4HGRA

Crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
163
Chain Sequence
b'MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGAKTEIVRRRAEALKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase, hydrolase
total genus 53
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgrA00
2R8XA 4OHFA 3I6BA 1Z4LA 4MWOA 5AVUA 4NWIA 1ZJJA 3TLMA 2AGVA 5IT0A 1EK1A 3NUQA 5AIBA 2FPWA 4UARA 3WKEA 4EZEA 5A3QA 1AQ6A 4XQ0A 5ALTA 4C4SA 5AW6A 4G9BA 5ALLA 1QQ6A 2QYHA 2WHEA 3WK5A 1ZRNA 3L5KA 2FUCA 3QU2A 1WVIA 4KX3A 4ZEVA 2OA0A 4NABA 2BDUA 2R8ZA 2Q5EA 4DFDA 3M9LA 5AI4A 2WF5A 5ALWA 1K1EA 3KDPA 1ZD5A 3N1UA 3NANA 2JAOA 5ALQA 5AW0A 1T9ZA 1L7MA 5AHXA 1SWWA 5AW2A 3N5KA 4UW9A 5ALGA 5AM0A 2G09A 4RETA 2NYVA 3ZI4A 3EPRA 2HEGA 2GMWA 3FGOA 4B6JA 3J7TA 4OFZA 1TE2A 2P27A 2B0CA 2ZG6A 1RQLA 1RKVA 1Y8AA 2FUEA 3KZXA 3OCWA 3IJ5A 4UMDA 3EF0A 4C4TA 5AKLA 4Y3UA 3NASA 3U19A 2MSNA 2B30A 2O2XA 3SD7A 5ALVA 2PQ0A 2QLTA 5A3SA 1VJRA 4CF4A 3QU9A 3AR2A 3ZWKA 3RF6A 3KC2A 4IFTA 4ZEWA 2YJ6A 2I6XA 2Q4TA 4J03A 1WZCA 2HX1A 3A1CA 3WKCA 2G08A 2P9JA 3QU4A 3FM9A 5AKZA 3ZUPA 3L8EA 1SWVA 2PKEA 4BX3A 3UM9A 5AVQA 2R8YA 1U2SA 2JAUA 3NIWA 1ZRMA 5AIAA 1RDFA 1VJ5A 5AM2A 5ALJA 4UMEA 5AVVA 3SHQA 5AKGA 2RB5A 1TJ4A 3DDHA 2P11A 3UMBA 3QUQA 1N9KA 1WR8A 5AI9A 3UMCA 2WF6A 1YMQA 4FFDA 1XP5A 3HLTA 4EENA 3I28A 3ZX5A 3DV9A 4UU0A 3R09A 5AW3A 4I9FA 5AESA 3SKYA 2YBDA 2G0AA 5ALNA 5ALPA 3ZVMA 5AI5A 4YIKA 3L1UA 3ET5A 2HF2A 2JAWA 3QU5A 1NRWA 2ODAA 2YY6A 2ZOSA 3IRUA 3MMZA 4KNWA 4Y2PA 3BWVA 1LVHA 5ALKA 2D2VA 3L8HA 5ALDA 1T5SA 4HGNA 3A1EA 2HDOA 4J2TA 2C88A 3HYCA 3K1ZA 3EWIA 2YJ5A 4I9GA 4UAVA 5AVTA 1RMQA 5IS2A 3U7EB 4YGYA 1SU4A 5AKJA 5AW9A 3OPXA 2FDRA 4BKMA 2RAVA 3N8GA 4UASA 2I55A 5AKYA 2O9JA 5FP0A 2W43A 2WFAA 1Z4JA 1ZD2P 2FEAA 5ALOA 4EEKA 2BY4A 3ZX4A 3L0CA 3KBBA 5ALZA 2B8EA 2EATA 2NO5A 2IOFA 3PCTA 3QUBA 1TJ5A 2YJ4A 3L7YA 5AKEA 5T41A 1FEZA 5AVZA 4Y2SA 2R8EA 3MN1A 1Q91A 4BBJA 1RPZA 1L8LA 3QLEA 1RRCA 4Y2QA 1XPJA 3OCVA 1Z4KA 3DNPA 4KN8A 3QX7A 1O08A 3WKDA 2GHQA 5AW5A 3SLRA 2JARA 2YMQA 4Y2JA 4FE3A 1RKUA 3P96A 4C4RA 2FPRA 2JGAA 2ZBEA 4BX2A 4HGOA 1PW5A 2VKQA 2IOFK 1IWOA 5AM5A 2G1AA 3WGVA 1RMYA 1Z4OA 4L57A 3W5DA 1RQNA 4NAVA 1ZD4A 1J8DA 3L0YA 1X42A 1CR6A 1JUDA 3FPSA 3D6JA 3SF0A 2G07A 4OCZA 3R4CA 3OCUA 4YCNA 3OCXA 4HGRA 3WK8A 3N07A 2HF7A 5ALSA 2I33A 2ZBFA 2B82A 1QQ7A 2X4DA 3WK4A 4KNVA 2IA5A 3WGUA 2YMLA 4UMVA 1Z4IA 5AI8A 4EX7A 1Z5UA 3ZTYA 2BDEA 1KYTA 1L7PA 3A1DA 2C9MA 2FPUA 5ALHA 1YS9A 3I76A 5AVRA 2W4MA 4HGQA 4BYGA 3WK9A 2FPSA 1CQZA 1QQ5A 2HSZA 3L8GA 3WK7A 2RARA 4NV0A 1RLMA 4UU1A 3I1YA 4Y2TA 4F72A 2C8LA 4MUMA 5AVYA 3E84A 1T5TA 1L7NA 3AR4A 5E0OA 3FZQA 1U7OA 4HGPA 5IT4A 1ZD3A 5AVWA 5AKKA 4NFLA 5ALEA 1RMTA 2WF9A 4UAUA 4Y2YA 1QH9A 5ALYA 3CZ4A 4KX5A 3S6JA 1VFPA 2CN1A 3ESRA 2MU1A 3M1YA 1TJ3A 2OBBA 4DWOA 2HOQA 3ESQA 3KD3A 2ZBDA 4YIHA 2YMMA 3FPBA 1RKQA 3AR3A 1Q92A 4YH1A 2EAUA 3U7HB 2WF7A 1QYIA 3BA6A 3W5CA 2HHLA 4UMFA 5AW7A 1TA0A 2HI0A 3GYGA 1LTQA 2RBKA 2B1QA 3A3YA 2OM6A 3E81A 5AK5A 3CNHA 4QJBA 3MC1A 2HO4A 3B9BA 4PNHA 2YJ3A 3IB6A 3E58A 3PGLA 1O03A 3L1VA 2YMPA 2P69A 3QYPA 5AK6A 2YN4A 4E88A 4YCLA 3AR8A 1Z4PX 3EF1A 5AM1A 3QUTA 5AI6A 1S2OA 3NAMA 4JDPA 4Y2RA 5AM3A 1L7OA 3ONNA 3MPOA 3ET4A 2G06A 4KYTA 4H1WA 2G80A 5AKXA 1YDFA 4XOUA 2HCFA 3PDWA 1L6RA 3AR7A 2W11A 1F5SA 3QU7A 2PR7A 3ED5A 3SKXA 3U13A 1U02A 1NNLA 3OCYA 1YJ5A 4YCMA 4EX6A 4JB3A 2GFHA 3QXGA 5AKHA 4BX0A 1Z4MA 4G63A 2ZBGA 5AW8A 3QUCA 3SMVA 1EK2A 3U7FB 3FVVA 1Z88A 5ALMA 3WKAA 5AM4A 3L0BA 4L6CA 3DAOA 3NRJA 5ALXA 3ZVNA 3R9KA 3AR5A 1N8NA 1ZS9A 1NF2A 2AUTA 1YNSA 3F9RA 4HYTA 4UM5A 2IYEA 4OD0A 2AMYA 2B1RA 5A3RA 5AICA 3ZTWA 4XE5A 4ZEXA 4GXTA 2C4NA 2Q4RA 3PGVA 1S8OA 4Y2VA 5AW1A 2B8JA 1WPGA 4L6AA 4RESA 3UMGA 3W5AA 4XPZA 2OYCA 2AH5A 4CE6A 4DCCA 3N28A 5AK3A 4AS3A 3E8MA 1U7PA 2FPXA 3KOOA 5AKIA 2CFTA 4BNDA 3U26A 1L8OA 5AVXA 1Z5GA 5ALUA 4EELA 3WK6A 1YV9A 1Z4NA 1RLTA 2I34A 4BEWA 3OTQA 1MH9A 5AK4A 1J97A 5ALIA 4AP9A 2EARA 4HAIA 2DQSA 1ZOLA 5ALFA 3L8FA 2CFSA 2GHTA 2I54A 3ZW7A 5ALRA 4CF5A 2IOHA 1U2TA 4CNQA 1XVIA 4IG4A 2WM8A 4UATA 3ZWDA 4GIBA 3VAYA 3U7GA 2YFYA 2FI1A 2I7DA 2C8KA 4Y2UA 2WF8A 2NO4A 1RLOA 3WKBA 3ZVLA 4DW8A 4AS2A 4BEVA 2ZXEA 5AW4A 1RC8A 5AVSA 4Y2XA 3RFUA 3B8EA 5JJBA 3OCZA 4BNDB 4CF3A 3W5BA 3AR9A 4FYPA 4F71A 3B9RA 4UM7A 1Z4QA 2CFRA 3AR6A 3NALA 3QGMA 4O8CA 4QQFA 3ZU6A 3QNMA 2GO7A 5AI0A
chains in the Genus database with same CATH superfamily
