4HGRA

Crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
163
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGAKTEIVRRRAEALKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase, hydrolase
total genus 53
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgrA00
4XE5A 5AK3A 1XVIA 2WF6A 3WK9A 1Z88A 4C4RA 1VJ5A 1RQLA 5AICA 1YS9A 1J97A 3QYPA 4XOUA 1ZS9A 1SU4A 1YDFA 2HHLA 4Y2UA 5AM2A 1RLOA 2IOFK 3DDHA 1XP5A 4Y2TA 4YH1A 4UAUA 2HEGA 3L8HA 3AR8A 1RKQA 3NIWA 2O9JA 2GHTA 4CNQA 1T5TA 1SWWA 3L7YA 4J2TA 2ZBGA 2B0CA 3QX7A 1Q91A 3A1CA 5AI5A 1T9ZA 3AR6A 1L6RA 2GHQA 2YFYA 3U19A 2OA0A 3L5KA 3KC2A 2O2XA 4I9GA 3NRJA 5AI9A 3SMVA 3L0BA 5FP0A 4FYPA 2HI0A 3ESRA 3OPXA 3TLMA 5AW2A 3AR7A 2B8EA 4CF3A 3MN1A 1ZRNA 1ZD4A 5AW1A 3J7TA 3A1EA 3VAYA 2P27A 2WHEA 2ZBFA 2NO4A 3DNPA 1Z4PX 3N07A 4JB3A 2AGVA 2BDEA 5ALOA 1CR6A 3MPOA 5AW6A 2FPXA 3UMBA 2R8ZA 1ZJJA 1U2SA 4BX0A 2RARA 1FEZA 3WK4A 2WFAA 3L8FA 2DQSA 2IYEA 3E81A 3SD7A 3ZU6A 2HX1A 3L8GA 4F71A 1ZD2P 2ZBEA 3N5KA 3QGMA 1QQ5A 2ODAA 1EK1A 1RKUA 1RQNA 4IG4A 4EX6A 3A1DA 5AKEA 3U7EB 4NFLA 4HYTA 1F5SA 5T41A 2R8EA 3M1YA 4GIBA 5AM4A 1PW5A 2JARA 1TJ3A 1QYIA 1RLTA 4YIHA 2EARA 2YJ6A 2FI1A 4C4SA 2YJ3A 3ZVMA 2CFSA 3ZW7A 3ED5A 1ZRMA 2BY4A 2JAWA 5ALIA 3RF6A 3U26A 3KBBA 5AW3A 4HGPA 3N8GA 4YIKA 1Z4LA 5AI4A 4HGQA 1QQ6A 4RESA 3U13A 3SKXA 2ZBDA 4AS3A 2YJ5A 2B30A 2HCFA 3ZVLA 3FZQA 4ZEVA 2C8LA 5ALZA 3OCUA 2ZG6A 5AM5A 1RLMA 1NNLA 5AKLA 1T5SA 2PR7A 3ZTYA 4F72A 3ZWKA 4IFTA 1L7PA 1VJRA 5ALFA 3QUBA 5ALLA 5AKKA 4EZEA 2GFHA 4UMVA 3WK8A 5ALTA 4BEVA 1YJ5A 2WF7A 1RPZA 2W11A 4UMFA 1XPJA 3NANA 3L0CA 3SF0A 2VKQA 2MU1A 3QXGA 4KX3A 2C9MA 2R8YA 3QUTA 2HF7A 1ZD3A 5AVSA 4Y2SA 5A3SA 5ALNA 4RETA 1LTQA 2GO7A 1L7NA 2HO4A 2RBKA 4EEKA 1TJ4A 5AKGA 5AKJA 2X4DA 3NALA 3E58A 3QU2A 4YGYA 3I1YA 5AVTA 2YBDA 3WGUA 1L7OA 2BDUA 2CFRA 5AI6A 3ET5A 1MH9A 1Z4JA 3R09A 1N8NA 4UAVA 3BWVA 2R8XA 1O08A 2EAUA 1U7OA 2QLTA 4XQ0A 5ALKA 4Y2VA 5AK4A 1J8DA 5IT0A 1YNSA 3SKYA 3EF1A 5IS2A 1L8OA 4MWOA 4BNDB 2IOFA 2RAVA 5AKXA 1WR8A 2OYCA 1VFPA 3HLTA 1RMYA 1Z4OA 4H1WA 3QLEA 4MUMA 3QNMA 4FE3A 2OM6A 2YMQA 4Y2QA 4DCCA 2G06A 4BBJA 2P11A 3BA6A 3KDPA 1Z4KA 5AVWA 2YMMA 4OCZA 5E0OA 2W43A 3WKAA 3ZTWA 4AP9A 5AK5A 1RMQA 3PCTA 3FGOA 4DFDA 1Z5GA 1NRWA 2B1QA 4UM7A 5JJBA 4UMEA 3OCYA 3NAMA 3R9KA 4PNHA 3AR4A 1Z4QA 2I54A 4BEWA 3ZVNA 3FPBA 2JAUA 2WM8A 2EATA 4YCNA 4FFDA 2I33A 4HGRA 3K1ZA 3QU4A 1Q92A 3A3YA 2FPWA 2QYHA 4BX3A 3B9RA 1Z4IA 3W5AA 4G9BA 3GYGA 3ZX4A 2IA5A 3SLRA 1YV9A 1U02A 3QUCA 4NWIA 3MC1A 5AM1A 3QU9A 3AR9A 4EENA 1IWOA 5ALVA 1TA0A 3AR2A 2HDOA 3B9BA 2FPSA 3QU7A 2FEAA 5AW4A 3WKBA 4EELA 3OCXA 2D2VA 1RKVA 2G09A 2WF8A 4KN8A 3AR3A 3EF0A 5ALDA 5AVXA 2B82A 4L6AA 2FUEA 2IOHA 2YJ4A 3WK5A 2YMPA 3M9LA 3CZ4A 4ZEXA 5AVZA 3KOOA 3NUQA 4Y2YA 3WKEA 1CQZA 5AW8A 4AS2A 3L1UA 3OCZA 2C4NA 3ZX5A 1KYTA 2C88A 2Q5EA 2CFTA 3IJ5A 3MMZA 4OD0A 2YN4A 4Y2PA 5AKHA 4BX2A 2Q4RA 4L57A 3WKDA 1YMQA 5AI8A 3PDWA 4BNDA 2AMYA 3WGVA 2YY6A 5AVYA 3N28A 3AR5A 1ZOLA 4KX5A 4KNVA 1Y8AA 4UATA 5AKZA 4UM5A 3E84A 1L8LA 2WF9A 5AVUA 4I9FA 5ALRA 2G08A 1AQ6A 2ZXEA 3F9RA 2I34A 3NASA 5AIAA 5ALUA 3UMGA 3S6JA 4NABA 4YCLA 5AKYA 3I76A 4KNWA 3QU5A 3ONNA 1X42A 2G80A 5ALJA 1RDFA 1Z4NA 4QJBA 4NV0A 5ALGA 4G63A 3WK6A 3ZWDA 3U7GA 5ALQA 5AKIA 5ALHA 3ESQA 2FDRA 5AESA 3W5BA 3IRUA 5AIBA 3I28A 2B8JA 2G07A 4JDPA 4OHFA 1U2TA 5AM0A 1WVIA 2Q4TA 2P69A 5AVRA 5A3RA 2G0AA 2ZOSA 2C8KA 5AM3A 3W5CA 3CNHA 3DV9A 4Y2RA 1N9KA 2CN1A 3OCVA 1NF2A 1Z4MA 5ALYA 3FPSA 1S8OA 4C4TA 2RB5A 4HGNA 3KD3A 3L0YA 3OCWA 4Y2JA 3U7FB 2AH5A 3QUQA 3EPRA 1LVHA 4HAIA 3EWIA 4CF4A 5ALMA 3OTQA 3U7HB 1WPGA 4DW8A 5AW7A 4XPZA 4CE6A 3FM9A 3WKCA 5A3QA 3D6JA 5AW5A 2NO5A 2PKEA 1RC8A 3B8EA 4EX7A 4QQFA 3WK7A 4UU0A 4DWOA 3W5DA 1O03A 4B6JA 5ALEA 2I55A 4Y2XA 4O8CA 3L1VA 3ZI4A 1TJ5A 3R4CA 1Z5UA 2I7DA 4BKMA 1QQ7A 2JGAA 1JUDA 3P96A 4GXTA 4KYTA 3ZUPA 2HSZA 2FPUA 3FVVA 2B1RA 4Y3UA 3RFUA 5AW9A 3UM9A 2G1AA 1TE2A 1ZD5A 2HOQA 4L6CA 2MSNA 5AK6A 2I6XA 4UASA 5IT4A 1S2OA 3N1UA 5AW0A 5ALSA 4UW9A 1RRCA 4NAVA 3KZXA 4CF5A 4BYGA 5ALXA 2YMLA 2GMWA 4HGOA 1RMTA 2W4MA 3L8EA 3SHQA 3DAOA 3E8MA 4UARA 4ZEWA 2AUTA 2PQ0A 2OBBA 5AVVA 2WF5A 3HYCA 2P9JA 2FUCA 1L7MA 1K1EA 3I6BA 3PGLA 1EK2A 1WZCA 2FPRA 3ET4A 2NYVA 4J03A 5AI0A 3PGVA 4YCMA 2JAOA 4UMDA 4OFZA 1SWVA 5ALWA 1U7PA 2HF2A 5AVQA 3UMCA 3IB6A 5ALPA 1QH9A 4E88A 4UU1A 5AHXA
chains in the Genus database with same CATH superfamily
