXB 2CMKA 1MXFA 2HRZA 1GDDA 4LNUB 2YINC 3H17A 1QF9A 3D81A 4Q4HB 2C2ZA 3COSA 5FPYA 1ND5A 1B15A 3H1GA 4DIBA 3BZUA 3OMWA 4IXMA 4HX9A 1GRRA 4FOOA 4IOLA 1CRWG 4YNBA 2X0DA 1DLJA 4KOEC 3IP7A 4DCJA 4DJFC 2JI4A 2GVDC 3OU2A 5CVEA 3SD7A 3D1JA 4H17A 3TEFA 2PZFA 2E4UA 4HHEA 2F3TA 3IHWA 3UFXB 2NPIA 5G4KA 1RE0A 4DT1A 4Q9JA 3OQNA 1CNEA 1US8B 2H2IA 2WF8A 4B3JA 2C3YA 1T9BA 1Y5NA 4NCNA 2CDBA 4Z1MA 2DH6A 2ZRPA 4U5QA 3PQEA 3DBLA 4ZANA 4AP9A 3FHLA 4NBKA 1QFSA 5CCXA 5LDDC 4AN0A 4GNRA 3I9LA 4WOKA 3MJFA 2VDPB 3ADBA 1PUIA 1IG3A 2AFIE 2XA2A 2ZWOA 3OPVA 4FDAA 5EJGA 4D9MA 1X77A 4D4JA 4OXYA 3QYJA 1E2NA 1KO1A 1V47A 2GBLA 2QR3A 4CEHB 2O8FA 5AO9A 3TE6A 1KMHA 3F47A 3HCCA 1J8DA 4R1LA 2YMMA 3UWDA 4B44A 4LBWA 4BU1A 5HZKA 3JATA 4GO1A 4ZJUA 5IXYA 2WD7B 2BEJA 2IWHA 2B94A 2XB2A 3O3OB 1M72A 2PUGA 2C2OA 3G5AA 4AJHA 3TFOA 4DR2B 5E6UA 2GZRA 2PGIA 3DE4X 1JDZA 1I6LA 1A3CA 5T67A 4G24A 4YJ2A 2ZXFA 1DFGA 1YZ3A 3CBGA 4UUAA 5KYUA 1YQXA 1H4VB 1U11A 2ZEJA 3ENWA 1UMDB 3KALA 5AVKA 4L5YA 1Y6FA 3OLWA 1W52X 3LQFA 1IJFA 3HLYA 5EI5A 3SKVA 4FYIA 2FSSA 2MHCA 2TMDA 3CSDA 4P5PA 1PR2A 2FXIA 3T8YA 1GZVA 2Q5OA 3FDJA 4MMXB 5SY4A 5KHOC 2B0CA 3NEAA 4URXR 5CT6A 1MOPA 1ZLYA 3CZ5A 3C45A 1UZMA 1V4BA 2HJGA 4BP1A 5A5FA 4K8OA 4CKWB 4ZYVA 2XCLA 2ODNA 5E3HA 1D9XA 1VYTA 4EL0A 5KS2A 3NHRA 1YB6A 2XYPA 3VZQA 1Z34A 2NYRA 4A36A 3JZMA 3TW4A 2PT7A 3KVRA 3LK7A 3IVRA 3D0QA 4EF6A 4NOJA 1X7YA 2P3OA 1JI0A 4RENA 4FHCA 2WYHA 5GM2A 3T1YB 1WUTA 2ZZKA 4LC1A 3D6JA 3F6YA 3FYHA 2O8CA 3GDFA 1VJ5A 5AI6A 1EDOA 3ESXA 3BXEA 3WMRA 4Q3DA 2QGFA 2IHVA 3O9VA 4UCQA 4P5EA 2NXEA 1W5EA 4CKYA 3RYIA 4QQFA 4XX0A 1J22A 1QWOA 2C57A 3E82A 1D07A 4GKAA 1EFPA 4F6CA 1U8TA 3IUJA 5C3MA 4DOMA 4UVHA 4NK4A 5GOTA 1BS9A 3SC3A 4W1QA 5GADl 1FTSA 3FH0A 1Y1QA 3IVAA 3UWMA 5I9IA 3N75A 3OZBA 4EX7A 3PGMA 4GGPA 4GP6A 1QG0A 5DCUA 1B26A 1YR1A 4O4IF 1HT0A 