4NLLA 4JITA 2OGSA 1US8B 4MWOA 1W34A 3NCTA 1QG6A 3ZNOA 3ZE8A 3AP1A 2MSWA 4DC0A 3ROEA 2X0NA 3OPYB 3LUFA 4X54A 4HTFB 2B20A 1KI7A 1QO7A 1T26A 3CEJA 4X71A 5IVKA 2NYRA 2I6UA 4MCHA 2AW3A 3VA7A 4RTJA 1NULA 2DUJA 2VFAA 5ALTA 1HEIA 1L8AA 1KU0A 3FVWA 4QRDA 3IT1A 4C0HA 1ZRNA 3KQQA 1PJ4A 3DPIA 4WDQA 1DZ3A 2E18A 2FUCA 2I3BA 3QU2A 4F8JA 1EVQA 2QVYX 4NABA 1YE5A 2LD4A 4OKSA 2O5EA 2BDUA 3DMNA 3KG2A 2I2WA 2DPHA 4MEBA 4XGNA 3A4TA 4YLGA 2UUCB 3CT4A 3P71T 4XEHA 3CEMA 2IWHA 1PYDA 4TWIA 2GAOA 1J0CA 1ETUA 2CJWA 1YOVB 3SBXA 4XRRA 1NSYA 1VECA 1E9AA 1SVUA 5EWJB 2NYVA 3H1AA 2W6JD 3DG9A 1L5LA 4BE9A 2GYYA 4LYAA 2F90A 2IIQA 5D01A 3K2IA 3SEAA 5JU6A 1PQPA 3CX6A 1XD2B 5JI3E 4JXZA 3G8CA 2PUJA 3DL0A 3V7FA 3LLCA 1ZQ9A 5DGDA 2NTJA 1R0CA 4N3NA 4ZYVA 1R50A 4NX2A 2IITA 2PPVA 3LOPA 1KARA 1PR0A 1TT5A 2CEAA 2ZCUA 2ZTHA 4FCWA 3VVLA 1E3LA 2I65A 2OV1A 4GBGA 2O7SA 3GEBA 1MDBA 3WYNA 1ZY2A 3P2IA 3TIVA 2ZYAA 4UNIA 2FUG1 4JL8A 3ME5A 4L95C 3HKDA 4R5MA 2EKDA 3RREA 3SEFA 4CV0A 1C9MA 3UJBA 5TQ0B 4YP7A 2IK8A 5HFJA 2BP7B 3OX4A 3TNJA 4FMDF 2H2DA 1KI2A 4R3UC 2QB5A 3BD7A 4BNZA 3LF2A 4FIZA 4PYJA 3GJ8A 1SG0A 4UDXX 1P2DA 4YJFA 1NVKA 5HKBA 2C3MA 4IHJA 2C2KA 4CCAA 1BFUA 5J23A 3TSOA 3NKVA 1AVTA 4Q5IA 1DG3A 2ZIGA 4U3JB 3RTBA 5MN6A 5BN3B 1VBNA 4JLSA 4YAEA 1RLJA 4PLZA 2C7QA 2MHCA 2PKQP 3KUCA 3T7JA 3CXRA 3QZUA 3T4XA 1GTG1 2JLZA 3OE4A 1VJ1A 3G5MA 4LGCA 5F4ZA 3WOVA 1VL8A 4QODA 3T9CA 4K28A 4EUHA 2PKEA 1C8BA 4PV7A 3UM9A 4JA2A 1HKUA 5COAA 5FWXB 2RG1A 1VJ5A 1JR4A 1AZLA 1B2LA 1K7FB 1YVUA 3CY6A 2A94A 1SVMA 5EMJA 1NY6A 4YO8A 4EGQA 2PJZA 2EZ9A 2VQEB 2OCXA 3VOAA 5CG1A 3O8DA 4ZHSA 4TT8A 2G71A 5B53A 3NWEA 3T5DA 2BYTA 1RWBA 2GCOA 2PPLA 4AJ2A 5AHKA 1YZKA 4CTMA 1LK7A 5AI9A 1EXVA 2ZYVX 4PSVA 4EENA 4TYWA 4II7A 4JEIA 1OTXA 2J0EA 1FDTA 2VJBA 4ZAVA 5IAKA 1ZP6A 1BD4A 3ZCQA 4G0VA 1W2WB 1M10A 4TXLA 4RORA 1IIRA 2QR2A 2AOVA 1X3LA 2FMKA 1N2GA 3ANYB 4HNGA 5EEHA 2O7VA 1MPTA 2YIJA 3MS2A 5HQJA 3WLHA 1Y8CA 1PS0A 3RBAA 4P8RA 3T1YB 5LOVA 3V55A 3N58A 4LDQA 3FDJA 4GDMA 2R97A 1SMKA 1RQXA 2BZ1A 2Q0HA 1B0ZA 2C98A 5KTPA 1V3UA 3G0IA 2QZ4A 3EZYA 3ZJ5A 5FOQA 3H9GA 4ACAA 1TPYA 3MMZA 4KNWA 1Q0SA 3QVUA 4PFQA 5CM9C 5ENZA 3S44A 3C5CA 3PR1A 4GP9A 1H2EA 3W77A 5LJIA 5J1SB 5C7IO 3BEOA 4HLQB 2XZOA 4ARZA 4WA8A 5K45A 1Z29A 3MK31 2XRZA 1OFGA 3NHBA 4YRAA 4R0MA 1UXIA 1AB6A 2V65A 3RV3A 5HP4A 3LXMA 4HEHA 1DDOA 1KGSA 4CQMD 4ENVA 3ZI0A 2V96A 1G8FA 1P0MA 3S2FA 3CF4A 1E9CA 3NTOA 1YO6A 1Z0FA 2X1LA 3HA3A 4AUEA 4BNHA 4E2ZA 5AJTA 1W0JD 2ZJOA 4AIRA 1GZ6A 2ZR0A 4WCVA 4PZYA 2V45A 3TTSA 4BFVA 2X2PA 4CKCA 3LG2A 5EJMA 3RE1A 6PFKA 1HNWB 1FNDA 3A2KA 3MS7A 4F3RA 4MCJA 1D6JA 2XUOA 4BKMA 3JZFA 3NRCA 2O9JA 4HWRA 3V9AA 1JALA 4DMLA 2JA1A 5A4FS 1CQPA 1W96A 1VLQA 2JCXA 3M82A 3PKIA 1U2PA 1VHWA 2ODTX 1E66A 1C9YA 5BYAA 5BSWA 2LBPA 1I32A 1PCXA 2ISCA 4TWBA 1IQRA 5I4CA 1NUSA 2R6HA 3B5JA 3EC2A 3L0ZA 3PCTA 4KAAA 4QDTA 1SU6A 1IN5A 5AVZA 4MAFA 4Y2SA 5A5EA 1DBWA 2BGUA 4BB5A 1SB8A 3IEKA 1PK7A 2F1HA 3GWGA 3K9WA 4FYYA 4INJA 4B6PA 1NIJA 3HR4A 4EKYA 5C9ZA 4MUFA 1E4OA 3PLNA 2C4VA 4LZAA 1N5LA 1J1ZA 4Y2QA 2WWFA 2GAJA 1H4TA 4QJ5A 3DH0A 5KYXB 3LFUA 1Z4KA 2GAIA 3WJ1A 3SEQA 2OTCA 4UHHA 4WAUA 2J30A 2ZATA 4DL9A 3MGGA 4BNUA 2IEBA 2YMQA 3IO3A 1M3SA 2G67A 4YRMA 4Z4IA 2YV3A 4YCSA 2IS6A 3AHHA 4PYMA 1JHDA 4E5KA 4RFLA 1N6OA 3IL2A 1SC1A 4I50A 4HDKB 2JFZA 3ISJA 4EKEA 4K8RB 1LRLA 4HDCA 2HDHA 4OIFA 1RHRA 4W6QA 1ZCFA 3BGVA 4WL0A 4D2IA 1J8DA 1DCFA 2Q6KA 1ZK3A 1ZJ5A 4H0NA 1Y6FA 4X6UA 5LXTB 2D74A 1YASA 4V1CI 2FSHA 5KVAA 2DMRA 3UJ7A 1EGQA 3EJWA 5LZ2A 4HEJA 4PTYA 1XL1A 1BH6A 2XKKA 3H6KA 3LD9A 3EDCA 4Q4AB 3BTSA 2FE1A 2BFEB 3SJUA 2D8MA 3STXA 4AMGA 3JQ8A 2MYPA 5GONA 4MUNA 2B82A 2ZE5A 5A04A 4QOEA 3BXHA 5IBPA 2AT1A 4ARVA 2JVKA 1FU8A 3DBLA 1QQ7A 3FSGA 3I2FA 2EU8A 2QPTA 3AQIA 3OLCX 4XGIA 4XYEA 3GCZA 4QOIA 4ABYA 1RKBA 4KHZA 1GRNA 3OAAD 3DZBA 5I51A 3RYFA 3U5TA 4BGEA 2V1UA 4Q66C 1D9ZA 3FTPA 1U6IA 2PYIA 2GM5A 4LRUA 1Q16A 5CIWA 4CLEA 1PD0A 4OHUA 5K3OA 5CDGA 2BBOA 2EFCB 3DE1X 3KVRA 2ZRLA 3WBJA 2BMVA 1UC5B 3MZ0A 1GP2A 3QLVA 4C7KA 1YS9A 4FFLA 4M38A 1E0AA 2BUAA 1XMVA 5CAEB 4C03A 4FI3F 4N12A 1V45E 3LFTA 5JMWA 4GBED 4XB2A 4BKQA 1QTNA 2PA0A 1EJBA 5J2TA 2Y76A 5IW8A 4G1FA 1RLMA 4KK4A 5FOSA 3ZGVA 2GA8A 1PFKA 3D7KA 2C8LA 3JQQA 4F72A 5AVYA 5J4VA 4N82A 2L18A 3NRBA 4CMEA 4ZRDA 4CUKA 3TI7A 2GBLC 1JIXA 5E7QA 1MFPA 4G25A 1R5OA 1MX5A 1UDRA 1YL5A 2ECPA 4YASA 3RANA 2WKPA 4M8KA 4BJ6A 5AVWA 1XPRA 4LZOA 1DVRA 2HA5A 2HQSA 1KVTA 1I3OA 3OX2A 2QN1A 4C3ZA 4Y2YA 3HR7A 1APBA 1E2KA 2BF4A 3DUFA 2IF0A 5KKCA 3CTMA 4OA5A 2H8GA 3L4SO 5C8XA 2IVZA 2C92A 2XTNA 2VHCA 5JNLA 2E6KA 3KLBA 5G4LA 4JLNA 4DB4A 3BAFA 1F2VA 4RYLA 3CZAA 4DSZA 4MGYR 2ADFA 2LUOA 3WR5A 2WM3A 3O4JA 2HIAA 4AY5A 3KQOA 1PV4A 5DYIA 3C8ZA 3VNRA 5C7YA 3K5HA 3CEPB 3L40A 2R6R1 3VR5A 1J1UA 1E8NA 4F1WA 2CD9A 4CTJA 2VJNA 3DTVA 2IY9A 4DNOA 3P2YA 2Y1DA 3QBEA 1YWGO 3L4BA 1X1DA 3OZVA 4KE6A 4RO0A 4AAYA 5DI3B 1PDWA 3GJ0A 3IPAA 4GL4A 2GAAA 2J6IA 1XOIA 3W8EA 6AT1A 1WV0A 3C3PA 3CRMA 3JD0A 2JC3A 2P69A 2VK8A 4DF3A 4BC1A 2O0LA 3NQ41 5CW2A 2OAGA 3LPNA 4ZXPA 3V2GA 3WLNA 4NDZA 3UCFA 3C3CA 4A0FA 3ZWNA 4KXNA 3LX4A 3AR8A 2P3OA 1OZHA 2DKOA 3AVUA 2F00A 4E03A 4Q19A 3RYCB 2QX8A 4MR8B 1A9ZA 1U9IA 3MINB 4FLMA 1L5MA 4LJLA 2DYKA 5T3UA 3CM0A 1MKYA 1S2OA 4YUWA 3HO6A 5KHLB 4PQYA 2IZZA 3EN0A 2CFCA 3PNYA 1CQJB 1P1FA 2Z0MA 3QBTA 4KH1A 4KXFB 5K8VA 5MGBA 1GG2A 2I4NA 3L02A 4OX9B 5HIIA 2EDCA 3LRPA 3JCZA 4Z2YA 1FXWF 3BFXA 1ESEA 4EY4A 4ND8A 1YZYA 1O6CA 3R74A 3RYIA 4C5CA 2QT9A 1F0KA 1K7SN 2PL9A 4XR9A 4HT3B 3KQHA 3Q11A 4UOEA 1C9EA 1BXGB 2CLOB 2G76A 2F1RA 2KYRA 1OH6A 4ARCA 4HEQA 2A9QA 1QVWA 1SHZA 1H5NA 5JXIA 3SMQA 1EFTA 1PYGA 1V6AA 