4HGRA

Crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
163
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGAKTEIVRRRAEALKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase, hydrolase
total genus 53
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgrA00
2NO5A 2YMQA 5AVYA 4CF4A 5AKKA 3PGVA 3ONNA 3A1EA 4H1WA 2I34A 1U2TA 1L7MA 3W5AA 2YJ3A 5AHXA 3ZW7A 2P11A 5AVWA 3L8EA 5AM4A 3U7GA 4F72A 2ZOSA 2ZXEA 3UMGA 1RPZA 3SKYA 4XPZA 3IJ5A 3OCVA 5ALSA 4UATA 4HYTA 1YS9A 4KX5A 5AM1A 2GHQA 3AR8A 4RESA 2JAWA 4KYTA 2G08A 4Y2UA 2X4DA 1RQNA 2GMWA 2I33A 5AVZA 3QU7A 2CN1A 4NABA 1T5TA 2YN4A 4YCMA 3L0BA 2YJ5A 1XPJA 3N5KA 1N8NA 4BBJA 1WVIA 3QYPA 3ZVMA 2GO7A 2RAVA 3E58A 1ZD5A 5AKYA 4OFZA 2I54A 1SWVA 2HSZA 5AKEA 3U26A 1RDFA 5AW8A 2G1AA 4KNWA 3UM9A 4BNDA 2PQ0A 2IYEA 2C4NA 4Y2RA 4UAUA 4UM5A 3NUQA 5A3QA 2YMLA 5AIBA 5FP0A 2PKEA 4Y2YA 4DWOA 2C8KA 4UAVA 1Z4LA 2G80A 1Z4MA 3ZX5A 3S6JA 3MMZA 3SMVA 2OM6A 5ALIA 3UMCA 1YDFA 2HF2A 3DNPA 3NANA 5AW4A 1RKQA 3AR5A 3QGMA 3FPBA 3L0CA 3M9LA 3QU9A 3WK6A 1TJ3A 2B0CA 4UU0A 3SD7A 3L0YA 3KBBA 4AS2A 3F9RA 4UMEA 1Q92A 5AKHA 5ALGA 2D2VA 4QJBA 2RARA 3BA6A 4YGYA 2OA0A 3QU5A 1MH9A 3OCXA 3ZU6A 3L8HA 4KX3A 2B30A 3E84A 4J03A 2R8XA 1S8OA 2W43A 5AI9A 2ZBFA 2YFYA 3WKBA 2BY4A 5AW2A 1YMQA 3W5CA 5AESA 2I6XA 2JAUA 5ALNA 3HLTA 4GIBA 3SF0A 1EK2A 5ALOA 1RQLA 1CR6A 1QYIA 3ET4A 2P69A 2BDEA 1PW5A 3L8GA 5AKIA 3RFUA 5ALTA 1K1EA 2BDUA 5AK4A 1AQ6A 3NALA 3A1CA 3OCUA 4I9GA 5AM0A 2JAOA 3DV9A 2OBBA 5IT4A 4DW8A 5ALFA 4QQFA 1YV9A 1WPGA 2RB5A 3AR7A 3QLEA 4FFDA 5AVTA 3OPXA 2IOFK 2W4MA 3E8MA 3WGUA 2NYVA 1J97A 2W11A 4YIKA 3ZWKA 4I9FA 2CFRA 3WKEA 3WGVA 1TJ5A 1Y8AA 4MWOA 4DCCA 4DFDA 3ZVNA 4NFLA 3B9BA 3EF1A 5A3SA 3TLMA 1Z5UA 1Z4IA 5AW7A 1QQ6A 1L7NA 2IA5A 2ODAA 1L6RA 1RLTA 3E81A 1IWOA 4BEWA 3MN1A 5ALWA 2YJ4A 2HDOA 4JDPA 5AW3A 5AKJA 3AR3A 2FUCA 1Z4QA 1ZS9A 2YMMA 5ALXA 4UARA 2AMYA 3DDHA 3NASA 4FE3A 4BKMA 5AW6A 2P27A 5ALKA 3SLRA 2Q5EA 3OCWA 3N1UA 3OCYA 3WKAA 2B82A 2G07A 2VKQA 4HGQA 1TA0A 5IT0A 1QQ5A 1TJ4A 1ZD3A 2MU1A 2WM8A 2WFAA 1Z4NA 4Y2XA 3FGOA 3D6JA 2WHEA 4HGOA 5ALRA 4PNHA 3KC2A 4C4SA 4EELA 5ALPA 5ALUA 1ZOLA 1LTQA 4RETA 2HEGA 2FI1A 5AKZA 5A3RA 4C4TA 4KNVA 3N07A 5ALYA 5AW0A 3CNHA 3U7EB 1Z4JA 1X42A 5T41A 3J7TA 2R8ZA 3ZX4A 2B1QA 2ZBEA 2FDRA 4ZEVA 2EATA 3U7HB 3AR4A 4OHFA 3FM9A 2YY6A 1Z88A 5AI6A 4CE6A 3QU4A 5AM5A 3QNMA 2JARA 3EPRA 2G09A 5AICA 4Y2VA 3R9KA 5IS2A 2C88A 3ESQA 4BX0A 4HGPA 4YCNA 2HX1A 3EWIA 1U7PA 3N8GA 4UMDA 1QQ7A 3K1ZA 1EK1A 1FEZA 2FEAA 3QUBA 4XE5A 3WK7A 3KD3A 1TE2A 2I55A 2AGVA 1J8DA 1L8OA 1S2OA 3QUTA 4BNDB 3QUCA 2AUTA 4Y2JA 2ZG6A 2CFTA 4C4RA 3AR9A 4ZEXA 3I28A 2ZBDA 1ZRNA 1RLOA 3QU2A 2IOHA 4NWIA 3L8FA 4NAVA 1QH9A 2MSNA 4OD0A 4UMFA 3VAYA 3NRJA 3GYGA 3AR2A 2FUEA 3ED5A 2FPXA 1RMYA 1WZCA 1JUDA 5AVUA 3NAMA 1U7OA 4UM7A 4MUMA 4CNQA 2IOFA 1RRCA 1Z4KA 1F5SA 1VJ5A 5AKGA 3RF6A 1L7PA 4EENA 3M1YA 4YIHA 3OTQA 3PDWA 5AKLA 2AH5A 5AK5A 1U2SA 2G0AA 3W5DA 1T5SA 3WKCA 2HF7A 3ZTWA 1NF2A 5AM2A 5AK3A 4BX2A 4OCZA 5ALZA 3ET5A 4UMVA 4BEVA 3U7FB 2RBKA 1Z4OA 4AP9A 5AW1A 2DQSA 1LVHA 2HI0A 5ALJA 2HCFA 4UASA 4IG4A 3W5BA 2YBDA 2Q4RA 5AVQA 3L1VA 3L5KA 2WF8A 3EF0A 4Y2QA 1O03A 2R8EA 4CF5A 4UW9A 1RMTA 3AR6A 5AI0A 2HHLA 4XOUA 2C9MA 4ZEWA 3QX7A 5ALLA 1RMQA 1ZD4A 2OYCA 2GFHA 4J2TA 3ESRA 3WK8A 3A1DA 3L7YA 3A3YA 1ZD2P 2CFSA 1Z5GA 4NV0A 1L8LA 5ALQA 4Y2PA 4EX7A 4HAIA 4G9BA 4CF3A 3P96A 1KYTA 4AS3A 4UU1A 3WK5A 2YJ6A 3B9RA 3U13A 5ALHA 3MPOA 5AI8A 2ZBGA 4YCLA 2B8JA 3OCZA 3B8EA 2PR7A 2WF7A 4Y3UA 1Q91A 3KOOA 1U02A 2R8YA 3R09A 1WR8A 4YH1A 5AVVA 2O2XA 2QYHA 1SU4A 3KZXA 3PGLA 1O08A 5AI4A 2G06A 3BWVA 2YMPA 3WK9A 3ZI4A 4EZEA 2GHTA 5AVSA 3HYCA 4GXTA 1RKVA 5ALVA 4HGRA 3ZUPA 2WF9A 3I1YA 2NO4A 3KDPA 2JGAA 5AW9A 3CZ4A 2EARA 1YJ5A 3I76A 3UMBA 4Y2SA 5AIAA 3L1UA 4L57A 1XP5A 3I6BA 5E0OA 3SHQA 5ALMA 1RC8A 4EX6A 1ZRMA 3FPSA 4FYPA 2WF6A 1YNSA 4G63A 2C8LA 3PCTA 2Q4TA 1RLMA 2B1RA 4O8CA 3IRUA 5AVRA 3IB6A 4HGNA 2I7DA 2FPSA 3WKDA 3FVVA 5AK6A 5ALEA 4KN8A 3R4CA 1VJRA 2FPRA 4F71A 3WK4A 3QXGA 3SKXA 5JJBA 1NNLA 4E88A 4BYGA 3ZTYA 5AVXA 1L7OA 2FPWA 3DAOA 4BX3A 1Z4PX 3N28A 1N9KA 3MC1A 1NRWA 3ZWDA 2P9JA 1RKUA 5AI5A 5ALDA 5AM3A 1ZJJA 2FPUA 1VFPA 2HOQA 2WF5A 2HO4A 4Y2TA 4L6CA 4EEKA 3NIWA 3QUQA 4B6JA 4L6AA 1CQZA 5AKXA 2O9JA 4XQ0A 2QLTA 5AW5A 1SWWA 2B8EA 4JB3A 3ZVLA 2EAUA 1XVIA 4IFTA 3U19A 1T9ZA 3FZQA
chains in the Genus database with same CATH superfamily