1P74A 2JFUA 2Q0XA 4MVCA 4O4LF 4XB2A 2WIFA 2P2SA 1QGYA 3LCVB 3C39A 3PNSA 2VDPB 4Y0VA 4YMTA 3BRWA 2ODEA 3PHIA 2MSWA 1B23P 1CQWA 2PL9A 2H1WA 1P2GA 1J97A 4KGDA 1TEZA 1S4QA 4Y9UA 4I1UA 4R54A 1JR3D 2VSNA 2WIKA 4XR9A 4RA6A 1RAAA 4UFOA 6YASA 3M6XA 3DJFA 1F9EA 1PEAA 3A1WA 4IH4A 5B58C 1XXHB 1TKRA 1N25A 1R0ZA 1EG7A 1SC9A 2C3PA 2HCRA 1FUKA 2ONYA 2I7XA 2YHBA 2XDYA 3UO8B 4AKGA 3ESAA 5D00A 2C31A 3HFJA 3II6X 2OZVA 4EGFA 1X7DA 2E18A 4LI0A 5LMUB 2QXYA 2ZIGA 3QM1A 2JI8A 4V3BA 1A0OA 1XF9A 2DBVO 1LZLA 1W59A 3FNGA 4MTLA 4QVIA 4BGVA 1R6TA 3WO0A 1CYDA 3WLAA 4GSLA 2FX3A 4WXRA 2L18A 4OUDA 3IALA 1KZ1A 3Q6IA 1T9ZA 3T54A 3WSVA 1YB4A 3HXOA 1M6YA 4OYLA 3RYCA 4GW3A 4M8LA 4MHTA 3BCHA 2ZI6A 4XPIA 3ZJYA 3WL8A 5L3SB 3EIXA 2PBZA 3WXBA 1N1DA 4Q66C 1WBJB 4R4JA 5FL7D 3HXLA 2NP6A 2BCEA 1EHIA 1S2LA 2TMYA 2LBPA 1MXHA 1PNVA 1ZMRA 3MAJA 2B8EA 4HSGA 3L7MA 4CHGA 1GRRA 3ZE8A 2EXXA 2X14A 1VPVA 4JXJA 1DC3A 2IQIA 3W34A 1ZCBA 5IBRA 1F6DA 3N07A 3RRMA 3BA1A 3D5TA 1XYYA 3FTNA 5CHEA 4TV8F 1TPZA 5HKKD 3A6JA 1ZGCA 2A94A 3MPUA 3OIFA 3T3NA 3B6MA 2O5CA 4ARCA 1Z8FA 4YV7A 3NOXA 4B81A 2HWXA 2C9ZA 3P0JA 1K9VF 5BV8A 4Q48A 2FQQA 2D1TA 1QHFA 5HP4A 2Q3EA 1ORRA 1PGJA 3JARA 3HYRA 1J7KA 2X1MA 4PNEA 1C4XA 1X74A 4FSHA 1IG3A 1W94A 2C9DA 2JK0A 2SECE 2YY5A 3UWOA 4IDNA 3WYDA 1LPMA 2JA1A 2W2XA 3M6MD 4QSHA 3ZDYB 1NVFA 1XNRB 3IIMA 3IUJA 3O47A 4HRXA 4UQOA 2HZBA 2ST1A 2WWXA 3D6AA 4ZXPA 5DX1A 1MPTA 1G21A 4MV8A 3EZ9A 4G9GA 4J0KA 2BFOA 5E38A 1UXHA 1U9IA 2O23A 1UDWA 4UNRA 3DMPA 5LYJF 4FI3F 1SPXA 3IH5A 2YJ6A 5FNZA 5TEVA 2JBHA 2OHIA 4W4TA 3T4PA 4ZYLA 5B2EA 4BB6A 4QAJA 3RIYA 2POQX 4Q9AA 3K9CA 1XEXB 2GD1O 2GYWA 4C4SA 2VZ8A 4LK3A 2OAEA 2MIIA 3AUAA 4JR2A 4HYEA 1AKVA 1E92A 1MRSA 3P9QA 2EF1A 2ZE8A 2GBFA 4BGIA 1YKSA 7ADHA 5KYWA 3OA0A 1V2GA 5KPJA 5K2MA 1NKVA 2Q7XA 4NMXB 4R7TA 2C2HA 4HADA 4CZ2A 3I72A 1KK2A 3DV2A 5LD2B 1UF9A 4EW1A 1IJBA 2P9YA 1N7IA 4B3DA 3ON5A 2M6SA 4YRJA 1KZ7B 2LUOA 1NXWA 3GEDA 1RHJA 2RHJA 3L6CA 3DEJA 2BGGA 2JGNA 3N86A 3PL5A 2CUKA 2OBXA 4RAOA 4N6OA 1M33A 4WMLA 4F97A 5I51A 2IOQA 3VO8A 5F3WB 4X8HA 4UMVA 1WUTA 4G8CA 4QUDA 2AFHB 5KKNB 3SYTA 3TBFA 4H7KA 5D87A 4YRBA 1ZH0A 2WVAA 3HA3A 3AF1A 4YJGB 2BH9A 3NANA 4JN6B 1JVNA 1VP3A 5DF1A 2ACVA 5AVOA 2Y1OA 2MU1A 1BJRE 1GR0A 2CLDX 3C3AA 4KQFA 2CYCA 3SFZA 2HMTA 4RHEA 3OE7A 1P8JA 2PKRA 4LKRA 1JSLA 3ZV7A 3IS3A 1R37A 3H5LA 3O4VA 2PAFA 3U44B 3Q10A 2R4TA 1HY3A 4C0WA 3DTVD 4CG0A 4O4JF 1GP2A 4L9WA 3AUJB 3WRXC 1PI3A 3K0EA 3EEIA 3ONEA 4LGVA 1IY0A 4JJAA 1ADCA 4EB6B 3F5DA 2I5PO 4XI9A 5E7QA 3TF5A 1LKZA 1UODA 1MEOA 1K89A 3DVAB 3VSEA 3R9XA 1A4XA 3UATA 3LHIA 3UK2A 4TKVB 5HQJA 1JKXA 1DG1G 1HF3A 2XITA 3SEFA 1FF9A 1KK0A 5LXTF 3THRA 2LKCA 1FFBA 4Z1MA 3ACBA 5GPBA 3FRJA 3CLVA 5I9SA 5CFQA 2QENA 5LNK1 2M6RA 5GV8A 3I6QA 1SBNE 3DZJA 3I5UA 4BVLA 1I94B 1QU2A 4D9BA 3DUWA 1DKUA 2XJ4A 4GX0A 1GILA 3C3YA 4NJEB 2XTZA 4YVFA 4ETIA 2TECE 3HU1A 4R1QA 4ZKDA 3O8NA 1Z16A 5A3VA 1O0SA 3YASA 3IUMA 4YRRA 5LJIA 5IT5A 1W36C 1C81A 3P1JA 1B0UA 2A5FA 4GXQA 5IT0A 1VSTA 2ZDHA 4K6KA 2Z6AA 2WD7B 3DNFA 1VKNA 4OJMX 4U3JB 4JL5A 4WNCA 1P1JA 2AJTA 2C8JA 5KOYA 3MK31 1E7SA 1SXJB 4YONB 5LA6B 1V37A 4AY4A 1D3AA 1YGPA 4BNGA 3KQUA 1E2BA 1LJLA 1IDOA 5KWIA 3CZQA 3BXEA 4WADA 1S3FA 1KFCB 3VKUA 4ECEA 4WERA 2YMQA 2PUWA 3FSGD 3LDHA 4ETNA 3PI6A 4NCJA 1REQA 2WOJA 1T9CA 2FZGA 2FE1A 5G3ZA 3TQTA 2WDZA 3IO3A 3P2OA 1BE1A 1Z8DA 1RXEA 3A25A 4FXOA 5EIBD 5EJMA 2O7SA 4P5PA 1RWQA 3CEPB 3G7UA 2FPMA 2ZJAA 4G0OA 4HLUC 3S27A 3HVUA 3T3PB 2BD0A 4C7XA 3BS4A 1CZHA 5HCUA 1U8TA 3OPVA 4XGRA 4AP9A 1FVFA 3ASZA 4QU5A 4CM1A 4KQKA 5BWCA 1YWGO 2DT5A 1LVGA 1MIOB 3GFSA 3KTFA 1K7SN 3FGOA 1D5WA 2BMFA 1LC0A 3VR6A 5A5EA 3NW9A 2G5CA 3CIFA 1ZWKA 1ML3A 3DSRA 4D4GA 1JG7A 1R0WA 2YC2C 5JJBA 1QR6A 3OPYA 3D3NA 2X4IA 2OLEA 4PNHA 5ICGA 1Z75A 1SQGA 2H4FA 4BDSA 3KKPA 2ZZMA 4POAA 4ID3A 2WM3A 4YRIA 1PZGA 4N3NA 1XZIA 1GPH1 2E4AA 3JASB 3K7EA 4R9UC 4HDMB 3SX0A 1DXQA 3QU4A 3R9WA 5SZKB 3M6FA 3Q3VA 2LDXA 2JLYA 2RAUA 2QYHA 3WBKA 2Y1FA 1USWA 2HD4A 3MAGA 2PX8A 2QAGC 2Y71A 4EEZA 4CEIB 4EDHA 1CDZA 2JAXA 2OBFA 2XXBA 2ZUVA 1JMYA 4RYDA 5LLDA 2E4WA 4UNIA 1M1YB 3T3MB 1AO0A 1WDKA 4OSPA 2ZW9A 1T5HX 1KYVA 2C03A 1R16A 3KFLA 3UG6A 2ISQA 3TSCA 2I7CA 4EENA 3QQPA 1EQAA 5I9MA 2DJIA 1NTOA 3UAXA 4PTLA 1WD7A 4IRUB 1B1AA 1GN8A 2D0OB 3N76A 3PA8A 4PS0A 4RF4A 3RHTA 2GJ4A 3QE2A 1N6PA 2O0HA 4CTOA 2O2EA 3FKSD 4PSAA 3MUNA 2BSAA 5F1OA 5DWDA 4QAQA 4ZHQB 1X38A 1C8KA 5C32A 2FFQA 2OCDA 1BW9A 5B2ZA 1Y81A 5ILGA 3WLIA 1I6MA 4BJ1A 5A2GA 1MABA 1DV1A 1V41E 3NHYA 1H4SA 2QVXX 4HQRA 1OY1A 1NG1A 1Y4AE 3ELBA 2QD5A 1XNQB 3OOEA 2G88A 3TE7A 2BGUA 3PVZA 2ZTHA 1AG9A 4ZEXA 3O4FA 5CT5A 4L1KA 4MVJA 4DYDA 1D07A 4I55A 4PQYA 3QOWA 3TZHA 2MDTA 1JKJA 2J7PA 4FEAA 1RTTA 3EPJA 2O0MA 3TPCA 3C5HA 1IN8A 1J0DA 1N6KA 5ER6A 1IHYA 1HZZA 3E3LA 3TUZC 2AN9A 5DIFA 1FVOA 3G88A 1QRRA 2LKDA 5ADWA 2YN4A 4DLAA 4UPDA 3ASUA 3PGXA 4RMJA 3MXTA 1OFIA 1FJ2A 3Q2OA 4GPD1 3ZLUA 2BKAA 2AFVA 1DBQA 1FDRA 3AHJA 4JIMA 2CE2X 3T1NA 3NVMB 2AKYA 4A6XA 2WTNA 1ZOLA 2VHZA 5DNCA 5H81A 5AKZA 3KJEA 1RW4A 3GARA 1SK9A 5F5LA 2WAYA 2XZDA 1N5KA 3D8TA 4K8OA 4BO9A 4PAQA 4B2PA 3N3AC 4HH0A 1CF9A 3PWZA 4FFWA 1SD1A 4RF3A 2G7ZA 1PFVA 2L2QA 4Q47A 5CPBA 3T9FA 1CUXA 4DY6A 3NASA 5BSHA 5FOQA 1JEQA 4PLPA 4ND1A 2WJHA 4F8YA 4O4HF 4C76A 2E82A 4EKYA 3MD0A 2P5TB 1JEYA 1NLFA 1V7ZA 2JGDB 2ZSJA 4M87A 3BQMB 5T4FA 3KB1A 3EZNA 4KOEC 3T7JA 3QU5A 3WI7A 5ELMA 4KO8A 4LWOA 4MVJG 4MDEA 4KMMA 1LWNA 3PQ8A 4E70A 1CB7A 3EFOB 5CX4A 5GONF 2VDUE 1SUEA 5B3AA 3FPFA 4Q05A 4ZT3A 3FMPB 3QYAA 1NQOA 1TQ2A 2XRYA 4HQFA 2DLDA 2XGJA 1TZKA 2QRQA 2I1QA 1N2CE 3A6GA 3P0IA 5AMXA 1TCAA 4KPFC 2UUAB 4PHCA 1JWAB 3WOHA 2B7BA 1RXWA 2G07A 1KDOA 5FBLB 2FZWA 2RGUA 1RYMA 5K0SA 3ZCTA 4BKRA 3GNSA 5IM4F 3ZQUA 3GV0A 3ZOZA 2BRUA 3R7NA 1V47A 1UDBA 1XNGA 4B3XA 4AJ1A 3KX2A 