4HGRA

Crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
163
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGAKTEIVRRRAEALKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase, hydrolase
molecule keywords Acylneuraminate cytidylyltransferase
total genus 53
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgrA00
5AKKA 2PQ0A 2Q4RA 3L1VA 5AW6A 5AM5A 3SLRA 2CFTA 3I76A 3KC2A 4HGPA 4UARA 4J03A 1Q91A 2HF7A 1L7MA 2FUCA 2YJ4A 4O8CA 2OYCA 3E81A 4Y2VA 4Y2TA 5ALIA 4B6JA 1L8LA 3QGMA 3U7EB 2ZBDA 4HGNA 3FGOA 4Y2RA 2C4NA 1EK1A 3QUQA 2OA0A 1Z4IA 5ALEA 3U26A 2IOFA 1RMQA 1ZD5A 3NASA 4DFDA 1AQ6A 3ESRA 4I9FA 1XP5A 2B1QA 5AKZA 3AR9A 3L8EA 1VFPA 1SWWA 3L7YA 3NAMA 1RKVA 3UM9A 5AVVA 2HEGA 3OCXA 1JUDA 4Y2UA 2O2XA 4NWIA 3U7GA 2WF9A 4FYPA 2FDRA 4YCMA 3M1YA 1RKQA 1L7OA 2GMWA 4EX6A 1RMTA 3NANA 4EX7A 3FZQA 5ALYA 5AW0A 3ZI4A 2HOQA 5AVYA 3L0CA 1U02A 2IA5A 5ALOA 2OM6A 4EENA 2R8EA 5AIBA 1U2SA 3PDWA 3HYCA 4NV0A 2FPRA 5AK5A 5AKEA 1MH9A 1ZD4A 5ALZA 4XQ0A 3HLTA 3ZUPA 4KX5A 1N9KA 5AI6A 1SWVA 1LTQA 2RAVA 2I34A 2HCFA 2CFSA 1RC8A 3WKEA 2FI1A 3OCWA 4GIBA 2AGVA 3OCVA 1U7OA 2ZG6A 4ZEWA 1TA0A 5AKLA 2B8JA 5AI5A 4BNDB 3OPXA 2W11A 5AM3A 3WGVA 4BKMA 3OCUA 2GHQA 4KN8A 3SKXA 4YCLA 2FPXA 3P96A 1Z4QA 3DNPA 1J8DA 2EATA 4I9GA 3B9BA 4CE6A 4L6CA 1Z4JA 4BEWA 1ZS9A 4RETA 1CR6A 3PCTA 1O08A 2I7DA 1CQZA 2Q4TA 1RPZA 3WK5A 1Z4MA 5AKXA 3SF0A 3KD3A 2GHTA 5AW7A 3L8GA 4UMFA 4MWOA 5AM1A 2ZXEA 4UU0A 1NNLA 2YY6A 2IOHA 3ZW7A 4BYGA 3FVVA 3QUTA 5ALUA 4HGRA 3BWVA 2I6XA 5ALFA 2P69A 4HGOA 3WK8A 3ESQA 4NABA 1PW5A 2ZBFA 3I1YA 4CNQA 3CNHA 5AVRA 2PR7A 5AKIA 5AICA 1RMYA 3MN1A 4Y2SA 3EPRA 5AM0A 1U7PA 3A1CA 3QXGA 2P27A 2D2VA 1ZRNA 1T5TA 2EAUA 2O9JA 3R9KA 5AVWA 5AW2A 5ALDA 5E0OA 1T5SA 1ZRMA 2FPWA 3W5DA 2AMYA 5AW1A 4UMVA 2B1RA 5AM4A 2B82A 2FUEA 2YMPA 5AESA 1Z4OA 5AW8A 4JB3A 3AR7A 3ED5A 4EZEA 2HO4A 3AR3A 2YJ5A 2EARA 3ZU6A 3EF0A 3R09A 5ALQA 5ALPA 4C4RA 1TJ5A 5AI9A 4BX3A 2R8YA 2JAOA 5AK3A 4YIHA 2HF2A 2FEAA 2YBDA 3PGLA 1QQ6A 4UW9A 5JJBA 3KDPA 3RF6A 4KYTA 4YH1A 3U7FB 3RFUA 3M9LA 1RQNA 4XPZA 3J7TA 4CF5A 1RLOA 4QQFA 3R4CA 5AVSA 3IB6A 2W4MA 3B9RA 2GFHA 4UASA 5ALSA 3NIWA 1RRCA 4UAUA 2HX1A 2C8LA 3AR6A 3U13A 3QU7A 1WPGA 1RQLA 4OHFA 4AP9A 2JARA 3OCZA 2Q5EA 2G07A 3W5BA 3ET5A 5ALLA 5FP0A 3U7HB 3KBBA 3SMVA 4YGYA 3ZVLA 5AIAA 3DV9A 4IFTA 2C88A 2ZOSA 3N5KA 1FEZA 5AM2A 2NYVA 3F9RA 1TJ3A 2DQSA 2YFYA 5AHXA 3ZVNA 2BY4A 4XE5A 5AVTA 3OCYA 4FE3A 2I54A 2WFAA 3QU9A 4Y2QA 5AKHA 4DW8A 1ZD3A 1Q92A 1Y8AA 5AVXA 3N8GA 2WM8A 2HSZA 3WKBA 1K1EA 1O03A 1Z88A 2R8ZA 2C8KA 5A3RA 4GXTA 1WR8A 1RDFA 2WHEA 2CN1A 3I28A 3I6BA 3QNMA 2R8XA 3EF1A 3E84A 2G06A 2G08A 1N8NA 3MPOA 3UMBA 1QH9A 3N28A 1QYIA 3OTQA 3FM9A 2MSNA 5ALNA 3ZX5A 2X4DA 4Y2YA 4BX0A 1XVIA 3AR5A 2G09A 4C4TA 3SD7A 4PNHA 5ALHA 3DDHA 1RLMA 4KNWA 1RKUA 4BX2A 1S8OA 3AR2A 3L1UA 4HAIA 3WK6A 3QX7A 3FPBA 5T41A 5A3SA 1T9ZA 2ZBEA 3FPSA 2YJ6A 3N1UA 2AH5A 1Z4KA 3WKDA 2JGAA 2BDUA 5AVQA 2WF6A 3WGUA 5AKGA 1QQ5A 3ZTWA 1VJ5A 1XPJA 4G9BA 4BEVA 5AK6A 3WKCA 3U19A 3A1DA 3A3YA 1LVHA 3L0BA 4OD0A 2HHLA 3UMCA 4FFDA 2I33A 5AI0A 1TE2A 4BBJA 2RB5A 3WK4A 2RBKA 5ALVA 5AW4A 1YJ5A 2VKQA 5IS2A 2FPSA 1WVIA 4J2TA 4YIKA 2YN4A 1ZOLA 3IJ5A 2WF8A 5IT0A 3WK7A 1Z4LA 2P11A 2IYEA 4OCZA 1ZJJA 2NO5A 3L0YA 4IG4A 5ALMA 3ZVMA 4CF3A 5AI8A 5ALXA 1NRWA 5AVZA 1SU4A 2YJ3A 4ZEVA 1L6RA 1U2TA 4DWOA 2WF5A 4HGQA 1QQ7A 2C9MA 5AW9A 2ZBGA 3QLEA 4AS2A 3NALA 3WK9A 4XOUA 4Y2XA 4MUMA 3TLMA 4BNDA 4C4SA 1RLTA 1NF2A 3ZX4A 1KYTA 3ONNA 4UAVA 2BDEA 3QU5A 3GYGA 4L6AA 3DAOA 5ALRA 4Y3UA 4AS3A 3N07A 4UM5A 4YCNA 3MC1A 3IRUA 3L8FA 2WF7A 4CF4A 4Y2JA 5AKJA 3E58A 4KNVA 2W43A 4DCCA 3W5CA 1ZD2P 2ODAA 3L8HA 3NUQA 2G1AA 2PKEA 3ET4A 1TJ4A 4QJBA 1Z5UA 2HDOA 2MU1A 1EK2A 2B30A 5ALTA 3ZWDA 3AR8A 2YMMA 3EWIA 3ZWKA 4ZEXA 1WZCA 3ZTYA 1YS9A 4E88A 4UU1A 2YMLA 2RARA 3B8EA 4NAVA 4UATA 2HI0A 5ALWA 4F71A 2G80A 3L5KA 3QUBA 3QUCA 1L7NA 1L8OA 1Z5GA 5AKYA 2CFRA 5ALJA 3WKAA 4HYTA 4NFLA 3UMGA 4RESA 5A3QA 5ALGA 2YMQA 1YDFA 3BA6A 3PGVA 1YV9A 3E8MA 4G63A 4OFZA 4L57A 4H1WA 5AK4A 2JAWA 3W5AA 2B8EA 2GO7A 5AI4A 1F5SA 1X42A 1S2OA 3NRJA 2B0CA 2FPUA 1Z4PX 2QLTA 3MMZA 4UM7A 3D6JA 2OBBA 4UMEA 3SHQA 1IWOA 3KZXA 2IOFK 4KX3A 4EELA 2JAUA 1Z4NA 1J97A 4UMDA 4Y2PA 3S6JA 5IT4A 3K1ZA 3KOOA 1YNSA 4F72A 5AW5A 2I55A 5ALKA 3VAYA 2P9JA 3QU2A 5AVUA 3AR4A 3A1EA 2AUTA 2QYHA 4JDPA 1VJRA 1YMQA 3CZ4A 3QU4A 2NO4A 2G0AA 3SKYA 1L7PA 5AW3A 3QYPA 4EEKA
chains in the Genus database with same CATH superfamily