4E4TA 1R00A 1DP4A 1K97A 2J1LA 2FFRA 3KWMA 4O4JA 4UBOA 4WDQA 3QF4A 4FGKA 5IARA 3L4BA 2J7PD 1ZOOA 2RIPA 1RRKA 3OUZA 2ZIFA 1IZYA 5JMTA 4Z0HO 1A82A 3ONNA 1ZSYA 3AY0A 4XASA 1U2TA 1D5CA 2Q46A 3OMWA 4TMWA 4CL8A 3CC8A 4WWHA 1MB2A 4EQ6B 4MRRA 3IQDB 1P62B 1XAGA 4FQ5A 2CNKA 3V6LA 4FTWA 3IUQA 3KP1A 2XITA 1SN7A 3L8EA 2IF0A 5CXUA 1UK8A 4IRMA 3U7GA 2FMTA 5BY2A 1GUYA 4IIGA 5JD3A 1DBSA 3ECCA 2Q1YA 3FWNA 4H3SA 4JI1B 3QYJA 3SKYA 4QAQA 3VDMA 3ZDCA 1KVUA 1Z33A 3HZRA 5EKSA 3Q9LA 4BLOA 1WW8A 4MWZA 3T5GA 4HLUC 5GGXA 2GZSA 2G0NA 1YB2A 3OECA 4KYTA 3JRXA 3W3AD 3S2EA 4V0KA 4HDSB 4LNUB 3RRFA 1CYDA 5KU1A 1VYHA 3FYTA 2O8FA 2P9HA 4KP7A 1LEHA 1DEAA 1P2SA 2UVQA 3LYHA 4JLJA 2ZRPA 4D7AA 2J45A 4WKBA 4LG1A 2WM2A 4XUCA 4D4KA 5TGTA 2MOKA 5AUPB 4ERXA 3ITEA 5J2TF 3WTCA 1UKAA 3NHFA 1ISFA 1KJJA 3N76A 1AD2A 4FDLA 4FYWA 2HJWA 2VYFA 2A4MA 2ZI7A 1TTQB 3QEMB 4B5LA 1SC6A 3JVUA 3ILSA 1TZJA 1E6LA 1U8YA 3I01A 3OZXA 1K9SA 4FFBA 4HX9A 1H1TA 5C80A 4RLSA 2HSDA 1G3UA 1IZ0A 4B3RB 5DW3A 4HS9A 4D4IA 4YUZA 1ICIA 1U3UA 4ZCTA 4MPPA 3UJAA 4BNDA 3OD5A 5HW0A 2Z58A 4DMKA 4GZLA 4C29A 1W4LA 3HDGA 2OCYC 1BWPA 3PNKA 4BX8A 2PKEA 5K0SA 5F9MA 1C3VA 1IXKA 3ZZUA 2DWUA 5H1YA 1Z4MA 3SR4A 9GPBA 4NBWA 4DV2B 1JSLA 1P5HA 1ESZA 1RXYA 3KJQA 4J0CA 4C01A 3IYLW 1OLOA 4B7ZA 4NV3A 3OEYA 1T0HB 1V1RB 2PH3A 4CV3A 2JLQA 2UZAA 4KQGA 3PI6A 3A4VA 1P6QA 4BMZA 4RIEA 1N6NA 3HZOA 3LE8A 1YK0A 4BO7A 1W2HA 2J3LA 4QT4A 5I4IA 3HXTA 2NZ8A 4UU0A 5FO1A 1Q92A 5AKHA 5KHOC 1CJBA 2WA1A 3EMDA 2II6A 2PGXA 4I9NA 4QPJC 5I9LA 2FP4A 4GOJA 4AZ0A 3WICA 5JDIC 3IGFA 4OB6A 1YBMA 2HBZA 3CG0A 3OCXA 4KVFA 4OTZA 5JSZA 1MO5A 1U1GA 4P33A 4KX3A 3CGGA 1SC9A 4MV7A 1MO4A 4AJ2A 3HYRA 3D6UA 3NHUA 3PT9A 2ZBFA 3HCDA 2M6LA 2FSHA 1KQGA 2PXAA 3LUPA 3LI2A 5LBUA 5KTPA 3H17A 1KI4A 4ZCMA 2EV9A 2B9EA 3ESAA 2GARA 3GARA 2V1UA 4P58A 4ARIA 2VTBA 5BN3A 4NOMA 2Q6KA 2C4UA 3OT1B 2AMVA 2C3MA 1X6VA 3EIOA 4L7QA 5HTKA 1RYYA 3AL2A 2Z1MA 5SZKB 3LPLA 4FYIA 5CB4B 2J4DA 2R96A 5E9QA 1OB2A 4XYBA 1N2CA 1X38A 1E0DA 1N77A 1FUIA 1GTJ1 3A2KA 1UXIA 2UXBB 1U2DA 1XZJA 3LV8A 3EH2A 2P2CA 4ZO6A 1ACMA 1KI6B 3FTPA 3L1HA 3L7AA 4TRNA 5F7ZA 2XSZA 2OBNA 4BNNA 5FTKA 3CUYA 1XMOB 5IULC 1WMFA 4AZTA 3JVEA 4B47A 1CUZA 4JUBA 3EIEA 2IQ5A 5D01A 4A0SA 1VKHA 4D02A 1NMXA 5FWYA 1A7AA 3ASZA 1BG6A 3LY5A 3IVGA 3NUZA 1YCDA 3P0EA 3N53A 4OQFA 2C20A 4EWLA 3TWOA 3Q5GA 1P0IA 3BWMA 3TLKA 2GVDC 1JT2A 4Q3OA 1WXWA 1ZK1A 2RBGA 1IPEA 1GPNA 5IMSA 3OEED 2Y1FA 1AZLA 2VAMA 3KT3A 2Y9MB 3EF1A 2VBCA 2ZRLA 4A6EA 1MZVA 2O2CA 1MAAA 1QVVA 1OHHA 1QQ6A 2H11A 1KEEB 1NU8A 3PUJA 1GEGA 3NIGB 4X24A 2VP5A 2WU1A 4ZVOA 4O2AA 4E07A 2ZS8A 2CF6A 4EUSA 4RVHA 1WP4A 4M1MA 2IYFA 1DAEA 1U04A 5FTJA 1YE5A 2X5JO 1C7ZA 1FPQA 1CDOA 4QBTA 4YO7A 2XMRA 2BFWA 3LK6A 2YMMA 4F2GA 3O84A 3KQLA 1BMFA 4UARA 1J0CA 3OQJA 2XLBA 1K98A 2FQWA 2R48A 4FE3A 3GLHE 2JGLA 1Z45A 3D8TA 1KQPA 1YL6A 1G5FA 2FJPA 2QN1A 4O4LB 4MCJA 3B12A 4C7KA 5IEJA 2XGJA 2HMSA 2QS9A 4CEJB 4K1XA 4QPPA 4F0JA 3AW8A 3QH4A 5D3MA 3IUJA 2HK7A 3QKSB 2F7SA 1ST3A 3D6MA 1OXKB 3MNFA 2Z43A 2ZB2A 1QDUA 1EBFA 1VJGA 2O8VA 2AN9A 3C3KA 3C3BA 4BFLA 4M1EA 4MVJA 4B2PA 1P9WA 4GWKA 1B6GA 1T4GA 2IHVA 3FVQA 1K89A 3MHPA 1A96A 2MIIA 2JJ2A 1YGYA 5DGDA 1JHQA 2MINA 1NC3A 3C70A 4IDCA 3OLVA 4PYJA 5JVDA 4FFVA 3CY6A 1AF7A 3OEWA 4DCJA 3H2GA 4N49A 3NTXA 4RW0A 4C0HA 5JO0A 1R27A 5GINE 2W6JD 1LZKA 4WZAB 1DEKA 1U0NA 5FUVA 3I9MA 5KYUB 5TQVA 2JI4A 2YKGA 1ZUD1 4Q3BA 5IVKA 3I92A 1IK6A 1F3LA 1T10A 2AF3C 4P7BA 4CEHB 1NJSA 2CF5A 2WE7A 3ZQKA 2HDHA 4AURA 4R6WA 2Y1OA 3V8MA 3VV2A 4I50F 3IP3A 5DMHA 4U63A 3VU9B 4YBRA 3VJLA 3RUDA 1SPBS 1Y6GA 3WGTA 3PDIA 3RYFA 3BRCA 4GPZA 1J70A 3MTIA 1I0ZA 2GPNA 1MVNA 3CM0A 3R3XA 2V45A 5D7NA 4MVXA 1J8VA 1CY2A 2QLLA 2WKRA 1WB4A 1Q1NA 5HQ3B 2FK8A 3GXBA 3ZOZA 5L9AA 2HRDA 3T61A 9LDBA 4OAPA 5ITVA 1G63A 1ZH8A 1R5OA 4AF7A 3FM9A 4CE6A 3G9UA 1UUFA 3MMXA 3T8YA 2QM3A 3K35A 1O95C 4K9MA 3HVIA 2CHVA 3THSA 4DQVA 4JDUA 3R9WA 1RRFA 5L8VA 1AKMA 2GX6A 1J8MF 5LUBA 1PUXA 5A05A 4Y67A 1V7QA 5B3JC 1HT0A 4AAYA 3S2FA 1UAAA 1ZVKA 2IL1A 5EHZA 4MYUA 1E18A 4YYZA 1PDOA 4IUDS 1POWA 2IY7A 2D74A 3EWIA 3KYDB 1KY3A 4ZDWA 3ECSA 4YRJA 4DNFA 3TECE 4UMDA 1JDVA 2BHSA 2BLLA 3AK4A 4Q5IA 4UD6A 1Z12A 3WL4A 4A5OA 3RSGA 3VNBA 2WD7A 1T8TA 4ENPA 3E3NA 3NETA 4GBJA 4HXEB 4EHFA 3DULA 1UDXA 2OUKA 1C3EA 2WOOA 3QMPA 4LTMA 4HB0A 3P9QA 4D8TA 4CCWA 2F55A 2YBEA 2ZXUA 1T6YA 1RKXA 5FOXA 4HQ0A 4HUQB 1XF9A 1V9CA 2A1TR 1VLMA 2TMYA 2ZBDA 4OL0A 4RTQA 5T3YA 1NI5A 3AM4A 5CMLA 1MVOA 5IBQA 4D9IA 4LHVA 1JTVA 4MAAA 1AUPA 1E6UA 1SC3A 2LW7A 1QBKC 1UPBA 3MJSA 4LXYA 4CDRA 5KYNA 2YW2A 1TQ2A 1CVRA 1ITZA 2GEKA 1G2IA 2W2XA 4OQZA 4F5YA 2R4UA 2AN1A 4UUMA 1OKKD 3ABQB 1ZMXA 4V0SA 1XE3A 1L7RA 2XQJA 4M7RA 3TZBA 5HGXA 3D7KA 4URWR 1U0OC 2G5CA 2J3HA 2O8EB 3D31A 5FA6A 5TLSA 2OXIA 4UM7A 1AKVA 2A1IA 4R0VA 1X14A 2IOFA 5AHRA 2AC7A 1EFPA 2NN3C 3B78A 3HBLA 4EIWA 4IQ0A 1X0XA 3FPGA 1J49A 3QVSA 3KVNA 2VA9A 5MN6A 3UXYA 3A6FA 1HDIA 1P72A 4YIHA 3AOGA 5LLSA 4CFZA 5DX8A 5AVJA 5A2QA 2Z95A 3ZWYA 4W1QA 5ER9A 3ZBUA 1DLJA 5BMVA 3DFFA 4R9SA 4P86A 3WVNA 2V7VA 1JHRA 5EVCA 5JWRA 3LPNA 1GGHA 1ZHHA 2P67A 3LS2A 3VNUA 4D74A 4O5OA 1VPWA 4XIGS 1ZGHA 2F1IA 4JI8B 2BMVA 4LMAA 4PLCA 4RIFA 3WV4A 1LPOA 1ZVVA 5JSHA 3OAAD 1FUKA 4XI9A 1GTSA 4HB4A 1K4KA 3CSUA 3H4VA 2DQSA 5F5XA 4XIFA 2HI0A 3VO8A 2RDMA 1S3SA 4NC9A 1F8XA 1Z0KA 5L3SB 3MS4A 4YCJA 2COKA 5LMZA 4AWXA 2P4HX 3K6RA 2XUQA 3IOBA 4JZYA 2GGSA 5CIQA 3L5KA 2XB6A 3EF0A 4QJ4A 3B1XA 1WLYA 4PVCA 2Y2UA 1HLDA 1MB4A 3FUWA 2C94A 2FRXA 2LIPA 2QJOA 2HTEA 3I45A 4W1SA 3RUIA 1CY8A 5E4JA 1PQPA 2ECPA 1QVWA 4JD5A 4PFKA 4DUZB 1W46A 4RK1A 1JPJA 4E2FA 2BGWA 1RQPA 1DBIA 4LYJA 2QM7A 4PLPA 1OI7A 3MIIA 3EFOB 2B5VA 3DL4A 4IDEA 4R8KA 4BO6A 3GY0A 5IF9A 2ZQYA 3N2NA 1E1QA 1JHYA 2WAXA 2GYUA 3RTGA 1KI7A 1GZVA 1UINA 2HQSA 3ON5A 5ITZA 3ZE9A 