5CR9A 4S04A 1JPVA 2OENG 5FBWB 2C8KA 1YO6A 5BMVA 1V4VA 3SS7X 5IUNC 4URFA 4UCWA 3SLKA 4J7UA 3JPYA 3DV9A 1N5IA 1M5UA 3SM3A 3LLSA 3K9GA 1LS6A 5CFPA 1GXSA 3GLHE 1N5OX 1XMJA 1V3TA 2FEPA 4WINA 3TCKA 5EY5B 3KDAA 4KN5A 3BJIC 2BEVA 3VPFA 3CNLA 3NJRA 4PEVA 1FRQA 1OXVA 1NMEA 3UTDA 1IK6A 2XA1A 8GPBA 2PGOA 2CLEB 1EYZA 1XU7A 3U7HB 3V80A 2HKIA 3FZNA 5HQTA 1CEQA 1WPGA 2VZLA 5DLDA 5CD9A 5KB3A 1F0KA 2GCIA 1E2IA 2HMVA 1SRRA 4Z4CA 1M2OA 3KEMA 2PZAA 2QX7A 3GJQA 5LZ9A 3PXXA 1NXOA 1FJHA 1OLUA 4AXXA 4IIDA 2QI9F 2I8LA 1IPFA 3B8EA 3GYBA 2IYUA 2GLUA 4MPRA 4MW5A 2V4UA 3SKVA 3WDKA 3V8EA 5JDCC 3W5DA 1OJ7A 2J5BA 1X7ZA 3F46A 4WFKA 2I55A 3SXJA 5HSGA 1W85B 1UR5A 1L7VC 4OATA 3L1VA 3V46A 2CHQA 4LSWA 5KJ6A 1H0SA 5D7NA 2XAAA 3HNPA 4RDIA 5F73A 1H9BA 1M76A 2BISA 2V6IA 3HXQA 3OJXA 5DHPA 3VBCA 3GVCA 4NXMB 1K4YA 1NZDA 1FFHA 2CB0A 2B1RA 3WGJA 4MB6A 4F4FA 2C98A 2WSIA 5D3QA 5JQGF 3TUJC 2Y67A 1E5LA 1HFWA 3CGGA 4B73A 3FCSB 1K88A 1P4SA 3KCNA 4J75A 4MW1A 4W1PA 5JNVA 1X8LA 3F6BX 3HHEA 1TVKA 2HHHB 3LD9A 3WGKA 4QPCA 4E2WA 1MHPA 4L28A 1OWLA 1JNYA 2J08A 3GA5A 3OM1A 3FRIA 5T6MA 5DYIA 3ZC3A 1IHXA 2AI2A 3R3VA 2NZXA 1EBFA 3KUCA 4U1RA 1OLXA 3CUYA 3L05A 4B47A 2HQ1A 1JECA 2BN4A 4RLSA 4UQPA 4CQLA 5M04A 1M2WA 1FQWA 2TMKA 3ADOA 3UHJA 1NKTA 2ATIA 4EEXA 2LZ0A 1IEVA 4AMUA 1RMTA 4BQPA 1WOYA 3JAKB 3BB4A 3D7RA 4NU0A 3Q9LA 4Y8VA 1VA4A 3E8MA 1Z2AA 4W5WA 3I9V6 3R5SA 5IDYA 3LMKA 1JHYA 1C3OB 1UMCA 2P1DA 4J8PA 2BBSA 3IMKA 1P91A 2P9JA 4UD6A 1KDVA 1J09A 3RIXA 2IC5A 1EJ0A 3UAZA 4BO5A 1SK8A 5HCIA 1N36B 1NRJB 3DAGA 4D42A 4KHZA 2OZLB 4H3HB 2CNNA 2O2IA 3VZCA 1XDDA 4RKEA 1BC5A 4P33A 3ECCA 1T9HA 4IX9A 1ZKDA 5AI0A 4BB9A 5H02A 1XO1A 3JZFA 2FSIA 2ZRQA 4OFZA 4D98A 1QTQA 1PTKA 3CXUA 3UMCA 3EXAA 5ICFA 3IE2A 3ZWCA 5EUQB 4UCFA 3RSGA 5BQXA 1IIRA 4XDZA 2NUPB 1GTRA 5AO9A 4D26A 4GHWA 3V8MA 3OF2A 1C0LA 4ZP1A 3JQDA 5DNDA 1CBUA 3ZXXA 4D8YA 3EDOA 4QRHA 1P7PA 1NC1A 2H1CA 1A1VA 1WY7A 4LZPA 2QVZX 3RWBA 5IP5A 5SYMA 3H9UA 2C7RA 2CY0A 3LKZA 1ONPA 3L01A 4NU5A 1H3NA 3OU7A 4GEKA 2UVPB 2FP4A 4L4XA 5F12A 2XYHA 2AN3A 1A9XA 4B0PA 2KSQA 5D5PA 4B5LA 4FILA 4DA9A 1SVUA 3ZE9A 4U6SA 3V3TA 2F8LA 4RY2A 2CDAA 2I3DA 2IOFK 1Q11A 2B78A 2H9YA 4MW2A 1QO7A 2WG2A 4BLOA 1Z74A 2NZ2A 4R8VA 1U7WA 2HB6A 2P9HA 5D6OA 3PXCX 1ZN9A 3N2GA 3K8OE 1XRLA 1C3VA 4Q4HB 3P20A 5E4YA 1JHZA 2WPDA 4BUZA 1U3UA 3RNLA 1GGMA 4FKMA 3C3XA 4A0GA 4L8YA 4B75A 2CNWD 4ZCQA 2B0CA 2ZRLA 1ULBA 3EASA 1J2UA 2AD5A 4J43A 4MWEA 3KL4A 1JQLB 1TW2A 3NVAA 5I4CA 1YZKA 4UHEA 4LX0A 3QLUC 2B1GA 4YMLA 5T8KA 1G9XA 4EQ6B 1JN0A 4NS1A 1CD5A 1N2GA 2I78A 2QPAA 1RYZA 3U49A 3UHPA 3OPXA 3NWBA 4E13A 3UAWA 1NBME 4Y7DA 4NK4A 1XMXA 1KJIA 2EKZA 1DX9A 3G1TA 1T36A 2IYQA 4RH0A 3WL7A 1R4NB 4ZMSA 3KT8A 1H2AS 2P27A 1GUYA 2AUNA 2VVTA 2RBEA 4BECA 2ZUWA 3M33A 4ABTA 3KSRA 3QX8A 2FETA 3I2HA 1KI6A 3OH8A 3O4IA 3TRFA 1IG0A 4EG8A 7MDHA 4JELA 4N0QA 4TTPA 3I52A 4B83A 5JLJA 3GF4A 1AX9A 2W6JA 4MQLA 4HLCA 4RQTA 3EBPA 3VH2A 4CKCB 5J5CA 2OESA 2NZWA 2QG9A 1V35A 3AB7A 5D51S 5KNDA 3PZRA 2QD2A 1C2TA 4EYSA 2ODWA 3WOVA 3ZU6A 5GADl 2HX1A 1SKBA 1SCAA 2ZBEA 3OZIA 4UZEA 2P2DA 5KYYA 3ZBTA 3V8NA 1SKMA 4YJHB 3CPJB 3G9XA 4N4AA 4CLRB 1U1GA 1OBFO 2AOTB 2EX0A 3L18A 4XX0A 1VYUA 2CNBA 4BNHA 2Z9BA 5JH7F 3QA3E 3F6YA 3MBOA 1QYVA 3GT7A 1JEDA 4MCJA 3ETHA 1OAAA 1H2FA 2QNRA 1NKSA 1OT5A 1K8XB 3MWDB 4PG8A 2FG5A 5KTOA 1SOMA 13PKA 3T1VA 4JZYA 4KPEC 4BNYA 4XJVA 4RJIA 4BRSA 1JPNA 5A4FS 4EF6A 2JFXA 1V16B 3THXB 2ZREA 4PYNA 3U26A 1Y34E 2VUTA 1E7QA 2HCBA 4M9RA 4LYHA 5DOZA 3HB4X 1BDBA 5E7IA 4D44A 2IYXA 3IQXA 4DL9A 2P9ZA 4LYJA 3UHFA 4IXTA 4DC9A 4O8ZA 1XVTA 4HQ0A 3DB2A 4KGVA 3DXZA 4BNZA 1EX6A 3GFQA 1GPKA 4H7DA 3OHSX 3PNOA 1UXGA 4OA5A 4OMFG 3I2KA 4DXDA 2BHTA 3EXEB 2JFHA 1QG6A 1ZI9A 3M6IA 4URVR 1EMDA 5CK4A 1FUUA 2NSHA 3BGVA 1SR8A 3L0DA 1H94A 3ED1A 2RHMA 2IODA 4CI0B 1QHSA 3N2ZB 2P6RA 1EESA 1SVKA 5AKLA 4D9GA 3EULA 1WUYA 3M81A 4L78A 1YA6A 4Q3CA 5JNUA 1GPMA 4YJ2F 2B61A 3OQ6A 5K9ZA 3KKEA 3N6XA 1PUIA 2IUUA 3GDOA 4BQSA 4MYSA 1YJ5A 3JQEA 4W5QA 4Q3EA 4E94A 4MRAA 2I65A 5K20A 2ZROA 1DIBA 1NUSA 3L0CA 4Q4JA 1AK1A 4LZOA 4C22A 1EFUA 2JFVA 4X1OA 3K30A 1GV0A 2R8YA 2VPQA 1PGQA 2GNAA 2VUSA 4U9HS 1QBKC 4BZXA 3HB0A 1UZAA 1J70A 2YR0A 3PITA 3UKJA 2BEKA 2TSYB 3K2EA 5JRDS 5DM2A 4XA8A 2MINB 3K20A 4MGYR 5JI3E 4B4DA 2R8PA 3D59A 3JQFC 1GPAA 1TQHA 4RGBA 4ZRMA 2JKZA 3RODA 5J5AA 3UW3A 4CU2A 2CUTA 2PLFA 3H86A 3CWCA 4PSDA 2QPLA 5JAMA 1WUJS 4H9GA 5AKGA 3O31A 3HEBA 1CC1S 3IEXA 4ISBA 1J5EB 5HXAA 3ABOB 1D2NA 1EIZA 1MJGA 1T4BA 3IODA 5EP4A 4XJTA 4U2GA 5FTLA 3GD5A 1L1EA 4RWZA 2G9NA 4F3KA 3VYRB 3S8EA 4CL3A 4GMFA 1E3SA 1F38A 5DRTA 1RYBA 3CLUC 1U0RA 5BSMA 3K09C 3E22A 4LTMA 1X1EA 2GK7A 3HACA 4YS6A 2ONKA 3MA0A 1WDLA 3R09A 1US8B 4WGGA 4JLAA 5GONB 2ZWVA 4XIJA 5LCXA 3G3EA 1PF7E 3G68A 3LBFA 1YT5A 1T3GA 4IICA 3BIJA 4CCWA 1ZGBA 3WYCA 4EKNB 2W0SA 2NUAB 4Y6PA 1VBNA 2R1ZA 3F3MA 2ZRBA 2JFOA 5BMOA 4ACAA 4DLWA 2GQ0A 5BYAA 4MI9A 3EF1A 5IS2A 3S29A 4ETMA 2NZJA 3P26A 4BO2A 1BRTA 3LYAA 3PSAA 3M4XA 2H59A 3C70A 3OF5A 4QGBA 2HGZA 5DM70 1IHOA 4U5XA 5H9WA 4OHBA 1SIOA 2WNHA 4TWZA 4HAXA 3SYNA 1SQ6A 3D0RA 3NM5A 1XQXA 