1RQ7A 3G9ZA 3R20A 2OXRA 1E61A 3W05A 1W87A 3EVCA 3LW7A 5BXQC 2UYOA 1ZONA 5CFPA 7ABPA 1EIZA 1L5MA 4OTZA 1IONA 2CFTA 4FVTA 1O8BA 4QHYA 4HX5A 4M3NA 4HNTA 4PC6A 4L78A 1ZKMA 4G67A 4B3BA 5EKUA 5EJGA 2PY6A 3TRFA 2X1MA 4HBGA 4N5NA 3WJ7A 1F1BA 4NVRA 2V0NA 4FR0A 1IVNA 3AFHA 1X0XA 1SH7A 3A6GA 3H1EA 4ZEOA 1QHSA 4ZO4A 2PAAA 3V8BA 3FPLA 2OCPA 1E2IA 4RMNA 5JEDA 1X1EA 2RJ3A 5A4JA 3UEOA 4RH3A 3OQNA 4Y2RA 1Z2OX 4FB5A 2HF9A 2P2SA 1E0SA 5DN9A 3ZGYA 5KSWB 3OICA 5JAMA 1KIAA 1TMGE 3PC7A 1I1QB 1SCBA 2FPKA 3RS3A 3RHFA 4D0GA 4X8HA 1YQTA 3BXFA 4A6PA 5EWLA 1G3IA 1ZQ9A 2QMUA 4H1UA 3UB4A 4J0DA 2DWCA 1LLDA 4EVIA 2PGXA 3K6JA 1N6LA 5REQA 1XKLA 4JR0A 3I04A 2QVZX 2FMHA 3H19A 3IPYA 3P19A 5KKAA 4P4LA 1T2AA 2LWIA 3FPGA 1H1TA 3TVTA 4BN5A 1ZK2A 3WI7A 4F97A 5H4GA 2FCAA 2I8AA 3A32A 4H6XA 3BIXA 3S2FA 5JV5A 1QFMA 4PGGA 4GSKA 2EQ5A 2XA9A 2YZKA 4PCAA 1PG5A 3QW4B 4RACA 5LYJA 1AHHA 1LC0A 1Y4SA 2H1VA 3CH5A 3NNSA 4DCPA 4EKEA 1TECE 3JQAA 5FWDA 3NWOA 3MMSA 5EL0A 2Z5VA 5BYJA 5FNZA 2F9LA 2R44A 3AF0A 1VLLA 2JFYA 2N42A 2VSNA 1OAKA 3ANTA 3HYCA 4HNQA 3ZU3A 3K94A 3MGKA 5CG1A 4CIWA 1J0DA 3HCEA 2NTYC 3GWZA 3U4DA 1IULA 2FSVA 1C14A 4ZV9A 4URHA 1OF1A 1IM5A 2R7AA 4N5HX 2X0DA 4N03A 3AJ9A 2PSJA 1DI0A 3DMHA 2Y92A 4PPNA 4UJ3A 3WRXA 2ODEA 4KX5A 4Y6GB 3QVTA 5TQ2B 4BZZA 3ZDQA 4BPBA 2AXNA 1WXDA 2I34A 1G8GA 1EWQA 4DCVA 1JBKA 3K9FC 2WIFA 5ECGC 4UHBA 3ROGA 5JSFA 1R5BA 1J00A 1MV8A 2CE7A 3D6UA 3NYQA 4OHVA 4YRBA 2C4VA 4DXDA 3VHXB 2E0IA 1CUJA 1TMYA 2AGVA 2A9RA 3CR7A 2CSUA 1EUDA 3GFBA 3I2HA 3H5RA 4KO3S 5LZ4A 1AOXA 1ZNXA 3HSKA 1MDFA 4JITA 1H9CA 3JQDA 3RW9A 1U8YA 3I0ZA 2PTHA 3QPBA 3S55A 4CM6A 2FF7A 4HYEA 2FG5A 3RSCA 4UXIA 4BUCA 1PJLA 4ZK6A 4UUPA 3W9UA 4Q7KA 3WS7A 4AD8A 1COWA 5K7SA 2DJIA 3JD4A 2NV0A 3RT1A 2X7HA 4DM4A 5IH3A 3PDIB 2R2GA 3KHTA 2HC9A 1JIVA 2RK6A 4B46A 3U3XA 2H54A 2JJ1D 3KUXA 2XV1A 4ZPJA 2GN1A 4IX9A 4C1BA 2LRHA 2OESA 4EGSA 4ZGGA 3GJSA 4AG6A 1IDOA 2PL3A 3E5RA 4GLOA 4KPUB 4MV8A 2QRUA 4QGAA 4LF6B 4CKZA 1ODCA 2CCKA 1DEAA 4Q1FA 4ZDKA 3O2NA 3QJGA 1W1WA 2XJ9A 2ZI7A 5C8YA 2Z57A 4Q9HA 3SICE 4AZVA 4MWOA 5JSHA 4BYGA 3KQQA 1WEKA 2HHCA 1JKMA 1PJ8A 1ZOPA 2Q3MA 3CZ9A 4PSVA 1DQRA 1QOPB 3FH0A 2QVXX 3VR5A 4GQBA 2Q5FA 4IWYA 1G60A 3ENQA 4HGOA 4CQJA 1PJ3A 4JU8A 3TLJA 3S0JA 2W6OA 5IVPA 4UAGA 2MCFA 1UK6A 4ETMA 1GKYA 5I47A 2ZBFA 4LY3A 2ENUA 4HAVA 1GZ5A 2X58A 4IHJA 2BBWA 5EPEA 5IRCD 1XU4A 2HRQA 3JWPA 1YHNA 3R0JA 4A8PA 3AF4A 3DDUA 2ZXUA 1L5VA 1R50A 2RGUA 5FHQA 2PX0A 1GAEO 1OFTA 1JEYA 1CE8B 2LV8A 3MFYA 5KWSA 4YI3A 1CUHA 3DHVA 4V0KA 4GYYA 2JJ1A 5BW8A 1NW4A 4HNGA 3VNUA 5BQFA 4BVEA 3KD2A 1M33A 4BVBA 2C03A 4MVJD 5DLQC 2K5UA 3BCHA 3IIIA 3TZHA 1DV1A 1DTWB 1REQA 2R1VB 3LT0A 1NMYA 2IUYA 2VAMA 4MW4A 1B8OA 2QJRA 2TRSB 4OJKA 4TKUA 5CM2Z 2ZZMA 2CYBA 1Z06A 2QZ4A 1GYQA 2P6NA 1E3JA 4NNOA 2V7PA 1Q0QA 1IY9A 5L6MB 2OKCA 4TWRA 3TTSA 5LL6P 2GCNA 5J5AA 1RM4A 1U1DA 8AT1A 2HF2A 3ICVA 5TRTA 3UWKA 5IXYA 4MRPA 1GCUA 2G4CA 3OC0A 2QTRA 3W4KA 3CVVA 4HB0A 3K72B 4WXEA 4K6OA 3TRHA 1P2BA 3V1KA 5IX8A 3JQ8B 1ZXBA 3DC2A 3EQ7A 1CZOA 3H5AA 3VSEA 1TGVA 4D98A 1RQXA 5AJTA 4QQFA 1KC1A 3PA6A 4Q93A 3IB6A 4DV3B 3BHNA 4FFOA 1KE2A 2YHIA 1FBTA 1UBNA 3Q85A 1I51A 2GXUA 2WUGA 5EZQA 5H5JA 2P4SA 4CU5A 4QTYA 3RSSA 1JH9A 3DDCA 1KSHA 2FSSA 3PC8C 1ZM3A 3DZCA 3PJFA 3WBJA 5KYGA 3U4GA 5E9WA 4ZVMA 2X7XA 3ECCA 2Q5EA 4LY6A 4B3XA 3EVFA 3MMXA 2BGIA 4BFVA 4A2WA 5D3ZA 5CDGA 2II6A 1WDKA 2CBGA 1C3EA 2GS9A 4MVJE 4X00A 3SMQA 5FWNA 4I9UA 1ZR4A 3LXXA 1YDEA 4WLOA 2I2XB 1H4TA 3WYFA 1JHUA 4BFSA 1EWRA 4AMGA 3FPKA 4YJ2A 1XA3A 4V3CA 3OO0A 1G21A 1Q21A 3F9RA 3KKNA 1SBNE 3MD9A 3ZVKA 1P7ZA 2FPPB 1HT2E 2AOUB 3F1LA 1A5BB 1DUIA 2RAPA 3AOEA 3GP3A 1ORVA 3HMKA 4K9RA 2XYQA 4EIWA 3K0CC 5DM70 4NHEA 2P3QA 1FS6A 2HA0A 2QNIA 2J48A 3OKAA 4M49A 2RJNA 3RK1A 3QBTA 2YNMC 4URXR 4BGVA 3IS3A 2O54A 2H16A 2FETA 4M6WA 1VMKA 3MIZA 4Y0NA 4CM8B 2Q6KA 1J8FA 1S2MA 2HMUA 3TTVA 3DLIA 3AHEA 1XTKA 3OZGA 3ZWVA 2ZYWX 4WEQA 5FUXA 3VGPA 4Z4IA 5SICE 1OLOA 2H0AA 4BVFA 3W78A 3I05A 3PSHA 4L85A 1H42A 5L9AA 3PZBA 3GAMA 2R8XA 4X8OA 4Y9UA 4BC1A 4BP3A 3RNLA 2EQBA 1UZUA 2IXFA 4HFNA 5T4FA 3WJ1A 4ZHSA 5K01A 1INLA 1ENOA 1T29A 2IWHA 1P7CA 1IXZA 1NUAA 2DPMA 5DULA 2ZWAA 4XLTA 2WHQA 3KJNA 5FOUA 4PU0A 1ZN8A 3ND5A 5AUOB 4DB2A 1VCNA 1QYIA 5EIAA 1GGJA 5G4KA 4DWJA 5C80A 1QBGA 3KTDA 3PXAA 4MINA 3WLJA 2X9NA 1NYLA 3O2QB 5K03A 1N2CA 3LHSA 3E7WA 4LWPA 3QYFA 2GF0A 2C7PA 3F74A 4PRZA 1C1DA 1Y6JA 2I3ZA 5C52B 4U3JB 3TI9A 2YZGA 3AU8A 4GXQA 1E0KA 1WQ3A 3W5SA 4BX2A 4Y9SA 5KWJA 1QR2A 3B78A 4QD3A 3TW0A 1M6VA 3ENKA 1H4QA 4DA9A 1YQGA 3N2NA 1XWIA 1KYWA 5IKOA 3CWQA 4DV0B 2IZOA 3GEGA 2ZBEA 1RZUA 5FRDA 3MVEA 6NULA 1LDNA 1PF7E 4G56A 3VOTA 2Q3DA 4PIVA 3TUJC 4JUAA 1JIQA 1Z47A 3T4XA 2GZ2A 1IXYA 3BXHA 1TC1A 3KAKA 3LT5A 3RYFA 3SF8B 2RJOA 1E98A 4CTOA 5HA5A 4MKRA 2BC9A 3EDCA 1I3MA 1WTAA 1LY1A 2AXPA 4WD3A 4IXNA 5IW8A 4RX1A 5JD6A 4LS3A 2VK4A 4I3GA 1FCJA 1LQUA 2C2WA 1QVAA 4GZ3A 1R0YA 2I1VB 2QJFA 2LGJA 4LWQA 4W9RA 4EDFA 4R3NA 3P20A 3UJNA 1PZFA 3SBDA 1MHPA 3DAYA 5CXUA 3C48A 6GPBA 3RASA 1DAPA 1L5FA 2VDNB 4LHVA 1HQDA 1JW9B 4IUCS 3Q87B 2RB5A 1Z2PX 4C4YA 1NVGA 2ZRQA 2GKSA 1QP4A 2WWGA 4YV1A 2BH9A 1SEPA 1WVIA 1YDGA 2ZTUA 4G1UC 4J2TA 3C6KA 1NRJB 2ZB3A 1WDMA 2AHOA 4QDKA 5EJ7A 1Y3HA 3IJ5A 1BHQ1 1WHSB 3BERA 4D42A 4H7EA 1NT2A 4KE7A 2I62A 1A1SA 1FQKA 3NH9A 5C2JB 5CFRA 1U2DA 1HLDA 1R9GA 3U2QA 2VFAA 3ZE1B 2ZXFA 4PC3A 1IZZA 1T36B 1EGAA 2E87A 3TKYA 5AI8A 2YZMA 1G291 1Q1GA 2ZJ0A 4GBGA 4BAZA 4RORA 3K5IA 4ER5A 4B6QA 1V16B 1HT1E 3H04A 3EVEA 4PZ0A 5IJAA 3Q8MA 3EG9B 1KAQA 3H1FA 4TUYF 3THOA 1SVSA 3AHHA 1B8VA 5DTQA 5F7ZA 3U4CA 5CB0A 2JH8A 1P4RA 4G9EA 4OYHA 3THXA 3IDFA 2QIPA 3ZKWA 4YAUA 1V1MA 5EJMA 3WK9A 5JATA 4P7FA 4CVNA 2XUAA 4Q05A 3O0TA 2ZR7A 3KR9A 1E3LA 4RA6B 4LNUA 1NN0A 5NULA 