1K88A 1GUBA 3F7NA 5G02A 4EX7A 3NHYA 1MPTA 4HWRA 5LQAA 2LD4A 2NPIA 1OU0A 2V5UA 3C7AA 2JK1A 2Y05A 4LJSA 2FZEA 1GZSA 3ZYZA 1N33B 1U5BA 1T1EA 1XQYA 5HJ5A 1QFYA 1XKTA 4Q1AA 3IEUA 3K92A 4C4ZA 1JU4A 2QGFA 3KD2A 1CEXA 1O89A 3KFVA 4RJTA 1SOMA 5BV2P 3FNGA 4Y3UA 3TLJA 2GAFA 2WSMA 3A2MA 2HPHA 3BE5A 3C6KA 1X1AA 2AI2A 1FXUA 5I3ZA 4C2BA 2BELA 3EVNA 4Q3NA 1VIYA 2BHRA 4HZUB 1AA9A 1Z6QA 5HKAA 3KZXA 4KAAA 4DIKA 1W1WA 2AKYA 1VOTA 4DAEA 2P62A 1DJNA 3EGIA 2PUEA 2WI8A 3ZNPA 3MMNA 1PWHA 2R1TA 4JT9A 3SY8A 4RZIA 2WY2D 3V2UA 3ZC3A 1F48A 3L7JA 4FNOA 2ANBA 1F7VA 3C7DB 4Y6RA 3N8KA 3E3OA 4CM8B 1H2HA 4NFHA 3EXG2 2AOUA 4WY8A 4S05A 3HGTA 4TM7A 2GDJA 5BQOA 2FQ1A 1ISRA 3I2FA 4EW3A 5COQA 2W2TA 4JI2B 4ENSA 1XRQA 5JPCA 1KTVA 1QYDA 1X74A 4IKOA 1UZLA 4ASUD 3U2QA 1OXMA 4L9WA 4TKUA 5KINB 1G0OA 3AFIA 4PPGA 4Z86A 3A26A 1AB5A 5JNVA 2D5CA 2O0MA 5K0EA 3C3DA 2BMDA 4RSMA 1VLZA 3TTXA 2JIZA 5KU7A 2WM3A 3IOCA 2BM8A 2AOTA 4K81B 5CVVA 3VKFA 3F9CA 3IRUA 3L84A 4DLWA 4PN7A 4II3A 8ABPA 1DUVG 2OO5A 4XUGB 3RH0A 2POCA 4IV5A 3AEQA 5DV9A 4KWHA 4Q93A 3KQPA 4RZSA 4TTRA 4G8JA 4TV9F 3U4DA 1T3ZA 1ZU5A 3DAPA 4WOCA 4WCDA 4JLUA 2O4UX 4BWYA 2FX3A 4KDFA 2JLWA 1M2FA 2FG7C 3AKEA 3P26A 1ISPA 5AXCA 2PRYA 5IKOA 3REQA 1TEVA 5JMWA 2D59A 1JKFA 2QB5A 2OT3B 4K6GA 1X1TA 2NVBA 3OIGA 4C2TA 2I6SA 3L6RA 1A1SA 2AYZA 2QZPA 5K4HA 1UJMA 4ON9A 5EYPA 1PSDA 1C8KA 1QFXA 4XR4A 3TEFA 4CV2A 4HFRA 1IN1A 3PFNA 2YS6A 3PDCA 3ABRB 1EVJA 1PVDA 4QPCA 5BVHA 2ZI3A 1NY5A 1PUIA 3UFBA 5BSFA 3WYBA 1JR6A 3NTLA 3MT7A 4Q9DA 2C5AA 5BRAA 3DWIA 5KQLA 3O4RA 4MV9A 3KQOA 2E85A 3CEAA 3AGPA 5DYGA 4B6QA 5J2TB 4JL6A 1LFDB 3UCXA 3WNVA 3H5NA 1BC5A 1TMKA 4HKTA 5CXSA 3DOEA 2BFNA 4FHEA 3CZQA 5IXSA 5JCXA 2BEJA 4C22A 2K7FA 4DSZA 1HNNA 4NBVA 1Y9DA 5A7FA 3DDOA 2VHZA 1PS8A 1TZKA 2VJMA 3FHCB 1C50A 3HSSA 1E2NA 3K2EA 1TB4A 3P52A 1T9ZA 1TKRA 3CJTA 3F78A 3CTMA 1H6BA 1CJTC 1ZK4A 4L8FA 4RMJA 3OE7A 4LY0A 5DNVA 3G17A 3C24A 3AHGA 1CF9A 1HNWB 5BN4A 3R41A 1BHQ1 3ZEAA 4CODB 1KY4A 5AVYA 2XMBA 4CF4A 4CHTA 2J3EA 3K0SA 1G3QA 3JQ6A 7GPBA 4A73A 1X15A 4PQGA 3CRMA 2I34A 3HN7A 1I80A 3KQWA 3DBIA 4LZLA 1L7MA 4S04A 3W5AA 1CULC 2OZPA 3ZDYB 1NM5C 4H7IA 2C57A 3C1OA 1W94A 3ASYA 3UW3A 3DLAA 4HT3B 1NWCA 2XDQA 4B2IA 4IVQA 1ZYUA 4GKAA 2YUIA 2WWHA 1E6WA 2ZYAA 1JAHA 4ZT4A 3O4HA 3G0OA 1MOQA 4UHBA 1ZINA 2JCVA 2PMCA 3DMYA 5EWJB 5IPFA 2Q28A 5EMKA 4OHYA 1YRLA 4CMHA 1NVFA 2EJVA 5FNVF 4WEOA 4DR2B 2ISCA 4DYDA 2X5NA 5K0TA 4RDCA 1J0BA 1RXCA 2YN4A 4QDZA 3UUFA 1KDYA 2WWVD 1Q21A 3W2HA 1FFEA 1TIBA 1ZD1A 2K5UA 1KY2A 4BBJA 4ZODA 2OQ2A 3CX8A 2VRBA 2XPCA 1CNEA 3NHSA 3L79A 3SZMA 1D1TA 4LY9A 3ZGZA 1DMRA 1P44A 1ZD8A 3AIMA 3KKPA 3S2IA 4ZMRA 1QB7A 2JCYA 3R4VA 5D84A 2G63A 4A2WA 3ZBQA 1KDOA 1Z7BA 3O26A 1Q0UA 2NU9B 1UMCA 2P2NA 3I8OA 221PA 4I4NA 4RNDB 5CVCA 3CVOA 4N6NA 3VTZA 2PCLA 1C7IA 3RREA 2CXUA 2GNOA 3PUXA 2RJNA 1UWLA 3P71T 4E5MA 5IJ0A 5K8IA 3HPQA 4CEIB 3C4JA 4CKZA 3E3LA 1CLUA 3CN9A 3WIDA 2JGDB 3ER9A 2GCPA 3BWBA 3SBOA 4KXUA 5BWBA 5ERXA 1XA3A 1XCOA 4NU5A 4BCCA 1AE1A 2F48A 4HB2A 1PNOA 4MUBA 1DC4A 2G5GX 3STUA 3Q3GE 4ZICA 3IFSA 3QVKA 1Y82A 1Z0UA 3K15A 4U8GA 4PF1A 3AZPA 5FLYA 5FAKA 1F0PA 1GZ5A 4IX1A 4OLAA 1KEPA 2IYZA 1P9NA 4WOJA 3TIVA 3F8WA 4R2LA 3ZX5A 1TEZA 5IN5A 1V8DA 1PWXA 1JQKA 1V9LA 3ISTA 1ODJA 4FFNA 4L5JA 2XVYA 4TRMA 3CZ9A 4YBZA 4B3DA 2R60A 4ARAA 1P1JA 3G7UA 4W5OA 4CKBB 2VP0A 3GP3A 1HDCA 2PLNA 3MJRA 4IF4A 4DJ5X 4DG9A 3MYRA 3KUCA 1RP7A 3NH6A 4OLHA 3SD7A 2EDCA 3F9RA 4UMEA 5FWXA 4DIDA 2WYHA 3BB4A 2YRXA 1IUNA 3K71B 1VKJA 3KKNA 4AP6A 3R3VA 4CL3A 1OUMA 2AD5A 1SCQA 1M73E 1Z74A 1J4AA 3KS9A 1OVGA 2ZWIA 5IAEA 4GBED 3LZCA 4A1OA 4BDSA 3KYJB 2PKQP 5KQSA 3I1IA 1IBKB 1TF7A 1UP7A 3OX2A 4PBTA 3ZV4A 1L5WA 4C7JA 2G9UA 1T0UA 3D6FA 3HJBA 1UJ2A 5LQCA 3RYIB 4X8LA 4JHXA 1Y1LA 4XGKA 2AZXA 1K5GA 4XDYA 4CLRA 3IAUA 4OYLA 5KYYA 4FWTA 2L82A 1LJ8A 3BZBA 3CISA 3H04A 3F5FA 3NORA 1Z22A 4GZ5A 1QE5A 4M0CA 3SIWA 5K05A 4CEHA 1JDZA 1P73A 1RWKA 1XQ6A 2BGNA 4HN2A 3NWJA 4EG1A 1NUPA 2NTNA 4AY6A 5DKFA 2V74B 4B3MB 3NHZA 2A7QA 1A3CA 1DB3A 1FSSA 1I6WA 3C14C 3KQVA 1NJFA 4J1NA 4ZVKA 4A36A 2FRVA 4XCVA 1G4HA 4P3PA 4Y98A 1R88A 3SNHA 3NALA 1XDBA 3ZY2A 4D45A 1H42A 3OLWA 4JI7B 2N0SA 1MJ5A 4LYAA 1VE9A 4OF4A 1J42A 2DU8A 2DR0A 2EP5A 5HFNA 5IDYA 5BN1A 3ZWNA 5MGNA 2WZQA 4P81A 4BE9A 2JFYA 2RB5A 3HU5A 4UJ5A 3TRHA 3MB8A 3N5CA 2ZTMA 1FC0A 2BMWA 2RHOA 3HA2A 2W11A 1GPMA 2Q5JA 4L5YA 4WOKA 4U02A 1ZY2A 1OXSC 2I03A 1AUXA 3HBNA 2V6JA 3WLRA 4BMNA 4DT1B 1E94E 1DFHA 1GAQA 1QZZA 2X6QA 2WPDD 4V0NA 2UXCB 1GEEA 2PSFA 4Q48A 4NBSA 4YWHA 2AEFA 2P7HA 2XOEA 1Z2EA 1M76A 3QTBA 4PCLA 2Z4RA 4L3VA 3SX4A 5JSFA 2VSNA 2X9GA 4X6UA 1JF8A 5CX1B 3NFRA 1KRXA 2FWJA 4DLXA 2XCOA 3MZ0A 4I50B 4FEGA 2FEOA 2WAAA 3ICEA 2DPXA 2VQ6A 4BGUA 1RPTA 1V25A 4EYEA 1XQ1A 1J2EA 2CHEA 2O57A 4GNRA 2O5VA 1FFDA 5G3YA 1T4DA 1TQHA 3RLFA 1AXGA 2AI3A 3LQFA 4L4YA 4M1OA 1K5HA 2H4YA 2C54A 2PSEA 2QUIA 5DX0A 1PDVA 2JANA 4AZSA 3MLEA 1D2GA 1WCIB 3D2BA 3B3GA 4R69A 3OQOA 1FVFA 3B1VA 1I4LD 5G53C 1E1CA 3I34X 4DUGA 1YI0A 1W49A 3C87A 4F6LA 1NUAA 1D09A 1Y48E 2D5IA 1GPBA 1DBQA 2JFPA 2IW3A 3LUDA 1NRIA 1TC2A 4JROA 5H80A 