3REOA 3OJLA 1Q0UA 1VZ3A 4KE6A 1J0EA 1OROA 2HIGA 2VAXA 4KNYA 1Z9BA 3Q3HA 5GM2A 1ZU5A 1CQJA 2JFYA 1YRHA 2QM8A 3NFYA 4G0UA 4MI6A 4DNOA 2Z5GA 1E7RA 1ZD8A 2VH1A 4QJIA 1DWPA 3DDNA 4HFJA 2YZKA 1N6NA 3MT8A 5IC5A 5AK5A 3UJ6A 2PE5A 2JKYA 1GLGA 10MHA 5HA5A 3ETGA 1SUBA 3QH4A 1CZNA 1CP2A 2B4RO 2GCPA 3CKKA 2JATA 1F2TA 3I2GA 1XLWA 3REFA 4Z4HA 1GA4A 2O19A 3QMPA 4EUSA 1G1AA 1CDOA 4B4OA 1P9LA 4WDRA 2D7DA 5KTNA 4YLYA 3VKWA 2A1UA 1X1CA 3GVHA 4A91A 3EOAI 4TMYA 3NV7A 3WFIA 6GPBA 4HDSB 3E03A 2QT9A 3B3QA 3BF7A 2XWSA 3H5WA 4B2IA 5JWHA 2IWHA 5E9JA 3ORSA 1GKIA 2NU8A 1O6FA 1X7GA 2DBYA 3MWJA 3VVMA 2CHEA 4DA7A 4WN9B 4I4LA 3U2QA 1DDGA 1OH6A 3ZWXA 1EXDA 1MB4A 1N1MA 4R6WA 3VC3A 2YVAA 4EATA 3NONA 4OL0A 4RTRA 1M1XB 4JI7B 1Z0AA 2IA5A 4I9UA 4LYFA 1GKKA 1MRNA 2NQTA 2QEQA 2DGDA 4K9QA 4PX5A 3UMVA 2A0UA 2V8BA 1M1NA 2FE4A 3FF1A 1DQYA 2HK7A 3P2EA 5CLLA 5E9AA 3D3JA 4YV0A 5JNTA 1B42A 1II9A 4U7DA 1G2IA 4LDRA 2VDQB 4RTPA 5BR4A 1DIAA 3FVRA 2P6NA 4X20B 1MC5A 3SCZA 2FEAA 1MPXA 1O1YA 1PP4A 1UKAA 2X5NA 3IVMA 1MAAA 4FQ8A 3V8VA 4ZJYA 1JAZA 9ATCA 1SXQA 2AW3A 2AUMA 2RFLA 1IPHA 3H11B 5BWBA 1KTVA 1C30B 4CT4B 1KKLA 2YX1A 4ETWA 3Q9NA 1TADA 1DP4A 4CM8B 2JL1A 5BR1A 5CJPA 2UYCA 3QEMB 4AWBA 3ULKA 3NDIA 2Z3VA 4FC6A 4JIGA 5I8ZA 3RABA 1TYEB 2OAP1 5TRTA 5K0CA 4PNPA 4CL2A 5IPFA 2UZ1B 1RCFA 1CS4C 4FDTA 4G5YA 2HMSA 5K01A 3ZNQA 3I9JA 1KP2A 3FYHA 4CEHB 4L3VA 2A3NA 4Y7CA 3G9QA 3FOFC 2FW1A 4GG1A 3EB9A 4DCOA 3I3SR 5FR2A 4CR6A 1I0IA 1YDEA 2C4NA 1USIA 2I7VA 4MS1B 4EW3A 1B4DA 2OP1A 2DUWA 1HE8B 3IPXA 4YV1A 3WAGA 3EG9A 3EXHB 1UXJA 3NIGB 3VV3A 2Q41A 4MKFA 2CNLA 3HVIA 1JJFA 3FFTA 4M46A 4BNUA 3PQ3A 3T9EA 2IK8A 5KNCA 3IVGA 1CZRA 1DO2A 2OM2A 5AUQA 4V0RA 5JXIA 1NUQA 1SOAA 1U5CA 1VGVA 4FYJA 3BPSA 2JIRA 2IL1A 1QB8A 2NTJA 4TLCA 1V43A 2H07A 1IOLA 2IY7A 2Y93A 4KU4A 1EUDB 3T3IA 3E7XA 1T0IA 4KRXA 1T43A 1RWBA 4JEUA 2VHJA 1CPYA 2W2KB 1FMTA 3KJHA 2EZUA 2ZEJA 3AI1A 2QP4A 4PS1A 5CCXA 5JV5A 3L07A 3MLAA 4D0RA 3VNUA 1BMFA 2HFJA 1M2GA 2F67A 3N58A 4LZNA 4R1TA 2ZVQX 2WM2A 2GJ9A 2E5LB 2V4MA 3PYXA 4ZEMA 5EIXA 1S01A 3PIIA 2OCYC 3ECSA 3FNBA 3P9KA 2TMGA 4IIGA 4QBGB 4YCLA 3AM3A 5LNK6 3RYHA 1PZEA 4X1YA 3HY3A 4IO0A 3G7SA 1ESNA 4NXNB 5AXCA 1HLPA 1KY4A 3BMOB 1Z4NA 2AV6A 4KI7A 3G79A 3UBMA 5ALGA 5EWLA 3MUFA 1W0JA 1TLTA 1ZH4A 2ZR8A 4OP2A 4ZVUA 3HYNA 5IKXA 4EG4A 2FFBA 2PLAA 4N5MA 4P32A 5J2TF 3TJMA 3F6RA 3HWWA 3GRUA 3UQYS 4J0EA 4AY3A 4M88A 1A9SA 1L3IA 2ORIA 3BKXA 3UT6A 1H8HA 4EGQA 3I28A 1JA0A 1JX6A 1CDEA 3IQEA 1N0WA 3IDOA 4ND6A 4F9GA 2R6CA 4Z4QA 3WISA 3DHYA 4IILA 1G0NA 1M6VB 1QHNA 4B8ZA 1Z8HA 1ZPDA 2YBEA 2P69A 1H0RA 3H17A 2ZS7A 4CM3A 1ONSA 1I4LD 3TGWA 3BFPA 1F8YA 3W2TA 4MITA 3AQ4A 3P0FA 1BVRA 2J32A 1L5MA 2F3UA 2VFAA 3AFOA 4MMZB 2QV0A 1T5IA 2LV8A 2GZSA 2O48X 4O0MA 4QDTA 3CNEA 3INGA 4F5EA 2J3JA 1NF2A 1JMVA 3BMNB 3I9KA 3KRTA 4HAZA 4LJ6A 1QM5A 4EB8A 3A1FA 5IF9A 2RB5A 4XM0A 3L0YA 4K6HA 3JVIA 1DC8A 1B73A 1T1SA 2OXFA 3K70B 2NO1A 3H2KA 1EVIA 1XR3A 5KVCA 4LJ9A 4ARBA 3AEKA 1EUCA 3DPUA 1HTBA 3OTQA 1KZ9A 4QGSA 2BEUB 2C82A 4R2KA 1CFZA 2CXNA 2WTEA 3H4MA 5DLYA 3GGCA 3C5VA 3PRHA 4M0LA 5EKSA 1ZUNB 3C41J 3LPCA 5B7QA 2UUCB 1M73E 1UWCA 1ID1A 2AXQA 2HRZA 2XMZA 3CH4B 4UEOA 4C87A 1G5RA 1E20A 2BP7A 1COWD 4O2BA 5BRJA 3NTOA 5ITWA 1RM0A 2NPIA 3VNBA 2VTBA 3CUSA 2VTEA 1XZHA 3RYFB 2ZM6B 2QB5A 2A5YB 4HNAA 3WIUA 4C9BA 3FCEA 1R0YA 3ZI4A 2EL7A 4E1VA 1AV7A 2XCIA 4GNKA 4S2EA 3UUEA 4OSOA 1SBIA 1Z5UA 2WYUA 3CNBA 4KXNA 2C7OA 3OM9A 1DS6A 1EE1A 2ZP1A 3E3MA 3EIQA 3LC7O 1VM6A 2P1ZA 4FNOA 3OE5A 1J7JA 3O4JA 3TXYA 3U40A 4N12A 3ZDAA 1DFHA 4AZSA 4Y1FA 1ABBA 3UM9A 4RZIA 3ZU2A 1MDBA 2HSGA 3SIRA 3HABA 2JVJA 1PSDA 5KKCA 1ZD5A 2XXJA 3JQAD 5DGDA 3U4QA 3SOZA 3TQSA 5JCXA 1FSGA 2IZZA 5KTTA 1YHYA 2GN2A 1O0BA 4NCNA 4PFSA 4PZUA 4GLLA 1KU6A 1TEXA 1U2GA 2LPMA 2Y3IA 3EOBI 4I8DA 4D6YA 4I1VA 4GC5A 3GUVA 1EJ6A 4UBMA 3SK0A 1W5BA 2FZEA 3DUFA 4GZ6A 4FBGA 1ST2A 2RK6A 5AHWA 3SZ3A 3OMXA 1LF5A 2JCVA 1QVRA 1M34A 1PVVA 4EB3A 1HR0B 3JWEA 2BF7A 4ENRA 1KL7A 1R50A 1CLEA 4V24A 1IUNA 2W4MA 4DDHA 4EAQA 3E5NA 4UBKA 3NM4A 3IMFA 2E1RA 3Q1KA 1NVMB 1ONOA 2VS1A 2AUTA 2XHEA 4K9OA 1X7HA 1ZH8A 4MIYA 4W5HA 4LF7B 1PLJA 3WWZA 4R1UA 4NEQA 1XTZA 4DSNA 4M1OA 1EE9A 1H3FA 3DVLA 2HWKA 3FWHA 4LE0A 4QFDA 1EK2A 4JSYA 1Z6AA 3QKSA 3MFYA 2CDNA 5CYOA 5FTJA 3EQ7A 5CFRA 1NI4A 3CX4A 1C4KA 1TA4A 2BKUA 3R7DA 3GDGA 4NATA 1QAMA 2AHOA 2JEOA 1W8IA 2ZQZA 3PFKA 4TXMA 4BFXA 3CZAA 1JHRA 1HL3A 1K7EB 3L3BA 2Z5FA 4XFJA 1W5FA 2WR8A 1WF3A 4RK6A 2BTQB 1NXSA 1A4IA 2ZUBA 5TQ2A 1T9KA 5A9RA 3AM1A 5KX5F 4GX5A 1C4OA 2GR9A 3DBHA 4PVDA 1HEYA 4XSHA 1QS0B 4RZUA 1ECGA 2OYRA 3WSTA 4C4RA 1U8UA 2YHSA 3RSZA 4TN1A 3HJUA 3ID6C 4ILEA 1SXJD 4DMRA 1RQLA 2EJTA 2E5WA 3L7KA 4FZVA 1W2GA 4YRAA 1PFUA 2O8NA 2NN3C 2OFPA 3H7IA 1RI3A 4UE6A 3WNVA 4XOUA 2D5LA 4IDCA 4AW9A 3E8SA 3GLIA 4KI0A 2XZTA 3F71A 1UWVA 3G6KA 3IFSA 3PE6A 2BE9A 4TWBA 2C5LA 2Y1CA 1KF0A 5FUQA 3H5OA 2J5XA 4KWTA 3DOUA 1ZN7A 1OR8A 4M9UA 4UAUA 4MROA 4U2FA 4HDRA 5C4GB 4JFRA 3V32A 1LVUA 4J4BA 3AR8A 4ALMA 1D6NA 3ZDQA 3R3JA 4WCFB 3JQ6A 3I3OA 3TOXA 4CNQA 1P18A 2AVDA 1RR6A 2OB2A 2VNIA 1G5HA 1HEIA 2XDWA 1SWWA 