2QJRA 2R6DA 3A6EA 2WU4A 4K9NA 1H2YA 4BTVA 5L3QB 2OBLA 1QYVA 4OXKA 2J8ZA 3SMVA 5LP6F 3OQBA 1NVFA 5HZGA 3F3YA 2EP8A 2Z9DA 1F8GA 1EDOA 1VBFA 4M60A 2A0XA 4KGXA 4N9WA 4DLAA 5JWOA 2FFRA 1BDJA 1G8MA 2EX1A 2FZEA 1O95A 2I6GA 3NRJA 3R44A 3IO5A 4GX1A 1T8UA 3RKUA 1G63A 4M8LA 2OSBA 4O25A 2DSNA 2DVMA 4PZ0A 2PLNA 1Q74A 3FJ1A 4UM5A 3TFOA 5FYDA 4ZTZB 4P83A 1HZJA 2FW9A 1OX6A 3FDXA 4NR0A 1PZXA 5F3WB 4JENA 1OAAA 2UKDA 1MGOA 1J5XA 5LPNA 1OZ0A 3T61A 1XVAA 4Y8VA 5ECWA 3LL7A 2Z4TA 3GD5A 1LJUA 3N3AC 5E8RA 1BXKA 1SEPA 1FRVA 1NW9B 4C76A 2UZ4A 3HU5A 3P9KA 1WVMA 5FUBA 1A5SB 4J7CA 4BWYA 1KYXA 3ILSA 2Y8EA 4RHTA 4RESA 1UPCA 3AB8A 5KJ1A 3UMGA 3MLAA 2BTOA 3G7SA 2FJPA 3EEFA 1ZD8A 3SXPA 1F3LA 4GX0A 4MPDA 4DA9A 2RSLA 4DKXA 1SZCA 3MTAA 4QLBA 5HF5A 1ZKMA 3UZUA 1Z12A 2VJCA 3C7KA 3Q3GE 4M8IA 3X1JA 2HR1A 1AG9A 1P31A 5BNWA 4DMHA 2RHLA 1H23A 1IY1A 1C5KA 4XQ9A 3UKJA 4R1OA 2IQIA 1QHSA 3T7SA 2OT3B 5CA0F 2VH1A 3K70B 5FUWA 2RKBA 5JSYA 4OYYA 3T5AA 4R84A 3CISA 3RSCA 3AQ4A 2EARA 1PR1A 3HZHA 1TT5B 2DU8A 2PTHA 3HBAA 3ESCA 3AF3A 4FWBA 4GPEA 1Y37A 1EGMB 3TTYA 2NV6A 3STYA 2H4YA 2VP2A 2FNAA 3IMKA 2CJFA 2RB4A 3HKDB 4RL6A 5F12A 5FPHA 5BNZA 2UDPA 1FE8A 3SQMA 2ZRKA 1USVA 5HDBB 1WTCA 5CP8A 4IG4A 1RC0A 5CPFA 5KYYA 3F5DA 4RXTA 1Z6AA 2JDIA 2Z1MA 1KVRA 2X7JA 2IHBA 1RQGA 1ENZA 1TA4A 2XW6A 3Q7QA 1ZN8A 1Z2OX 3GGGA 2Q0QA 2Z83A 4WUVA 4HUJA 4IHJB 4F4CA 3ZE9A 4HNVA 1TLLA 2HK8A 4RS3A 3FMOB 1XQVA 4OXRA 3ZCSA 1DSSG 1R6UA 1IOVA 5F35A 3UV6A 2VYQA 1A95A 1JAYA 2RAFA 4U5XA 3PV0A 4KPFC 4MICA 4CF3A 2BH9A 4O4HA 5E9JA 4GRIA 1IN1A 5EERA 3B9RA 4LHSA 1GTMA 3GEGA 3VZPA 3I6QA 2UVPA 3OU2A 1M2NA 2CFRA 5D86A 4AWAA 4Z3KA 3RTCA 3NALA 4GLLA 4O3MA 3GNTA 4Z7JA 1DC3A 2VTBB 1XLVA 3HVKA 3DMYA 3V48A 1OB5A 4V3CA 3K31A 1Z0DA 3A1NA 1MZPA 5IVPA 3G6KA 2C2HA 1QV7A 1QX3A 2F1JA 3H1GA 4WN9B 1ST3A 5AXCA 3U3RA 3IPXA 4B0OA 1MHTA 3V80A 4K9SA 3OF3A 3K0AA 4J9VA 3F67A 5TEWA 3H5LA 1WABA 3A8TA 4H17A 1C9NA 2AGVA 1OI2A 2B4QA 3FBGA 4MQBA 5F1OA 1I51A 3PHGA 1ZOSA 2GCOB 3QF4A 4X60A 5HYVA 1JDTA 1QK3A 5A3VA 3WBKA 4LK3A 1J0EA 3NNSA 2Z4SA 3EVFA 3RYTC 2ADOA 1I7PA 4Y1GA 1SD1A 1NONA 1QQ6A 2BHTA 4KLZA 3ONEA 3H8JA 5BQ5A 2OB1A 2HGSA 4QU0A 2HLNA 2XEXA 3F49S 1FJ2A 1G64A 2AG8A 1ZWKA 2YRXA 4D9IA 1YVPA 1Z26A 3OJCA 3PYMA 4RADA 4YRPA 1J2UA 3HDGA 4E07A 1E4YA 1I4OA 3DQZA 4AF7A 1JIKA 1J21A 4PVDA 1I0IA 4EHAA 3K92A 5KNDD 3IKLA 4DIBA 1AY0A 3IUEA 3O73A 4F3YA 3ZD7A 4EJSC 1D6MA 4LE1A 2XD9A 2HDWA 5DOZA 3MBOA 4WOCA 4V03A 1YU9A 4PYIA 3FZEA 3QLTA 4NZYA 3SFVA 4YXFA 4ALJA 5E7MA 4ARZB 4O02B 4B46A 4Q0MA 4NJEA 4BFYA 4JYCA 1R0SA 3FUXA 2Q8PA 5F64A 2Z8YM 3TECE 2ZG6A 1DBIA 3LPMA 4HFNA 3W3AH 4W7IA 2F7SA 1P7YA 3U19A 1NF8A 5EQTA 4QPCA 1H2RS 5JNSA 1GVHA 2DC1A 2G3YA 5C32A 3EOBI 4CKCB 1WUKS 2RI1A 4KIWA 3JQ9C 1C3EA 1J07A 2WVGA 2XKBA 5EWMA 2IH2A 2MSNA 2CXNA 2Q4EA 3AESA 4R1PA 3T9BA 1LI4A 3MAGA 1P3DA 4M1SA 1XNRB 1WB6A 1WPQA 3JRWA 3BL5A 5KB3A 3WNQA 3FCCA 4N03A 1HOXA 3U37A 1Z7GA 2RH9B 5JCZA 2J33A 1U0BB 1C1XA 4CF4A 1EWQA 1FFDA 2ZBPA 3ACBA 4IG9A 4QARA 4RJLA 5BSTA 4MJ3A 3QHQA 3U3ZA 2FSIA 3VI4B 3WYCA 4EO4A 2BAGA 2NN3C 2WIBA 2EJTA 2YOGA 1NU6A 3B9PA 4NNOA 4ZOAA 5CX1A 1UZUA 2AYYA 2P3SA 3EUFA 4H0CA 1YRQA 4D9KA 2ZVJA 3A9WA 1FLDA 4Q6BA 3UHPA 4D45A 4HNSA 1E2HA 4KVZA 1RYNA 5CNIA 2FPIA 4L8FA 2HDNB 4QUGA 1IJEA 2DQKA 3CYFA 1JXAA 1R2QA 5A6SA 1LSUA 4S05A 1KEZA 4EVSA 4ZEVA 2GPTA 5INTA 1B8UA 2Q5FA 1N9ZA 1YBMA 3EW9A 3IDOA 1UKAA 1VDZA 3LS2A 1D1QA 1I3LA 1OLSA 4UD6A 2Q45A 3HNRA 3M5PA 4I50B 1Y7HA 4Q12A 3W0LB 2HA7A 2WMDA 3DF7A 1Z2PX 4ZICA 2AOXA 2N46A 4PC6A 1XZGA 1YRLA 3IILA 1KI9A 3ROFA 3PX2A 2PMBA 2G77B 4JYAB 2X5OA 1T3HA 1WR8A 3T5MA 2BM8A 2ZM5A 3RD5A 1ZEJA 2PGAA 4UHBA 4AYXA 4E2XA 4F4FA 3DV9A 4EYQA 1XCJA 1FSSA 3HRIA 3M3PA 3VPXA 2WG2A 3JRNA 1RSZA 1K4MA 1RE1A 4JNKA 5AESA 3SR0A 3D6NB 4P3YA 4BEWA 4FQ8A 3TTVA 4DSNA 5KVSA 3KELA 4KG7A 2NSJA 3M5DA 3PKJA 3MTDA 1U0EA 2V7VA 4KXVA 4FMCB 4CHTA 3A7DA 1L4FA 3DBLB 3O90A 3PFIA 3TRHA 3NI2A 5G1NA 4B3MB 2RKOA 4EG6A 5E9WA 2HA6A 3NBZC 4FD2A 3NFRA 4A10A 2LE0A 1ABBA 3VI3B 2Z6QA 2ZOSA 2D7CA 3WLPA 4BLWA 2BHSA 1JB1A 3RYFB 2XUJA 3NAGA 3ZHCA 3KPVA 2WSIA 1N5OX 3D6HA 4I6EA 2HPAA 3GAAA 5HW0A 1V7ZA 3IUYA 1CNFA 1T5SA 2QD3A 3EHEA 3KHTA 4I9HA 4J76A 4UVDA 5JAOA 5JATA 2P2DA 2OO5A 1GPNA 2O2YA 3D1VA 1O89A 1FVOA 4FLFA 4R40A 1WOYA 3K1ZA 5IVDA 3HA7A 3HSYA 3I6ZA 3IIMA 3O8QA 5A3JA 1DFGA 4MV4A 3QVOA 1E5XA 4XZ3A 4BTLA 3BQMB 1ORHA 3IYLW 5FTNA 3TVTA 3ER6A 2HHJA 3RODA 4MUYA 4I1YA 1GPLA 1UJCA 3OH8A 2PUVA 4PO1A 1VL0A 3LBAA 3V5NA 2QRLA 1Z25A 2Y0BA 3II6X 2VXCA 3M4YA 2FZKA 2ODEA 4LJ9A 4Z7NB 3SPXA 1JPUA 4I4TB 3ZOKA 3L7DA 2O3UA 3BD6A 4NEHB 2VR1A 1YZQA 3QMPA 5T41A 4UOZA 2ONKA 1BMFA 2JGFA 1YGPA 4MVJG 4BQEA 2H1RA 4M1KA 2V7BA 1CS4C 4QGFA 2JIOA 1V9CA 5KKAA 4XGRA 3F9IA 5J5CA 5K8TA 1SAYA 4TMYA 3FWHA 3S27A 4D74A 1MH1A 4HZIA 2WG1A 1ZMOA 5B3KA 1RWPA 1XRPA 3C3AA 4UFNA 2H1IA 1GKLA 2Q2NA 3C4QA 1U2EA 4JK3A 1LSJA 5AXDA 3ASZA 2W2LD 2JJ1D 3WGNA 5HPYB 1T6YA 1TVEA 3O75A 4R1QA 1M6HA 3V6MA 4QSHA 4IDFA 4IIFA 4YMGA 4AZ0A 4U9UA 3FFTA 2I6SA 3KKZA 1OASA 3P96A 1OH7A 3KALA 