2L0XA 2R6HA 3H5IA 1CS0B 4OATA 1XCLA 3IO5A 2QLLA 1EIWA 4NRDA 3X2FA 1T26A 3CVUA 2CZCA 3WFJA 2BC9A 2GLUA 4LYGA 1QIEA 1QIMA 3REQA 2YWRA 1XZBA 2PE5A 3CF4G 4LWPA 2XQVA 4MO9A 5JS1A 5GQSA 1YZLA 1RLOA 1WW3A 3OX1A 4MVJA 4W5TA 3MMPA 3PJGA 1QIFA 1M34E 3BL5A 2OE2A 1P2UA 3I01A 4Y30A 1LGYA 5EERA 1DAOA 3Q87B 1YS2X 1U9IA 1XJCA 5H1YA 4FB4A 4BXOB 3IBYA 5LBTA 1JAYA 5I9BA 3BA1A 2OG1A 3TG2A 1SNYA 2JHPA 3ZHSA 1OZHA 4M99A 4RHFA 1RHQA 1J39A 2VPTA 4BFTA 5DNEA 4X44A 2IBMA 3KX2A 4QTUB 2J4CA 4CF3A 1U7WA 2ZFUA 4JLNA 5M3BA 3EQ6A 3SQMA 2O9JA 2WSSA 1AMUA 1V96A 1F3OA 2OOKA 3AR9A 1TIBA 3TF5A 4DIKA 3DR3A 4FHEA 2AMJA 5AD1A 3C8HA 4I36A 3A04A 4Z0TA 1W2WB 3U9SA 1U0OC 4Z6KA 2TS1A 4LJLA 1NBMA 1T25A 3K0EA 2TECE 3OQIB 4DM7A 1LLFA 3A4VA 1EJ6A 4HAYA 1DIHA 4G8DA 4LRUA 3ZE9A 2QIPA 3DF7A 5B7NA 2PUFA 1FZQA 2OBBA 1UOQA 3HJAA 3KUCA 5ANRB 4QFMA 3HVUA 1Q1QA 4GECA 3ZJUA 4AX8A 4H3HB 1Z2PX 3PQCA 2NQ2C 2XT6A 2XWQA 4PO3X 5P8WA 5K0BA 2BFOA 2FSGA 1J49A 3DL2A 3F0TA 4YN3A 5DCLA 4L0CA 2TMKA 4OBXA 1S3IA 3PNVA 2H2DA 3A6PC 2AX3A 1PS9A 4B5KA 13PKA 4ETMA 5CURA 3QLUA 4RXMA 3E4DA 4QO7A 5ENDA 3CJRA 4OJNA 1IHXA 3BICA 3H1FA 2WSMA 5JI3E 3MUOA 1XCBA 3R9IA 3HBLA 4H7PA 1W0KD 5EXTA 3VZDA 4GUAA 4EPYA 1P0FA 3JS5A 1VLZA 3E3LA 4D4IA 1PK9A 1PL8A 4WZAE 4W9NA 1ZY2A 4UEJA 1TZJA 2GAIA 3H2IA 1KSGA 4DAOA 5HRUA 4BEVA 2AQHA 3RHTA 4Z4IA 2ILVA 2PZLA 5CX1B 2JJ2D 5SZKB 5TGZA 2BM9A 4FNGA 3KOOA 4KAJA 1BWPA 5KB3A 1YA6A 1I2CA 1NBHA 1T35A 3OIFA 3JAKB 1G5QA 4YMGA 1AXRA 1SHJA 4BFLA 3R6TA 3LO5A 5F12A 3RS2A 4Y98A 3UAXA 2VQ3A 5BR7A 2MU1A 1PTJA 3RUEA 4TVKA 4RULA 2V7XA 1JRLA 3G0HA 5JNSA 4P83A 2PMEA 4WIAA 1F6BA 1B2LA 2A14A 1BXKA 2CK3A 3IIMA 3HCNA 2L69A 4J1TA 3OKPA 1PT9A 4F45A 4FYMA 2HPZA 1EGMB 1MH1A 1R0LA 2GZ3A 5FR1A 2WTMA 3O2QB 4FNOA 3T99A 5EIXA 1IBLB 1GZSA 4KBFA 4NNJA 2ZK7A 4MINA 4MICA 4ZQBA 5BYJA 4QZVA 5AT1A 2NO1A 