1CE8B 4KXYA 4BMNA 3DMTA 1YJCA 2PEZA 3H5AA 2HBYA 5HIMA 4YUWA 1M2JA 2EHJA 3N8NA 3PWSA 3AF3A 1XDUA 3WGMA 3T5AA 4RH3A 4TUYB 2R1TA 5CIWA 1JQKA 4W9NC 4XM2A 3RK4A 2B2CA 2R751 1HUQA 3PNKA 4NP6A 1KSGA 4JQSA 4AMZA 3AI7A 3TN7A 1ZU4A 2C4MA 4HRVA 4ABYA 4AJ4A 5CYGA 3SMVA 2PN1A 3LQYA 1WB5A 5CXSA 1OI3A 5ICCA 3V7UA 2CJPA 3VPAA 1LQTA 3FDIA 2OBYA 3SJ7A 1G98A 2J85A 5FOTA 4P3NA 5DV9A 2IPNA 3GEBA 2R48A 1T4MA 2WAOA 3ZD9A 1KEWA 2P3LA 4JBYA 4RY0A 4E5MA 1J6UA 3HB7A 2GPAA 1F0YA 2G7MC 1IRIA 4V03A 5HEKA 2F8MA 5ALOA 5BYJA 2HUNA 4ZAYA 3NGMA 5THQA 3NNNA 2B1JA 1IK4A 2CXTA 3TTWA 5KSYA 1NE7A 1I7QB 2PUAA 4KH1A 2CLFB 1U2SA 4PRYA 2WTAA 3BWBA 3Q8LA 4OHMA 3Q12A 1D2EA 4PSVA 1G3QA 3L8FA 5LOVB 2O8CB 3AFHA 1GADO 4XTCS 1XMOB 3E5HA 4CFYA 1W88B 3AF4A 4ZPXA 2A9OA 4LXIA 2GI4A 4A6DA 1DUVG 1H2EA 3OFNA 3MWLA 2H4WA 4F71A 4GPTA 1UPAA 1VDZA 2C54A 4KLZA 4L73A 3U4CA 3OFVA 1WLSA 2FOIA 2XNCA 5K1ZA 1AZSC 1ZVKA 3TGPA 2OGWA 1T2CA 2RGWA 3VR2D 3WTCA 2EG5A 1A8IA 2X1HA 3C16C 4NFLA 2ZRJA 4ANFA 5IH7A 1V9SA 3FFWA 4GPAA 2XAUA 4RVNA 4R81A 1U9ZA 1GAQA 2J33A 4H17A 2DHDA 4I19A 3NHWA 4UUAA 1MVNA 3RTCA 1NIPA 3HJFA 2ZRKA 1KQFA 2X15A 1HORA 5F98A 3ZIDA 1F4VA 4E3ZA 1JFSA 3BGOS 3HNOA 2ZIZA 1SBYA 1ESEA 4C3VA 1YSCA 1PW7A 4Y6OA 4D25A 2MYUA 3TBHA 3QSYA 4GOJA 3BMCA 1JB9A 3DOOA 4WZAB 2Q9UA 5FNVF 2VTDA 2R1UA 2WWVD 3U7IA 4AY5A 2WWYA 1S7GA 2CXRA 5LU9A 3FDZB 5DYTA 3H2IA 4HDAA 4B17A 2GEUA 3N8DA 1H9AA 2DVMA 3EBOA 3QW2A 1PVDA 3ELUA 1MO5A 4FCTA 4CDGA 4BGUA 2ZYVX 1X13A 3W5JA 2C2OA 4AO8A 4DIKA 1Q19A 3SPXA 1V3VA 5FA6A 3PXBA 1XWWA 4RZQA 4TT3D 1VHJA 4Q9HA 1V8PA 4XW2A 5ALZA 3OIUA 3TMYA 4ZCTA 2VDNB 3FOBA 3H5IA 1ZR2A 1YR3A 1SIBE 2AF3C 2PR7A 2O3SA 1TT7A 4N54A 4IIJB 4FLMA 3S5UA 3TKLA 1V9CA 3S44A 3O2SB 5CXUA 4LOHA 2D4HA 2AQIA 4CTJA 1E62A 2F3RA 3CZ9A 2FMIA 2G3YA 2VEOA 4WTOA 4O1IA 3TTUA 2QGFA 4AJOA 3AG6A 2LWIA 2E48A 3BILA 4GVLA 4LVNA 4NE9A 1IQUA 1E5TA 4QXAA 5CHYA 1XL0A 4UNQA 1V8BA 4JLVA 2PRJA 1QKKA 1P0MA 2VT7A 5K0JA 5H8WA 1OYWA 1FOEB 1SBQA 2ZTSA 3JWPA 4G89A 4DLXA 1AY0A 2ZVPX 3K1JA 4GX2A 4PRLA 1P39A 2VYFA 1IY8A 4UE3S 1MJGM 4CV3A 5J4LA 1CY4A 1SC1A 2IUEA 3UOAB 1EWRA 1G4HA 1GUAA 3WLSA 4EHKA 1JA1A 1AZTA 3ZGOA 2VHEA 2Q4OA 3QF4A 2I4NA 1N2BA 4UU7A 4D92A 3HJAA 4WIAA 4KE7A 1WUHS 1YIAA 1YJBA 2EZ9A 4G84A 1J8FA 1NQUA 3D3KA 4KPUA 4PR3A 1OGJA 2FVYA 5I47A 1AKRA 3VDNB 2C59A 2CDBA 4P58A 2BOVA 3SFTA 3E58A 2O7NA 1VYHA 1NX6A 2I8AA 1QX3A 3LA6A 4FNGA 4HYQA 4ZOBA 3VNQA 4RZXA 1JR3A 4OAPA 1HE1C 2JHGA 4ZVKA 3LX6A 2X1VA 2I6QA 1OBOA 5CVUA 4IMJB 3SP1A 3R7WA 1OWPA 3JQQA 3OLQA 2ZUCA 3HJRA 4RVFA 1RIIA 2HU2A 2HO5A 5DDIP 4P4LA 2WMOB 5BSUA 3AL2A 1X92A 4RAQA 1GITA 5HVNA 4WAUA 4CM7A 5I3ZA 1R9NA 1R6DA 2PXXA 4MPJA 2C2GA 1FFAA 1FA9A 2O2ZA 4IUBS 3WB9A 2IYNA 2RGEA 5K8IA 5EVCA 3ZZNA 3EARA 4EA7A 4IXNA 5F1KA 3WL5A 3KPYA 1PS0A 2C2KA 4RPIA 3L1IA 3L6OO 2BUCA 1EG2A 5IM5A 1NWCA 3CLSC 4KZPA 3GAAA 5HQ3B 4IFBA 4PZDA 4K8RB 4P3PA 5ARCA 1D0IA 4H6XA 2IYFA 1S4MA 5FL7A 4TRJA 3DE2X 4BS9A 3RASA 3X1DA 1MO6A 1PN3A 4ER3A 2FR8A 2XDAA 5KNLA 3HCFA 1OV4A 1WKVA 4B3IA 1EI9A 3O3NB 5CT4A 5ETJA 1XX6A 3ZLBA 1I14A 1CRZA 2FPGA 3D7MA 2XCTB 1L5RA 4Z9YA 4PN3A 2ICAA 1G55A 3LGSA 1Y8QA 5SZJA 3OG9A 3KAQA 1NVVQ 3DF7A 2C57A 2R79A 4HY3A 2MYNA 1JG4A 4HDKB 5F7XA 1UM9B 4CCSA 1NZJA 1WBDA 5HKKA 1FYDA 4XIGS 4N9WA 2AN1A 3DBIA 4JVMA 2XYGA 3AHEA 4RDHA 4RZSA 1U5BB 1RMQA 2QLLA 2XUFA 3PFHA 1L3CA 3K9FC 3WLRA 1Q0PA 3Q8KA 1QVAA 3SS8A 2OD7A 4BIMA 1TU4A 1MD9A 3OQPA 3TQIA 3EMDA 5DTQA 3G0OA 1YQWA 3D6HA 1P2BA 3A9CA 4PM4A 2AEJA 5E6RA 2IUFA 3V4LA 5L40A 4Z49A 1MW9X 1U2RA 4R9NA 1JYFA 1VMDA 2NV0A 3KUXA 3ZE6A 4C4AA 1CB0A 4G0MA 3A3YA 3TMAA 4XZ3A 1ABEA 1WTAA 1E2KA 1FJXA 1DV2A 4REOA 2BGIA 3G2MA 1GO2A 3L7IA 4B6OA 1YTUA 1KY2A 1QFZA 3LQ2A 1HZJA 3GYGA 3LBYA 1S8FA 1QPBA 5DBFA 3SLRA 5I7FA 1LWOA 4FR0A 1UDAA 1UT8A 1PZFA 3PQ2A 5ICSA 2QJRA 1FQKA 2GRAA 3M9XA 5HUHA 4GBMA 1IWOA 2DH6A 1NW6A 3AR2A 1NOIA 5I7RA 1R0BA 3PICA 1DIOB 3QU7A 4OXQA 2PO5A 2DEUA 5DX0A 4Z3OA 4IIHA 5U4XA 1JBEA 1UEIA 1NUPA 3NYRA 2AEFA 4F12A 3MTAA 4TKZA 2XUZA 3EVBA 4AG6A 2IIVA 3NXSA 1BWSA 3GAFA 1DDIA 2BGLA 2ZUSA 6LDHA 1JBQA 4ARVA 5J9FA 4FE7A 1WPQA 2PR2A 2AA3A 1QX4A 1FRNA 5C51B 1KPGA 2I99A 4IQ0A 3INTA 3ZZUA 1LPSA 3HVHA 3LLVA 3SYKA 3T52A 5B2FA 1ZQ9A 3G2PA 4N65A 4FYYA 2EQBA 1YGYA 1K5DA 5AW8A 1RJWA 2DLCX 1CXZA 4QT0A 1WO8A 2FN9A 2YZGA 3AVOA 1L4MA 1QFYA 1KXZA 3MINB 4G1UC 1FXWF 3PC8A 3T7RA 1P31A 1GGFA 4M98A 3FFAA 3Q15C 3NATA 4BPBA 1KERA 1I51A 2HA6A 3HZHA 4P98A 4WACA 1KI2A 2ZYTX 1F12A 4PLCA 2IU0A 4RQUA 1KC1A 3LP6A 3PDWA 3EEQA 4IH1A 5AI8A 2FJPA 3Q3IA 1JIKA 4FFRA 4WBNF 4NOJA 1CJMA 3SXUB 5AVYA 2QLFA 3M4YA 1U3DA 3DTVA 3QZUA 4FR2A 5FWDA 3B1KA 3DF9A 4HWSA 3MWGA 4IJQA 4LXGA 2BI4A 3NHRA 3OICA 4X7MA 5FUBA 3SLGA 4CBVA 5EJ5A 2XCUA 2V7WA 3BORA 2XBLA 4FQ5A 4WUTA 2AOVA 1GUZA 2BR3A 2JVKA 4FFSA 4JLPA 4UM5A 2AFIB 1L8LA 3KFXA 5LQUA 2VPTA 1RJ9A 1SCJA 2PV0A 3CY6A 3QBVA 4L5AA 4ZREA 3UUFA 4YYEA 4CM4B 5KSOA 1K8YB 3ACDA 1MGPA 4IDOA 4Y1RA 2ERCA 2C9BA 4HN9A 1FLDA 1SBCA 1G3MA 4CODB 1GT6A 3R40A 1MNQA 4TV9A 4URHA 3OOWA 5F4BA 1X42A 4EHJA 3FB1A 1G20A 1NBWB 1O9HA 3GDFA 1KI1A 1Q50A 3CWQA 1WDTA 5CB4F 