1NFQA 5C31A 3R8XA 3DTVB 1VMAA 2YWRA 3SYLA 2LGJA 2XKJE 2QPLA 1SM4A 1W4AA 3EVZA 1BX1A 6YASA 1D2CA 1PW7A 2WSYB 5BWLA 4P31A 4L57A 1JVNA 2JHFA 5D3ZA 2INGX 2PSDA 2CF5A 1X42A 2YHIA 2F48A 3C5HA 3EPLA 1P6UA 4BMNA 1UODA 2ZB8A 2CXQA 4RHCA 4BQRA 2IHZA 1VA5A 2XQVA 1W1WA 4HO1X 1OIXA 2B7BA 2RBGA 3TK1A 4W5WA 3W5VA 4A92A 3ZCUA 1RWWA 3I8OA 5JSQA 1SHLA 4O1MA 5P8WA 2FWBA 3P45A 3A4IA 5C4MA 1Q7CA 5EJGA 1OR8A 3BERA 3NGXA 2LDXA 5L3RA 1WZUA 2VA8A 1K2WA 4HVAA 3N07A 2KB0A 1NIPA 3I9KA 4PPYA 1JIQA 2Y9MB 4Y0NA 3TW4A 4A6XA 3E8SA 4WBNF 4FN4A 4MKXA 1AKMA 3FMIA 3IT3A 4IDHA 4TKVB 4KOAA 3SS7X 2PD3A 4G86A 4HYYA 3BMQA 3G6WA 4EI7A 4F0JA 2EXXA 1JU4A 3R8CA 1N0UA 2C7VA 2FR8A 4JY7A 3REQB 4W8HA 3ZIAD 4E5MA 2CBXA 3DZFA 4UMVA 1L4NA 5T8KA 2Q9BA 3AXTA 3RBZA 4ND8B 4BKOA 1UP6A 2P2GA 3RYIB 3ZTYA 4DTIA 2FGJA 3ZIUA 1JEEA 4WIAA 2BDEA 1RJFA 4F8EA 2N75A 2ZCVA 3ZU4A 3AJ9A 3OPMA 4Z6KA 4HAUA 4DCSA 3K0CC 4PHTA 1Z0AA 3PDIA 2B99A 3DP9A 1IVYA 5K03A 1VMEA 4PBRA 4FHFA 3ZGZA 2IZ1A 3QMMA 5CCEA 1E0KA 3V9PA 1ZXXA 2RJOA 1AGYA 1NBAA 4P0QB 3H9BA 2PGDA 3T15A 4A2WA 2H5IA 4MUMA 2GN4A 2PYDA 1Y6ZA 5FL7A 1E3TA 2PZGA 2QE7D 1OGJA 3BE6A 3QXHA 4E70A 2DHRA 1OA1A 2Q62A 2VBGA 2CLFB 1CE8A 3FZQA 5U9CA 2OD9A 1UBGA 2A30A 4E5PA 4KO1S 1HORA 4URFA 2O7NA 1IU9A 3Q3HA 3TTTA 3BGIA 4LPSA 3RKSA 5DYYA 1AV6A 4NHOA 3TZCA 1HETA 5ALYA 1J0XO 2GO1A 4NVRA 3PNBA 1K3UB 1T6ZA 2WV7A 4ZCIA 1P33A 3N86A 4M7OA 3W90A 1N5DA 4BO9A 4WXEA 4AKIA 9LDTA 5GJBA 3C6BA 2A3RA 1DRJA 2O2JA 1HDXA 2VHJA 2HXYA 3JQFA 3IDSA 1HTWA 2CL7X 4KUHA 5CJ2A 2JBHA 3CNLA 4JXXA 2P41A 3GFVA 2GXQA 3E81A 4UD2A 4PZZA 3IEMA 1EVLA 1R00A 3AI3A 1KERA 4G5OA 1IG0A 4UVIA 4J7AA 4LQ4A 4WLUA 2K7FA 2OD2A 1NI5A 3CVOA 1VJ0A 3BIWA 1WCYA 3IB6A 2GZSA 2VG8A 3E58A 1DIBA 4QPNA 4CM8A 1LZKA 5K09A 1QE5A 1Y3AA 1YQXA 4LDPA 5KMGA 1ZL2A 4ZT3A 1FZTA 4HDAA 4RPIA 4J3FA 2IYWA 3CLUD 3CVVA 4M6WB 2GASA 4CDRA 1U0GA 2WJJA 1NQAO 2FW8A 3K70D 3TSCA 1Q0LA 2FN7A 2OBMA 2B7CA 2XQIA 5KYYB 4GYYA 2Y3IA 5CFLA 2IYSA 2RIPA 4Q1AA 1R9JA 1YOBA 2UZ0A 5DWDA 2YWXA 3H0EA 4E4YA 3BWMA 3QWBA 3LWZA 1AQJA 3M1AA 2JBWA 2DWQA 4N01A 1B00A 2XIJA 3BE5A 3R7SA 2I4IA 3TMKA 4B3IA 4U7WA 5AKXA 4AT1A 2BRUA 1G6HA 2KQUA 4B71A 2ZJ4A 1PFGA 4URHA 3HCDA 1C0IA 1QUFA 1P0CA 1ACMA 3BXOA 2FN4A 4YT2A 3ZNNA 3L49A 3ZWPA 5MFZA 4O4HB 2YWCA 3MWLA 2DULA 3L79A 2RK4A 4FZRA 3UJCA 4KR7A 3K6KA 2X9GA 2UVPB 2Z3ZA 3Q72A 2I8LA 1U02A 3E27A 2VZ8A 1NNLA 3LZCA 3LPLA 4FOTA 4XD2A 5CUQA 1MX3A 4YCMA 2PE5A 3TLKA 3T7EA 4PBTA 4QXRA 2OCAA 4QO8A 1Z4MA 5IMBA 4OYHA 1UMBA 4YFVA 1SURA 3D31A 4ND3A 1B0PA 4Q4LA 4R51A 5HM8A 4YJHA 3K0AB 4EVQA 1AK2A 4OBXA 1Q7BA 2VRNA 1NBMA 3L9XA 5JXGA 1U2QA 2AQIA 1XKQA 3OMWA 3OU6A 1Y3HA 3QF4B 1X7HA 3O82A 1N25A 3PPIA 2CUTA 4MYUA 3N05A 4JKIA 1F4LA 1T8SA 1HUQA 4L51A 4BPBA 5K3AA 4WINA 4X9XA 2ZRAA 1G20A 3WFZA 3PIIA 4BDTA 3R6LA 1N77A 3UAWA 2PMKA 3C85A 5JCXA 2VHZA 1FMJA 2A5GA 5C1OA 3DKPA 3F1LA 3WRXC 4EPRA 4F45A 1XRMA 5IT9A 4RFVA 3AZOA 2BBSA 3QBDA 1Z6GA 4RK4A 5C18A 3A6GA 1KH2A 3DXYA 4H2DA 4ZVVA 3Q3CA 2OYCA 4HMQA 4R6XA 4UFOA 2HFJA 2F8TA 1Z08A 3HCAA 3MJEA 4JT8A 3N28A 4LZNA 4B2YA 4ZYLA 4DLWA 4NJEB 5TT0A 5A4IS 1XZKA 1X8XA 3U26A 4HDRA 4L4XA 4K46A 4N3BA 1IOLA 2O19A 1I2AA 3N74A 2MMGA 1G21A 4Z4EA 4UAJA 1I5EA 4UCFA 4GQAA 5JAZA 3FUTA 2HRCA 4Z5XA 2PX5A 1CY4A 3DL2A 1P7ZA 2P77A 4BFXA 4HVCA 4NBTA 2R6GA 1BS9A 1J49A 1M2FA 4ZVNA 4RDXA 2QZ9A 4FNMA 1YFJA 1U6KA 2G40A 1CZRA 1ML3A 2XMCA 4RHXA 5EHZA 1R88A 3FB1A 1VE3A 2VSQA 4XDHA 2PGIA 4OQMA 1ZUNA 1KEUA 5B4UA 1KDVA 3LLSA 1YCDA 2NNLD 3SZRA 3B6MA 2X9LA 2BMAA 4HKTA 4MQ6A 3VSEA 1QTIA 4X62B 1DKNA 1N8KA 1ORDA 1R8JA 1XYVA 3GT4A 3OPQA 1HLPA 3AINA 5BUCA 1C1XB 2YYAA 4JVMA 1TZCA 1E1LA 2WF8A 1P7CA 2IXDA 5DM4A 2ZSDA 1VBKA 3LP5A 1A7AA 1CX9B 3BXXA 4FJ0A 4MR9A 1ULAA 4KXYA 1G19A 2DRIA 1QGDA 1W581 1ZNZA 3I4FA 4M9XA 4ITRC 4IKPA 4F93B 1TKCA 4BQNA 5JANA 1KQNA 2P9EA 1K5PA 2AB0A 3AR9A 4ZDKA 3IAHA 2HNKA 4B47A 4PR0A 4F71A 2FPIB 4NESA 3DDWA 3R7AA 1NI3A 2IHTA 1NW6A 2HSJA 3M6FA 4XVQA 3WLJA 3HRKA 3QGMA 1KC3A 1HZZC 5A6SB 3FTNA 2PJRA 2IYPA 3GPIA 4WCFA 1TRHA 2CLIB 3NV9A 3O0TA 2LXNA 1E94E 1OLSB 3P9SA 4PONA 3I6BA 4HUQA 4MQLA 1B8VA 2FLWA 4IVPA 3G1TA 2X14A 3RFVA 3EX7C 5CLLA 2QTVA 2H2FA 1OFUX 1PK8A 3C6MA 4JIMA 4LJSA 3DVAA 4PHCA 2Q8QA 3WKEA 1A5TA 2P9FA 3UWKA 1SUBA 3GXBA 5MN4A 3WYAA 1PNOA 1QOZA 4RD4A 2D0OB 2I2BA 3GROA 4FFVA 1MX9A 2Q9AA 4K2AA 4C2UA 4MQ4A 1E2EA 4GGOA 3D2CA 1Y7TA 4GPZA 2VNSA 1K8XB 5GVRA 3HDTA 1E5LA 4FPXA 4LNHA 2QN9A 3HSKA 4S0XA 5FHRA 5HFNA 3JZDA 5BOSA 4KWIA 4JYZA 4B3XA 1MJGA 1Z8FA 3UGKA 3MHTA 4LV6A 1ZD5A 3RHZA 3E7DA 1ATZA 1DXQA 4QGAA 4B6SA 2JIBA 4RTKA 3CG4A 2YTZA 4NE9A 5DCLA 4AF6A 4ESVA 4UW9A 5GM2A 5ALGA 4L0QA 3I52A 2NZXA 5DNEA 5A7FA 2EHDA 4TQAA 5ESDA 3ZI4A 3I58A 1WUJS 2GMWA 3WP0A 3WWZA 3AHCA 3KXDA 3J7TA 4FDLA 1H1LA 3P5BA 1XA3A 2C8VA 4CMBA 3SY8A 1ZI9A 4CJXA 1NQOA 1CVRA 4LGYA 3FSGD 1D2NA 3HCEA 3LLMA 3ZC3A 5CD1A 2QPAA 2GPAA 3GLGE 1Q50A 3JYNA 3TF5A 1WD7A 4LECA 4OOFA 3O8QB 3WMXA 3B6KA 2RHHA 4M54A 4X97A 4IM7A 4EECA 2A1TR 1IRXA 2E87A 1GLGA 1QZXA 4FDVA 4KJZA 1P61B 3JATA 1FP6A 4Y6LA 1UDBA 