4NS4A 3WA6A 3JQFC 5DHTA 1DAEA 1EM8B 4FIDA 4RVNA 3O7MA 4M0FA 3KEQA 3ZX4A 4E5PA 2AOXA 1IOZA 1VI2A 2NZXA 4HDNB 4RNCA 3HA7A 4MPDA 2IOYA 3QU5A 5FI3A 4B71A 1DWOA 2V7VA 3DE7X 3TNFA 1X1DA 5LYYA 3TNDA 3QKSB 1SVOA 2FLKA 1TI7A 4UM5A 1ZY2A 4QGBA 1T9GS 3L8ZA 5DRTA 4LOHA 2AEMA 3LP8A 1PT9A 4M8IA 4IJVA 4Y6OA 2H18A 1VCOA 2Q45A 2L69A 3MTEA 4KDFA 4Z0NA 1U0NA 1X9GA 3S1AA 1MB9A 3NJRA 4DCCA 1LFDB 1ZD2P 4NE9A 2IBSA 3EQZA 1O94C 1XDUA 4HNAB 2XDQB 3LI2A 5CFQA 4DT1A 2DECA 1CQPA 1CUYA 2XRFA 4WCFC 3V1TC 4CG1A 3SGLA 4IM7A 1CFZA 1EFCA 2H29A 3E9NA 4FXOA 1QG6A 2VJLA 3G3EA 4KVZA 2X6TA 2WYOA 5I7VA 1E9RA 3F3KA 4EQ6B 2VXBA 1JLRA 3ESXA 1NC1A 3A05A 3NBZC 3SM9A 5L4SA 2FYTA 3HBNA 4H7PA 3SZLA 3MM4A 2CLLB 5AVKA 2W6ZA 1AMUA 2J9ZB 1MOQA 1ZUWA 3DEKA 1C1YA 1IMOA 2AFHA 3GFOA 2RSLA 3DDZX 3I30X 3IPLA 5EHXA 2D4HA 3ZLTA 1E2QA 3A37A 4KHPB 5JBNA 3Q9LA 2IZZA 3N7AA 4NL4H 4CEJA 1WMSA 5IZCA 2VXOA 121PA 2FHPA 3AG5A 1AQUA 4OLBA 5DSXA 5FOWA 2X3UA 3OPQA 4XASA 4NFLA 5THXA 2B1IA 4OEHA 2VDJA 3LHIA 1K89A 4S04A 3G8DA 5AXBA 4PFKA 3BA6A 2JHGA 4NYMQ 3EIUA 4JI4B 3A58B 3FYUB 3IQZA 2IEBA 2WUVA 2Y0BA 5E9QA 3V4OA 2C4MA 2G0NA 2NZ2A 1JRLA 4NK4A 1FXWF 3OM9A 2NPFA 2CVZA 1UQRA 3D54D 1YB2A 2V58A 1P31A 3M34A 3NOQA 5BN3A 4LF7B 1O9HA 5CNMA 3DMYA 2IOFK 3LC0A 4JBIA 2Q9UA 1HDZA 1JZTA 4WW0A 1D09A 1NBWB 3P9YA 3VNVA 3FDFA 1JR4A 5JI2E 3G0IA 4PO8A 3RVSA 3Q5EA 4O33A 1OBCA 3OPVA 2GJKA 1VKHA 1VIMA 3KQKA 2ZYUX 1G8AA 2HDHA 2OUKA 3HP1A 2Y1GA 3BX1A 3OOYA 1GPNA 3FUWA 3X0DA 4UU8A 1YK0A 2R97A 1TAHA 4LZJA 3H9CA 1GFSA 4PFQA 3FHTA 3LCUA 4HXEB 1M5UA 3GJTA 3ADPA 2XITA 3QYPA 3EXAA 4FX2A 3BE8A 3SM3A 1GTJ1 1ZVJA 2HRCA 1CUAA 2K2QB 2PUWA 3KXIA 3U4MA 4OQEA 1U8UA 3F6BX 1BS2A 3KAQA 4GPIB 3HDVA 4MRMA 4GC5A 1KKLA 2O4UX 1Q91A 1PTJA 3RU2A 3L0PA 4P36A 2NU8A 3S28A 1DKQA 1GPAA 2QD3A 1T5DX 3VR5D 3RVJA 2BHRA 1UWCA 2IPLA 1O54A 1SZJG 3MYRA 1HX7A 3A4YA 4K6KA 4PHGA 3TJZA 1Z5NA 4EGAA 2X8WA 1R9NA 1SU7A 1R12A 2C9BA 2NU7A 3IILA 4O1MA 4V3BA 3SBXA 5B30A 2AV6A 5JPCA 2RCNA 3IMCA 1OLXB 1KI6B 1JMYA 2P5TB 4Q9JA 1QGYA 1RKBA 2NT3A 3JZIA 4AY2A 1DB3A 4GVLA 1IBCA 5DDIP 1NP3A 1HGXA 3KV3O 4DV6B 2XMBA 3E70C 1QM5A 4O2BA 5H16A 1NHGA 3ICCA 4P4TA 4KPUA 4TV9F 1XP5A 3ZJ4A 1OR8A 1C3JA 3UAOA 4IOMA 4JP1A 1J0AA 1O0BA 3FBTA 3PQ2A 1PN3A 2FH5B 2G83A 4RY0A 4XUGB 4D43A 2HEGA 4E22A 3A31A 3RT9A 2HAEA 1JUDA 2Y1DA 3D7KA 1CT9A 3CVOA 3RVQA 3MGCA 1IBKB 3DNFA 1NJ6A 3O4GA 1FNCA 3W2IA 3U7GA 4W7HA 1OMOA 2F43B 2NZWA 5HCNA 5DGXA 4LXXA 4E94A 4EX7A 3RRZA 3ABZA 1L5GB 4OXYA 3OQVA 5GZ3A 3DCNA 3GCGA 2DERA 3KVOA 3EEIA 1AV7A 1ZUNB 3OF2A 1PI3A 2AK3A 4QPJC 1XEXB 1NVDA 1NF3A 3K35A 1C7IA 4ZI5A 2WDPA 3FG9A 4YMWA 1DCTA 4MYTA 3KJZA 1F0KA 1GZ6A 2BBSA 4ZHQF 1VDMA 5JXIA 4Z2AA 1TQ4A 1XZQA 1PGJA 2X5XA 2K4MA 4ZVNA 5J1TB 5LKRA 1FW8A 3AIKA 2QN2A 4OATA 4EABA 2WJYA 1DP4A 4XYMA 1DKRA 1NOIA 3E7DA 4KR7A 4BWVA 1E9DA 1ND5A 5DJ5A 5JLAA 4FGLA 3CW8X 2ZCJA 2B92A 3NIDB 3BUSA 3EIOA 5IAOA 4JODA 4W5QA 2RAVA 1KDOA 2FJUA 4YX9A 5A06A 2JVJA 1QE3A 3PHGA 5ETJA 3QEMA 1R4MB 1G20E 2D00A 1QF7A 2GPYA 2H5IA 3E82A 3JZFA 4HFRA 2WP0A 5DSTA 4C29A 3V7FA 2IXTA 1NMZA 1EM8A 3MBIA 4JSYA 2FX2A 3JALA 3VXKA 1JDJA 3EG5A 3U7QB 3LX8A 1O8CA 3CLRC 1FUYB 4P4NA 5CLJA 4MQLA 2JFGA 3WR5A 2GHQA 4HWPA 4EB0A 1OUMA 4AS1A 1W4LA 2O8CA 3O2SB 4JXKA 1L5LA 2ZUSA 3HJFA 1V9LA 5D3MB 3KYJB 1PCXA 1LPOA 1Y33E 4FBGA 1MEOA 4TN1A 1N5OX 1NVWQ 2AUNA 3LZ6A 2NUTB 1SC4A 4A92A 2IS1A 2EATA 2VTVA 1SBCA 2NZJA 3WL3A 3WZMA 3THWA 2FEOA 5E38A 1EFDN 1RT9A 1KH3A 3GLHE 2ATEA 3MS2A 4EW2A 4ZVQA 3V46A 1ECBA 2CKMA 4Y6LA 1CR6A 5IAJA 3PQ8A 5JO9A 4BRUA 3D02A 3U3DA 2WOOA 1DKOA 1C1XA 5CAEB 4POOA 2GBFA 3M2PA 3Q8KA 3DL0A 3I9LA 4PYIA 2X0KA 4JDUA 5CFLA 1R0LA 3DKIA 1QYCA 3JYPA 4S1VA 3B5JA 4HEA1 3G5AA 4UE2A 2QAGB 4BNUA 2ZI6A 2NU6B 3CISA 3JQQA 4BMVA 1U7WA 4KNYA 1L8AA 3WL5A 2WHYA 2NO7A 2IOHA 3GGGA 3Q8LA 3JASB 2A35A 2I66A 2IYWA 1KOLA 1XL0A 4UD2A 4N7RA 1BDMA 3HJBA 4Q6WA 1V6AA 2FEMA 3KVRA 5ALFA 5TR9A 4HEJA 2AR0A 2ATVA 1KBZA 4R8RA 3VHQA 1Z63A 2QLNA 1E89A 1NMXA 2I4IA 4IQGA 1PGPA 1W5BA 5LPNA 2RK3A 2DM6A 4R2WA 2WTUA 3NYWA 2HWXA 2PGLA 3G0CA 5J58A 4IJKA 5B58T 5K8JB 3KSBC 4TZ6A 1QZUA 2IYOA 1WTCA 2C58A 4D1YA 1U7PA 1A8PA 1TD1A 5LYJB 1LJ8A 1VMEA 1T5TA 3H8VA 4FZVA 2VEDA 3QVLA 2DT8A 2QTVA 3GPCA 4Z3DA 4OMFG 1GSIA 3OOHA 3P9QA 1IATA 1W47A 1L7XA 4FOSA 1YFLA 1MCZA 4MQ6A 4RVGA 4CIXA 5HZKA 3N6VA 4LHYA 3WNBA 4MWTA 2JI7A 1I9GA 4P33A 5BRJA 3EW7A 4EI7A 3WMEA 4J2HA 1SCIA 3G13A 2J3IA 2CY0A 2EHJA 4UU7A 5AESA 5JUWA 5KHOC 3PXEA 1PEKE 4MUFA 1IQRA 2PMEA 4WMLA 1S5PA 1EXNA 3EF0A 3K6KA 3SEQA 3I01M 3I39X 2A4KA 4FWTA 3RWOA 4KZKA 2HWKA 3BHJA 4F91B 2VIIA 3DUFA 1E1RA 3K0BA 4IXMA 5DP2A 5AUNB 4TYWA 1ZW6A 1B6SA 5KO2A 1O2DA 2O6HA 4Z9AA 2JAOA 3NNDA 4PPQA 2FXIA 1TVKA 2CD7A 1NVUQ 2GPWA 4TS3A 3VMFA 4ID3A 4ZWNA 3W5IA 4TPKA 4F4HA 1R9JA 3T9AA 3NTUA 4UEWA 1UXIA 1OXUA 3D8SA 4H3HB 2RIPA 3IQGX 4KFRA 5HWSA 2QDKA 3DVAA 4MWZA 2ECQA 3RIGA 1YB6A 3U7FB 2ZYVX 3CNBA 2JFOA 2X5JO 3GJ5A 1J70A 3NWBA 3JWEA 4HZUB 5HPYB 2IYPA 3RYTC 3NVDA 2EGGA 3SZMA 3DE6X 1ZCFA 3T9BA 1G8HA 2HX1A 1N0VC 4D5EA 1M6WA 3IKJA 3P45A 4PGAA 4CTNA 4IMIB 3Q12A 1D1SA 3DAPA 2COEA 1SQGA 4G5QA 