3T0IA 2ILVA 3EQ9A 4OXKA 2IX3A 1U8FO 1VCOA 2WUDA 3BD9A 2O1SA 5LQDA 2R6DA 1U90A 5BV7A 4YUZA 4GOMD 4V38A 1PX0A 1YB2A 2POCA 2N75A 2EGGA 4PLGA 4OQPA 3GLVA 3FMIA 4EL0A 1QBGA 1OIWA 3DWGA 4DR6B 3VKGA 1VBFA 4HZIA 4GI3A 1A4RA 3B6EA 4YGXB 1A8QA 1VMAA 3UC5A 2X9GA 5BN3A 2RJOA 5I8PA 4L3OA 1XQ1A 3FPKA 1IZYA 3OWXA 2WZBA 5IMBA 1E9AA 2X3FA 2YIJA 4HJRA 4OIMA 4R2JA 2JJ2D 2IH2A 1WAMA 3BWCA 1KIAA 5ALYA 3S7ZA 3FSGA 1Q74A 4KQJA 2O2HA 3R5FA 2ZJ4A 4MUKA 4R3WA 4DWVA 4DDMA 3BVPA 4RY9A 2PL3A 1KBQA 4TXHA 1OZ0A 2C29D 2AH5A 4I50F 4RA6B 4KBFA 3ZN2A 3L1KA 5CVJA 3ZQ4A 1KPIA 4TXJA 1RBQA 1HOXA 3GC6A 2V03A 2VAPA 4HWOA 2AXPA 4IHJF 5K0FA 3HXKA 5SY4A 3WADA 1E9DA 4K1XA 1SEVA 3IEKA 2P9QA 4O5AA 1II0A 1NQTA 3PUWA 2WE7A 5BURA 2O3UA 3DAFA 4H3SA 2FG7C 4ESOA 4HATA 4NMLA 4OUDB 4QJ5A 1W76A 5A7FA 1QB7A 3JD4A 4UEQA 2O8BA 3WWYA 4O8CA 1GSOA 3RYCB 3U5ZB 4IWNA 4QDUA 2D8MA 1ULUA 3RSCA 2XE4A 4Z9XA 4TZ6A 3VC7A 2YJGA 2EIHA 4RVCA 2BZGA 2VNHA 4AK9A 1JUDA 4M3NA 3MRVA 4PIMA 4FGSA 2OQIA 3WNDA 3KWLA 4BBZA 1ZVVA 2VK2A 2QW0X 3TW8A 1M2FA 2RIRA 3AETA 3BZUA 3RLFA 2WVGA 5SY9A 4DBLC 4JU8A 1FLNA 4Q3OA 9GPBA 4MHOA 5L9AA 4BEJA 1QYXA 4IJKA 1QFJA 5FOXA 3ZQJA 1ZM3A 3IHWA 1PJRA 3NORA 4J0JA 4KV9A 3RVLA 4AJPA 5JAHA 1QIJA 5FNVB 3N1UA 1K27A 5CCDA 1Z07A 5EXSA 4BKOA 3FKSA 4IUDS 1DOZA 1QH0A 5CVDA 2W2VA 1XRMA 1PT7A 3GDHA 2IYLD 3C97A 1DJMA 2H48A 2YNMC 5FOSA 1ZK1A 2GA8A 2BF4A 1EWKA 2M2IA 1IHDA 3QLJA 3PDIA 2YOGA 1ECBA 1WNTA 3ND8A 1BDJA 1XBTA 2K6GA 3HWX1 4QXPA 3LPMA 3PQEA 5EI5A 3SC2A 3WB1A 4H4CA 4H1TA 3K6SA 2W6MA 4ZEWA 2GD6A 4LZJA 2C95A 3U0BA 4ATNA 3G0HA 1MTZA 2ZYDA 4YWJA 4OI4A 3T7TA 3QP9A 4CLDA 3OSZA 2R6R1 4KACA 1ID8A 3B78A 1G21B 2QV7A 2RH4A 3QHPA 1SVIA 2P4QA 3O4GA 4DB4A 4EG3A 3KSUA 3OZXA 2VRWA 4DVGA 3ABIA 3AF0A 1WHTB 1NBAA 3D7LA 5SZIA 3VU8A 4YCMA 1AKMA 4EIWA 2JAOA 1PU2A 1G7RA 5H59A 4AQDA 4MO2A 2AI3A 3OZVA 4W8HA 2P65A 5LP1A 3GEGA 4R01A 3PCXA 1CR0A 3K2BA 2GYYA 2A1TR 1A9YA 1EX1A 4XYEA 2GEVA 4ZGBA 3U80A 1ZMOA 2X1LA 5ITZA 1EWQA 4OFXA 3AFNA 3PD0A 4TMTA 2AYZA 1ISJA 3QBJA 1HQCA 1P6QA 4LSZA 1KAEA 2V9PA 4UNSA 2OORC 1LB1B 1Q1AA 2WICA 4KHPB 4B7UA 2D5AA 4QOJA 3F97A 3FF4A 3AXTA 4EW2A 4OMCA 2BKEA 4Y98A 2CMHA 2WOOA 4UNNA 4JWKA 4RCZA 1CT9A 3JD0A 1UQRA 5CTAA 2VJDA 4A10A 3SSAA 1SU4A 1PT9A 3L7OA 2KX7A 2VDLB 2FMXA 1Q6YA 4XGNA 3RG2A 1ML4A 3ZKWA 5JXWA 5DGIA 5C7OO 3FHOA 2WKPA 1HEUA 3ZS8A 1GNSA 1B7GO 1GPDG 3R24A 1KY5A 3T5CA 4DSAA 3ABZA 3KOZA 2DQYA 1T34A 2O9JA 3EGEA 3L0ZA 3VBEA 2BSQA 2CZQA 4AJKA 2HLNA 2BAGA 3OIGA 3PGA1 1JZSA 3Q0IA 1H6BA 2HC9A 2NUBA 4IVQA 2AR0A 2XUPA 3B20A 3VI3B 1UXIA 4L16A 3VH4A 2PVSA 1EINA 4L5CA 1J23A 4TWAA 4EHFA 5JAQA 4IF4A 5DP1A 4AX4A 2Z43A 3EX7C 2OA0A 2R7LA 3HUDA 4P7JA 5D3MA 3W8NA 1R64A 1SIUA 2FOLA 1JLMA 3VOAA 4EFKA 5DI9A 5AP9A 3UFBA 3ISTA 1P7VA 4BBAA 4ENVA 4CG3A 4CKEA 2G9RA 3ZZ1A 1LRKA 1NP7A 4M0DA 1VKZA 1DTEA 1YOVA 2QG6A 2N46A 3R9XB 4H6WA 2F43A 1P5HA 2IYAA 2HNBA 2V6MA 3PE3A 4X44A 5HW0A 3PTAA 1T2DA 1VOTA 2GESA 1QANA 1HRKA 1RPNA 1GT91 1JHMA 1OIVA 2W4QA 4INPA 3UYKA 3WS7A 3VNVA 2CEKA 2W42A 3G82C 4XWYA 2RH5A 4NZNA 3KSDO 3GRKA 4V0ME 4Q9KA 4FJ2A 4GF5A 4LHZA 3RUAA 1WP9A 1DDOA 4PE5B 2RGXA 1VJCA 3MB8A 2H8GA 1OYYA 4PYIA 3RVNA 3UXMA 4EFLA 2RGCA 3L6RA 3NMUF 3E81A 2ZI3A 2Z2XA 3G85A 4G56A 2ZI4A 1IRXA 1AQUA 2WHPA 2ZBPA 4YN3A 3MEQA 1CUBA 3B9PA 3KLBA 3RPEA 1R6UA 1K3TA 1GCGA 2I29A 4OHXA 2H00A 1YACA 1BOOA 5NULA 2H2AA 1TQ8A 1LI7A 1TCCA 3U4IA 1KYZA 2RKOA 4N5HX 1H1LA 4LJLA 5LUBA 1D2RA 2RHGB 3RR2A 5FHRA 3UWSA 5JCZA 4LE2A 2YWRA 2HLDD 3LNTA 3KVRA 4EITA 1AMUA 4YDSA 2AN5A 4L5JA 4Y6QA 4BP8A 4X63A 4DSOA 1KEVA 2ZFUA 3DFMA 3HBMA 4S0ZA 3E05A 5LQSA 3TI7A 3VJMA 5B1EA 3DEKA 5AJHA 3M5PA 3H1TA 1PR4A 2P30A 3L93A 4CTKA 4DC1A 2YJ3A 3LC0A 2CFSA 4W9MC 1ZRMA 3F2IA 3TQFA 2EBHX 3KBBA 3MLEA 4OBWA 4G8DA 1B8VA 2XMDA 2W2QA 4ZOLA 4I1PA 4RV9A 1GAJA 3FUTA 4NBWA 4QWMA 1XKLA 1TMKA 1JIIA 5TSDA 1ZNYA 3FI9A 5A4DA 4UTNA 3LQFA 4DUPA 1I9CA 3A1UA 4KQWA 2L42A 1C1YA 3T5GA 3BWDD 3KNZA 3FD8A 3IQZA 1H2BA 4ZEVA 1B6RA 4PPQA 1C2YA 3ONWA 1E8MA 3OPYB 3K9HA 1AGPA 4KVZA 4MKHA 3UTCA 4F9EA 1FDSA 1L5VA 1NNLA 1VIMA 4AN0A 3ANSA 3EZ2A 1BA3A 2WV9A 3TTXA 1GPLA 4ZU1X 1ZEMA 3P9RA 4WOBA 3O2JA 1BDIA 4NKRA 4PANA 5HKBA 4ARUA 3A26A 2VQFB 3RYIA 2OO3A 1CUDA 4KXVA 3LUJA 4ZU3A 4BU1A 2C4HA 4GPEA 1NU8A 3RQSA 3A27A 4E5PA 4LC1A 1P0QA 2PRIA 2I4MA 4G97A 3ODGA 4LI3X 5HHTA 1ENZA 3ITDA 2XGSA 2ZJ5A 4X97A 5C5EA 1KJ9A 1P0PA 1RLUA 3DXXA 4DABA 3NLLA 3TQOA 16PKA 4YECA 4OBEA 5JUWA 3PLNA 2GO7A 2HXSA 1O7JA 1Y7IA 5K6AA 4BQIA 2P2YA 5L45A 1NM5A 2B7LA 2DWCA 1X9GA 4M22A 1D0VA 2OG1A 4PLHA 1Z25A 4BLWA 1T10A 1BHO1 1BW9B 3KB6A 5DTIA 3KZVA 2XV1A 1MABB 5IEJA 4GECA 4ZO4A 1CUHA 2HWYA 4G5QA 1K92A 4F91B 3FGPA 3GRCA 3ZJUA 2G70A 1MC8A 4NYIQ 2QL6A 4U6NA 4QPNA 3TG8A 3OUTA 4X8OA 1QTRA 1PYGA 3P0HA 4GM0A 3RKRA 4OXRA 2VP2A 1LPAB 5EXDA 4Z9FA 4I55B 3L8DA 4L02A 1N34B 1X7WA 3O8BA 1JKJB 1SBHA 4MMYB 2AYYA 4XCXA 4PHHA 1UIRA 3GUCA 1ZK3A 4WSOA 3UMMA 2O3RA 2F55A 1YFKA 5CB4B 4HZGA 1FSPA 2W71A 4URXR 3KLOA 4NDZA 4N7JA 1T2FA 4H4EA 4YQZA 5JYDA 5TJHA 4FMPA 2NO6A 1DJQA 2CDRA 2CNWA 3DBOB 1E3TA 1Y8CA 3N7TA 1TTHA 4WY8A 2H7XA 3I05A 1OI7A 