3T1HB 4O2LA 4PQFA 1WHTA 3M5PA 5JQWA 2CUTA 1JZQA 3S1AA 4MW9A 1FDRA 4Q66C 4HGQA 1TA0A 1XNJA 4KK3A 5E8JA 3Q88A 2VSOA 2AJCA 1U9ZA 3BRWA 4G0YA 5C53B 1EM6A 2O0JA 4IMJB 3FOAA 1O9HA 4KDEA 5GONF 4DLSA 1KI2A 2GN0A 3PYXA 2I6TA 3IP5A 4HO1X 4F7WA 1JDUA 3K73O 1M2VB 2ATVA 3GT7A 3R6TA 1J23A 3WMXA 5K8LA 1WNFA 5LXTA 2XB8A 1S0UA 4WXMA 3F4KA 3G9XA 4EKDA 1I30A 3N2YA 1SGWA 5FUBA 1GGJA 1Q3KA 3OPQA 4JZKA 4LDPA 3GQBA 1LTHR 3EN0A 4G81A 2PT7A 1WL8A 1IATA 4LYGA 4QU0A 1N3YA 3D8BA 2OCPA 1ZMRA 1E2KA 1U28C 5FOSA 2V5AA 4LJRA 3FPKA 2IS2A 4QICA 2FQQA 4EECA 2X13A 4KNVA 5E3IA 1HZJA 4L5CA 3DZKA 4P0PB 3GF4A 3RYHB 3TZ6A 1BDMA 3P9SA 3Q7TA 1YK1A 3FBWA 3MWFA 1FYDA 4R8MA 1STOA 1BCRB 3WDMA 4ACBA 3MTQA 3PNYA 2A9QA 4XJTA 2QRQA 1MJHA 3CF4G 5LL6P 1VE5A 3FMFA 3R0JA 4MIEA 3VR4A 2CLCX 3I12A 4ND8B 4WK2B 5DGIA 5C3MA 3FWPA 4BP9A 4OHFA 4GEGA 2BM0A 7REQB 4YJ3A 3OZWA 3JYLA 5KSYA 1Z18A 2K4MA 4I2NA 1MJFA 5CJPA 1COZA 3PHLA 1MTOA 3MGKA 4H08A 4RVCA 3VZSA 1M6YA 1T9GR 3EIHA 3W2EA 4PPQA 1X3LA 1M1YA 4AZWA 4LRWA 4TUYF 2PH5A 5IS2A 2XHEA 2ZTHA 3OE1A 3I4CA 3OLQA 3MW8A 4PTZA 4UHJA 5DBOA 5BYBA 3TTSA 1Z08A 2KLHA 1U7PA 3MRTA 1Q1AA 4LRSB 3QQPA 5UKDA 4BUJA 4EG3A 3GN1A 2W6QA 4WECA 1QLJA 4YGXB 2Z83A 3A4TA 1U9CA 3AZOA 2VT6A 3QFRA 2ZSDA 4MVJI 4O4JF 3M9WA 4LJAA 2BHTA 1J8DA 2XECA 1LSOA 3TKYA 4G8CA 3LYLA 5HXAA 5J4HA 1IOVA 4FFPA 2MHCA 2RHGB 4BB9A 2ZREA 2RKOA 3Q3VA 5LD2B 3LHDA 3VX3A 4PXSA 1E2LA 1N2GA 2DPYA 2JJQA 2XVXA 4BTVA 4DEVA 3T7JA 4RPJA 1W1IA 1IEVA 1VMDA 3DCYA 2C7VA 2Z6UA 1M6WA 1GSHA 2R8OA 3MTAA 1T5DX 1XNHA 2H0AA 2G9QA 2JATA 1GO2A 3DF7A 3Q3CA 4P2GA 2XZDA 4RKRA 2FF7A 4J7CA 4TS9A 4YT2A 4RE5A 3VAYA 2JRLA 3FWKA 3NRJA 4PPFA 4ZOLA 1X7XB 2BGIA 1DI0A 3MFYA 3GFBA 3TBKA 1RE0A 2DTEA 2EF0A 2GOYA 2PVPA 2PZFA 5CPBA 1NNEA 3H0CA 1SA0B 1JIJA 5AVUA 1UXKA 2VHVA 2FDXA 2HDNB 4WJKB 1U7OA 4AXBA 4UPDA 3PJDA 1UBTS 2C1XA 1JG3A 3GHHA 4BN0A 3GB9A 1DU4A 1VJ5A 1KK2A 4B3HA 2QX9A 2NU7B 4H17A 1SVKA 5EXPA 4O29A 3RF6A 2X5KO 5CEJA 1TRHA 4CQMB 3Q8KA 1AS0A 4NI5A 3R9XB 3ZQ4A 4EL5A 4NBNA 2OXRA 3QW4B 2AUNA 2VYCA 4YHBA 4ZVMA 1AHPA 2LGJA 3KQHA 4I55F 1EA5A 1WKBA 3P0FA 1VHJA 1XLTC 4X1IA 5E9WA 1Z56C 4YAIA 5LFAA 5CDYA 4ER0A 3UG7A 4Y6SA 1Y6JA 3AUFA 1U2GC 1KBZA 5F1KA 3JASA 1RVDA 2XAAA 5DNAA 2I66A 2CWWA 3O75A 4OQQA 3NEYA 1NJ8A 1RIFA 3MBKA 2NXNA 1N3BA 3QSGA 3HXKA 2C00A 3TPFA 2VO1A 1V96A 2JH3A 1HE5A 2QN3A 3EIWA 4PBSA 3HWWA 1N92A 3BMOB 5AR1A 4DLVA 1VSQA 2HSEA 3C1AA 4QDKA 3ZBPA 3QOFA 2CNLA 4LZOA 4W5NA 2IEAA 3DT6A 4FXPA 3CH4B 1GTZA 2D1YA 2J7PA 3HU3A 1NATA 4HH4A 4JLOA 2Q4OA 4GXNA 2PFSA 2VTVA 1MMFB 3GNQA 3JWPA 1NOJA 4ENRA 1N3LA 2HMTA 2HIAA 3VAAA 1D9ZA 1DRUA 2RFLA 5HFAA 2ACWA 3NHWA 5TNXA 3JY6A 1I9CA 2B20A 2C59A 3OU6A 3QX7A 2BH2A 1D4OA 4HWTA 2D00A 1UDWA 1KYQA 3LF2A 1IXSB 4PNPA 4CKWB 3ZE6A 2R65A 1SQSA 3GJQA 1CUBA 1E59A 2PXXA 1YMUA 1Z75A 1KDPA 2PD6A 2WT4A 3HJRA 4LSWA 4PRKA 4DLAA 2XMGA 1PR5A 3RVJA 4BFSA 4C7OA 4NV0A 5C8DA 1EGQA 3MTBA 1IAVA 2ZU0C 1GV1A 2BKLA 1MX5A 2R00A 1E3WA 2AOXA 3P8ZA 4CI9A 3ZD6A 1CQJA 2NACA 5FORA 5KTNA 3E2IA 2C7GA 5EZ6B 3MFQA 3P9CA 3BQMB 1E64A 2QX7A 1FSGA 1T2CA 2ZBGA 3MWEB 4TV9B 5K3AA 2B8JA 2OENG 3OCZA 3ZK7A 4TZ0A 4UDYX 2GBCA 4DTIA 4G1FA 4LF4B 2P0AA 4MNTA 4LBYA 3CLRD 5FJJA 5A4MS 4RACA 2R4QA 1C1HA 1CQIA 1XN4A 4H16A 5BWCA 1TA9A 4P4TA 1DIRA 3REGA 5LJIA 3PZRA 2X1MA 1E6MA 1PNQA 3K8QA 2GKSA 2RHCA 4MWEA 1U3DA 3ROPA 4ZI7A 3G2MA 2R1VA 2Z4SA 4EGCB 3ODPA 2NVUA 3DOJA 3R3WA 2RH8A 1DIHA 2RGAA 1S8FA 1LUAA 4Q15A 1XP8A 4Y1FA 2DXIA 1PGNA 2GVZC 4AD8A 4CTKA 1VMIA 2Q1XA 2E4VA 4OHBA 1ZR4A 3KKQA 1K6JA 5KSWB 5HF6A 4IYJA 3PQ7A 2O3QA 2GEVA 1Z2CA 3UMBA 3G8BA 4MW5A 2FFHA 2CNWD 1IZ9A 3ZGYA 1FL9A 1HT1E 5HBGA 2V7UA 1PBTA 3DDUA 1QHGA 4V38A 3TLXA 1T6ZA 2HPAA 3LWBA 3A11A 1TUBA 3D1LA 2OORC 1W5BA 4G63A 3PLAE 3ZDAA 3EGXA 5IJZA 2B1RA 1YB6A 3SMQA 4HEQA 4RADA 4KRGA 4B31A 3IVRA 4MVJG 4M0MA 1PEYA 3LIPA 2I7DA 2R84A 4JJKA 3PFGA 4EVQA 3BREA 5CEEA 1WUTA 2BE9A 2HLHA 4JQYA 1F5NA 2I2AA 2ZYSA 1PJCA 2JFOA 2XT6A 3DO8A 3RSQA 4NBKA 5ALEA 3TOVA 4A6DA 3SSAA 1KQNA 1X8LA 5A3VA 4WNAA 3S5JA 2XADA 4FILA 4HVLA 2J9GA 3Q7IA 1RTKA 5DX1A 2JFUA 3E9MA 2VZLA 1A5BB 1Y8QA 2ADFA 3GI1A 3GJTA 3TCKA 4DWWA 3TLAA 3VBCA 1CE8A 2AOWA 3OFSA 4CUKA 5F5LA 1RQXA 1W25A 3EXHB 1WDKA 4WH0A 2CJWB 4QYSA 1G7CA 4B34A 1TMYA 2ZJOA 4ER6A 3CEPB 1ZFNA 4GGPA 4MVJF 1ULTA 1DPGA 1H5UA 4F4JA 1G16A 3WWZA 5JDCC 4RF4A 2NZUG 5JVDF 3RI3A 4BV9A 2ILTA 3QUQA 1X7ZB 4G97A 1YI1A 4TKVA 3TW8A 4WMLA 5ESDA 4NJMA 4N47A 2FWAA 2VS1A 3RSCA 3VR3A 4EA9A 1M1XB 1TW2A 3Q40A 4PG7A 4AZ3B 3ZVLA 3TCNA 3G2HA 3BC1A 1ZSNA 3RRYA 3OSZA 1BW9B 3NTQA 4I9HA 4M53A 4EK9A 3FNFA 4AY5A 4OJYA 2AFVA 5SV2A 2JIQA 3FLAA 4FMCF 4NYIR 3CN7A 4Z4FA 5FFMA 2YHUA 5AKKA 1IG0A 2NMVA 1SBCA 1YRBA 3OEEA 4B4KA 3FF4A 4ER3A 3DFUA 1A2OA 1DQZA 3B85A 4M86A 5CT4A 4CCYA 2WJPA 3O4IA 3MELA 3HVUA 1NN1A 3IE0A 3RVPA 5JJIA 3WWDA 2QTVA 4MZDA 2BP7A 5CFMA 3H4MA 4AMUA 2Q21A 1SOWA 2AQKA 2FWNA 4M60A 4EFLA 721PA 3UMGA 3L4BC 4B3FX 1MBZA 4BNVA 5I7VA 3DQZA 3T3IA 5BWNA 5J1SB 5KYVA 1TLFA 3G7NA 1ZLXA 2VP6A 4PSAA 4R3WA 3ZOKA 1REQB 3D4BA 4RPIA 1V2GA 3UGKA 1GRNA 1HXHA 1RR6A 3IE2A 3LD9A 3Q8XB 4P35A 4PXAA 