2F62A 3QVWA 1RXCA 2P1ZA 3UHOA 3VX4A 3P0JA 2CXPA 5C34B 1NXWA 2WYIA 4C7JA 1NAHA 2JIRA 2R6R1 2XVMA 4PO9A 3K0KA 1T9BA 1XLTC 2BJHA 2P9QA 2I4MA 1N3BA 3AJRA 2O2EA 3JQAD 3JYHA 3P2JA 1Q22A 1SG9A 4CL8A 4UHHA 1ORDA 1VE7A 4WUVA 3DV9A 5B53A 3VPXA 3GJ3A 3VR3D 3LRXA 1Z2AA 2ZUUA 3ZS8A 3OY7A 3KVNA 3G5TA 4IOJA 2ZTLA 3ZIAA 4TTQA 3TOZA 2WUWE 4Z4CA 1M1NA 1GSAA 3A4VA 2JLBA 4D4IA 2PL5A 4FTWA 4WKOA 2B7LA 1E4EB 2OG2A 2MINB 4JA2A 1A9XB 3BGWA 2R60A 2WFAA 4DCMA 4XYBA 4A8JB 4BQIA 1A95A 4TN5A 2WICA 5JNRA 4OYLA 4EW3A 1W8IA 2PLRA 2I1QA 4IGIA 2WJHA 4UTRA 4LY9A 4EVQA 1KO1A 2GHIA 5UKDA 3ND6A 4OBEA 2HA4A 1ZN9A 3VJLA 2J9RA 4DMFA 5FAKA 1IH8A 3IP8A 2BFBB 4XDHA 5LMZA 2VTKA 2P5YA 3FWZA 3K73O 2C82A 4GI7A 4BBZA 2PDAA 2PKXA 4FWBA 3HE3A 3PYLA 1P3Y1 3ZLJA 2VJYA 1FTNA 1FVXA 2UZ1B 2X0RA 5EEHA 3VR4A 2ZBUA 3KOXA 3PR2B 1A96A 3OP4A 3I28A 3I6BA 1UEXC 2ZRNA 2JGMA 2ZBQA 4PLFA 2RI6A 2J6BA 1P4SA 3P2IA 1KK0A 5A3JA 4RHFA 4GPD1 3HZHA 4P6VF 4U2FA 2QRKA 3AEXA 2HMVA 4BHTA 3DBLA 4GP7A 5CB4F 3NS7A 1QGED 4MAMA 4QQNA 4OL0A 1XRLA 1XNHA 3I8XA 5BSTA 1T91A 3VTFA 3OA0A 3VKVA 3LUJA 5EIEA 4I55A 4PAQA 3RVBA 1C8LA 2VDKB 1SB8A 3L6BA 5FPSA 2OHHA 3B60A 5GWXA 5CIWA 4TL7A 2JPDA 3F98A 4HD8A 2I71A 1T9AA 4CM1A 2CHUA 1GPLA 2K2WA 3ER6A 1X80B 2VLIA 2W70A 3VPDA 1O9GA 2ANBA 4ENVA 5HM6A 1M2NA 3VSCA 1T4MA 3QJYA 3IAUA 4QGHA 4JP2A 3TQFA 1FDRA 3ZE6A 2BM0A 1EVZA 1E63A 1L9KA 4EPWA 2AH5A 4LXYA 2GK6A 2IW1A 3HKEB 1U2GC 3MGBA 1ISGA 1HDGO 1YKGA 3JQCA 3Q2OA 4FMCF 4OB8A 4X94A 3RROA 2Y6UA 3H4MA 1F38A 2XXAB 1BYIA 1OKKD 2WWHA 3IAFA 4CL2A 3OZCA 3DLBA 3L40A 2JZCA 1P1HA 2E18A 2JGFA 4UBOA 3AEQB 4JB0A 4MH0R 1JKIA 1DJOA 1RYBA 2YRWA 2Q3FA 3ZHUA 4IY1A 3DLCA 3ASVA 3LCRA 4JQCA 3VHLB 4DJTA 4JFRA 4E1VA 1U9JA 2ERYA 4ZGWA 5T3UA 1TAUA 2QLFA 2QRVB 5D8DA 3S2GA 2PS0A 2GBLA 5LC1A 1YJ5A 5IS2A 4JJ4A 3PVCA 4FHGA 1ZHFA 3D4PA 4LRXA 3NTOA 2V5UA 4WZBA 3UUEA 4QXOA 1HL3A 4OAQA 1QC5A 4ZVLA 5C7LO 3EMBA 2JI6A 2A0XA 4M53A 1IK6A 2UYYA 2QTBA 4ND6A 3NJ8A 2JHCA 1RBMA 2Q99A 4TLAA 2IX3A 1Y5RA 3SZRA 1ADCA 4YBZA 4MTLA 1TVCA 5SZIA 3QFTA 1CRWG 1F0PA 2F3TA 3PD1A 2ZB7A 3O8QA 4CHGA 1HDCA 3X3HA 1E1QA 5GONF 1ATIA 1Z17A 3ZV7A 2EEPA 4TKLA 3NP9A 3WFZA 1K5DA 3N75A 4GPBA 4DWOA 4DG5A 2C9MA 3DMRA 4QUIA 3LBHA 3MCAA 5T67A 3VH1A 4WPGA 3ZE7A 4G65A 3GH1A 4OXKA 4EG0A 3HSSA 4ICIA 1A77A 5A71A 4ZQIA 4EQ6A 2OFOA 2Y1CA 4L5IA 4MS1B 1GYRA 1CR2A 2V7BA 3OQPA 3GRCA 3OSZA 2FSPA 1X7WB 3CF2A 2P7IA 5FEMA 1KZHA 4D5GA 1Y7PA 5AK0A 5JH7A 4UM8B 3TF5A 3INTA 2VYFA 2Y8EA 4MSUA 2R8BA 4RABA 2PX8A 4A1OA 5JSKA 1U7UA 1MGPA 2J6IA 4HDRA 3N07A 4RVHA 2JGLA 5IUJC 2J0QA 3LBAA 3WGNA 3DHEA 5TGDA 3S1AB 2YC4C 4Y2JA 4BB6A 2C96A 3P71T 2NXEA 3QM1A 4F9EA 5B7PA 3E58A 5LP1A 2O5CA 3SPXA 1F1JA 1G2QA 1VM6A 1M83A 1Q11A 4YDRA 4EUEA 1W6RA 2G9QA 4OH1A 3EX7C 1G6Q1 3GVIA 3HGMA 4RD1A 4I50B 1PFWA 2AT1A 4CKBA 4JB8A 1HE3A 2ZSIA 1EDBA 1IL0A 1W94A 3QLUC 3QOWA 2G1AA 4JP8A 4O4LA 3VV3A 4QUJA 2R0QC 1Z29A 1VLZA 3VKWA 4LRWA 3BXXA 2JCXA 5BNZA 1RHUA 5HDBB 4OOFA 1XL1A 4XJXA 2E1PA 3HKEA 6ADHA 1MX9A 1VRVA 3I42A 1NNUA 3EIEA 4RC9A 4DM3A 1BVUA 1TZCA 2REBA 2MT9A 4BV9A 1O6FA 3BDIA 2D1FA 3IDAA 3KALA 1Y7TA 4AJKA 3D7SA 4JCCA 1ZNQO 4OQFA 2GEFA 3N87A 4TYPA 2RHCA 4H59A 3IMGA 4FR5A 4EKYA 1F8XA 4Z4HA 4GP6A 3LCVB 1OU0A 3OKFA 4BU0A 2RKWA 4N6OA 5JT1A 2AQHA 1GTG1 1A7UA 1T9GR 3B3GA 4BLUA 2IZ7A 1I24A 2VHTA 4DBLE 4QLBA 2BFDA 5CNKA 4NI5A 1XZCA 2IYNA 4X71A 2GPBA 1YCFA 5IG2A 2V96A 2WA1A 3LUDA 4CEHB 1AC5A 3A1FA 1TUEA 3T5AA 1EP3B 2V3CC 4CT5A 1YVRA 5AK4A 1O89A 1L4BA 2YUIA 1QR6A 2HL6A 1FPQA 4K40A 3GRVA 3QBDA 5TT1A 3AB8A 3PWZA 2ES4A 3FDIA 1XPOA 3K09C 1FSGA 2P62A 3EN0A 4GUAA 3T06B 4B17A 3JQBC 2DBRA 2WTXA 4H15A 4MO9A 1JLLA 2WT9A 2MR5A 5EG5A 3RLIA 1HDXA 1SKBA 3KR2A 4H1TA 4KBYA 1RVV1 4U0KA 2JDIA 3HRIA 1JHPA 1UDRA 4XFKA 4OI1A 5JHHB 3S6JA 1KQNA 5A9TA 1CRLA 4Y6SA 4DAOA 4PONA 3OFNA 4YACA 1ESCA 1KY2A 4E09A 4YDQA 1A9XA 2VRCA 4OQYA 1WXQA 3N05A 5ALKA 3MB5A 3H11B 4IUBS 4NMXB 3PFFA 2AC2A 1MRZA 2QTCA 1KEPA 1O87A 3BMXA 3I9V1 4JI1B 4TSFD 2PFKA 3A1EA 2AUTA 2QYHA 1UK9A 3E18A 4JD5A 4FC7A 3U81A 4EO9A 5K3OA 4AB1A 4U3JA 5HKKA 2CHQA 1IZ8A 2VH2A 4YUYA 2O3JA 1KI1A 3IOBA 2ZBPA 2GO1A 2PMFA 1GNVA 1M2HA 2YVLA 3RJ5A 3NNNA 4WOCA 5AM5A 2OXIA 3T34A 3H3FA 2VHWA 1F14A 4K3UA 3EF3A 1N3IA 3TR6A 4DIOA 5G4KB 3PC4A 2HUNA 5FO1A 2H5JA 1FX1A 2YJ4A 4W5HA 5G1NA 4BLWA 2JLZA 1YACA 1EQ2A 2IY8A 2D0DA 4D3DA 2B8NA 3BB4A 4ZMRA 4QDXA 1P5ZB 2AR9A 4Y2VA 1FSZA 3OZTA 2PBRA 2Q9CA 2NIPA 2Z08A 2MWMA 3M3PA 4N5LA 2HLPA 1ACLA 1X14A 3TBHA 2FWNA 3F2IA 3FKQA 3T7AA 3OC6A 3IQDB 3EPLA 2H4HA 3I0NA 2R7KA 1YJBA 1A4IA 3QUQA 4R69A 4X1YA 1EVIA 3KTAA 1PS8A 1Z6ZA 1AK9A 3A6EA 3CNNA 5E9AA 2QKYA 3MJDA 3OPYA 4PBRA 5U4XA 4PV7A 3U26A 4CDGA 2PPLA 1ONOA 2GAIA 2V1UA 4IO0A 4DFDA 3BA1A 5B58C 4WXYB 1SQ5A 3AFIA 3BQNB 1L7BA 3KJQA 3TL2A 4B75A 3NV9A 5HZMA 4EAAA 4V0RA 5JJ5A 1OHHA 3L7YA 2FZEA 5HZHA 4XPIB 4OHKA 3CB2A 1T0UA 3RE1A 2ZSFA 1EGVB 2IODA 1RD4A 5EZYF 3ZU2A 1SKYE 2KLHA 3BK7A 2WWRA 2WU3A 2XODA 3EYWA 3N6RA 4KE9A 1KMQA 4G89A 1BXGB 4D3XA 3ECSA 2B4KA 2PANA 4FYPA 4E7PA 1FMTA 4ZC8A 4F93B 3L9WA 1U0GA 5DYGA 1HE8B 4UNPA 3B12A 3DYVA 4EHDA 5AW0A 4P4SB 4UJ5A 