2Q6IA 3AUSA 1QG4A 4MTCA 5ALVA 2V54A 4FFWA 4XH9B 4AZTA 2QG6A 3M9WA 4NH0A 3GH3A 4EEXA 1HNNA 1LQTA 4RTRA 3EFEA 5A3SA 4B3JA 5IAEA 4QL3A 4WE3A 4PX3A 4I1IA 4CFSA 1Z5ZA 1L7AA 4LSGA 1GZSA 1NLZA 3MOSA 3DT8A 3H13A 2D5AA 4R8MA 5LZ9A 4ZI2A 7ADHA 1EGHA 5I6DA 3A70A 3K32A 2PT9A 2HWKA 4E7PA 1E2UA 2XB2A 5HJ5A 5KTRA 1PEKE 4H08A 1JJAA 4CMIB 1M75A 5L95A 1PUJA 2O6LA 1U5CA 1LC0A 3RUIA 1WMEA 1ESZA 1I3CA 3SDBA 3D7MA 4I5GA 1AGPA 1B0UA 1EP9A 2I1WA 2MMCA 1I80A 2PMCA 2QVGA 3OFJA 4N5DA 2EFHB 3IBSA 3PHBE 3QXJA 3HKCA 4IS2A 4NPHA 3IAM1 4WOPA 2JVIA 2ZXUA 3DA8A 3I37X 3ULKA 4HN4B 4DZRA 1DX9A 4JU9A 1UK7A 4AZ0B 1CRZA 2ZIXA 4EBFA 2JL1A 2LRHA 1FVXA 3CR3C 4QG3A 1NNUA 3X1DA 3T3MB 1V47A 3TCXB 4DGSA 1GAXA 1TB4A 4NCHA 3HGQA 4UNQA 1F3OA 2OG1A 5FI0B 4IUBS 3KYJB 1L1FA 4YROA 1T6BY 2JFHA 1WDMA 4WXHA 4X5OA 4E11A 3QLUC 2YHIB 5CLQA 1SCNE 5CB6A 1NMXA 1ZHHA 3UKDA 5C52B 1FNBA 10MHA 5CYGA 2VEDA 2NG1A 3VBEA 3RG2A 2PWPA 1VCHA 3BWDD 5CVVA 5LKRA 1UQRA 2QX6A 3VR5D 3GUCA 1M2EA 4RTNA 2QR5A 3PXUA 5F7JA 3DTVD 3HYSA 3JPYA 4HJRA 1ZA2A 4ZEOA 4NQRA 3EFHA 3PWKA 2ZU0C 5CIYA 2TMGA 4CMAA 1FS5A 4WCDA 5AI5A 2FLKA 2OUIA 5JSKA 1HTBA 3EVDA 3LYLA 5T6BA 1U7XA 3RWMB 3JX9A 1JHQA 3GEIA 4XIJA 3QU5A 3PEFA 4YV0A 1ZLYA 1NE7A 4RGYA 1V5EA 2BEUA 4QTZA 3TIFA 3USCS 4EFNA 2FWNA 3IRUA 1N2IA 2FSGA 5BRNA 1T5DX 4CIBA 4XJTA 1LVHA 2JJ2D 1RM5A 3FWNA 3LWDA 3NHYA 3BCRA 4FHEA 4GM0A 3E6AA 5DX0A 1QQBA 2CY0A 3L01A 1DAPA 3E82A 4CI9A 4IZIA 2IV3A 1P39A 3GCGA 4HDMA 3BXFA 4FVTA 4U4AA 5A9RA 1F7VA 5IBQA 1U3CA 3PDIB 3SYNA 4WESA 4YHHB 4ENPA 1UJMA 1XQ6A 3TEJA 2DPYA 2YXNA 4UUAA 3TTUA 5B4VA 1K27A 1Q1AA 3HYCA 5I7EA 1YS6A 4D9CA 3MWEB 1F1JA 2AJTA 2NLOA 5AVTA 1WDLA 4CM7A 1RLUA 1HQCA 1QIFA 2DP4E 1ZUHA 1Z5OA 4GEGA 3O3CA 2GJKA 2HRQA 4JB0A 5FI5A 5BR4A 1Z75A 3HJHA 1WOMA 4LN1A 5CVEA 1K98A 2R6CA 2VDRB 2W8BA 1YQ9A 4KR0A 5EUQB 5FWDA 3R7FA 1NJ2A 1I13A 1VHTA 1ZD2P 2Q2VA 4PW0A 4A1FA 4MWSA 1DFIA 3ZWXA 2GK4A 4Q02A 2NXNA 2K4MA 2Y6VA 3C8HA 5CLGA 2CVPA 1GKUB 1G18A 1OLXA 2ZJ5A 3E2MA 4O4LF 2LCIA 3LPAA 4NMWA 4BMDA 4QXPA 5FTLA 1YUMA 4F46A 1E1RA 3ORRA 5DX8A 4EFKA 3CLRC 2B6NA 1EFPA 3L0IB 3RUHA 3ZPXA 4JI2B 2Z2ZA 4CT5A 4UCXA 2AIRA 4DCMA 1JHMA 1W1UA 1SKYB 3LQ4A 2YQ5A 3L8DA 2CNDA 5JV5A 4UTVA 3OVMA 4G2TA 1QHHA 1RLIA 4YJDA 5K2OA 4MV3A 2XVZA 2B94A 1U04A 3CEAA 4N7RA 4YJGA 2GN1A 1XZPA 3DOIA 4J94A 4ZQBA 3T41A 1CZLA 2XWBF 3VGPA 2IV2X 1IN4A 3JYOA 3VOBA 2JHPA 4L8LA 3G1UA 5FOVA 3O4VA 2XBUA 2V9PA 4IGEA 1BRTA 5JYDA 4UCQA 3Q5EA 4BX2A 4DNPA 1GQRA 5CHYA 4HN2A 5B55A 5BQ3A 1Z0KA 4QXAA 1NR1A 3TVYA 3TBKA 2ECOA 1EZZA 1A9YA 3MAJA 1NV9A 4Z53A 3T7AA 4YLYA 5F9HA 4NU0A 4CM8B 3B52X 4D3XA 5BN1A 1ODKA 2D54A 2Q1SA 3G2LA 3L0YA 2M6SA 2QTTA 3GQVA 4TKMA 2J4DA 3OOWA 1D7AA 1NN1A 1QMPA 1JMVA 2CDRA 3WSTA 4YRKA 1PJ8A 4WZAA 3F8TA 2AUNA 3A28A 3PYLA 2EP7A 4C4OA 3LRTA 4LBVA 2YINC 2WIJA 4HAWA 2ID9A 3CJTA 1CUAA 2WVAA 3EVAA 3JWJA 1Q77A 2QDKA 2ZWMA 5TMEA 4X3PA 4ZEMA 2D13A 5CVDA 4JVLA 1NVVQ 3I5XA 4V38A 1WDTA 2ZSKA 4A5SA 5HWSA 1FP1D 2QAGB 3W5SA 1KVQA 4LY3A 3K2QA 3ZXYA 2BKEA 4RD1A 4ARUA 2YMLA 1DUVG 3KR1A 1DEAA 1WX1A 2GK3A 1F2UA 3SU8A 1RKXA 1Z4IA 3K9QO 3PB3A 4RNCA 4UZSA 4XAQA 4DREA 2AG6A 2J32A 3I09A 3O26A 2VH2A 1JLHA 1NRIA 3D5TA 1AZSC 5A7HA 3WLSA 1QB7A 2H00A 3FLAA 1P5JA 3OJEA 5FBWB 2JDID 2XYGA 5AK0A 4OGGA 2DFDA 1UPUA 4WHMA 1GEEA 1VGVA 3G9ZA 3TR0A 1L0BA 3D3QA 1HMPA 2Q5LA 4LBWA 2ZZMA 4R05A 2CWWA 3PEYA 3BSYA 5TIIA 1UMBB 5TGDA 5DLPA 5EZYF 4JR1A 1EX9A 1VJDA 2GZ3A 3EG9A 4MI3A 4I5DA 4M3NA 2FR1A 2I3AA 1B3RA 1NRXA 1NXWA 3TB6A 4XJSA 4BVJA 1I94B 2C07A 1DAOA 1YB2A 2W8ZA 4OMFG 4DXAA 1IMJA 1UKBA 3PPVA 1RWQA 4NMXB 2YWHA 1NY5A 4B3TB 2QTBA 3HB4X 3AEKA 1ZNXA 3CX7A 3C3BA 3OLQA 2HCRA 1G20B 3JR7A 4QXMA 4Q4CA 1ZD3A 4GW3A 1P2SA 4EG8A 5IAAA 2O8EB 4CBVA 4RV9A 2ZBRA 3M3DA 4A6DA 5JPDA 3OPNA 5ETJA 3GJSA 1O58A 3PHCA 2QM8A 2VT7A 3SZMA 4EO9A 3S6JA 3ZWVA 4YDHB 1ZSVA 3HCRA 3W7AA 1W9MA 1FFBA 1N2CA 2FEOA 1IZYA 3T3DA 4QNNA 4AC9A 4BFZA 2C2GA 4W6ZA 3UBMA 5LQMA 1H5UA 1RXIA 1WKBA 4GI5A 1WQ3A 4W63A 2FKNA 1P4GA 3Q5GA 2P8JA 1RKQA 4P2BA 4YHBA 1HYQA 2H6EA 3VJKA 1L5OA 4R54A 3GNSA 3OF5A 4PLHA 1TYZA 1XAJA 2RBKA 2QZJA 3OLYA 4EAQA 1T2FA 1UF9A 1EMDA 1FX0A 2AN1A 2JIDA 2V7QA 2Y0DA 3D8HA 2XLCA 4QJBA 4D4MA 3TIIA 1JPVA 4R2MA 5KJ6A 1KIMA 2ODBA 4WKPA 2Q7DA 2YJNA 4ZXFA 3AUFA 1WCWA 4ICIA 1PGQA 1GU0A 4M46A 4BMVA 1SXJA 4FN5A 1NQUA 2YJ3A 2NZJA 3BB3A 4KJXA 2H08A 5CYPA 1K89A 4O33A 2Y2VA 4ZRMA 4AMBA 4G0WA 3WIOA 3LAWA 4I19A 3DLCA 3NIBA 4B6OA 2YV4A 4QHSA 1VLJA 2P6NA 1ISJA 2F1OA 1ZUNB 4GR9A 2E5LB 5KNCH 4MMYB 3ROQA 1Z35A 2P9CA 4ER5A 4HLNA 3G2IA 4S24A 4MKHA 4FLEA 2EFYA 3ADDA 3P0RA 5TJ9A 1A9TA 2RGNA 2G7ZA 3G2OA 4U9IS 5BSMA 2YQZA 3OJLA 1S7GA 4N49A 4C0AC 1K9SA 1HQDA 2EL9A 5JD5A 1NJ5A 5DHSA 4TLLB 4MR9B 4M1TA 2FF5A 4X1YA 4P0PB 2WK1A 1L6RA 2P4SA 1LJLA 4XUCA 3HKBA 3M2TA 4AS1A 1FYXA 3BF7A 4DLVA 5H8WA 1JFRA 3RC8A 3AIMA 4WNAA 2QQFA 3GN2A 2FWMX 5KNCD 5KNBH 2G9RA 4OQZA 2VPQA 4JMPA 4X61A 5LYJF 2D5IA 5CVJA 1CEQA 1XWWA 2GBLA 3PF9A 4R01A 3SF8A 4FP9A 3I92A 3FVQA 4WCFB 4BX0A 4FR5A 3RAGA 1X1CA 3HBLA 3FUCA 4NCJA 5B1HA 4O29A 