4WK4B 1T0BA 1MO6A 5JAOA 4OOEA 1VGRA 4JL8A 4KGDA 2JKVA 4N6GA 3S0JA 3UATA 5IDVA 3ZXYA 5KMGA 3L6EA 1XPJA 2JFNA 4AY3A 4DV6B 4L3WA 4P7FA 1T35A 3HDQA 2QVYX 1E5QA 2I78A 1ENYA 2NUTA 1FW8A 1OPXA 5DWDA 2CUZA 1X1BA 4GE3A 3VZBA 3NCTA 3DOFA 2W2QA 5AKEA 5H16A 2V96A 4ZAWA 4YQFA 2HO5A 3RK1A 5DTEA 4YV7A 2RGCA 1TU4A 3GT3A 1UEXC 1CS0A 2Q27A 4QO8A 4URUR 3KB8A 3GPIA 1XT6A 5J9FA 2PX2A 3O1JC 4POAA 1Z0FA 2IEIA 3E8XA 4YJ2B 4B0OA 2W6JA 3R5TA 4FYMA 3L92A 4NV1A 3RUEA 3OI7A 2UU9B 4PAWA 2Y0DA 1G42A 3RIXA 3SEZA 3BCSA 3KQYA 3FNQA 4MTLA 1HORA 1SUBA 4U6QA 3TW0A 1XQ9A 4ESOA 3WLAA 5KNCD 2VRCD 1PK8A 3IBCA 4Y2RA 3T41A 4DBLE 4UCFA 5KX5A 1IULA 2G25A 3FSRA 3QLVC 3I6MA 4TTSA 4K5QA 3UQZA 1XJQA 3D0QA 2QF7A 5IK2D 2YHSA 3ZIAD 1P0PA 5D3KA 3SYNA 4U7FA 4LE0A 5CFRA 1GV0A 3L41A 4UE6A 1HTTA 1OW3B 2OESA 3IPYA 3MMPA 5BN5B 3S6JA 3SS9X 3X3HA 3PEYA 2YCBA 1K68A 3Q9SA 5EXTA 4L73A 1SXJD 1LDMA 3SR3A 1B2RA 2ATXA 3A3OA 2JHGA 4R9UC 2OCXA 1Z8DA 5IP5A 2A2ZA 4EA6A 4DMUB 2BC9A 4URXR 1GZDA 2YXNA 3S55A 3FPBA 5KNBD 3O9ZA 1WE2A 4K03A 2YC4C 4AG3A 2WB4A 3KBBA 4QNRA 5BMVF 4DF3A 4Z53A 1O0CA 1FZQA 3ZWMA 2JI7A 5ALGA 4HDKB 5C37A 1QYWA 2IQIA 1TZ2A 4M4SA 2V8BA 4GZMA 4QTTB 2GM5A 1WW3A 3A7DA 4HWKA 4UAGA 4CQJA 4E6EA 3EYWA 4EHLA 1PG2A 4DA8A 3CUTA 3UB3A 2FSFA 3KHTA 1RBQA 4BJ3A 3P9PA 2CNNA 5AI9A 2QYOA 3ESBA 3WA6A 2XB9A 4ANFA 4E51A 2CUNA 2P4UA 4XB6B 2WIFA 4E33A 4A91A 4TVBA 2OO3A 2HHAA 1Y7TA 5JE8A 2EX0A 1BCSB 1SCUB 2XNHA 1Q0ZA 1QIIA 3BIJA 3D3EA 3S40A 4NCBA 2B2CA 5ALNA 1N1GA 4L78A 2RMKA 4M0EA 3CVVA 3SF0A 1LBQA 4UREA 5DTRA 3DB1A 4REQA 2VTEA 1V8PA 3KXKA 3MS7A 1RQLA 4W5RA 1QYIA 1UC9A 4B6EA 4P3XA 2UYQA 1KE1A 5EJAA 2FHSA 3V4RA 1K1EA 2BDUA 2XYGA 3QKIA 1N5JA 3HCRA 3BGWA 4N3NA 5AK4A 4KQIA 5F2OA 5G4KB 3GUUA 2ORYA 1Z2DA 2IYNA 5DN6D 4XRGA 5LP1A 1OH5A 1QFSA 1K9VF 1KZ4A 1ZITA 2GPTA 4R5MA 4M99A 5IZ4A 1QGYA 1BXGA 4WESB 1LDBA 2YWBA 5JJCA 1W75A 3JD4A 3E8MA 4TWRA 3ZWKA 1PZHA 4L28A 1R4NB 2PO5A 5FUXA 1OPRA 3LDAA 4LQLA 1Q7GA 1M2KA 4ODIA 3UAWA 1EX6A 1GT91 3QWHA 2ZJ8A 1RPJA 2ODTX 1U2DC 3OQBA 4TKMA 1EE9A 4W99A 1ZGGA 4F9FA 1N6IA 2WHPB 4DCCA 2RAUA 1L4KA 5A0FA 1JLLB 2IPMA 5ILOA 3GWGA 3M4JA 1KHHA 3ACCA 3LDFA 3QI2A 3X2EA 1D9XA 5EHXA 2ERXA 2O8CA 1L7NA 5A3JA 4LGCA 5LPNA 3AVYA 5K8UA 1N9GB 1IFXA 1QIMA 3WNBA 1Y5LA 2B99A 5DEOA 4CTOA 1PNTA 4HAXA 2QTLA 3AJRA 2H5JA 4WZAE 1ZM9A 1EVZA 3CNLA 3PRHA 4RPHA 1EVYA 3EVZA 4G4SO 2C4TA 3B38A 3JQQA 4R54A 3DLBA 4FBGA 3KKEA 5JALA 4FE4A 3BDVA 3RROA 1R0YA 3DEFA 3AJAA 3H3FA 3OAAA 5HS6A 1IJEA 1XD2A 2NPFA 5CDFE 2JLVA 4R9RA 5J3JA 1ORHA 3KR2A 2PRIA 4XDGA 3AUYA 1ABEA 3N0RA 1AKWA 1BZYA 1HTBA 1UK6A 3PNLA 2J0UB 4HFMA 4KBGA 3M49A 1QQ5A 1UKCA 2BGLA 3GIDA 4D4HA 3NBXX 2BCEA 1TYBE 4ILKA 2QRJA 3ANSA 5HKKA 3VR5D 1I7QB 1IVNA 1SHTX 4KEAA 1Z3IX 2WU3A 3UF0A 2B8NA 4INPA 3FGOA 2XXAA 3A1VA 1ELOA 1BS9A 1N4DA 3Q2IA 3QWFA 4HEA1 4XW2A 1G9XA 3AB3A 4JGGA 5GY7A 2FGJA 4GM4A 3PC8C 2CK3A 2X19A 4HGOA 5CVDA 2DLCX 4C0JA 3QF4B 2ST1A 5DZSA 3UVEA 4HAUA 3T15A 2QN7A 2QR3A 3FJOA 4Q1DA 1T8YA 5JHGB 1VG0B 4D96A 4NK4A 1TQ4A 3BK7A 3G9QA 3TLCA 1Y80A 4C3UA 3HCBA 3PA6A 2Y1KA 3WYDA 3O03A 1X1CA 4DJTA 1XRSB 2ID4A 3E22A 4RJ2A 1Z0SA 2G72A 5ADUS 2OBYA 3A6JA 3RRMA 2FI1A 3L6CA 4HAWA 1EXWA 2HXYA 3U3ZA 1CJUC 3R6GA 4MINA 5JPIA 5EKDA 5KTYA 1PAUA 4J0GA 3ZE0B 4CEIA 1S9HA 4OK6A 4YRIA 3TLEA 2J9YB 3RTBA 1QK5A 3ZZMA 1QIKA 1JWBB 5T41A 2O2SA 4NR0A 3K53A 4HWSA 4HH1A 4EQ6A 1XTSA 3LP6A 4KI7A 4RDXA 3X1ZA 3V8BA 1C8VB 2UDPA 1IOZA 3G85A 3PNPA 2O8FB 3A4MA 4MS4B 2FOLA 3P2JA 2JC3A 1R50A 3ZDBA 1D6NA 3BXFA 2C8VA 5G1PA 2WU8A 5AM5A 2ZB8A 4L75A 3UTDA 2XUOA 1YAHA 3I37X 1LBIA 3R23A 4EHNA 4KSYA 1OYOA 3EPRA 1UPAA 2HCRA 5EXSA 3JQGA 4B7XA 1RYMA 3MLBA 3U7JA 2ECQA 4UM8B 3SN6A 5A4DA 2G8LA 3IOEA 2MYTA 4JJIA 5CH3A 1AQNA 4KU4A 5D2CA 3SIXA 2EJWA 4X44A 4JYAB 3RVMA 3BB3A 3GAAA 4M89A 3KZVA 4TWIA 5DOZA 2ZSHA 4FFBB 1P3JA 1B42A 4TYPA 4M1WA 4BZXA 3PS9A 2GZDA 4MQUA 1ECPA 1THTA 1YZVA 2ZWVA 2O3JA 4ZQFA 1WNTA 4LV8B 5D1NA 4ABYA 1FVHA 3WWYA 2XOKD 4ASUA 1L8OA 2PZBA 4PQEA 4BNDB 3L7LA 2AUTA 1PZMA 3GGPA 2Q3CA 3OJXA 2N1MA 1II9A 3A9TA 4GM0A 4HH3C 1FDSA 2XWPA 4YB8A 1JLMA 1TI7A 3GRCA 2A5LA 2PBRA 1G1MA 3L6DA 3PQFA 4GMHA 2PU7A 4UULA 1CB0A 3KR0A 1QO9A 4BOYA 4M98A 3T5PA 1WXEA 1C30A 3GT0A 1QCZA 1THMA 4YMHA 3LCCA 4CMEC 1QH1A 2V58A 4OD0A 4FZVA 2ZWOA 4BCBA 4CG2A 1L4GA 5E95A 2CNDA 1UBNA 2P9FA 1CHNA 1ZOPA 3JWIA 2IV2X 1NF3A 3EUAA 5TIIA 5JJKA 1E2BA 4D9NA 1T24A 3U56A 1TYCA 1C3JA 5HRUA 3D7LA 1P9RA 2WKPA 3IEXA 4U2EA 3O47A 1J2TA 4OQXA 3B52X 4Q18A 3B60A 4ZO7A 3SDSA 5K3EA 2WZCA 4PSDA 1VMKA 2CXSA 1ZNWA 2HDWA 2FP4B 4MI1A 2JGMA 3G0CA 4AZ0B 3D6NB 3M5CA 3T4PA 1CZKA 1M34E 4KTVE 4EENA 5J43A 4TYYA 1FRVA 3EZ7A 2WFLA 3RIGA 5BSVA 2VJPA 5B55A 4P32A 3D3KA 1E7RA 2WDZA 3C8ZA 4GT1A 3MJEA 3N8DA 1UDAA 1RU3A 3PV0A 4X66B 4CLDA 3AVQA 4UNRA 2YZMA 1TVCA 2I6QA 3ANTA 1GGFA 3P2OA 4ENQA 4RIGA 3WXBA 1BKSB 4CV1A 5BNWA 1QMPA 2LNDA 2NYAA 1P7YA 1GA6A 3F6CA 5BN3B 2VTBB 3F6PA 1F7UA 4U7GA 3WSWA 2ZUDA 4KV9A 1U6IA 4UNPA 4Z4HA 3OIVA 4KREA 1I7PA 3KXLA 4RS3A 2FZ5A 3CCBA 3CVJA 1N2CB 5JPDA 4DAOA 2P3OA 4D6PA 1XN1A 4N03A 2E4XA 2YBDA 4UXIA 1UIRA 2Q4RA 1WXXA 3HXMA 