5KSPA 1F2UB 3V8RA 2H06A 4DPMA 1VI5A 5K4HA 1OFUX 2CVFA 3CJRA 3LT4A 4U5XA 4P0PB 3EEBA 1TU3A 4CKXA 1K4KA 1VPWA 4NXNB 4C4ZA 2QUKA 4E1AA 3DQQA 1HZZA 3RFFA 1OQAA 2GBIA 3PQDA 5HS4A 5A5VA 1OIWA 3TECE 1MDBA 2QN6A 3DVRX 4WFJA 5AK5A 4DCSA 3LL4A 2ZUWA 3RFXA 3GA0A 2Q46A 4BMOB 3CF0A 4DDTA 4KPFC 1ZI8A 1PG2A 1G6KA 3GQBA 2PZGA 2R6CA 3WNCA 1U7ZA 2ZI5A 1F9EA 2VCEA 1N6RA 2XD4A 2ZYTX 5KYKA 5A0FA 4ERXA 1XLUA 3LYHA 1R27A 2R7LA 4JI2B 4EYKA 5KVCA 2WNIA 3TPFA 1W73A 2ONZA 2Z83A 3QEKA 2PQMA 4HMQA 2NNLD 1FYFA 4QRHA 3U3KA 4E5YA 3UB3A 1TYDE 3NETA 5E4FA 1Z9BA 3HGTA 4KHZA 5ER9A 1I01A 2HNKA 2VKTA 1UMBA 5DLEA 1A76A 3VJRA 3R7SA 1VXOA 2ZRMA 3WGVA 1O95D 5EINA 2AA3A 4WA8A 3RGWS 3SKXA 1A69A 1R6BX 4XYEA 2CGEA 1Z4QA 4L51A 4L5BA 2A5YB 3DNPA 1QDLB 3EXIA 3ZCQA 5KVVA 1TW3A 3WB9A 1J8DA 4EB8A 1HOXA 4I81A 2V6FA 4R81A 5JQGF 3B82A 3DL7A 1DVRA 4YUZA 3KQNA 1YHZA 4MVWA 3TK1A 4IMPA 4IVRA 4L6CA 1OYOA 1RHJA 5ENZA 1S01A 5DYNA 3VPHA 4A16A 2IIBA 5JBIA 1F4PA 3OP1A 2ZWOA 3ONVA 1JFFB 3JQFA 3OOEA 1NQTA 4O4IF 4N8EA 3WIBA 4A3SA 5KNDA 1LQTA 1ITZA 1PT8A 5DGHA 2CFOA 1IY2A 2QN1A 5IAKA 2FWBA 3V2UA 5JCZA 4DSAA 3MUNA 1KEVA 3GLFB 1H6AA 4FGJA 4UDNA 1T3LA 2OQVA 4HPJB 3TMAA 3JD2A 4F2DA 4B84A 5JS8A 1NQAO 9GPBA 3ZW7A 4OHOA 3L4BC 4AP5A 5K09A 3U16A 4KIUA 1FQJA 1EWVA 3CUYA 3BG5A 3PB3A 4P3XA 3G6WA 4OGWA 1NV9A 1U9YA 1ZEJA 5EA2A 2UUBB 1YZYA 2I4NA 4DTIA 4PR0A 2Y1KA 2W2KB 2ZYGA 4E5SA 3ESQA 3I62A 2C2KA 4Z7QB 2VBFA 2P40A 5GINE 1DO8A 2PMDA 5BSKA 1UL1X 2VDVE 4G01B 4KQ2A 2W6MA 4BXOA 4JUFA 1QJCA 4ANFA 2I6UA 1ZHOA 1IHXA 1L7EA 3DBOB 1JFSA 4U8GA 1I6MA 2GN2A 2WK1A 4K9LA 3KWLA 1ZRNA 3HY3A 1KEEA 3NOOA 3FSRA 3UMJA 5F9FA 1UKZA 4MW1A 1JHDA 2OY0A 5GPBA 5FPQA 2DQZA 1NXVA 3ENWA 2QORA 3A3KA 2QTZA 3BT7A 5CX1B 1CUFA 2FPWA 2GX6A 4HO1X 4HH1A 4CKCB 3TXAA 1KQ3A 1T6XA 4ZT4A 3UIEA 2OO5A 4WXPA 1GZVA 2FUEA 3O8QB 4Q1VA 3C15C 1LA2A 2VF4X 1RTTA 1PBNA 3CA8A 4FW8A 5CVEA 1Z4OA 3TJMA 2QTGA 3FHCB 3Q5DA 1ODIA 2QN7A 5CA0A 4KOEC 1JEQB 3PFCA 5F4ZA 1E79A 5D84A 4BP1A 4E5NA 2YJ5A 4FM9A 5A1JA 1E6MA 3MT8A 1PD0A 1LPAB 3EHEA 2DBZA 3EPPA 1DHRA 2I3AA 3NAGA 2OQRA 4KDCA 2JCGA 2IF0A 2X2OA 5B57C 1C0LA 3NTLA 3UK0A 1TQ6A 5LLDA 1DAMA 4YIHA 1KVUA 2D62A 3PLRA 4ILEA 4PG7A 2UZ4A 3CSDA 3LPCA 5BT9A 4NJEB 2VT6A 4KQJA 1E96A 1XQ1A 2BCEA 2QRVA 1D4AA 3M1IA 3LX4A 3OO1A 4TV8B 1XZAA 3ZWYA 2ECFA 3P2OA 3PGXA 4FU0A 2HIHA 2POCA 4OQXA 1Y7HA 3AETB 2BE9A 5EOVA 1L3IA 1N8KA 1P5JA 3SP1A 3AYZB 3PF9A 4M0CA 3GELA 4CF5A 4ZRNA 1J8QA 4PSUA 1BD4A 2CWWA 1WLYA 1HZJA 1AUQA 3T7RA 1R6AA 1ZMOA 5DBEX 1SUWA 3OX3A 2LTAA 4HNRA 3CZAA 3L02A 1L4UA 4H08A 2WG1A 1TVEA 1DBIA 1Z3CA 2WTEA 3U13A 1L5OA 1MC1A 2WD7A 5LIPA 4BFUA 4ER7A 4Q21A 5T8KC 2VP0A 2Q28A 1TYAE 1V43A 2RAUA 3R3YA 3F96A 2CNBA 3OEEA 4LDRA 4Q82A 4XUEA 4YS6A 1V4BA 4RFSB 1YAJA 4J0CA 4OG2A 3ZNOA 1N2CE 1SIUA 2QR5A 3AJ8A 4FK8A 3R0IA 3ANYB 1Z45A 2ZQ5A 2N9UA 2Q3EA 2PBFA 4IW3B 2JIDA 1WAMA 2Q3BA 2WMDA 4TYYA 4MP8A 1EQAA 4B47A 2BUCA 3MJRA 4V0QA 3ANNA 1UXGA 3AB3A 1V35A 5EKTA 1WBBA 1B73A 5AM2A 1U3WA 5FLEX 5JAPA 1IRIA 1HZZC 4QEZA 3HO8A 2W2PA 2YINC 3GHYA 3SZOA 4EBFA 4NBWA 7REQB 4N4AA 1S1MA 3EBPA 2IYSA 5IDVA 4AL4A 3L7LA 3D4NA 4U9HS 1NIPA 2GJAA 2DUJA 1WHSA 3PE4A 4WTOA 4EA6A 3R5FA 4P5EA 3CRZA 5CB8A 1Q17A 5JBQA 2HQSA 1ESNA 4FYHA 5FULA 5M5BA 1TEZA 2HHAA 1KDRA 2DQYA 4K7JA 4P92A 3KPUA 1I2BA 1GXSA 3CF4G 1SQSA 2H59A 2IW3A 2EP8A 2PGDA 2VUSA 1ODFA 4LGVA 3ZYCA 4F9FA 3ODPA 1G6HA 1XQYA 1YQDA 1SG0A 1UBEA 2Q8PA 3BRWA 2BHNA 1DJLA 3B48A 3BM5A 3F4LA 3QNMA 2R47A 3GP8A 2G7MC 3LFUA 4MAAA 4TVSA 3SNHA 5JC1A 2I9KA 1W85A 2FP4B 7YASA 5IJ0A 4WJZA 2YIMA 2GERA 3E6AA 1Z8FA 3H1AA 3UT5B 5BPHA 1P8AA 3ZIUA 5THQA 4F5DA 1P44A 2ORVA 3EMVA 1HM5A 3KLMX 3CS3A 4TXJA 3ZX5A 5LIRA 2QE7A 4WGFA 1XMOB 5CA0B 2SICE 3PENA 3G0BA 1CK4A 1CZHA 1VIDA 3K15A 4C4TA 1D2EA 4B80A 5C3MA 3DMTC 2XTJA 3MNFA 2JJYA 1H2RS 4YI5A 1RKUA 3H9BA 3COYA 3NG1A 1MOZA 2JZOA 1RR6A 3QX7A 3SIWA 3HY6A 4Q03A 3MD0A 1JPVA 2EJWA 4FMDF 4P34A 4CLDA 4YQFA 4CEIB 1KFCB 1SUBA 5IC6A 4K9PA 1KEEB 1UBRS 4C87A 3G2KA 1W4ZA 5AVQA 4PBTA 1LC3A 2QSJA 2GCOA 3C3EA 3WLMA 4ED9A 4D0SA 3PC3A 1XEAA 3FNBA 4OLFA 1OLUA 4R51A 4Q4CA 5K3EA 3IPAA 3OPYB 4OJNA 4R1QA 5JFGA 3V8MA 3JXEA 3W2FA 1O94A 1HMPA 1ZVMA 3GMTA 4DDWA 2PKRA 3ZJ5A 3UAZA 2HHLA 3DVAB 1XVTA 5KWIA 3GMDA 5CT4A 2X9GA 5AI0A 1T3SA 6PFKA 3TSYA 4BBJA 3D6TB 2H2AA 5GM2A 2BBOA 4GT1A 3DE0X 5ADVA 2PUGA 2EDCA 5DW0A 5JCOA 1GLNA 2W7TA 3FE2A 1GQ2A 1KYVA 1C3OB 3FCCA 1XDZA 3QVMA 3GAAA 1ZINA 1XQXA 4D56A 1E5LA 2YYYA 3D8NA 4OBBA 3P9XA 5IT0A 1SUPA 1A5ZA 4Q1DA 3VKHA 3GHHA 1S7CA 4Q4AA 1Q74A 3B52X 4TOIA 4X6XA 2FPPA 4KB5A 2FN8A 1GUZA 2XI4A 4EJSC 4QXPA 5JAHA 2DLDA 4BLOA 3N0RA 4YVFA 4YT8A 2V7GA 1KZ7B 4R1LA 2KJQA 2UVDA 1YVUA 1MABA 2X14A 4JY7A 1L6RA 2V9ZA 2ZJ5A 2QPTA 1JG7A 4NDAA 2Q3LA 4JXJA 4QTXA 3CXRA 3UTCA 2QS9A 3WYBA 4EY4A 3KZCA 4PYJA 3QLEA 1S4QA 2O8FB 3BCRA 3ABQB 2RI1A 4PC2A 3NALA 4D02A 2WG2A 2W6IA 5M7EA 2HD4A 5IFLA 1DL5A 3R24A 5EE3A 2WWYA 2C7QA 4J1TA 4EB6B 2JHFA 5ENVA 1PJQA 3PTAA 2VZLA 1BDHA 2CNLA 5IZCC 4WOJA 2QRZA 4OX9B 3B70A 1V3QE 2OAQ1 2OL4A 2YWEA 2IK8A 5TC4A 4V0MA 4KVGA 5HF5A 4PINA 621PA 1GCIA 4FEYA 4W5RA 3CCFA 3LUGA 