3UMRA 1Y9EA 4LF8B 2P65A 4Z9XA 1JSZA 2CUNA 1P2GA 3ML1A 3WKAA 1SXQA 1O96A 4C9BA 2W6NA 1WEHA 4J29A 2G17A 2DWCA 1QM5A 3DVAB 5DT9A 1N8TA 1V8OA 2QN8A 3F9RA 3GFFA 3VH2A 5FA8A 2JH3A 1ZVQA 3EEYA 1G9XA 2RK3A 3ZEIA 5CEJA 2PUAA 1CF9A 4BKRA 2K2QB 1C9JA 3AJEA 1DJQA 1NOIA 1RWKA 3L5OA 3UJ6A 1LVUA 1NXXA 1KJZA 2XR1A 2XVAA 4I81A 1L5NA 1Q1NA 1WAMA 4W8OA 4Y6OA 3LUBA 5D3MA 3NDJA 5BOSB 5IC4A 4AZVA 1A97A 1UIMA 3DE4X 3B3AA 3E1GA 1KQGA 2MCFA 2FQ1A 5B2EA 2Q49A 2W0SA 2ZAIA 2VJAA 3AJAA 3BS4A 1OLOA 1TZKA 2JGMA 2Y0PA 2V59A 2P1DA 4N4AA 3T5PA 1G7SA 5FCDA 2RH5A 3CW2A 3SIRA 3LUKA 4QICA 2BH2A 4YCCA 1FL9A 4RMGA 1AXGA 1ZFNA 2O52A 3PXGA 1XB2A 3MCUA 3V3KA 5I8PA 4J0HA 4F97A 1J4AA 4GZ6A 2YWJA 3RK4A 1H1LB 5BR8B 3NG1A 3RJZA 3AUXA 2G5CA 5JH7F 4D57A 1KQFA 4ND4A 1ZQ1A 4TS9A 5CCDA 5I7HA 4J1TA 4WZBB 3N59A 3DE3X 3DOFA 3Q12A 1UIRA 2VZLA 3CRQA 1RZ3A 3P0EA 5EE9A 2B8TA 1QO9A 1RXVA 1G2QA 1XD9A 2O3SA 4MPRA 1FJXA 1PVOA 4IXWA 4DDMA 2R1UA 2IFTA 4EKGA 2BFWA 4E7OA 3AUAA 2XAUA 1JFVA 4XUEA 2O1EA 1F6DA 3JATB 2GTIA 5CDUA 2IYQA 2E4AA 2XNDA 1UP7A 2YVKA 2OGWA 4IF4A 3FNHA 4MGEA 4GMDA 3FHCB 3TCNA 3K4QA 3U1VA 4CNQA 5JNRA 1YB5A 2C4WA 2PMFA 3ZWDA 3RLIA 3TOXA 4D3DA 3HXMA 1U3FA 1ONBA 2FK8A 2QL5A 3VAYA 1GCOA 1O5IA 5BWBA 4TS1A 4MDYA 3SQOA 3URKA 3LXUX 4RACA 1WMBA 1QGAA 4BMSA 4CTOA 5M04A 4WK2B 3FXAA 1KAHA 3ECAA 3EY9A 3I2KA 5CNJA 1UINA 2X77A 5JJBA 1GXSA 2Q4OA 4YC7A 3OZIA 2WWYA 1J23A 3T9FA 1UPBA 5FADA 4EGAA 4OAOA 3QQPA 4ZVQA 2JHCA 3T9AA 4NS4A 2MYNA 4H7FA 3I9V6 3IXMA 5AVOA 1GD1O 1IHXA 2NWQA 2ZIXB 5HTKA 3MJCA 2BEWB 5HKOA 2ZEJA 3ZD6A 1VJCA 4IX1A 4E1VA 2Q9CA 4AP5A 3K05A 4BLQA 1GPYA 4BB9A 1YHNA 1RT9A 3CE6A 2XCQA 5HJ7A 3EPPA 4LVCA 1JWAB 4I55B 1KVUA 4BV9A 4NWIA 1Z7WA 3HABA 1L5VA 1MXFA 2M9MA 4K86A 5FR1A 4DMRA 3M2PA 1JTVA 5BV7A 4YWHA 4TN1A 2ZWAA 3HUTA 2CVFA 2PS1A 1C7EA 1EQUA 3EY4A 4XX1A 4WJKB 4PRZA 1ISMA 3KKOA 1GQOA 4IH9A 3R9IA 4DLLA 4ZV4A 5IKMA 5A3QA 1AQ6A 1EZ4A 3CLTC 4D5EA 5TVGA 1QFZA 2OFFA 3V1UA 1OYOA 5KBYA 1H4QA 2XV1A 2Y1WA 3CJQA 5E6SB 3CSDA 2OAQ1 3F6BX 2BEKA 1A69A 2WLSA 3U17A 1NLYA 1ZI8A 5K5EA 2CT8A 1C9DB 1G4HA 1MP0A 1R4ZA 3N1UA 4FHGA 1KOJA 1CHNA 4NJMA 4OPMA 1R6XA 5ALQA 1L7MA 2R25B 1SWWA 3UW3A 1U11A 4IICA 2JLVA 3EVCA 2QPOA 4KXMA 4LE2A 3VDMA 1A8PA 4UUBA 5KYXA 1LU9A 1Z33A 2QQ5A 2OZKA 1T3TA 3FGOA 2NSYA 2JPDA 1N0WA 3FH0A 2H9YA 3QVWA 4N6NA 4PPNA 1JJBA 4B8ZA 1JQJC 2P27A 2VT3A 3O74A 1KHHA 4B4UA 3KQPA 4BVHA 2Q41A 1ZD9A 3NYIA 5AO9A 3U6BA 2AFHE 4Y6SA 3WWOA 4X84A 1ZXLA 3TJZA 4UKDA 3WGIA 1KA9H 5CH5A 5JG7A 5EIEA 4KXXA 3EF0A 2PANA 1UANA 2V5UA 3IBGA 2VK2A 4G0QA 4PG4A 5I4KA 4UHKA 3CCBA 2RHBA 4TSKA 3KSMA 2AI1A 1NAIA 4GU5A 4RYDA 1N3YA 1SY7A 3RRMA 2CGEA 2ZRGA 2A67A 4EMSA 2ZYUX 1UXGA 1X7YA 3RR2A 1P1JA 5H3CA 3PUHA 1JE1A 1BX3A 1EX7A 2VOEA 3JZMA 3KOWA 3CB2A 3QJYA 4FHDA 4IDBA 1VJRA 2QV7A 3VR6H 4E31A 4PM4A 3X43A 4WNYA 2ICAA 3BWBA 1X8JA 3LL4A 4PZPA 1MN6A 4RVCA 4QUBA 2DHQA 2WWWA 4QG7A 4QDXA 4EB3A 4EWLA 4MROA 4C88A 3EGOA 5E1BA 2GD2A 1NMQA 2CD7A 4J90A 2JD2A 1R27A 5FL7D 3U3XA 2BFDA 3G8YA 5BW5A 1Z0ZA 1C8KA 3PNKA 4XRGA 2GZHA 5LU9A 1JFFA 2VXYA 3Q3JB 5JC8A 2EJVA 2KSQA 2NTVA 2MYTA 1HFKA 3SXJA 2Z30A 5B64A 4KNYA 1EDBA 1QHHB 3NO4A 1WA5A 4EPXA 3Q1KA 4D3SA 1OSNA 3DR3A 2B0JA 4F56A 4W7SA 2VJPA 3PJGA 2G4LA 3I0NA 3DV0B 2I7TA 5K6RA 1CVIA 1FRQA 3VR6D 3WA6A 1JHYA 2G5PA 1NQWA 1E2PA 2PS9A 2QP3A 2WU1A 4P4GA 1N6PA 1QRSA 5DPMA 2JI6A 5JASA 3ERCA 3IEVA 1Z37A 3OUTA 2I1LA 5AVVA 3HVRA 1H8ED 2RB5A 4I1UA 1JBKA 1F8UA 1FDVA 3C16C 3DDHA 3NLLA 2PS3A 1GZ7A 1JYEA 1D1PA 2G8LA 3VHQA 4B4KA 1ZW1A 4NIMA 4R98A 1KDRA 4WZAB 3WGQA 3M1LA 3Q3IA 2W22A 1DTWA 1XI2A 2PU5A 3AG5A 1A1VA 1I6MA 2YVLA 1P9NA 1ZJZA 2G0AA 2JFXA 2NACA 2W2KB 4JC8A 4C87A 2YIMA 3CZ5A 3KJIA 1KXZA 1P77A 1UZMA 5B4TA 1NU8A 3OPYI 2FWPA 4QXQA 1G3IA 4M49A 1XGKA 2IWRA 3K1YA 1N6HA 3WB0A 3PJRA 2V7XA 2YY6A 5EGNA 4DJJA 4RH1A 1Q3TA 3EYWA 3AF6A 3KTOA 4F4IA 2KLHA 1FJGB 1F2UB 1I2DA 3H4MA 3M4XA 5IM5A 2F9LA 3KZNA 1W73A 1RD4A 1OZFA 2HTFA 2Z5LA 4WOBA 5BXQC 4CEHA 1E1DA 4JL5A 1GGJA 4ZCTA 5KC9A 1ANKA 2F43A 4W5TA 2VS1A 3I30X 5L7WA 4FE7A 3UGJA 3HA2A 4M86A 3K9FC 3PS9A 1RHQA 2DFKB 4QBGB 4KTVE 1NJGA 2WD7A 2GEBA 3HL0A 3MGBA 2V55B 4I8DA 3UAGA 4AJNA 5BV2P 3DE6X 3L9WA 3TKAA 3RUCA 2B3TA 1YZHA 3EG9B 5AW9A 3PFFA 1Z38A 2B1IA 3RSOA 2P0YA 1UJ6A 1Z5VA 3UH0A 1B23P 2I55A 2QUIA 4G0OA 3GPBA 4RH3A 4R41A 1E6LA 2GQ0A 3MS4A 4RK5A 4NFYA 1U9CA 2OCIA 3AEKB 4K9MA 1SXIA 1R6AA 1M5UA 4Q4HB 2JKVA 3ZX4A 1QCCA 1OFHA 2WHRA 2NO6A 2I62A 4C4AA 3NB0A 3LNTA 4D97A 5JTUA 3NKLA 3WMFA 1Z0IA 4RF3A 3W8RA 4JI7B 5SY4A 4Y2HA 1I7LA 2JKZA 4JC4A 4KXLA 3I61A 4IIYA 4MRSA 4GSKA 1Y4AE 2R8EA 1N2CB 1N6IA 3LT2A 5E2BA 2RMKA 4CIWA 4JT4A 3ADCA 2WINI 1KS9A 1O8CA 1UBFA 2QXTA 1VPEA 1XMJA 3TKLA 3VKUA 4ZQGA 4EHHA 1ZJ4A 1IUOA 3CRNA 521PA 4GOOD 5PNTA 4ZZ3A 1VG8A 1EM8A 1SN7A 3QOFA 2IP4A 2JARA 3GY0A 3NHJA 5IDVA 4FTWA 3A1WA 4ZTUB 4FE3A 5LUAA 1RKUA 1CKEA 1QLHA 1IK4A 1MEEA 4QUHA 5GM1A 1BKSB 4BVLA 3WL7A 2XLBA 2A7QA 1DAFA 2G83A 2JCBA 2XZLA 4QU5A 3ZQKA 1NXQA 4AB1A 2DHCA 2Q1WA 3A1UA 3IDQA 4U6SA 3UK2A 1CJKC 1SXJB 5C4IA 2VYVA 2ZBQA 