4P5PA 4WN3A 1XXHE 3H05A 1YF3A 1QF7A 3D1JA 5HOQA 4LXXA 4NBLA 3GLHA 1XEWY 3KDAA 3KNZA 2CLKB 3ZK9A 4QG3A 2ONJA 5FWYB 3IBTA 4IGAA 5ALLA 3PXBA 4PYKA 3OZUA 3WGLA 1HMPA 5DHSA 4I5EA 4WACA 3QG5A 3D8HA 4KXYA 4HQOA 5FPKA 1VLQA 1NXWA 3WK8A 3L7YA 1OAAA 4MR9A 4C4OA 2ORED 1MFPA 1YU6A 4QT0A 3RS2A 1GADO 3NIBA 3UMFA 3MUFA 3VDXA 1PR4A 3NV7A 4XR9A 1WVMA 3WIVA 3MTDA 2HBRA 4EUFA 1P81A 2HSGA 5EIWA 2BWJA 5A7GA 3ERCA 1BXRA 3NOOA 3P19A 2QRHA 4O2AB 3CLTD 4PX9A 5CFZA 2RK6A 5CDTA 1J56A 1UOPA 2HGZA 2WAOA 3G3EA 5C5EA 3M33A 1IDOA 4YRDA 3KOOA 3A1SA 5IHXA 2XTJA 4U6SA 3H2IA 3GA0A 3WYAA 2VDMB 4BMVA 3U4QA 3X1JA 3QBJA 2G28A 3ST7A 2OY0A 3CE9A 3THRA 5IKPA 1X1RA 3NVDA 4S2EA 3ABSB 4AKTA 2ODNA 3BWVA 4KV7A 5CYPA 3WK9A 2PWBA 5D3MB 1YQWA 4OSEA 1FLVA 4KMRA 3TX2A 3UB2A 4INOA 2FMUA 1DTSA 1HURA 2QU8A 1PJ4A 1MEEA 2GHTA 3HSKA 3LHSA 4GYKA 4KLAA 5HCIA 4EGAA 4EPTA 2BF4A 3OKAA 4MB2A 2VP3A 1SKBA 1GT6A 5AWFC 3BEOA 5AUNB 1PWZA 3L1JA 2MINB 4HGRA 1N9ZA 4IMPA 4JKOA 5JCOA 1ZJ5A 5JVDB 4KE9A 3VUFA 1JR3D 2PGJA 2VDUE 4BFVA 3FKSD 2GBLA 2AW3A 2WWRA 4NQRA 4PHFA 1SFRA 1M54A 2PKWA 2Z2IA 3KPVA 5CDSA 1YGPA 3AI3A 1QMGA 2NAPA 4RVSA 1M2EA 3U17A 1TXGA 1XP5A 1UPTA 2O5EA 4DDHA 3I6BA 4D92A 3FMVA 3KVRA 3C4QA 1SJ9A 3NT5A 5GZ1A 2QLBA 2Y1GA 4N7MA 2ZUSA 4TV8A 1C3LA 2QPTA 4FFSA 5BOSA 1VYTA 2H4XA 4FMCB 2PN1A 3TRIA 5LLTA 4AQ7A 1K7EB 3OWOA 2ZR9A 4RMNA 8LDHA 3KALA 1QWOA 1QLHA 3QUAA 4LMPA 4NVRA 4UVDA 1E3JA 5DCWA 3PDIB 3RYFB 3AF2A 1IB0A 3G2OA 4PO1A 2G67A 1ZSVA 2HYDA 3A3NA 1DT3A 2IP1A 1ILWA 2IP4A 1P8AA 2FZ4A 4CRWB 3OQHA 4CLOA 1JU9A 2CMHA 1Q77A 2NLOA 2YJGA 3V6MA 1VJRA 1LDGA 3WK4A 3WRXA 1KAHA 3DTTA 5JJBA 4MGEA 4N5IX 4EUKA 1J0DA 4BYGA 1UJNA 3W6PA 3COVA 2WG2A 5DBFA 2G36A 5EI5A 3AY6A 1PP4A 2BGRA 2OO5C 4TTIA 3TKAA 1NDUA 5C7OO 3TLYA 1IRIA 1Q14A 4I81A 2G5PA 3UA3A 1DAFA 2NTEA 5B53A 5K6TA 1F9EA 2F4VB 2OGUA 4G85A 4MROA 4FZJA 1VCOA 4ROTA 5T6MA 3T7AA 2IOQA 2ZIWB 3K5PA 4Y0NA 3VPAA 3I0NA 2Y1CA 1YRYE 3DO6A 4LV6A 3WLHA 4B7CA 1W0KA 4PZEA 3DZIA 2F9LA 2FKAA 2XNCA 2A5FA 4HLDA 4TLDA 5LXTF 4QEZA 4EKEA 2WD7B 4Z4CA 3KV1A 3OOEA 4LHWA 4WN9A 5BSMA 3BXZA 4GX1A 5BRJA 2CDNA 3QTLA 4FHGA 1SOUA 2YV5A 4F9TA 1PNRA 1NC1A 1RI5A 3BYZA 2W2OA 3LZ6A 2FSSA 2WJ4A 5IYZF 2NP7A 2VKTA 1FYFA 4Q7EA 1EA7A 2YYAA 1ZEMA 2QL7A 4NMHA 2QA5A 2VJYA 4NTZA 4FT2A 5B1EA 1JR2A 2QMQA 2QTTA 1RWOA 2CFCA 1MO2A 3L8ZA 2PV7A 3QHQA 1W2GA 1V3QE 3OLZA 2YMQA 3A70A 4MHOA 5FWDA 1IPFA 1KO8A 2XB4A 4MP3A 4OYHA 5AMXA 1P45A 3ND7A 4AO7A 1I5RA 2H59A 2AFHE 4L9RA 1KSJA 1Z0AA 4DL9A 2ILVA 4H1WA 1AXEA 1TVEA 1VYVA 4TLMB 2E55A 2PGDA 3EQ2A 4PN3A 5KSPA 1W36B 1KSHA 4U7JA 5CGQB 4DJEC 2WZDA 3FUXA 5IDWA 5JZBA 4F72A 1R0LA 1HE2A 1V5WA 4HZGA 3OX3A 1NBEA 4YJ3F 5DH9A 1EFPB 1GGNA 4F1WA 1TK9A 4CV0A 3AY7A 1T2FA 3ORHA 1RHJA 1DIOB 3CF0A 4KIFA 3I4FA 1SBHA 4FMPA 5HM6A 1VIVA 3I72A 4A15A 1WF6A 4C88A 2HSWA 4CTNA 3CMCO 5BMVB 3DEKA 1LWOA 2BGUA 5GQSA 1YL5A 3THYB 5KDLA 1IDN1 1Y4ZA 2O1XA 3TXXA 2VZ0A 3EJWA 3W5JA 2JAHA 3ZVMA 5FNZA 2RAVA 2GWRA 1C4KA 4YDSA 1TQ6A 4F6RB 1QCYA 2F1KA 3GELA 3U80A 5F9HA 2D0OB 1PLLA 2NYUA 1N36B 5TQ0A 4YPFA 3X1YA 3U26A 3E18A 2Y4NA 2RHDA 1Y6RA 1D4FA 1JN0A 1VB3A 1AKNA 4E70A 3QVLA 5B12A 4CM4A 1J9GA 4F7DA 4ESEA 2JDIA 1QYCA 2M2IA 3AU8A 1E66A 2BKVA 4RSGA 4YO8A 3HJTA 2H63A 5EUQB 2P2DA 3MCUA 2GZMA 3IL2A 1WLSA 4PSCA 5C5DA 4DV1B 3OLCX 3B6ZA 4PFJA 3WLTA 1NP6A 4ZOLF 1L8QA 1X7YA 4HNSA 2QIPA 2Z2KA 2ZJ4A 3DEHA 1W5EA 5BNIA 4WKCA 2LZ0A 3TBHA 1S6YA 1R0BA 4F4CA 1ECJA 2FQXA 1LJLA 4S1VA 2LWIA 3OY2A 4RVFA 1I6KA 4GOLD 3W9UA 4MOWA 1JT9A 5ITZB 2V7GA 3CURA 1X1DA 3DOIA 2A9OA 2RGRA 4B3CA 2HQ1A 3QUSA 4UEKA 1KYXA 4EHIA 1NT2A 4YALA 4UJ3A 3VM6A 3QXSA 1U5BB 2VN8A 2XUAA 4WTOA 4YXWD 1UPCA 3LFHA 4LYEA 3RS5A 3VH4A 4B80A 3RAPR 2IXGA 3IBFA 3ZDZB 3HCNA 3OZBA 2A0YA 2WOJA 5ES4B 5JWOA 1R5JA 1L5ZA 1DV2A 3RU7A 4A2CA 5EHGA 4C7VA 1RYNA 1N6HA 1L1RA 2AWNA 2CHFA 3N74A 3V00A 2GZRA 1UK9A 3OPVA 1JA0A 3NM5A 2VC2B 1SQFA 4KLRA 3D9QX 3O8OA 3D3JA 4AG6A 3TNLA 2WJHA 4JUDX 2XTMA 3T3MB 3WKBA 5K1ZA 2O3UA 2NUAA 3IXQA 3NP9A 4WLEA 1BE0A 3PP8A 2NUBA 3AXSA 2R1TB 4ZPXA 4LF5B 1GQRA 3DEAA 1Z83A 3JVVA 1KJIA 3IAFA 3IR5A 2JAUA 3B1KA 4MR8A 5KKAA 4PLVA 4D4MA 1OZHA 2AMFA 5A2GA 4X85A 3K2QA 1QTNA 1AQYA 3L3BA 5DTIA 2AOUB 1QS0B 3PTZA 1MENA 2DMRA 1NL3A 3RVOA 3MWJA 2Z8YM 3L8GA 4BB6A 1BA2A 2SNIE 1GGVA 4L07A 4AROA 4U4AA 1L7QA 1NN0A 2AEJA 3A36A 3AQIA 3A1CA 4I9GA 2EKPA 4R8RA 3HB0A 4Y9DA 4TKUB 2OBBA 4HDOB 1LK7A 2YZ2A 3GPBA 5EERA 1ZONA 4UVHA 4J6EA 4F86A 2O2YA 3QEJA 3AW9A 3KVOA 2GJ4A 4RVGA 5C7LO 4FJ0A 4EPXA 2W4MA 4IY1A 4ZAZA 3LBFA 2RKBA 2WFZA 1VB5A 4YP7A 3LWDA 2AOTB 2EFDB 3SC3A 5KI6A 2Z2XA 4F91B 5KC8A 2I3GA 3IXMA 4OHPA 1B0PA 4EO4A 3AHFA 4L4UA 3QMMA 4IZOA 2EKLA 3EW9A 4KWCA 3AEQB 4QUAA 3O8CA 2EYUA 4CETA 2W8ZA 3NBKA 3IESA 4EPVA 1W48A 1WOYA 3TLMA 5CITA 1NX6A 1DG9A 5ESXA 5LN1A 1NG9A 2FLWA 2QBYA 2O07A 3FWZA 2ETVA 3AB8A 4JVMA 2R6DA 3A32A 1A8QA 1KZGB 3HV0A 4IL5A 3REQB 3VR1A 5CDUA 3H1GA 4AN0A 4ZU1X 3CVXA 5H9WA 3CRQA 3LO5A 4HAYA 3ZLJA 4JDPA 5EYPB 4C07A 1CERA 3P5BA 2Q3EA 3W90A 4ZI7F 3PNVA 3U7QA 4D9EA 4NOJA 1U8FO 3BOSA 4Z7OB 1AV6A 3ER6A 1ANKA 5GJCA 5BVHB 3IP8A 5ALXA 3NASA 3ENZA 