3KWFA 2GA9A 3N8KA 4KVFA 4W63A 4AS3A 1NP6A 3S99A 1BX0A 3UZUA 1E1YA 2PT6A 2XUPA 4MKXA 4S0XA 3QIVA 5IM4F 1THGA 4EF4A 4XWKA 4W5TA 1HC7A 2QZSA 4C89A 2DR0A 1SOUA 5F73A 3TTUA 2JIOA 1QK3A 4D4GA 1HETA 2O06A 2XGMA 3EUAA 3IDQA 4H31A 4PNEA 1NE7A 2Q4EA 3ZHXA 2PRJA 3U4IA 3QE4A 4TMXA 4ES6A 1CC1S 3DEHA 5IBQA 4MS3B 4EUSA 2EIXA 1QJ4A 4RTQA 4TRNA 1PZXA 1NYRA 5DM1A 4CF6A 4ZO7A 1TPYA 5U1PA 2C4UA 1M1YA 2DG2A 2H2HA 1HYQA 3U7RA 2W42A 2PGNA 2EV9A 4PG8A 1FFYA 5HX7A 2GEJA 3G0OA 3V80A 1C1XB 1TGYA 4O1HA 1IQUA 4C0BA 4EATA 3ZWDA 3ZXIA 1R8YA 2C9CA 2OWDA 1H5QA 1VYVA 2FFHA 4QRDA 1RAHA 4O3FA 3ETLA 5EXTA 1P1BA 1QCYA 3JAMA 1PQPA 1X1SA 1VP3A 2GQ0A 4OXIA 3ZOKA 3BL6A 4AZTA 8ADHA 3FYUC 3IX7A 3HBLA 3OZSA 4ZO8A 4GVXA 4RL6A 2VCHA 3Q9SA 2FQWA 2PEZA 2ZITA 3U3RA 5J2TF 4NAVA 3U3ZA 5DXFA 2O8CB 3D0QA 4ZN6A 4F5EA 1PYDA 5E1OA 5EEGA 2BGLA 4XDZA 5ANRB 2ZWVA 4BZPA 1ZOIA 3DOEA 1NHWA 3TW4A 4EBBA 4QDUA 5KSZA 2CFRA 1FFHA 3FFWA 4D6XA 1BWSA 2PU5A 3TLEA 3IT2A 3WKAA 2BP7A 3G0HA 3BJIC 5BUQA 2H3HA 2X4IA 3ENZA 3F49S 1G5FA 1CUXA 3H18A 2WU4A 4G63A 4EG6A 1VLQA 1KY5A 1NPYA 3ITNA 5IMBA 4H1WA 3COWA 3GJQA 5DHAA 4MW6A 3RS4A 1C4XA 4A2QA 1MAHA 1S8AA 4RCYA 4RK7A 2JJQA 4ROTA 4X3OA 1U81A 2B0CA 4D8VA 2QRJA 4FFNA 1BW9A 1V95A 2X3YA 4ZVOA 2P30A 3PD7A 1IWPB 3PX3A 1PJAA 3SR3A 3RT7A 4BMZA 2GN9A 1YBVA 1DEHA 2Q0SA 4UMDA 1GDHA 1YS7A 3PQEA 4Y6RA 1G19A 2NPOA 5FI0B 1CIVA 5KVSA 4Y9TA 1W46A 2H1HA 1N7HA 5EZ6B 4HWOA 5D51S 4G3XA 4AT1A 5BNIA 4XUDA 1CYDA 1ZSYA 4TT3A 1W2HA 1XCLA 2WKSA 4H18A 2J3KA 3K0EA 3PQ7A 4F3TA 2P4HX 1ZK4A 1ENYA 1N5RA 3EXEA 3QSGA 3D4BA 2WFLB 2XUOA 1XZMA 3V4PB 5BNTA 3HKBA 3QF4A 1V3UA 2EBFX 4UVDA 2SNIE 5EJ4A 3QU4A 2HN9A 4M9RA 4RQTA 1PVDA 3GDFA 1B1CA 4EJ6A 3RAGA 1R0RE 2B8TA 2OAGA 3FWYA 4V1CA 4QU8A 3ZE2B 3ZHTA 2ZIVB 4UARA 5TNXA 4C0WA 3ZGZA 2X6QA 3GU3A 3H3JA 3GLUA 4WJLA 1NXQA 2FP4A 1N5IA 3SHTA 2VTBB 4IIJB 1WU7A 2YHUA 3CEJA 2I22A 5JQGA 1EFAA 4FONA 3IKLA 3ULKA 3K70D 1S2LA 4OY3A 4QZVA 3AEKB 4Y1EA 4NY1A 1GU1A 4NOMA 4U2CA 4AXBA 4B31A 2OMKA 5TSDA 4QJ5A 1Q6ZA 1GWNA 1J49A 3KQLA 4EOGA 3CRVA 3KSMA 2GJ9A 4X93A 5I7AA 3VC2A 3FGOA 4BV8A 4EF5A 1OLXA 1VI6A 2EYUA 1KR5A 2QTNA 1WUTA 3D81A 3HS3A 3PHHA 4YUAA 2G72A 2Z09A 1DC4A 3RKUA 1N33B 2QV0A 4L4RA 5FLYA 1P7WA 3RCBA 4CV0A 1BXKA 1QS0A 4HXGA 3EZYA 1NURA 1XZDA 2VHXA 1P39A 5E8RA 4ESVA 5AKZA 3GD5A 4X54A 1ULBA 2VNJA 4QYIA 5CTAA 4U9IS 2HT1A 5DEIA 3GT4A 2DOKA 1FNBA 1PQWA 2V0CA 2K7FA 3RU7A 1QH1A 5LXTB 5IDXA 1YULA 3EGVA 1FP6A 2AMLA 4I46A 4RH1A 4KDRA 4IKPA 2HPAA 2VJAA 2A9QA 1XU9A 1ZIYA 2FW8A 2WF9A 3Q3GE 3I9NA 2COKA 3PZRA 1S0UA 2VYNA 5AYVA 1VA5A 2J3JA 3KPWA 2J59A 1USGA 2Z2YA 3NBYC 1A0OA 3NOVA 2FMIA 5BSUA 4A82A 4KKVA 1D0IA 1BH2A 1Z75A 3TTWA 5LXTA 3AEUA 5ALYA 1A8IA 3HLKA 2HOQA 4RFSA 3PNYA 2DFTA 4LZNA 1ODTC 2PWAA 2W9XA 4UEQA 3ZV5A 4BVKA 4YY3B 1D3AA 2Q5IA 2CJWA 4AN4A 2QTTA 1OA0A 1IOLA 1CSEE 2OC9A 4IHJB 5DOVA 1ESDA 3RSFA 5AIBA 1K7YA 4JC4A 4NV0A 4GR9A 2ODBA 4KC0A 1J4AA 1HDOA 3GXOA 1PSWA 3DMDA 5IP5A 2DCUA 4OM8A 2QLJA 5IVIA 4YDSA 3OLCX 3RUFA 2H4WA 3PDCA 1Y42X 1H0SA 4CDRA 1UAYA 1QQBA 1ZK0A 4TV8A 4ABYA 5B12A 2PLNA 3WMRA 1MB0A 3V4VB 5KSYA 2GXQA 1A7AA 1JSCA 2OSVA 2TMKA 4P3NA 2E85A 4NBNA 1Q7BA 3P4XA 2JFPA 2W8BA 2OYSA 3DD1A 1U3FA 2FI1A 3WGIA 1U63A 1PUXA 1C7JA 1J20A 1ZI6A 2XNHA 3OCWA 1OU4A 2N75A 5TQVA 2HNBA 2JKYA 1DKMA 4MKZA 4N5IX 1HMYA 1ONSA 1WMAA 4C5BA 1G8KA 2ZE7A 1SXQA 3SDZA 1NW8A 1FP4A 4D9KA 4DR3B 3FOCA 3OPXA 4DNQA 5D3QA 2E5LB 1M1NB 3FCOA 4E21A 1MT3A 3OX2A 2XT9A 1RE0A 3SVTA 4LJSA 4LY0A 1BXRB 2P8JA 3JATB 2P5SA 1HNWB 3NM6B 3B5EA 2NO6A 3WGMA 2IVFA 4EARA 1NU8A 5L51A 3QE9Y 1Q1NA 3BMQA 3LQYA 4R5HA 4EMSA 4RD0A 3KJIA 3EXEB 1W0JA 4MB0A 4YP0A 4B82A 4C01A 1HNXB 3NBUA 2H1SA 4QOGA 5EN4A 4ASUD 5JY1A 4LE0A 4E03A 3I92A 5IBRA 4DYDA 4B3HA 2CXUA 1O08A 2HBRA 2PVCA 2RGXA 1GUDA 3FA2A 4I1RA 4Q1CA 1T4BA 3AVWA 4HB3A 5F98A 5F5LA 3ZK7A 4H4DA 4LYAA 1EJ0A 1IHOA 1PSDA 1PS9A 1G42A 1JI0A 4M60A 4YQZA 2PT5A 1QMGA 2GZ1A 1WXGA 2Y2UA 2YXLA 2WHPB 5KQLA 3NBKA 3O9MA 1CY2A 1ABFA 3BREA 4L5JA 4OL9A 4P7BA 2GZHA 3A6LA 3D6AA 4ZQCB 4JI3B 2ZZNA 3GNTA 2QVBA 3HV2A 1P1JA 4JJZA 5EKDA 4ZCMA 1OD6A 1UMCA 2BT4A 5BWOA 4YTEA 4E15A 3C3CA 4A5OA 4F21A 1G21E 4NFYA 3WOHA 4M22A 5TDHA 3OT1B 1H9BA 3HNOA 4UHEA 1R4ZA 5FPKA 5HM8A 1JPNA 2A58A 3NH6A 2D2VA 4ZIRB 2GWRA 1M5TA 1R0ZA 3P2MA 1CRPA 1C5KA 4MW0A 1T10A 1WHTB 3WISA 2GPSA 1RXEA 3K6SB 4W5OA 1SVWA 2XAAA 3SU8A 3O4FA 1DPFA 3DMGA 5AHKA 3GLGB 3THXB 1U0RA 1F6BA 2ON6A 2A92A 2NZUG 4IAOA 4MULA 2YV2A 1JG4A 3SHVA 1SU6A 1CDEA 3EQ2A 4JBHA 1I7NA 2X9LA 3FR7A 2W0MA 2Q2OA 4NE2A 3NCHA 2BPOA 2NG1A 3GY0A 1AZSC 4P38A 2NO1A 4PICA 2M6KA 1NI3A 4XD7A 5FNVA 5C8XA 3ADCA 1GG9A 4KQMA 3FRJA 2GUWA 4NZOA 1QFYA 3ZYZA 4AF8A 5FPPA 4NQZA 2GZ3A 4IP0A 2A78A 4OGFA 3VR2D 2C5GA 5AI9A 4L3VA 1ZLXA 1I33A 1XF1A 1Z8NA 4C2UA 1N2XA 4EHAA 4AN0A 3MWLA 4JYCA 4KQEA 5GJCA 2JG3A 4JI0B 1KI7A 5J4HA 2BW0A 3E27A 3H1GA 2AOVA 3K96A 4G23A 2C3PA 3M83A 3MWDA 3RF6A 4P3PA 4Q16A 1NFRA 4XLZA 1QIDA 2E48A 5MFZA 1JBEA 2ZANA 3PA8A 1U8XX 3M9LA 4LJLA 4LQLA 4RZ2A 1FFXB 2C9DA 1XZNA 3IUQA 4S24A 3NRBA 4OQLA 1WP9A 3BJMA 1RM5A 2NV2B 3DW3X 2MIIA 4IJ6A 4P84A 2PMWB 4JKOA 