2ZJZA 3CLTD 1L7RA 1DQYA 1O6ZA 3EHEA 4MB0A 2PS0A 2PX3A 1OXUA 2FUEA 3UMBA 2FLKA 2C3PA 3WRYA 2J5RA 1VE1A 3DE0X 4FCWA 1Z5PA 3R7WA 2BMJA 3AUJB 5CHEA 3NIBA 1L7XA 5DNDA 2BGRA 4HDCA 3SJ7A 1NVWQ 3WZLA 1RRPA 1Z0JA 2CFTA 4HRXA 4L27A 1DOHA 4RDXA 1P5RA 4OQZA 1T5IA 2UXBB 1H0RA 2WU0A 2Z9DA 1LQUA 3R1IA 3HTXA 1C7IA 3L0SA 3GG2A 4JXXA 5D3ZA 3IT1A 1T3LA 1L5MA 2P3QA 3NATA 4PHHA 1WW2A 3O4HA 3PFHA 5BSGA 5EJ9A 2ZBPA 1IXSB 1X86B 1I2BA 4K46A 4ZVVA 3NBUA 3P5BA 3IUQA 4DNPA 2PX0A 1XVAA 4KQXA 2O2GA 4JSYA 5LC1A 1X3SA 1C3LA 2VYCA 5EAIA 1E5TA 3SHFA 4BZPA 5IT5A 4WESB 4OOEA 2C7GA 1H8ED 1QE3A 3NFRA 4LN1A 1DV1A 2P2LA 3NJRA 3EGOA 1ULTA 2IVFA 3MBIA 5HDBB 2Z95A 3KV3O 4CR8A 2PCLA 2I2CA 4Y2JA 5EPEA 5F5LA 3PC4A 1KIMA 2AFRA 2HIAA 2IYNA 1R6BX 1MGOA 3R2JA 5GAJA 3TD9A 1W8DA 4E6EA 5C9ZA 1V45E 1OH6A 1VJGA 1H9AA 1GCAA 4G85A 5E7MA 1DI0A 3U4GA 4YRMA 4KKXB 1K89A 5LXTF 1MORA 2O6LA 2JGLA 3IQWA 3OHMA 3C1AA 5DYWA 4COKA 5KNDA 3S7ZA 2JJ1A 2ZYIA 4MS1A 1EAYA 2H6EA 1TYAE 4MZDA 4OYLA 3NBKA 4P3PA 4PNPA 2XCUA 3K0FA 3MT7A 1B00A 2J0UA 3TM5A 2WIGA 4MP8A 2VRWA 3O84A 1QZUA 1I4EB 1LLDA 3IDFA 3P52A 1FCJA 5JZSA 3NOXA 1YIAA 2PUTA 2W6JA 4I1OA 1V4VA 1QBGA 3ACDA 1CU1A 3VDQA 2QM0A 4LRQA 1XHLA 1EFAA 2XUFA 4A0GA 5PNTA 3HDYA 4F6RB 3OUUA 3QXHA 2CV0A 1VCHA 1QYWA 1O9HA 1P91A 1PEYA 1M2VB 4FMPA 4AN1A 2QN8A 4FD2A 2ENUA 1RPNA 1SB8A 4KX5A 2P9YA 3UVEA 2PU5A 4ARAA 1U4NA 5LQRA 4E0BA 3SBXA 2WHPA 1G18A 4QUGA 4FMBB 4B4VA 5I4CA 4GMXA 5F78A 1PJTA 1Z88A 1QR2A 2G17A 2ZR7A 3HWX1 3PX7A 1TKAA 2ORYA 5CXSA 2YDYA 4MPPA 3UXYA 4KNVA 2DP4E 3CUTA 4XQEA 2WIFA 4QJ5A 4ZCLA 4E4YA 4XKJA 5CPFA 4YDHB 1NI5A 4NV1A 1JFFA 1FUUA 2QJWA 1UM9A 4GT1A 1YZGA 2OD9A 4BFSA 2NU9B 1RXWA 2PRJA 2MINA 3MWYW 2QRLA 3BBPA 1L5HB 3QBEA 3ZJVA 4ZOLF 2JANA 1AM4D 1EK5A 4BO3A 4C89A 2D4HA 1SC9A 1NLFA 3WL5A 1WBDA 3IAUA 3OEWA 2W2VA 4YIKA 4G5HA 1OBFO 3KB2A 