1TQ8A 1MF7A 1Y3CE 3H0KA 1PL6A 2EGGA 3CRRA 4I6JA 4NMMA 4R9NA 5ERYA 3DZCA 3ETLA 4D4LA 1LWNA 3ROGA 4X0EA 4BVBA 4EF5A 1BH6A 2ZRCA 3SSOA 1JAYA 1MW9X 1UZNA 4B9AA 4LF8B 1Y9JA 3GRKA 1G98A 1SZPA 4DLTA 5EJ2A 1KKLA 1OYVA 4FFWA 4P08A 4YCSA 2J3DA 1K27A 2EJBA 2I2BA 4RWZA 4KH1A 4EJ0A 5K8TA 1C1YA 5LU8A 1VTKA 4X84A 1P61B 3I42A 3ZHBA 3N86A 3NJ4A 4LWZA 4RZHA 3CYFA 4DJAA 1PLJA 5ADVA 2HU8A 3DKVA 1Y7PA 4R84A 4ZVSA 2QXUA 1XVUA 3OOSA 4OV6B 2QRZA 3HXPA 4J16C 5BN4B 1TVMA 3GD7A 2DPMA 3MXOA 2IU0A 1F6DA 4JS0A 3USZA 5JCZA 3C6ZA 2RGNA 4OSOA 4M36A 2GRAA 4ENVA 3VBEA 5I7OA 5IWAB 4Y6QA 3L9XA 4HEJA 2P75A 1G5TA 1HF3A 1R0RE 4MWBA 5FPSA 3UHAA 5CURA 4LFAB 3BRQA 2R6AA 2ZT7A 1U90A 3HJAA 2QRVA 3EVEA 4JMLA 4R1OA 4TM8A 1L7BA 2JIOA 2ADOA 1FE8A 1G5RA 3FUUA 1MEJA 5ENDA 5COAA 3X0DA 4L8YA 3COSA 3KQNA 1E8DA 5GJBA 1Z68A 2RGGA 4KR0A 2WJYA 2H4WA 3K0EA 4YJGA 3PUWA 5EAIA 2ZI4A 1B3BA 2MSLA 5LYJA 5K3BA 1TAHA 1HRKA 2GN8A 4YI5A 1MIOB 1EFCA 2ZVQX 4EKYA 3B7PA 3BRSA 3ONFA 4HATA 2BHLA 1Z7YA 1T1RA 2YHIB 4N9WA 4MCHA 4ETIA 5KOHA 3E23A 3PRKE 3SQDA 2N46A 1WD7A 2A7XA 3TFWA 1Y3AA 2DBYA 3T5BA 1KJYA 2CV2A 3SSNA 1YZQA 3F2IA 2QVCA 4IJVA 2JNWA 4FPXA 3CKYA 4KMOA 2Y1DA 1UM9A 4YYEA 3V32A 2HX1A 1U1CA 1UMCB 3LUHA 3MSXA 4BTLA 1G66A 2A67A 5CAEA 3K0CC 4P7JA 3KD3A 2JLBA 2G9VA 3CW2A 2RGDA 3PRYA 4IS3A 4QPDA 5IJ0B 4KR7A 3KV3O 4YY3B 3QUTA 1ARZA 1BGWA 2CNWA 1H2EA 4RH1A 2IHZA 6ADHA 4FR2A 3DBLA 2BV3A 1CFZA 4ITVA 3GLUA 4PIMA 2GBPA 5CJ2A 2XMDA 3E1GA 4ZEXA 3RABA 4LZPA 1ZRNA 3USES 1NW8A 4DKJA 2IX3A 3JZAA 4YP5A 1ODSA 2HRCA 3QPDA 1ONNA 4RJJA 4LOIA 2APJA 5C1IA 3M4XA 3KEQA 3W5HA 3KAKA 1EUZA 1U0EA 2IC5A 3BJMA 5EINA 1JG4A 4RMHA 4C76A 3K1JA 1KORA 2NADA 3RGGA 1QC5A 2HJHA 1HEYA 4NHOA 2UZ0A 2Z2ZA 3NT4A 3U3XA 3GRZA 5HBRA 3KOYA 5FWXB 3ITKA 4OO3A 4EGSA 3H99A 1KU0A 1QYXA 5LMNB 2X58A 2VBGA 3TUZC 3VI4B 2L17A 1B2LA 1N0WA 2W2LA 3BL8A 1QK4A 1OD6A 5AKGA 1OXBB 1B1CA 1ODTC 3GJXC 1KI3A 1SBTA 2J4CA 4L08A 3GEHA 4LYFA 2QW0X 1IHDA 1Q5PA 3OTQA 2NM0A 2AH5A 2E21A 3JYPA 4OBEA 5KWSA 4K0KB 2OKGA 1PO7A 2JIMA 1ZRHA 1BN6A 2H16A 2HREA 4ZAVA 3A58B 3V8NA 4G86A 1ODLA 4ARZA 3LPMA 2B35A 4HK4A 3LXUX 1E9CA 4CLRB 5ICCA 2H1FA 5KYYB 4AY4A 2J59A 5IZCC 5DBHX 1AVTA 4M1SA 4PZLA 4KK4A 5C4MA 1S1CA 2X0RA 1WULS 4ZJZA 4AS1A 1XVAA 2VLBA 4FGZA 3ET5A 4BNYA 4DYVA 3OZAA 3PHHA 2IZ7A 2J41A 3DE3X 1NBWB 5AW1A 4RAOA 1GAXA 1AV7A 3D7SA 2VWHA 1T29A 3V4OA 3AJ9A 1GYQA 2G88A 3W5VA 5KX5F 5DN9A 3GC6A 1LLUA 1PYOA 2Q3BA 3AWDA 1YT5A 3S28A 4EJ2A 5HZGA 3PPVA 1SUSA 3W34A 1E3QA 2OCBA 3GA7A 3V42A 5FBVB 1H3NA 4OMDA 4CF5A 2IH4A 1KOLA 3V7FA 4LFCB 3PBKA 3G5LA 2ZEJA 1I5OA 3OEHD 4PR3A 5AI0A 4AM8A 3VHRA 2ZUEA 2WYOA 5E1MA 3IMKA 4YAEA 1SKYB 4A1FA 1EXMA 1UBKS 3QZUA 4L8WB 1PWEA 1FFCA 4ONEA 4QBFA 3RVRA 5L51A 1E2MA 5FEMA 2V0GA 4BMPB 2BW0A 1E6EA 4UHKA 1BOFA 2JBAA 2OV8A 3OQIA 1WRBA 1NN3A 4PFQA 2GM9A 3UAYA 4TLAA 3SVZA 1Z5PA 4FSDA 4RD6A 5D51S 4RY2A 2XKBA 4ZAGA 4ZYTA 1GNTA 3T54A 1HT3A 4C7BA 6CHYA 1CJKC 3T34A 1O97D 2C4KA 3C5EA 3EW7A 1X13A 2BKAA 4MO9A 4X3OA 3QMVA 1GG2A 5G0SA 3ZJUA 3CEHA 4X8HA 3LUJA 2VF7A 3KWLA 3KDSE 1UT6A 2O8BA 1N8SA 1QHYA 4V24A 3U4CA 1H2AS 4ALMA 2MYNA 5F98A 4DANA 3OU7A 2V6GA 4F9EA 1N8KA 4U7PB 4HNQA 4E11A 3K6KA 2Q7XA 4EPYA 4KGZA 4J0HA 1HRDA 5D6OA 3KLMX 3OQNA 4A8HA 2R00C 4PSKA 1GTMA 2ZBVA 5AJTA 3BHMA 1UBUS 3ILYA 1XNQB 3HPRA 4G5GA 5TJ9A 1WHTB 3Q8LA 2AB0A 3S1AB 3GMSA 1TM1E 3KTAA 4EYOA 3W5SA 3W5UA 3NDBB 3RFTA 4J4TA 4H7KA 2WYUA 3SZLA 3MRXA 3IEMA 1E1KA 4BHTA 4JVOA 1A9PA 3ABZA 2ZAOA 2AL7A 4PC1A 5B4VA 4PYRA 2A9KA 3UMJA 4UOEA 1SXIA 2GA8A 3V1MA 3ZWBA 2SKCA 5KNCA 1P4SA 1LPSA 4XGQA 5JAHA 2BHNA 1LLCA 3HA5A 2O23A 3A6EA 1YDHA 1VMEA 3CRW1 1U3FA 1V71A 3KDPA 3QEKA 5F12A 5IK2A 2A0WA 5EJFA 4AQDA 4B83A 5BR1A 2DHRA 4OREX 4KGXA 2I4RA 4GOMD 3PFIA 1Y6QA 5EWMA 4IQ4A 2OPBA 3GQBB 1NP7A 4ND4A 5E0OA 4QELA 5FPQA 4PC2A 2DB3A 2Q07A 1KYVA 4FYPA 4G0XA 4NDAA 1JB9A 5LZ2A 2QPAA 1PEKE 3BAZA 5FPHA 4GW3A 4MPJA 5KNBA 4AJLA 1OT3A 4WFIA 2XGSA 1DSSG 1WSWA 4TMFA 4A0GA 1KDZA 1FVXA 4M54A 4ZKEA 3OLYA 2DWQA 1KS2A 4OHOA 5FULA 4LS3A 3GLFB 2PGAA 1P0FA 5FTMA 3W8FA 3R4CA 4BRZA 4R7TA 1U0FA 3UK6A 1FP7A 1YZKA 2B7BA 2I2DA 4CVNA 4EKIA 5M29A 4IXDA 4YJ3B 2YZ7A 4A16A 3OZFA 4TN1A 4C43A 1PFQA 3UPTA 3Q41A 3GVPA 2NSJA 4M9ZA 1EB8A 1PT8A 1JDTA 2QLMA 3SF8A 3CZMA 1Z4PX 4MEJA 1N9KA 1M1YB 1G20A 4UOQA 3D3WA 4I8DA 1GPH1 2I2CA 3HV2A 3LVBA 2OD9A 2XBLA 3EFHA 1NV8A 4IIUA 4LJ7A 5TPWA 5E4YA 3EIUA 1UT5A 2JS7A 5JAIA 2W2NA 4CKCA 4PONA 3ZHXA 4FU0A 1PCXA 4BN4A 4RV5A 3EUEA 4WFQA 3DLTA 3ITNA 3UK7A 4K9QA 5THXA 4D42A 3UC9A 3FCXA 4EY5A 2BDTA 2EL9A 3WAJA 2OM2A 4U2BA 1QO0A 1YJCA 1U1FA 4X8OA 4PLHA 5IT5A 1PQYA 1R64A 4PRLA 5DN6A 4AJOA 1Y7IA 3VVCA 1Q95A 1UC8A 3KT0A 5SZJA 1SWWA 4JKIA 5TQ2A 3VFDA 2OV1A 1CIPA 1RKBA 3L8MA 2K2QB 4I1YA 4R2KA 4M9XA 5JT1A 3HJGA 5U1PA 3QHAA 3W8EA 3GD5A 2HMAA 3W3ZB 1EZ1A 3JQFA 3HUFA 3CA8A 5CNJA 3WZ2A 3GP5A 2TS1A 1OFIA 2EGUA 4FZRA 1HE8B 3BWDD 3DVAA 1NVVR 2BZ0A 1V26A 3H9UA 3NB0A 4UAJA 1GZHB 5E2AA 2DQYA 2B4AA 3W2IA 2WPNA 3A1EA 1HDEA 4ZOLB 5B7NA 5JANA 3DBOB 4U1RA 5AHXA 2IJGX 2VI5A 2BBSA 3RVSA 3MF4A 1J9ZA 4Q4DA 5AM4A 3A1TA 3L7NA 1DC8A 2HIGA 3P0JA 