4UAUA 4B83A 1LNZA 4BQNA 5JQGB 4MQFB 1PJSA 4YAIA 1WPGA 3C6BA 4IILA 4OFXA 3EH2A 3UM9A 3IEUA 3SIRA 1GQSA 4AP9A 2G71A 1EJ6A 3JS5A 4O4IB 5CNIA 4F4FA 4L8LA 2OP1A 3FSEA 4Q4HA 2IU0A 4C5CA 1DPGA 1V1RA 1NN3A 3I45A 1ZSVA 3OZDA 4LYDA 5A6SB 3DTTA 3GXBA 5F64A 4DAEA 4EY7A 3RS0A 1E4OA 2HCRA 4QYWA 2R6ZA 3AILA 3ZVLA 4DTCA 1D07A 5FH9A 3WICA 1TFUA 1E9SA 4P53A 1P0FA 2ZSUA 5DNUA 4Z9FA 3ZCSA 1E2MA 4J16A 4XGKA 2YFYA 1U2PA 1SZDA 5IABA 5KAPA 4DY6A 1S2DA 2GSDA 4IDCA 2FA9A 4J1QA 3CNQS 3DS8A 2FSIA 3LLVA 2C95A 1XVVA 4L27A 4NYMR 3TPZA 4HXYA 4RTOA 1XR3A 2WKWA 1EFTA 3FSGA 3EJ6A 4FE3A 4R71A 2Q6VA 2QQ5A 4BDSA 3JD3A 4YC7A 2QF7A 3V4SA 1DWQA 1VLJA 1ZD3A 2JBWA 1GL3A 1OW3B 1Q92A 3WWZA 4BRZA 1CB7A 1Y8AA 2OZLA 5AOVA 3UWPA 4AQDA 2MSLA 4CHTA 5JD4A 1MRSA 2GM9A 4YAOA 5IDWA 2A4MA 4BC0A 1T4GA 7AT1A 1AKVA 3BEOA 4E11A 1U80A 1ANKA 3AT1A 4CDMA 3WAGA 1P18A 1R00A 3A6HA 2AD5A 3CRRA 5E4JA 2Q1WA 2VDWA 5C18A 1BD3A 1O94D 5IFKA 1PUJA 3OH8A 3WNZA 1O3YA 2ZIAA 1Z83A 1MJFA 3JWJA 3ZHVA 1RFGE 1QTIA 1NKSA 1T5BA 2G08A 2GCOB 4B5KA 2OB1A 3B36A 2WJGA 2ODTX 1NBIA 3GDHA 1X6VA 4RLSA 2YW9A 3HVHA 3K0CA 3DJYA 4DQUA 1G3UA 1P4HA 2UVPB 3EAGA 5LQUA 2FOXA 5ALNA 1C3XA 2QX4A 3AZQA 3S44A 2FK8A 4K9MA 2HGZA 4CKWB 2HPVA 1JHQA 3BFVA 1ZW1A 3I1JA 4WK6A 4TWIA 4YJ2B 4OKIA 5D01A 1JB1A 1OX6A 2FVXA 2P9EA 3AUFA 3CX7A 4O5OA 4DCOA 1S8OA 3L1UA 2WE8A 1OTYA 2B5VA 2G9UA 3GLFE 1SQ6A 2IU4A 4Q1AA 3IHLA 1IRXA 3L7MA 1YOVA 2IH5A 2R9VA 1XJWA 3K2IA 4RVCA 2P1RA 1M2WA 2JFHA 1M3SA 3HXKA 5TVGA 3DE4X 3HJAA 1JFRA 5EUBA 4DB4A 1NM5A 1WMFA 4O2BB 5AMXA 3U5TA 1E2LA 5JECA 3T1VA 2MSDB 1XCOA 5AK6A 4R1NA 1GKUB 2EF0A 3RO7A 4D4JA 4PZUA 3X2SA 1GIAA 2YV1A 1TAGA 3NDBB 3MOSA 4NR0A 3I73A 1Q7GA 4B45A 1RABA 3JQ8A 3B3QA 1UJ5A 2VKQA 1FTSA 1J06A 1WPQA 4FINA 4LDPA 1E2JA 1XZKA 3O8CA 3DPIA 3LA8A 4MJ7A 4UOQA 1EXDA 4BVGA 3G8YA 3HR8A 4XVHA 2OLJA 1NGSA 5FL7D 1U5CA 2Q5QA 3GUHA 4X1IA 1DMSA 2W6NA 3L8MA 1DFGA 1W35A 3WMGA 4XD7D 4BNTA 2P11A 2CHEA 4EFKA 1W52X 1YHYA 1XK6A 2ZM6B 2DY1A 3A4LA 4FP9A 2Z4TA 3THWB 3R3HA 2V7QD 4J94A 1W8DA 4YHHB 2IZ0A 3ZDDA 3SAJA 3N86A 5I48A 1QCDA 5F2NA 2WF5A 4ALIA 1AQNA 2CK3A 1CU1A 1M2KA 5AW9A 5I9LA 1L7DA 5IBCA 2QM3A 1SD2A 4AS2A 3AC0A 3MRTA 1CR0A 3H5TA 1GD1O 4H7FA 3LLSA 1V37A 1L4YA 2P6UA 3K0FB 4RNDB 5KOYA 3SEZA 4MUMA 1I7DA 1RJ9B 4XQ9A 3LLUA 1NBME 2FG6C 3RQSA 4YT4A 4G0PA 5B1YA 3HBAA 4TLMB 4GX2A 4PRYA 3OT1A 5KOJA 3KV1A 4LNHA 3FZGA 2F3UA 4ISBA 4UM9B 3UY4A 1TRHA 2BKEA 5ALRA 1SBZA 3TGPA 2I9PA 2A3RA 1JU9A 3IRUA 2PWZA 5EKSA 5KS2A 1V8PA 2CJXA 2XB2A 2IHNA 1XKQA 2HRZA 1EH5A 1K6JA 2OXTA 3VU9A 3WVNA 4A0RA 1VCIA 4G5YA 1UFQA 2O2HA 4B3CA 1MFPA 1SCNE 2PKYX 1R8QA 2WSYB 3CYFA 1VJ0A 5JR3A 3UB2A 4WNIA 5DISB 3HVRA 1CZLA 4JUDX 3IVXA 1E2PA 2AN5A 3FGNA 3FRIA 1BWQA 2OD9A 4HNVA 1ILEA 1UOQA 1ICEA 2VT3A 3QVSA 2HLDD 1UKVY 2ROQA 2NSDA 2HDOA 4WUTA 3GRKA 4YJ3F 1E5XA 2CBXA 5DK6A 2R6DA 5IN5A 3ZXSA 1D8AA 1E6KA 3ZWKA 2W98A 5TIIA 4BCBA 1JB9A 1V45E 2BELA 2E7ZA 1UOEA 3IR7A 1GUYA 4AKGA 2L42A 3DAGA 3HACA 3RG2A 4N82A 4BCCA 2KWIA 3WGJA 1YBMA 2FWRA 1WIWA 2A9OA 2EBHX 1L1RA 4EA9A 1JTVA 2WYHA 1NW6A 3VR6D 1B00A 4B33A 4LJ5A 1KTIA 3JAWB 4RPHA 1SVNA 4JLVA 4UHJA 2G6TA 1KYXA 2JK1A 5KKCA 4QQRA 1RYNA 2ZR8A 5DCWA 5ALJA 2NQ8A 4YJGA 1W4AA 3HFJA 5CEFA 1YDWA 2QUBA 1DLJA 5BNWA 1H2ZA 1K6IA 2YN0A 1SR8A 5IULC 3LUCA 5TXGA 1U5AA 2GBGA 1RFLA 4H0CA 2GEKA 2IDKA 4JLDA 4PG5A 1NG9A 4Y7DA 1E92A 1NDHA 1DG9A 3I2IA 4MHTA 4MROA 4BAUA 1XTPA 2I2BA 4ITUA 3D5TA 1BRMA 1HEIA 1JHRA 1BO6A 1NJ2A 1T0JB 2AVNA 2GZMA 2AC4A 3RTCA 4J29A 1D2RA 4WNCA 1VA4A 2AI3A 2YWDA 4NEQA 3DTYA 5FV7A 3HUFA 2C9OA 3PV0A 4GOND 4K3VA 5JCPA 2AZTA 1QAMA 2XCTB 4OLJA 3KEMA 4L5AA 1IWOA 3LS2A 2WQ7A 4XZ3A 1WQ4A 4R8VA 1IUPA 4UXHA 2CXTA 3V4ZA 4C20A 1AGYA 1G8PA 1GZ4A 1JG3A 1Q57A 1QMPA 4JBLA 4C7VA 4NEGA 4ETNA 5JJKA 2DPGA 4G0YA 4BMPB 2PBLA 1NNSA 2GTHA 3CRQA 4G24A 1TYZA 3GLKA 2IYRA 3H1BA 4B6SA 4ILKA 1ONBA 2ODNA 3FPAA 1YZ3A 1FE8A 3TX2A 1U04A 4HLDA 5BW6B 1YFJA 2VPQA 4GRIA 3KKEA 1DAGA 2I2DA 2NO4A 4DUZB 5LZ7A 3SKYA 2VH5R 3PJEA 4HVCA 2YKGA 3RYHA 4QHTA 1L7QA 3KDSE 4UCWA 2O8DA 3CW9A 4I55B 3L1VA 2G1JA 2R87A 2Q27A 3LUKA 1U90A 3E0XA 3R7WA 3RSOA 1GITA 1K8RA 4K6HA 3F5FA 3ONEA 3DEZA 3TO5A 2G40A 1H8HD 4HQ6A 1BJTA 4B76A 5CBKA 5GY7A 3P9NA 3PI6A 1I1HA 1EE1A 1QKKA 5F3RA 2BZSA 2ZUVA 3BMOA 1XCJA 3OIWA 1FU8A 2EW8A 5K0NA 1IHPA 1M2JA 3RRXA 1XC7A 2EOAA 2GNPA 4I14A 4R2KA 5G53C 4EY8A 4IRUB 3DZFA 3CRMA 3AKZA 1E1KA 1FDSA 1T9CA 1L8LA 5HR5A 2PWBA 3LYAA 4R2IA 3V32A 4PSKA 3JQ9C 1X13A 1EK0A 2BFFA 2J3DA 1N2EA 4ZXPA 1EK1A 1QOQB 3FCSB 4QOJA 2VTDA 2XB4A 4CWAA 4CKEA 6AT1A 2EEZA 2OXCA 2IOFA 3EH1A 1EINA 1MW9X 2ZWIA 4RXMA 3I6YA 1IZYA 3L7DA 4WK0B 4CL3A 4BUJA 4R84A 2AZMA 4YRRA 4X8LA 2IE0A 2Z43A 3ESRA 4JK3A 1EX1A 2P6PA 2PKCA 4YJFA 3V4FA 1NI5A 4CIVA 3OPMA 1CY0A 4NXMB 1MA0A 3ASYA 4DV5B 2A5JA 2R84A 4B3MB 2AFRA 4B4UA 1Z8HA 2FY8A 1C7QA 2OFPA 2VA9A 2HBZA 5ICEA 4NYIQ 1G8YA 1LLQA 1PZEA 2O2XA 3UH1A 2DUNA 4TYMA 1MNQA 2CW5A 2LXNA 1KDZA 2FDRA 2QRHA 3MUFA 1T0IA 3I1FA 2VNSA 2GGSA 3LFHA 3IUNA 4B3DA 4UBKA 1UT6A 2RHTA 4URYR 1CNMA 1K5HA 1V7ZA 3NTRA 4TQUS 5GOTA 1F8YA 1KZ6A 5AVYA 2ORYA 2PM8A 3R0XA 1GY8A 1HXHA 1Y1QA 