1IBKB 3L8CA 3RJTA 3JYQA 3N6RA 1WU8A 4RZIA 4Z49A 2AI3A 3DEAA 1N6LA 4BNNA 2R0QC 1MVOA 1DDGA 4MIKA 1Q17A 3CPEA 5K3FA 1KXJA 1GQYA 1DZIA 1ZGBA 4GEKA 3FBTA 4LJ7A 5GIPE 2V6JA 1Z5WA 3V1MA 3OCXA 4ZMBA 2REQB 2PX2A 5FA5A 5EJ4A 2XWSA 1TEZA 3DMGA 1GTRA 2O2SA 5K0BA 1LRKA 2HK7A 2O3QA 2X40A 1NHWA 3LW7A 3RC2A 1XR3A 3D5EA 4Q9HA 4ALLA 4C14A 5U4XA 4BXOA 2WP8J 5DO9A 3FSEA 1ONSA 1W94A 3RAEC 1S4MA 1SCDA 3AF1A 4TKUA 1YR1A 2OBXA 4NNJA 4RX1A 4ZAXA 5KU1A 3CH5A 3GRKA 1REQA 4X1YB 2CHUA 1OPXA 1DL5A 2NW6A 3OZTA 1SUEA 1QIIA 1OW3B 2QORA 3HKBB 4M8SA 4R9UC 4WZZA 5ARCA 3DLTA 4OSEA 3SOPA 3ZHOA 1Z45A 3ETCA 1TCCA 2VZ9A 3LYHA 4IZHA 4KE8A 4WNAB 3A1DA 1QVVA 4HWTA 5C5CA 4PSDA 3QEKA 2AOWA 2Y4OA 3OKAA 1EJ2A 4I2NA 5J40A 4AL4A 3D6TB 1ZCBA 3ELBA 4PGMA 1UWCA 2ILTA 3SF8B 2PUTA 4BYGA 1BC5A 3FZNA 4CIDA 4E3WA 3EIQA 4RSRA 4J6FA 4J16C 1GNVA 1R8QA 5LOVF 2JIRA 3LBNA 2GYVA 5FYQA 2CXPA 5KOYA 4FYXA 1Z36A 1XTSA 2WJ3A 4LF4B 4J0FA 3RW9A 1VLZA 2QMUA 3A4VA 3EGCA 1X7WB 2EZUA 4FX2A 3ZWAA 4Q7QA 3GLTA 2DQZA 3FDFA 4F4HA 1DTSA 2OXIA 4Z0HO 3CKMA 2OGUA 1ZR4A 1TQDA 1LXCA 1VG1A 4WK6A 1SD2A 2R79A 3X1ZA 5JMPA 1U3VA 3SJ7A 2X7HA 2IYLD 3I3OA 4FCCA 2QENA 1UJ2A 2RHRA 3IVMA 1RHUA 1FW8A 3FAKA 5D3MB 1DCTA 4G23A 1DIHA 2Z2IA 1KETA 4DWWA 1IB6A 1O6GA 3F7OA 3L93A 5CDSA 3GLIB 3UC9A 2J9ZB 4BMZA 4NK5A 1I7DA 3BOSA 1FRNA 4OHVA 4AWBA 4C1BA 4L07A 4X00A 1IAQA 3BCSA 1YRBA 2VF8A 4C3OB 1O94D 3INTA 1JMKC 1N2ZA 2GLXA 2ZUCA 4RJIA 3LTNC 3GUUA 5GGYA 3MQFA 2FB9A 3K3PA 3VR2D 1B41A 2VTDA 5L7YA 3M83A 5DYTA 4M7WA 5ILQA 3X1WA 5KIAA 1J5EB 1VKJA 1SBIA 1H6DA 2OAP1 3A26A 2IPOA 4F21A 5AK5A 2AZTA 3FMGA 4GGPA 3WLIA 3HI4A 2WT8A 3KAKA 3C14C 4MAAA 1GT6A 2XMZA 1X1TA 2UYGA 3MGKA 4OUDB 4LY9A 4O2RA 2AFIA 4R2WA 1T9BA 2BMWA 5LN1A 2EOAA 3ZNPA 4HYEA 2AXPA 5EPEA 2WE8A 4CIVA 4OLAA 2PR2A 3H87A 2WYOA 1NAHA 1PD1A 1FU4A 1YNOA 3U40A 3FYUC 2GBGA 4Y9SA 4C29A 4EG3A 1OIWA 1JR3D 3VU3A 2C20A 4IJUA 1Y1SA 2CVZA 4FYWA 4ZT5A 2C82A 2WHPA 2OLJA 4RXMA 3BK7A 3EF1A 3UPDA 1RHKA 1I5OA 1UBHS 4ZI3A 5EIWA 4GR5A 3QUTA 3R76A 2N0SA 3A9SA 3UJDA 4CUZA 1P29A 4JDPA 3K0CA 2FEXA 4OQFA 4ZN6A 3U44B 2A9FA 1P9RA 1PR5A 1VSTA 4MW1A 5EUCA 1XNHA 4I50F 3KKLA 3CO5A 1X9GA 1MCZA 1SCUA 1GARA 1ZMTA 3ESDA 3IHWA 1A88A 2Q3DA 3WVNA 5AD1A 1T2DA 4KFUA 4UVHA 1DDIA 3NWJA 4E08A 6ABPA 1GXSB 2WNSA 3MYYA 3K8QA 4TV9A 2O06A 3AHGA 5TLSA 2YZKA 3PVCA 2FVXA 3WGZA 3T1QA 5HUHA 3K4HA 4OHKA 4XWTA 1W59A 1OXXK 4LWOA 1TU0A 1XVUA 4F2GA 1AH2A 3ZCXA 2LR0A 2JLAA 4JYBA 1PK9A 3OO0A 1L7XA 1QRRA 3HP7A 3AMVA 5KDOA 5GONF 2C9YA 3ZLJA 1P2VA 3ZK9A 5IUKC 4I3FA 1SUIA 1U8YA 1AGNA 2PCJA 2Y1EA 3UWMA 4GLJA 2ENWA 3RVPA 4NMMA 4PX5A 3V8QA 3ZE6A 5DNCA 1R0BA 1JDBB 3R9KA 1X15A 5JNWA 1RAAA 4TLEA 5DH9A 1YL6A 1SQFA 4HYTA 4LJKA 1G16A 1XHLA 3D81A 3S7TA 1VQ1A 1R12A 1M2GA 1DCMA 3A9UA 3MUNA 3N6VA 5TRTA 4E4RA 1I8TA 2I87A 1BMTA 1VHLA 1DC5A 4WXRA 1N7IA 1MRNA 2IHNA 1U31A 1OI7A 1KSHA 1QX4A 2C4NA 2GHIA 4JDUA 5JCOA 3FOFC 3STTA 4EA8A 3JSXA 4PIVA 4YJ2A 1CHDA 2H3HA 2QX4A 2GJ9A 4NJMB 2Q6OA 3HJRA 3X0DA 2N1MA 5J2TF 3TZHA 2PNFA 1UMDA 1LSOA 1YJQA 1U2GC 2VJMA 2XUHA 4DCCA 1PQUA 4NEQA 1FYWA 1X6VA 2C4HA 1OYVA 1TGYA 4RZXA 3RGGA 4F4DA 1SC3A 4H3SA 1E0DA 4ZC1A 1P2FA 3UHJA 1WDWB 2NO7A 3EQZA 1FXSA 3AEXA 5BWNA 3ZY5A 1ZYUA 3DUWA 1L5GB 2DOKA 1E96A 5IASA 2Z8YA 1NKTA 1EG2A 1X8LA 3MMSA 4RY9A 3BXEA 4IINA 1R6VA 2HSGA 1HKHA 1D1TA 5L3SB 2M32A 5ALFA 5UKDA 5THKA 2BPOA 5M7EA 3EAGA 2GDZA 1PWHA 4L9SA 4LOKA 1AOXA 4BLSA 3HN7A 3MPUA 3HKEA 3HBJA 1J0DA 4OFXA 4BZPA 3UFXA 1NDUA 2C1XA 2FQYA 2UUOA 3THRA 1OFTA 5CNKA 5A0VA 3GLFB 4ZANA 4PSCA 5ANRB 1A2OA 1VI5A 4YRZA 1J6UA 3NOQA 4YYZA 2FGKA 2I2DA 4PBSA 3FPJA 1KYIA 2EZTA 4ZVLA 4EPWA 1I9GA 1AA6A 3A2MA 4R7GA 1JGTA 3H8SA 3KQVA 3GFOA 1TW3A 5K6TA 2RGEA 3DOOA 1KYZA 3D6FA 4WTOA 5C1DA 3LDFA 1CUFA 2QY9A 4Y2XA 1JFFB 2ZYTX 2VIIA 4IDGA 1ZWLA 1D8TA 2F64A 5A71A 5KTYA 3WNZA 1JLLA 1URPA 4ME6A 2FUG6 2QIPA 3GBSA 4TRMA 1M0TA 2XE6A 2X6TA 1D4OA 3HJGA 1Z4QA 1F5NA 3GNLA 4EF6A 1E1RD 4O8CA 4OKNA 1HL7A 4IGAA 4CM9D 5KPDA 1L2TA 1MX1A 2FAXA 3MEQA 2H9IA 3QPCA 3D7NA 1RWOA 2VP4A 4KDEA 3JTMA 3ZR4B 3LVFO 3IOYA 3UHOA 2NZ8A 1UXJA 3GD7A 1VTKA 4ES6A 2P5SA 1GFZA 4QM6A 4LXQA 3NR2A 4D8UA 4TT3A 3WRXA 2X58A 2HPHA 2Z2JA 4MKGA 3EHDA 4WY8A 1XTKA 2CL0X 2QM7A 4PIMA 2R8RA 1OV4A 1H66A 2DF8A 3WA7A 3CW8X 2C0QA 4AW9A 4PVCA 4RTSA 3WQQA 2O2HA 3WYFA 2OHJA 5EN4A 1DTWB 3N7TA 2ZWOA 2EX4A 5ALLA 3AY7A 4ZGBA 2QYHA 2NQTA 1KO4A 2PT7A 3DWIA 3GRZA 4MVJH 3TIXB 2J3IA 4JI5B 1ZAKA 2ZR9A 1TA9A 4L2IA 1E9SA 1IFXA 3IUQA 2IPMA 4LRYA 2Q3LA 4B6FA 4YX9A 5FF9A 1QH8A 1UBUS 2BTEA 3OHPA 2WV9A 2OK7A 1CS0A 1GRQA 2P6PA 4YAUA 4BNWA 5AW2A 5EINA 1HE8B 4W9NC 4KZKA 4X1OA 2IELA 4C6HA 1IBMB 4N7JA 2IPAB 2X0KA 3Q7IA 1ORTA 3EPRA 4CEHB 2RGWA 1OXSC 5LR6A 3HCPA 4X45A 4UVGA 1PR3A 3USES 4YRJA 1W4CA 2F43B 2P68A 2B0CA 1NSTA 1OOEA 5DSTA 4MVJD 1RI5A 3L8YA 4IIJB 4JJ6A 1NXVA 5FTJA 4F60A 4AROA 1EVZA 1YJ8A 4TTVA 3T1HB 2WD7B 4L7VA 2D5LA 3T1NA 3B78A 1RZUA 3ZDEA 3UT5B 1JNYA 2IIVA 5GTDA 4DNFA 1IIBA 1AIPA 2WIKA 3NASA 1UM9B 1E60A 1F8YA 4HMOA 4QBKA 3ABZA 2JGNA 3JPWA 4X41A 2OESA 2ZPAA 4DHWA 4ZDJA 