1OH6A 2RIRA 3ND9A 4INJA 5ALSA 5E7IA 4DZTA 3CX3A 5BT9A 1CUGA 4KXNA 3Q11A 2XE8A 1XNGA 1HDGO 1OWPA 5FI0B 1YC5A 5FEUA 2YOGA 3KSBC 1KAGA 2WAYA 4PTLA 3I04M 3H97A 4FC7A 4X1IB 2Y1WA 3C16C 3C3PA 1SUIA 3CUEF 3HZZA 3VRHA 4ZQBA 1DX4A 1LBTA 1SD5A 4YDQA 2ZIXA 2I2WA 4UVGA 3IHKA 2HRRA 3BJIC 4MR7A 3JASB 3JD2A 3ZPXA 4BLTA 2GO7A 3JPYA 3L1KA 4LJ5A 4EFNA 3KSRA 1N57A 4Y6LA 5DLPA 4JT8A 1IOLA 4FCTA 2FXVA 2Y6UA 4DRYA 4L4RA 3TM5A 5IAJA 4MIKA 2DFVA 4CL2A 5JZSA 3BB1A 4EJ6A 2QPOA 1C8LA 4YCAA 1ESDA 1GYPA 2L0XA 1Y7HA 2ORIA 1WW2A 2FPIA 3FTQA 5CNIA 3T3OA 1MKYA 3CF2A 3R3ZA 1Y6ZA 1P80A 4L0MA 4UHCA 4E5YA 1JDBC 1XJ5A 3GNLA 2EG9A 2JFXA 3DFZA 4DM7A 3HJCA 3FPLA 1B1AA 1GKUB 2C4NA 4CMKA 2GH1A 3OZIA 3IKLA 1PG5A 3RNOA 3EVDA 4B8YA 2B4YA 4NH0A 4PYQA 2QD5A 4W1RA 4B45A 4D3ZA 4B2YA 3GRYA 3FLEA 3CCCA 4MRMA 3CUSA 1JIQA 1Z4LA 1GYRA 5CXXA 4E12A 3UA4A 4CBVA 3R44A 5KOJA 3ETDA 2WC1A 4C7OB 1Y9EA 4R1TA 4XWKA 2O5CA 1NG1A 5HIMA 2R4TA 1E3WB 1P4GA 2H1VA 1FMJA 3PE3A 1CQJB 1RAAA 4NDNE 3ZR4B 1JHVA 4P8RA 3QGMA 2IFTA 1DJPA 2RGXA 5DFAA 5F64A 1G1AA 1E5XA 3LKDA 3Q98A 3ROQA 2WNSA 3VOAA 3DMRA 4AS2A 1Y63A 3BILA 1KS9A 1JMKC 3NOQA 3IB3A 2Q1UA 1ADJA 1HC7A 2Y67A 1JBQA 4OLBA 4CDGA 2AA3A 2Q5IA 3QU5A 1V3VA 3OVMA 3FYHA 1C0PA 4YJHB 1CQIB 5KQPA 3N58A 9MHTA 1S9DA 5AXDA 1H4SA 3GNTA 1AX9A 3GCDA 2VCHA 2BY4A 1M7GA 1Z07A 3MAJA 3E27A 3W5CA 1QXSA 3SZGA 3TQSA 3OQ1A 1ZUHA 5AESA 3KPUA 2I67A 2R1VB 2H2WA 3DHEA 2NVUB 1GKLA 3UAXA 3G2LA 3REFA 2CDRA 3EEYA 4BN5A 4PAMA 4I6EA 4CIVA 1EWQA 2KB0A 3CKLA 1G2PA 1NKVA 1DCKA 1KNQA 4PXYA 1EP9A 1WB5A 2B21A 5CBPA 1YA8A 1YZLA 2RBEA 1U9YA 1VLLA 3A3PA 4JSRA 3C8HA 5B6IA 3NJRA 1L4EA 3WL7A 2QRPA 3DLIA 4IICA 2E4ZA 4DMGA 4IZ6A 4Q9HA 1K7SN 4GICA 3AR7A 3ZEIA 3H42B 3LNTA 2IOFK 1TUBB 4X61A 4XX0A 4O63O 3WGUA 4EW6A 5EHQA 3DHYA 4JASB 3EGXB 4PG8A 5IANA 2CFRA 4PLWA 5A7HA 2FRDC 1I2DA 3BGOS 3SHFA 5C1PA 3OTOB 4PLTA 3SC2A 2BVNA 2J6HA 1I3LA 3ZGVA 1QG4A 3V97A 3V2GA 2VJAA 1O6FA 2P77A 2VRWA 4RJKA 3Q72A 4KI0A 4XPIA 2D2XA 4YRRA 1Y8RA 2IS1A 2ZTLA 2H9AA 2VHWA 4NFLA 2PX6A 3X1DA 4OB7A 4X7BA 1QYRA 1CZHA 4JVNA 2JAQA 1JSRA 1M6NA 3IOYA 3RBXA 2ODAA 1RLTA 5JH7A 3ANLA 1N0IA 3L7CA 2H5IA 3MGGA 3GLKA 1N0VC 1ZL2A 3JTMA 2FA9A 2QU7A 1U8UA 2GCEA 3DMPA 1Y8QB 4JMPA 1A1VA 1CE8B 3FCYA 3LUKA 1ZLYA 5F23A 1WA5A 2BI4A 3EE6A 1MHTA 1GDDA 4L5BA 4GL2A 4O4IF 1FLAA 5IH3A 2HT1A 3PB3A 5LM3A 3FKQA 2HHHB 3DBRB 4OHVA 4KUEA 3K70D 1DKMA 4LOJA 3SLRA 2AZDA 2LKDA 1C4OA 4MJLA 5HGJA 1F17A 2BFDA 4HH0A 5DRYA 1J1IA 1D2HA 2ZKLA 2Q49A 5KBYA 2VKQA 4DB2A 6ABPA 4N5LA 1JWLA 5LC1A 4JLMA 3DWFA 1I2BA 3OCCA 4NJMB 3NRBA 4R2XA 1Q22A 3HKCA 1GA4A 2ZYDA 2LIVA 2PL3A 3C3YA 3PF8A 3QY9A 4L8GA 4PG5A 1J0EA 4QSMA 1LTKA 3KLOA 3EGDA 1MAWA 2E37A 1MA3A 2WV9A 3ACBA 5JLJA 4ZEMA 1BTOA 1KSFX 3NAQA 1AHIA 1CZOA 5JAZA 5ELXA 4TV8F 2XNDD 1RABA 4E15A 5EGSA 1RAHA 3JQPA 3S70A 2C9ZA 3GDOA 1U80A 1NRXA 1JHOA 1HL7A 4IYRA 4PNHA 5CVUA 2A9RA 4XUEA 3USCS 3DONA 1GQYA 4DJFC 3LX8A 2JFHA 4IZIA 1V1RA 3OPYI 3ND6A 4NYIQ 4YMIA 5ALPA 4PSVA 3W8RA 4CCYB 4D57A 5AFSA 2FUG1 2R1ZA 1PFVA 3I32A 5EIFA 1KEWA 2QTVB 2J6BA 4TXNA 6Q21A 1YFLA 2BP7B 3IALA 1G9TA 2HU5A 4GXQA 3N07A 1DC7A 3DNMA 4ZYLA 1XRLA 3CNHA 5AW0A 5LMCA 5DSTA 4G1VA 2FW6A 2IXBA 2Z8YA 3G68A 4E13A 4DIUA 4LF7B 3IDQA 3A0UA 3ICWA 3ORQA 4MJXA 1EBUA 2WVJA 3PQ2A 5IC6A 3TVTA 4GP9A 3SZRA 3O74A 3WLMA 3PCRB 1W4ZA 3IQZA 2FDRA 1I7DA 2VJKA 3QLJA 5AVOA 2O2HA 4S35A 2QUKA 2ACEA 3SHVA 5KMGB 1KIMA 5EZSA 4OHZA 3NJ8A 5CFOA 1KEUA 1P0MA 1AK9A 2JGIA 3HMQA 5HIIA 4QU5A 1WDWB 1JLRA 2XRMA 1SQ0A 4O0MA 1SC1A 2NUTB 4R8SA 5EE3A 3HA3A 2O05A 3OIDA 4UEQA 5H83A 4P2BA 2FJUA 3UJCA 3N8GA 3ZZ0A 4NBTA 1CS0B 4N54A 2DPLA 1W2WB 2G3YA 3C1TA 3AFHA 3FKSA 2X0FA 3OSUA 3WK7A 3O0DA 4D3FA 2OOKA 2Y0CA 5TF0A 5JS7A 4S3MA 3VC7A 5FQOA 1RWWA 1Y34E 4BY9E 5FKJA 1OTXA 3QKTA 1RW4A 4ND2A 1EUYA 3H8JA 4NYMQ 5KX5B 1KOJA 4FD2A 5H0IA 3HFJA 4C4RA 4AJ9A 1I2CA 3TGWA 1E1YA 5J4LA 3R3UA 1VPTA 1RLOA 1ZJZA 3KSZO 1NULA 2CWDA 4EY3A 2YWFA 3DZHA 2DM6A 4ECEA 3PNQA 2PKQO 1SUEA 3PGA1 4QGSA 1M0WA 2FPGA 1N6KA 2IH5A 3TOSA 1Q1BA 3WJAA 1KAMA 3FIUA 3COJA 5EJ4A 3EVCA 4TYMA 2QTZA 3DLHA 1N2CE 3C3AA 2B2NA 1L1QA 1Y3FE 1LDYA 2H8KA 1YMVA 2NZVG 3OT5A 3PLNA 3SZ3A 1NHGA 2TMGA 3B51X 1ENZA 3TZHA 4MUMA 5CX4A 5EIOA 4W5HA 5J5VA 1SXHA 3PKJA 3PXUA 3TL2A 5IT9A 1FJGB 3M3HA 3Q85A 5IAKA 1HYHA 1SNYA 3DC2A 1EVLA 2CVQA 1U0TA 2X4LA 2X9NA 1VHQA 2F2TA 3IURA 4V0OA 2OAQ1 4IH4A 3TDKA 1X9IA 3EEIA 5DLDA 3M1YA 4WIAA 4BCDA 3DCNA 1Y9ZA 2VJLA 1D2CA 4URZR 1BHSA 1NVBA 4UHHA 5CH8A 5DHRA 4D46A 4CEJA 2C2WA 4PIPA 1I36A 1XDSA 3W5DA 3UJ7A 2POQX 2OP1A 3V7WA 4WK6A 1M1ZA 2DZDA 3LC2O 4R41A 5CLLA 1JVBA 2E1RA 1C2TA 2EFJA 1W52X 2F3TA 4AWAA 3DCJA 2PJRA 4OKNA 3EULA 2OLEA 4REQB 3KK0A 3P1JA 4LMRA 4B3BA 1ACLA 4B75A 3A4IA 4UXHA 2OFPA 4NENA 1LVHA 1BMDA 2N3ZA 2GFQA 3ZD9A 3C41J 3NPMA 4QD3A 5BR7A 3WAGA 5JJLA 2EW2A 4RZUA 1XCJA 3FW1A 2ZM5A 4I46A 3ORSA 3ZWAA 1S3FA 3ZE1B 4BNUA 4HVCA 1FBNA 2WF8A 1W6UA 3Q12A 4RV9A 4Y2QA 4U39A 3P97A 1IM2A 2EU8A 1VI2A 4GWGA 1BXGB 2GEFA 2HHLA 2RCYA 2RC5A 3D0OA 4WV3A 2ZAIA 3ICPA 4RPLA 1SQGA 1ZKMA 3U39A 5CDFA 1A4XA 1OZAA 2X3FA 3EBLA 3NVMB 4JQCA 2IDKA 3T94A