2VWHA 3RU2A 1NDUA 4Q39A 3I53A 1XZFA 1YZQA 2REQA 1O3YA 3T4XA 1J0BA 3D4NA 1WR8A 4ZDWA 2D59A 3UN1A 5BWLA 1FFCA 4W1RA 3GVPA 1TTTA 1FNSA 5E4FA 3JWHA 1JI3A 4L4ZA 4EPXA 5SYAA 3GCDA 4KDRA 1BOFA 2HXYA 5IT9A 2XCRB 1RBZA 5SV2A 1TJPB 3SIPA 2WYIA 1WIWA 1JEQB 2J3IA 3X0DA 4BMXA 4EPVA 5E1DA 4FMDB 2A57A 2FWBA 4M55A 3KU1A 2Q5LA 5I8WA 2Z8XA 3FOEC 2QE6A 2RGGA 3NWOA 5TEWA 1V11A 3ZTWA 4YT2A 1M67A 2BBOA 3PDJA 4N9QA 4D9JA 3UK0A 2XNKA 1HYEA 3HLKA 5H80A 3ORQA 4TX1A 1J4AA 5KOIA 1GEGA 5LWQA 3BXPA 2NZVG 1G6HA 4QVGA 4V0SA 1J25A 4PAGA 1SELA 1K5HA 3SQLA 1USGA 4D4LA 4MYCA 2BHRA 1ZQ1A 2F17A 3D8UA 1TXGA 1Z26A 2QTLA 1OTYA 1QWSA 1BE6A 1NXTA 1NBIA 1JW9B 1O2DA 4XGIA 1R5JA 5A05A 3WDSA 4LF8B 4B3TB 4B32A 3KBOA 1HLFA 1I3LA 2A0XA 2B37A 4MLPA 4EGCB 3CYFA 3MT7A 5DLEA 5BMVB 1W5AA 3UXYA 4BEBA 1RS0A 3LV8A 1YI1A 1W5SA 1VXOA 3W5AA 2O20A 2X3YA 2DHEA 4OI2A 1W47A 3RVJA 2NACA 2JLSA 2QQEA 1GXSB 2V45A 4R8MA 1FNMA 4LY9A 4RVOA 4TWRA 1Y9AA 5AOAA 1RLIA 3QUCA 3Q9UA 4OQYA 4P80A 3TECE 4KMSA 2BIFA 2XE6A 1Z2PX 2BEVB 1DTWB 4IVNA 5TVKA 4RO0A 4B6RA 2K7FA 2IY9A 4MUBA 5IUKC 1WD5A 1A7AA 3EXHC 1XCPA 3GI1A 3HSSA 1KMCA 5JECA 4KXWA 1K98A 3O9ZA 3H2HA 3ICPA 1CDDA 1M1ZA 2P2ZA 3OY7A 4UUMA 1LLCA 3VSDA 2A2ZA 4J7AA 3GLTA 1M2OB 4IDFA 5ALDA 5L3QA 2YKGA 4WKGA 4ENSA 1OLUB 2I2WA 2VXOA 4BRWA 1YVDA 2Z2KA 3HDQA 4ZVMA 1EP2B 3NJ4A 1UAAA 1IEQA 3QYJA 1ZIPA 1C41A 3IERA 1FS5A 2H92A 4NBKA 1V6AA 1X7ZB 4PR0A 4OQDA 4PZPA 1D1PA 4EUKA 1EX9A 1CQZA 1FFGA 4EB0A 3C8UA 4R1SA 3A11A 1G2QA 4A6EA 3F49S 1JG6A 2P9GA 3Q6MA 3FSJX 1QAQA 3NFRA 3PJDA 5F7OA 4DV5B 2YYZA 5A03A 5C18A 1LI5A 1X0XA 1E6UA 3AW8A 4XUGB 5DK4A 5CU7A 3DFUA 2ZITA 3ZE7A 3FTEA 3VTZA 1U0BB 3FBWA 4NYIR 1PT6A 1VSBA 3R0IA 3C87A 3N8IA 5LBUA 4JV5B 3CLUD 5G0TA 1GSHA 3SVZA 4F8EA 5F9FA 4MGZR 2QPTA 3WL3A 1IN1A 3G6WA 4QO7A 2V3VA 1VLMA 3CEAA 3DOJA 1JBKA 5DYNA 1SHKA 3BJEA 1NW5A 4B6GA 5CFLA 3AERA 3D54D 3IX7A 1GQQA 1Y42X 2DPMA 4BFVA 5I5EA 1UDRA 4BHTA 1GNTA 2QL5A 3H2JA 1T4CA 3G5MA 3Q5DA 3Q6NA 3TCNA 1OLXB 4ERXA 1NJ5A 1RZRD 1EFAA 3NBAA 1UC4B 4MJ3A 4CQLB 1I5EA 1L7XA 4II3A 4PZ0A 3WMGA 5C8YA 3KQLA 3PS9A 1BEUB 2ZXEA 4ARAA 4W82A 2W2TA 1GVNB 4NABA 5KVQA 1ETHA 3U7RA 2ZB3A 3U39A 1LDMA 4GT1A 2II6A 4I4NA 3ILYA 4JX9A 2ZT5A 3QKTA 3LU1A 2BKXA 1WETA 2QTNA 4WFQA 1HG0A 1RRKA 3LL7A 2JI7A 1PQWA 1RNLA 1UMCB 4RPCA 4QJBA 5COAA 2ZU0C 5LZ2A 5G41A 1AKWA 1NLYA 4N3BA 4Y18A 3BZWA 4QSMA 5HGXA 2KLHA 2ZSKA 3IUEA 1PK7A 2FWJA 3PK0A 3K70C 3ICCA 4I36A 3WGHA 3GLKA 4X71A 1YZGA 3EVTA 3B5IA 4I46A 1T0UA 1J2JA 3IOMA 1JI0A 1E2JA 2XUKA 3UAVA 2X3UA 2I6TA 3DFIA 1U2TA 1XVUA 1P2DA 4JT4A 5FF9A 1OBVA 2RI0A 2AEMA 2ZB7A 3ETCA 2CJXA 3DR3A 3R1IA 4KUHA 4RPKA 3WYFA 3CEJA 5HJ2A 4TKMA 2H5JA 3MQFA 4LNUA 5FULA 2WQ7A 3CNHA 3FTCA 5DCYA 1DAOA 4ZQHA 2CVHA 1UJ5A 3V7WA 3Q7IA 2QVGA 5K3OA 4LHSA 1XTQA 3I9NA 4LWZA 1FU7A 4E14A 4CV2A 2Q5HA 4F9FA 3UPUA 2FP4B 1VIYA 4D57A 2QZPA 1A9XB 2Q5FA 3OLZA 4OQ4A 4RX1A 1J2TA 2Q7OE 4UPEA 4YI3A 1KEZA 3M0EA 1Z5PA 3FNHA 1PJ3A 1MV8A 4KFTA 5ERYA 5JSKA 3CMCO 7AT1A 3ZWWA 3AGQA 3MTEA 2VYND 1LJUA 2WMNB 2ZYRA 3JCZA 1EUYA 1L4GA 4A92A 1QWOA 1VI5A 2CNOA 3N2GB 3ER8A 5DOVA 3CNQS 1AMNA 2PKEA 4S3MA 3WLEA 4QWWA 4BMSA 4GI2A 1NSFA 4Y30A 1NULA 5F64A 4CIWA 5DHFA 4FX5A 4PQEA 4HDCA 2PZ8A 2YFQA 3WLHA 3NS7A 4O4IA 5JOQA 2Q27A 3OTOB 2X5XA 4WDQA 2YHIA 1QSGA 1HDIA 2GNPA 4E5VA 1ZJ4A 5JWRA 4G07A 3JQBA 4BKMA 1KMMA 5JSZA 3VO1A 1DARA 2XQVA 1GZDA 3GB9A 4OXNA 4GMDA 3E9CA 2EOAA 2FPUA 3BTSA 1ZIDA 5DFAA 5TGDA 3TRHA 4F6LA 1FE8A 3C5EA 5FQOA 3ADCA 2EJBA 1N92A 2CXSA 3DEZA 3I9FA 3MW8A 2QUJA 4X3OA 2IHUA 4KIJA 5A7HA 3R74A 3T8YA 4ILKA 5J4KA 1A5ZA 1BH6A 1KI6B 5I4IA 3ZY6A 3LX8A 2XVZA 3KQOA 1RHMA 1W9MA 4LZWA 5KSPA 4AYTA 3BFXA 4GR9A 4QLAA 2FW0A 4NAVA 1DJPA 3RREA 2PMDA 4E5NA 4EO4A 4DRZA 1XDGA 4AMVA 1XLTC 2QL9A 4ZCIA 3EGIA 1ZKMA 1Q77A 5EINA 1WL8A 4RKFA 3EQ6A 4ZZ2A 1E2PA 4RMGA 2C58A 1QVWA 2A88A 1IZ9A 4NZZA 1DKOA 2GCEA 4NECA 2Z1MA 3TNDA 3I8SA 4MCAA 2RHOA 3ZBQA 1VHDA 4XX0B 5M2QA 4C7MA 1AA9A 2QMUA 3U3RA 3OQOA 2XT9A 5KNBH 4DQDA 4G0XA 2C99A 1GRVA 1XXHA 4KRYA 4DQVA 2W90A 4GMHA 4KSCA 2NQ2C 3BC1A 3I83A 2HCTA 3SHOA 3V7FA 3HCCA 2Q3HA 4R84A 5CH8A 3WGGA 1P5RA 2IHBA 3IGFA 1ISGA 2G1JA 2AB0A 3GGOA 4QPJC 3U4DA 2QROA 5CDYA 1L2TA 4GBED 4EKDA 3HRIA 1KZYC 1RSZA 4OQZA 3D1VA 2F59A 4LS3A 4ALJA 1ACLA 4WCFC 4CIAA 2REBA 4V39A 4DSTA 1QP7A 1P62B 3GT3A 3PB3A 1P9OA 4FYVA 1L0BA 2Y05A 3KV1A 5B3JC 4I7EA 2AFRA 3T34A 2FSHA 4RTSA 1EVKA 1RQPA 1WXDA 2AF4C 4AMGA 2EKDA 4QXOA 4B34A 1JDVA 5C1IA 4G81A 1NATA 3I4LA 2QUZA 4P22A 4TSFA 3PX3A 4TMVA 3ZHVA 3RVMA 2VG8A 5AICA 4AFNA 5KI6A 1DBWA 1CV2A 1K6IA 1ATZA 2V3WA 1PBTA 4PN7A 3CNOA 4MEAA 1NNUA 2YYSA 4UJ3A 2RK3A 5H9VA 3BSFA 1P4AA 5DNYB 1LPPA 1QE5A 4FE4A 2QRUA 1ZRSA 4HCJA 5HKAA 1Y7PA 4YH1A 2Y1EA 3N0RA 3TVDA 2VEDA 4Y1GA 4CLEA 5AUNB 3STUA 1E60A 3LO8A 1GA1A 4LQDA 2JCSA 1GUFA 1YQXA 3C3EA 4HNGA 4F1JA 1T9GR 2FX2A 2VJNA 5LN1A 3GJ6A 3TCXB 1T5TA 3LUGA 4LV6A 4OJNA 3VPBA 4Q4JB 4U4AA 8LDHA 2VHYA 1G8GA 1YRWA 4UM8B 1SCDA 2B36A 2ZBGA 1UK9A 4O2AF 4X1IA 1UANA 1AE1A 4GL4A 5IVIA 2H5IA 1MEEA 1H4VB 3PHLA 4JBLA 1P75A 2E7ZA 1I7LA 1ZIOA 3H6KA 3VVCA 2RGNA 1PEYA 4NYMR 5T4HA 