4HQNA 3ACBA 1QTNA 3UMMA 4BNJA 1E3WB 3OKCA 3L0PA 5JPDA 3WWZA 4ABYA 4REOA 1YZQA 2GXUA 2BEUA 2B9VA 1B6RA 3TIXB 4BMDA 4CNBA 1ZSYA 3SVZA 2CJPA 1YGYA 2D54A 2R00C 4GPBA 2O8EA 4F92B 5IN4A 1DAEA 1I2ZA 2FFAA 4EDHA 3HDHA 4E5DA 1DKNA 2H2FA 1GFWA 1YBMA 5FF9A 5FADA 3ANNA 2GPWA 4Z7OB 1RVV1 1PR6A 4JEHA 2Q2QA 1RQRA 4DEVA 4ZYYA 1QH1B 3EXG1 3V9AA 3DTVD 1E5LA 2GFHA 3I2JA 5CITA 4FGLA 3W9UA 1GQOA 5A3JA 1W49A 3JYHA 3LQ1A 3MGCA 2FMUA 4PLTA 4RGVA 1F8XA 2PMCA 1IZ8A 4Z9FA 4D0RA 3NTQA 5J4LA 5UKDA 4I7EA 4XRRA 3A8TA 2C4WA 2E6UX 5EQDA 1CS4C 5G40A 2QE7A 5FBLB 4I4NA 1UWCA 3BD7A 4JLDA 4N8DA 5EJIA 3WOHA 2OHJA 1SK8A 2YWDA 3CUEF 4R8MA 4ZEVA 2NUPA 1AU9A 5EZSA 3RUAA 2EZ4A 2JCBA 4N65A 3CTMA 1BZYA 3H18A 1PAUA 1YJAA 5L40A 1EVIA 1H85A 3S2FA 3WWDA 4D0NA 1RJ9A 4YT4A 4I50F 4TQ9A 2IUYA 1NW9B 5AW3A 1OW3B 2I4NA 5HNKA 2IXGA 4NS4A 2AI2A 1KI3A 4GSLA 4HEA6 4XUCA 3RC8A 3IV7A 2MSLA 3EIUA 2CFCA 3TQSA 2Z2YA 4CWAA 4TMYA 3PD7A 1JKJA 5HIIA 3OCWA 1JIQA 2JGRA 4MMYB 4LI3X 4EYEA 3N8IA 4AY5A 4PAOA 3TUZC 1YRQA 2OHGA 2IZ6A 2Y1CA 1ONPA 5HM6A 3QVLA 3JVVA 4X7RA 3KUDA 2GBLC 1RWMA 4NY1A 5CA0A 5TVKA 4CYMA 5HWSA 1LDMA 1Q12A 2ZITA 3Q8WA 2IVZA 1VMEA 5HMMA 3VH4A 1YSCA 2NG1A 3C3CA 4DCTA 5K99A 3WNVA 5JI2E 1E79D 3HSYA 4ER3A 4I0WB 2Z6AA 2OFPA 2QNBA 4PLPA 4GFDA 5LP6A 2P5UA 3BS4A 5AOBA 2UXDB 4C0LA 2HHHB 2KB0A 2A88A 4E94A 2OCGA 3DYVA 4KMMA 3E35A 3V3TA 3N59A 1B6GA 2XKKA 1JTVA 3HU5A 4HB3A 4NE7A 5KYGA 1FEZA 4IDNA 4HGQA 5EIOA 3ZV3A 1DDOA 5JIBA 1L4YA 3E15A 4GZMA 8MHTA 4XAQA 1B93A 2WTNA 4P93A 1UKZA 3COPA 2OAGA 3EIOA 5L3VA 3Q8XB 1NJGA 1A97A 3KC2A 3ABRB 5FL7A 2J3EA 5H7XA 4EPTA 3A6ZA 4G84A 1BVYF 3VPSA 4JU8A 1A2QA 4HNAA 2Q0SA 1YVPA 2HWKA 3UJAA 2A30A 1WXEA 3UV6A 5ITWA 1CUDA 3RS7A 3LY5A 4FMCB 2Q1YA 4MX8A 4J4BA 5KX5B 3DXYA 2J3QA 5IKXA 2PYIA 2VVTA 3ZZ1A 1DKQA 1NLUA 1TM1E 1FTWA 2XE8A 1ODSA 2G9UA 2VNJA 2AKYA