4W8GA 3M6FA 5EUCA 4YQEA 4C3VA 3P5BA 1DZ3A 3VAAA 1N7JA 2XECA 3KFXA 5DN6A 5FQOA 2QM7A 3WO0A 1S2IA 3QF7A 1QTRA 4ID9A 1U9CA 1JDBC 3SKVA 1T8PA 5KVAA 4URZR 1LDMA 3AY3A 2J31A 3CM0A 4EYEA 4CFZA 5HG0A 5BV7A 2VPXA 2ZTSA 2ID4A 1IC6A 1Q20A 4N0QA 3FWPA 3MYYA 1R4NA 3BMCA 3TIGA 2SKCA 4LSGA 3ZK9A 2XB6A 5KDDA 4QBGB 4URFA 1R3DA 5AJWA 2H1FA 4PLGA 2LDXA 3PL1A 4CM8A 1SD1A 3PC8A 2J0EA 3QFHA 5DM2A 3GLFA 2BEUA 4KEAA 2OOKA 4EK9A 5CU7A 3ZVRA 1KDPA 3OCVA 4GWGA 4H60A 1HNNA 4JLMA 5AKLA 1APBA 3RVDA 4ZCPA 3G17A 2XMGA 2QYSA 2VUUA 3DMNA 2GK7A 4HLUA 4J43A 4LG1A 2F1OA 1M8JA 1XT6A 5LJIA 1EVYA 3BKWA 1GNRA 1TZJA 3S8MA 2DZDA 4N3AA 1ZU4A 4TMWA 2Z6UA 4TWAA 2D74A 4KN5A 4LK2A 1CZNA 1LV8A 5EXEA 2P9YA 5KU7A 5J3JA 1RXWA 1LV7A 1HY3A 2WOJA 3BHIA 1MQSA 1UADA 1ABEA 3WLIA 2PUCA 4MKGA 1V1RB 1XZFA 3KQPA 5AJUA 2FOLA 4RETA 1P5FA 1W59A 3IXMA 5BW4A 3P26A 4KODA 2QZPA 3KXPA 3OU7A 4BPRA 3BB3A 2DKFA 4BFYA 4HY3A 4ZA2A 3N0VA 4BNWA 4CQLA 3A9SA 2WA2A 4XAQA 5EXSA 4X64B 3NDJA 2YHIB 2ZU0C 3OE7A 4A10A 5MFPA 3JQ7A 4IIUA 1TM7E 2HA5A 3D8UA 3IAM6 2GHTA 4MS3A 5EMLA 3CLSD 3GN2A 3LQ1A 2OD2A 4TTVA 3RD5A 4HDSB 3MWJA 3FVVA 2QP3A 3C7DB 3DW1X 4MRSA 2GT1A 5GJBA 3BWVA 3HKDA 5CDFA 3VO8A 1PWYE 4PTYA 1DDOA 1U7HA 3OURA 1UDWA 2Q1TA 4BASA 3AI7A 3IAHA 3WK8A 4BIMA 3HHPA 5EVCA 2OCAA 4RAQA 1GCGA 3IUEA 4N0PA 2RHOA 2NAFA 3U9SA 1TXGA 3M3HA 4A73A 4O4JF 1K3TA 5AICA 2ZIWB 4PS0A 4BQPA 1GAQA 1M8FA 3II6X 1Y3IA 5FADA 1CJBA 1HRKA 3JYNA 2JEZA 2QM0A 4JLUA 2QNRA 4U7FA 4PEVA 4QYXA 2CXHA 3S70A 4EVSA 1JR3A 1FRNA 1YKFA 2ARKA 4NEHB 3NB0A 3KEGA 1C3LA 1G5RA 4IQFA 4KWEA 3DGFC 1DT5A 1KPIA 4EHFA 1OTXA 1F7UA 4HI0E 4KGXA 2OKGA 4M0MA 5JQWA 2GDZA 5AW1A 5K0EA 3CY6A 3OEYA 1WA5A 1GQRA 4JLJA 4IV0A 2PRSA 2XOEA 4FGWA 4JAVC 1Y9EA 2XDYA 2WZQA 3N7UA 5AW8A 1NX9A 3C7AA 3W77A 4OU5A 2HK8A 3AR3A 1IY8A 3ZWMA 1IYZA 2DPLA 1K7SN 3LQQA 4C76A 3EPHA 3BPSA 5JDIA 1IN6A 3O3MB 4C4RA 1FRZA 2DE0X 4LMRA 3MQ2A 3R3ZA 3MUOA 4HS9A 3RRBA 3NW9A 4JLNA 4LQCA 2FMKA 2EERA 4MGHA 2UAGA 3Q3HA 2VAXA 4XM1A 3LXRA 5IJ9A 3EVBA 3WDKA 3HBFA 5H68A 1JF8A 1YR1A 3PGLA 1UMCB 4GNKA 4RKEA 2NSJA 2CLMB 3QXHA 3DBHB 4YCJA 1S02A 3ECAA 3U09A 3UJ7A 1U3GA 5JI3E 1K6MA 2YIDA 1NVMB 1W76A 4NX2A 2V7WA 4JIGA 3NBXX 3C2QA 1W0KA 2XMQA 1HQYE 1U0EA 4JI6B 4QM7A 1XRJA 1V5EA 4DSTA 3Q1LA 1YL7A 4YJGB 2MR6A 4Y98A 5GIPE 3EVAA 3I3OA 4J7CA 1YRQA 5DIZA 1FJHA 2EBUA 4QEKA 5JSYA 4B4VA 1SCDA 3I6MA 1AQLA 1VKRA 3JAWA 3T95A 4D0LB 2PSHA 4KO2S 1M8PA 3AU9A 3QLUA 3VKUA 1WS6A 2REQB 3DB1A 3ZZMA 1QGUA 4I1VA 1TVMA 4PX2A 3D64A 3SJUA 3T7TA 1QO9A 2QSZA 4IFTA 3C70A 3B51X 1JJBA 1CW2B 1J8VA 1E3WA 3EVDA 2AF4C 3OM8A 5CX1A 2EL9A 1EAMA 1UPXA 4HX2A 2IYVA 2J9FB 3NAZA 5KNBH 3MINA 2KE5A 4M4SA 2CFIA 2XBUA 5B4VA 2CL7X 4RDCA 1PEYA 4CR7A 3T3MB 3D2LA 4DILA 2OZVA 2NSYA 3B9QA 4DJFC 5GVSA 1KAMA 1SBYA 1PJTA 2X2EA 4WV3A 1NASA 1TL7C 3NOXA 4P7KA 2IYUA 4Y2QA 5HFJA 2ZJ6A 2ACVA 3CSSA 3O75A 4ARVA 2E55A 3GPBA 5EQTA 4FHEA 5LQAA 6REQA 2ZJ1A 3AF6A 1KEZA 4FDUA 4MA4A 4ALMA 1VPTA 1Y81A 3J7AC 1ZX1A 3KIPA 3NHZA 3RTBA 5CITA 5KOHA 1E1RD 4GGMX 2ZKIA 4G1VA 2ZT8A 3ANXA 4HPXB 4KREA 4QUBA 5DM60 2FZLA 2VC2B 1GSHA 2VNAA 1MVLA 4AC9A 5KJ1A 1EUZA 4KXYA 2HZBA 2PR2A 3MMPA 4QPDA 4KOAA 4RF4A 5IF9A 3ABIA 1G5HA 3QX8A 1YE8A 2C20A 3UMBA 1QH9A 3ZQ6A 4ZZ0A 3Q7TA 4L4UA 3UKOA 3T3HA 1YQWA 1K8QA 1AHIA 3ACBA 3L1KA 3HN7A 4PR3A 4GG1A 4EFNA 3I32A 2AKAB 2KBEA 2P8SA 4IDNA 4I6EA 5HE9A 3BXPA 1W93A 1T0PA 4E30A 1XVIA 1Z6AA 2EGHA 3ONWA 2HWWA 3QA9A 3QA3E 4LE2A 4NFSA 4TRJA 3R7NA 4BE9A 2ISCA 5KWEA 1NJGA 2GHRA 3CCCA 5F9MA 4O4LF 4X95A 5DHRA 4F96A 1G6OA 2Q2QA 3IJRA 4EB3A 3LUAA 4MQ4A 4YRTA 2XQJA 3KHKA 4XGIA 2NXNA 5ITWA 3HG7A 2F17A 4ND8B 2Z9CA 3P32A 1Z28A 4KQCA 3D3WB 3HCFA 2P2GA 1NLUA 1Y80A 3PFBA 5IEBA 4AAYA 3GRFA 3L7IA 1UAAA 1JN0A 3G1TA 3JZDA 1VBKA 2AG8A 2O7SA 1FRVA 3K8OE 4Z4EA 4KPEC 1MP0A 2PUVA 1GGVA 3OSUA 3D7RA 2BGJA 3GJYA 4RO0A 3T1QA 4G9BA 4B2PA 2BKVA 5JIBA 2E89A 4WBSA 1MO2A 1OPXA 1KP3A 5F1PA 1E9CA 3AERA 5CVTA 4X0EA 5I01A 4N8SA 3AX6A 1AA6A 1YZTA 4M1OA 2XT6A 2Q2WA 3OOWA 1YZHA 4QUKA 2A88A 1IU9A 1RWMA 3D6HA 1NJ8A 3EC1A 1X7ZB 3FWKA 3R7FA 2D5AA 5H70A 1E5QA 2GD1O 3C6XA 4IHQA 1U1IA 3SDBA 2JIZA 4DA6A 1GVNB 1T13A 2HYDA 3GFPA 3NCTA 1O77A 4YIKA 3I04M 4BWGA 4GBMA 5JMTA 2I99A 5JFOA 1H4SA 4W4TA 4R8MA 4AUNA 5IU6A 1EBUA 1YUNA 4HWRA 2BR4A 3HNRA 1N5KA 5BMVA 1V6SA 2X22A 3G2PA 2IF2A 2OEPA 1P0QA 2FSFA 2JLRA 4RZHA 2WB2A 2Q0HA 1WBJB 2J9FA 5FAXA 5GV8A 1N92A 1OGIA 4K9KA 2FSHA 1NMQA 3N39C 2O57A 4M1KA 4TVOA 2I76A 5EIHA 5HW0A 2YV3A 4MIOA 2AN1A 1R6VA 3NVMB 3UBMA 3O82A 3AESA 3M9XA 1PTKA 2INGX 3CGGA 2JAHA 5DX1A 2XZTA 9LDTA 3PCRB 5LQRA 5DF1A 2W2NA 1MO4A 4Z0HO 5CLLA 3U6KA 1FPMA 3SE0A 3BRQA 4KMMA 3I09A 4DBZA 4QU5A 2DRIA 1E7QA 5FPTA 4OHPA 2WT4A 2LNDA 8ATCA 3F6SA 3M0EA 5KTRA 1NLZA 3BULA 3SFTA 2J5RA 4D4LA 4D9BA 4CLRA 5ECWA 1AQIA 2WYWA 3DAOA 3O92A 4A4DA 1C9KA 1FYDA 3KQYA 1V9CA 1E2UA 4YRFA 2Q2VA 3W3ZB 3FTPA 3S4YA 1SCKA 2XUGA 3QY0A 3TCKA 4DJAA 3STXA 1YR3A 3DQPA 2A14A 2P78A 4TVKA 3HDJA 4DJJA 2WTAA 5IT5A 1JSRA 3CNEA 3R9XA 1HNZB 2UUCB 2Q41A 2P77A 1Z26A 1B16A 1NUTA 2IEAA 1KERA 1S4MA 1OZFA 1GO2A 5E3JA 2B21A 5GTDA 1EXVA 5DNVA 4IIGA 1PJCA