1Z5NA 4QEKA 3TSZA 2AC7A 2DUUA 4GOND 1LV8A 5ADUS 1PG2A 1ZJYA 4GRIA 2A84A 1X7YA 4WJLA 3CONA 1Y9DA 2LNDA 4KRFA 3VM6A 1ZRNA 3RS7A 1UK8A 5ULLA 4FFNA 3E4CA 3Q8XB 3BD8A 1AZLA 1D6JA 3DNPA 4W1QA 5LQKA 2PU5A 1N6OA 1JFVA 3A6KA 1YMUA 3DPIA 3TEFA 1CR6A 2V7EA 1P4RA 3HDTA 3DD5A 2OPHA 2P35A 3ML1A 4FQ7A 3E22B 5C1PA 4WKNA 2BFEA 1WSWA 3GPDG 3P4UA 3FPHA 4FP9A 2ZRCA 3NBQA 4OBBA 3FLMA 2Z4TA 4H7HA 1AS2A 2BFCA 3U31A 1L5HA 5LDDC 3VGPA 4I9NA 1K75A 1ENPA 1QCCA 1UXKA 3JSXA 1ORVA 1IN7A 1LC3A 5JFTA 4BNMA 1COWA 1NVBA 3FOCA 1VE3A 3W1EA 1FTSA 2CK3A 3CX7A 1T6YA 4OEHA 4QQRA 5AFSA 5FIUA 1UPCA 4YP1A 1M8KA 3TTYA 5BY2A 4R71A 1RCUA 2OFWA 1F4PA 1T6XA 4HYTA 1G5IA 1FS6A 3M1YA 3H4IA 2IYTA 1A76A 4BLVA 2Q3LA 1O95D 4YIHA 2OV4A 5CTJA 1T35A 4P2GA 5DHTA 1QHHA 3QX9A 2H5LA 4G0NA 1QLWA 1AMOA 4MLDA 1PS9A 1CUEA 3GPCA 1VG1A 1ZCJA 3AJ8A 3JQAA 4PZEA 3KJXA 3ZW7A 1FNCA 1ZGJA 2FYTA 4MDFA 4U7TB 2XCQA 1VJ1A 2IEIA 5MDHA 1GDDA 5AD1A 1CQJB 5DWQA 2MTBA 1JZTA 2X5KO 3RUHA 3R5XA 1X15A 4ZN6A 4G1CA 2FMTA 1Y48E 1O6BA 2VOEA 4L7VA 4R9RA 4UEWA 2DPXA 3NNDA 5K3SA 1GL3A 3QSGA 4Q7MB 4JGGA 1RJEA 5KJ1A 4XFDA 1JYSA 1VE1A 1OBCA 3QI7A 4XEUA 4Y9RA 3RTEA 4M37A 1Z0UA 3GELA 4BP9A 4EJSC 5F2OA 1H2RS 1VKHA 3DL4A 3GA7A 1F2TB 3MJ4A 3VGJA 1PZHA 3BF8A 2XNDD 4GOOD 3W3AH 2Z2ZA 3IUQA 3K92A 3LWNA 1CUFA 1DAMA 2ZB2A 1Z28A 2C8LA 4MH0R 1GPBA 2A1UB 1VYVA 4TKVA 1XP8A 2ZAGA 2ZBUA 3F6PA 5IYZF 1YL7A 2HXGA 5JAIA 3VNSA 2WHYA 3LPDA 4GO1A 2QMZA 1G8KA 4ZCLA 5DCWA 2NU8B 3GT4A 3O1LA 2PZKA 3DONA 4D5GA 3I0NA 3K35A 5JD6A 1KDZA 1UC5B 1E9EA 1U0LA 1N2JA 1Y1LA 2W11A 2PVCA 4L95C 2XB4A 1SKUA 2FN7A 1M5TA 2GSWA 4DV2B 1U0FA 1UPBA 3IQHX 4TGLA 4DANA 4B3CA 2ZAIA 1PTJA 1Q7EA 4NOLA 5CA1A 1ZHOA 1E5QA 4MB2A 4F21A 1M1NB 3IBTA 4XJSA 3AJEA 4MZXA 1ZHHA 1TM2A 2QVLA 1J99A 4A5OA 3ST7A 1GPUA 4B84A 4MUYA 2G1UA 2JH8A 4CQMD 3KE9A 4F06A 1V7CA 1EFKA 3ZDFA 4QZVA 4JY7A 4O02B 1RABA 5FEMA 3SU8A 4IKEA 3DULA 2PS9A 1SXJA 5LA6A 1YC2A 3OKFA 4RDXA 1E7MA 7GPBA 1H2YA 3GGSA 5BV2P 3SQOA 4LXYA 4KVGA 4MICA 2W93A 2PSEA 1KO8A 5AVTA 4MK4A 2VJAA 1BQEA 4MVJE 1L5LA 2IPXA 1M6WA 2OG2A 2P4EA 3A6FA 3H9JA 3JWGA 3EUFA 3EC1A 1NNEA 4K6OA 1MG0A 4C21A 3RC7A 5JS7A 3OOYA 3SYMA 1Z3CA 3LP8A 2ZYWX 4HXFB 4KRGA 1FVXA 2YWJA 5IZCC 1HNZB 4EA6A 1OFHA 1EX7A 1JL3A 3EZYA 5FHQA 4D8UA 1MIOA 2QQGA 4JYAB 2EWMA 3EG9B 4FCVA 1XMSA 4I81A 5LB4A 1W93A 2PGJA 4A26A 3BD6A 4QOGA 4BWYA 5G40A 1RAEA 3SYLA 2Y4OA 1WU8A 1GNPA 1AA6A 5TXGA 1WXIA 2PUTA 4BN4A 3HLTA 4QUEA 2X9NA 4QELA 1TEHA 3MWKA 3T5BA 1RMYA 4FS8A 4S1WA 5HJ7A 3ROEA 2DETA 1EM6A 4KXMA 5G1NA 1KSHA 3GXBA 3QNMA 4U8GA 2H6EA 2IVFA 3TTTA 4US2R 3ESZA 4RHTA 5DEOA 3KLMX 5E4TA 2Z2YA 5AWFC 2Q9BA 3BA6A 1D1QA 1QIEA 4BJ3A 2AJCA 3QVJA 1FFEA 1UJNA 2X0FA 3VKVA 2OZPA 4EI2A 3V8BA 4PYJA 4CR8A 4RTMA 2QLMA 4IMPA 4MPTA 5D86A 1YZFA 5G4KA 2EFGA 4X1YB 3RVDA 4UBIA 4YNBA 4BFSA 5L6LB 3SX2A 4HXGA 5EIAA 2EF0A 4ZVRA 3NAZA 4DT1B 3O3OB 1TGVA 5DM4A 2RHHA 5EWLB 1LD3A 1DWUA 2VJOA 3KTAA 4BTLA 5K0EA 1FMLA 4BFWA 1U0JA 3BMQB 3R8XA 2Z9DA 3EXIA 2PXHA 3HXPA 1WW8A 4F2HA 3LBIA 5IJ0A 2IXGA 3IAS6 2YFKA 3NOVA 4L51A 3DM5A 4ZI3A 1XZJA 4Z3DA 4JI0B 1ADYA 1KA9H 4G3XA 5LZ5A 4N03A 5CP8A 3WIVA 3WLMA 5DASA 2BM0A 4IKOA 2SKDA 1Y6ZA 3VR2A 1A3CA 4GU5A 3A14A 4DV4B 5GM1A 4XX1A 1A04A 1K8ZB 2G6BA 5A9TA 4JP5A 4LNAA 1A82A 1GQOA 2A9FA 5BSTA 1KJJA 4FB5A 3OOHA 3IDZA 2GEFA 3LUBA 3FCUB 1TQ4A 1U2DC 2BZSA 2D13A 2BDTA 4PO3X 2P75A 1U1IA 3HEMA 2Q7DA 1YV9A 1JHUA 3PYMA 1P60A 2DM6A 3R0QA 1T2AA 3WIEA 4C0LA 1NW3A 2CSXA 1Q20A 2LW7A 3GMIA 4HAWA 1UKCA 5EE5B 1M74A 2PUHA 3MC1A 3AR9A 4WLUA 4FGKA 4A2PA 5EHGA 5INTA 5EYPA 1C3EA 2C61A 2HIHA 2I4LA 3D7SA 3P9SA 3OAAD 5EFOA 2ZTLA 5TS2A 3AEKB 3TUIC 4AL4A 1MIHA 1EUCB 5HTKA 4US0R 2AWOA 4E5UA 2AG6A 3GZJA 3TOZA 4BATA 1B2RA 4O4LA 1L7EA 2W8ZA 2W6ID 1YVUA 1V5WA 4PU0A 3V00A 3ZDZB 1OFUA 1DFGA 1MMFB 4AO6A 1UP4A 4BV2A 1Q1ZA 1JE0A 3VHXA 5HRUA 2GD2A 3UJDA 3WHIA 2ZB4A 1UQUA 2WZCA 4TT3A 2BP7B 1YH3A 3G5TA 3KAKA 1TMGE 2I67A 1AVTA 4O2BB 4A1OA 4BCBA 5AK0A 1PWYE 3KOOA 3OPNA 2ZSFA 4GYYA 5EE1A 5IW8A 4HNAB 1Q1BA 4MVJP 2WTMA 2D2EA 1BFKA 3A4YA 1BMDA 1QIFA 3CB2A 3CBQA 3ENWA 1UBSB 4DIEA 3M70A 1P44A 2Y6VA 3ABQB 3L1UA 1ZG3A 3T99A 2MOKA 2IFTA 1SU6A 2JCXA 3FKQA 4RLQA 2E89A 2WIJA 1VLQA 3AC0A 3I12A 4NS4A 3RBXA 3TVYA 4X64B 1EEXB 1A71A 1NW4A 4L57A 3Q88A 1VPWA 2QLJA 1PT8A 4LRUA 3NDPA 1K9SA 2HREA 3ETEA 3HDGA 4GKVA 1RCTE 4OY3A 5AJZA 5DYYA 3F8SA 3EC7A 3WQBA 3L84A 2UDPA 3P4XA 4MV3A 2JFQA 1UBUS 1F60A 1WXQA 2XOXA 1O4VA 2Y1LA 3D4BA 3T9BA 1N0UA 2NSJA 3G8DA 4E3WA 1XTVA 2XLBA 3AJ9A 1N2IA 3DUFB 3M89A 1I7SB 4TS1A 2I8CA 4A4DA 1M34B 1H1DA 2JLQA 1UMDA 1BGXT 4Q3DA 1OXTA 3OESA 1T9DA 4RJJA 1QG0A 2CZCA 3QVGB 2JANA 3WKEA 4XGQA 4OO3A 1E59A 4D4JA 2QYTA 3D8BA 2NYUA 1R12A 3G9TA 2Q2NA 5K8TA 1XJCA 3A4LA 1X77A 3CZRA 4DCVA 1ZFNA 3O7WA 2HPAA 3NOOA 4LRWA 2QT0A 4FDVA 4M54A 1P4JA 4TV8A 8ATCA 2GZMA 2R25B 4RLHA 1KETA 4WPGA 4DR1B 2GTPA 2LTAA 2P7IA 3F3SA 3K2IA 4NJMA 3QKSB 3IRUA 5JCJD 1EP9A 4G5GA 3V8QA 2FK7A 4UXIA 4K03A 3USES 3VYSB 4CQJA 3JSAA 3LF1A 4YAOA 1IJFA 1KU0A 2WMYA 3WLKX 1JFRA 2UZIR 1W9HA 4F3CA 3IDQA 3W2FA 3VJLA 3CG0A 2X0NA 4E6EA 5JC1A 2A8YA 4P34A 4WK6A