1FTNA 1MOZA 1ENYA 1EAYA 2VRWA 1NXSA 4BN4A 1T1SA 3BZUA 2RD2A 4HL6A 3KT3A 3NWBA 4KE9A 1JYFA 4KU4A 4PNEA 1O0CA 1KI3A 4LXXA 2I76A 5F1PA 1EUYA 3SSMA 2NP6A 1HZZA 3AR2A 3M6VA 3LUJA 4H3KB 3KV1A 1NA5A 1N3LA 2UZ1A 3VKVA 2Q27A 5HGXA 1CBUA 5BMOA 5KNLA 1I33A 1WZCA 2DY1A 2HX1A 2V7EA 3G9QA 4FDAA 4YNBA 2R5WA 3TZLA 4GZ3A 3FOCA 1U0RA 2BCGY 1LTKA 3E9EA 2X3UA 1UAAA 4KODA 4JI0B 4N40A 3C4JA 2LVBA 1QVAA 2YQ4A 3BG5A 2M6RA 5AKZA 1SXPA 1E9EA 3ZHZA 4B9EA 5M29A 4D4JA 3L6RA 2O1WA 5AJYA 1JQBA 2ID4A 2R8YA 3AEQB 3NIWA 3NTQA 3QVGA 1RDFA 1H05A 1M6VA 2IYOA 3COYA 3K4PA 3ZWWA 4RIEA 5HXAA 1G2PA 4NMHA 1RACA 4LIPD 1Y1KE 2NZ2A 4E1BA 3EXHC 3GJ5A 2ZIAA 5BW8A 2JFQA 4I9UA 4TL6A 1JX6A 2PBLA 4FUQA 3TI9A 2GVZC 3IQXA 4D98A 1DWOA 5MDHA 4K81B 4O59O 5FTMA 1M2OA 1NW3A 3V2HA 4CR7A 4EHDA 1GGNA 1OTHA 1QE3A 5I7OA 5K3FB 1G2IA 2F4VB 1QU3A 4O4HF 1RZRD 5A9TA 3TAHA 3PXBA 1TQ2A 5ELLA 1N57A 2NSLA 3MFQA 3SKYA 5FI1B 2XT0A 5E7JA 1M2KA 1QZUA 2CFOA 2J5RA 3AERA 4FW8A 1KH3A 1NR7A 1PG0A 1SXJD 2HLHA 3LBFA 5TJHA 5EUMA 1IM8A 4DZTA 4F5WA 3AFHA 2P2SA 3B1JA 2GCEA 4TKUB 3DP7A 4BUZA 4MJXA 2QMOA 5HHTA 5IZCC 1YK1A 4URUR 3EUWA 1VKHA 1Z34A 4WKOA 3UGTA 2PY6A 4BLUA 1BYIA 2Y9PB 5A4AA 3BTOA 3WXBA 3LKVA 4L5JA 3S5UA 3KQWA 2A78A 4UPEA 1EVKA 3I64A 1SUAA 1DIOB 2PSJA 2H4ZA 4CMHA 3WGJA 1HM5A 4LXHA 2V3CC 3IV7A 4KUGA 2GRUA 5ALDA 1Y1PA 4ZOBA 3VPGA 3NBQA 2B4KA 2X3FA 4FGKA 1U1IA 2ZAMA 3AU8A 3S2EA 1LWNA 5L6LB 4NBRA 2XWQA 2IZ5A 4W9RA 5BURA 4CEJA 3SXUA 1MEJA 3RSQA 5EJ7A 4R68A 1Z28A 2OQ2A 2COKA 5IJ9B 2HL6A 2LCFA 3RS2A 3HK2A 4TZ6A 2PKCA 3MILA 2J9FA 1AT1A 5FJIA 1QRUA 3U4CA 2YV1A 3DLIA 1XF1A 4PHHA 4R8KA 1TADA 5TV2A 4YAIA 3N8GA 4F04A 5JJKA 1MABB 2Z9BA 2JB9A 5FP0A 1I01A 5FUVA 3FHOA 2H07A 3HZOA 1GYPA 1Z3IX 3P32A 1NG9A 3CE9A 1ND6A 1YKFA 3OZFA 1B74A 2ZTLA 4OL0A 1G1MA 1ECJA 2QG4A 3LLVA 1J33A 4HS9A 2Q5OA 1U7WA 3WDKA 4JNCA 2Q6VA 1AU9A 5IKEA 1PWXA 2X9QA 4QUIA 2PRZA 5FRDA 4XIIA 3IP7A 2WTEA 3ORSA 3BYZA 5EKDA 4EPYA 3ZXIA 3W5UA 3N39C 1D2MA 1GZ4A 1PE0A 4EA6A 5KVQA 5TF4A 2FW1A 3NDIA 1H1DA 1L8LA 3P9ZA 4OG2A 3UXEA 1GN9A 1IC6A 1U5AA 3OM0A 4W5JA 3C1OA 1XPJA 5IDQA 3DNPA 5KX5A 3THWA 3DONA 3IIKA 1MZVA 4HDNA 3ELUA 2GHQA 3QW4B 2W70A 3PT9A 3FUVA 3ZGOA 4UU7A 4J1QA 1TIBA 4TGLA 4YQFA 1F51E 1TKBA 1ZINA 3QI2A 2BDTA 3A6PC 2ZAYA 1JVSA 2C2YA 3GRUA 4OU5A 3U62A 2XVMA 2EJBA 2B92A 5ICMA 2ZBEA 2YWFA 1DV1A 3W4IA 4ROTA 3ZHRA 4GI1A 2RGAA 2I2CA 4F2HA 3FETA 3SVTA 4XWWA 1M2WA 1PJSA 2AFIB 2G1AA 2XSZD 5AM5A 2W42A 1A50B 3UJ9A 5REQA 1RQNA 5JDIC 4WD3A 3GJZA 1RAIA 1DQNA 1ZD4A 1JAXA 2OHOA 1V0JA 2QTMA 1CR6A 1LPSA 3OX3A 1NNI1 2JH9A 4IF6A 1JUDA 2EX0A 1OKKA 3FPSA 1V5IA 1DQPA 2OPBA 1N1DA 3FIJA 3LJKA 1HSOA 3PXAA 3CINA 5ED0A 3OCUA 1TKRA 4O4JA 2D7JA 2OCLA 1QGUB 3E9NA 1DMSA 4MULA 1SIUA 5D6OA 3GGPA 5LZ5A 2C03A 2HF7A 5ALSA 2PUDA 2YN0A 3PP8A 1O8BA 1X9HA 4IKOA 4MPJA 3UMMA 1X1RA 4HQKA 3CG0A 2B35A 3GZNA 1LLQA 3G7NA 4MZXA 5AHRA 1YI8A 4DXDA 2GH1A 1SCUB 2BEVA 3ICCA 3KSRA 3D8SA 4P7GA 4RK7A 1XDBA 3STHA 5JI2E 5C7OO 1WW3A 4PC7A 1MTZA 3PF8A 2XNDD 5DHTA 4DJTA 1KY5A 1WBBA 3WV5A 3DZCA 4DDKA 4ABTA 2JIZA 4G26A 3BKXA 1SEVA 3ETJA 3Q6MA 4WK0B 2F3UA 4KRYA 5CEEA 3KXIA 1JN0A 2O57A 3EA5A 3OLVA 4R1UA 3RH0A 1LUAA 4AKGA 1GQQA 1Z0JA 4EB6B 5C1BA 3QXXA 2XMDA 2WSBA 4E21A 2FPSA 3DCJA 2NYAA 2FMXA 5LZ8A 3AJRA 4FS3A 4BP8A 1U90A 4WX2B 1TZBA 4KLAA 1SC4A 4MVYA 4MQFA 4XSVA 1LWOA 3SHOA 3ISTA 5EE3A 2PBFA 2H59A 5KI6A 1JIVA 4DV2B 4AVYA 4BVBA 1ND5A 1ZGCA 5JZBA 2OV3A 3H1PA 3IHTA 3N8DA 4ZT7A 2MT9A 1F2TA 3BFPA 2AOUB 1PZEA 2GM4A 4KV9A 3HVJA 4L5BA 3CLUC 3S2UA 1C2TA 5C0OE 5AKKA 4PZEA 3HU1A 3K70C 3AFNA 1EVJA 1RMTA 5A0TA 8MHTA 2ZUDA 4FD3A 1G3RA 4QFDA 1Q3KA 5AOBA 4A6EA 4AQDA 1QONA 3DMTA 4HGYA 2EFEB 4YJ2B 3TDNA 2VDPB 5ICEA 4INZA 2PRSA 1SG6A 5TC4A 2OBBA 2B6HA 3HRHA 3NXSA 4D9HA 2ZTSA 4IWNA 1L7DA 3EUAA 4QU9A 1ZLXA 3Q85A 1C3VA 4YH1A 4LZLA 4ZP1A 1UMDB 3B13B 3DVQX 3R6WA 2VJMB 2WSMA 5HEKA 4EYSA 5HIKA 2R6ZA 1TA0A 4NCAA 2R6JA 3A3YA 3FI9A 4LPKA 1VHJA 4JROA 2V74B 3DHEA 4JT9A 3MC1A 3H3XA 3QNUA 3R6TA 1ABFA 3O2JA 3GGOA 3SGLA 1UC4B 5L3ZA 1BS2A 4E22A 4D3ZA 1M6YA 3TRDA 4NE7A 4ZDWA 1Y89A 1VLLA 2G70A 1C7ZA 1K6IA 4Q9DA 2ID8A 3TRKA 3S1SA 3RTEA 5JQGF 5EIAA 1Q1EA 3IELA 3QSGA 2W6ID 1E2DA 1EAMA 1A04A 4BRWA 2B1JA 3ZBUA 2ZUEA 3UFXB 2YR0A 4ZOLA 4HB4A 4DM7A 4CQLA 1W8IA 4V39A 4FGZA 1B0AA 2VJLA 4G89A 1F1BA 1NDQA 3UQYS 3IQIX 1X39A 1VCMA 2C3UA 1EZ1A 4Q3KA 4ER0A 2DLCX 3ZJ4A 3QKRB 3R9WA 1RTKA 1DHTA 1KP3A 2VDWB 1EP2B 5SY9A 2FUNB 4Q9IA 5HBRA 3G68A 3MPOA 2ZSJA 1EFVA 2WQ7A 1THZA 4ZQIA 1L4BA 3LGXA 2HCFA 3F73A 4P7JA 1OGYA 4JI8B 3F6PA 5TR9A 4YMUA 3FWKA 1MORA 1JLLB 1SKBA 4KQGA 2LDBA 3VPAA 4B4OA 3KNZA 3NVAA 1S8AA 5BSUA 2XWJI 3E18A 1ATIA 2E4XA 2FR0A 2Q3HA 2QX7A 1T5BA 3L4EA 3OM8A 3IQFA 3L18A 4BNLA 5K8JB 4ALKA 3BZBA 2VWGA 4PQFA 2UAGA 2O2ZA 1BQ4A 1N0HA 4G63A 2J4FA 2W2XA 3DEFA 3DLPX 3QUCA 5TF0A 4UM9D 3IUBA 2JFPA 4V0NA 2P0EA 5E4TA 2BJHA 2ODPA 1O9HA 4MPTA 2JRCA 3KUDA 4EVIA 3F98A 4XKJA 1NSFA 4DLUA 3AR5A 1IEQA 4RMJA 1Y42X 1TF7A 2H1CA 4HBZA 2I67A 2AV6A 3ZJTA 5JYEA 3D6UA 2BGTA 3G23A 3RWOA 1XLUA 3K94A 4G1MB 3RVSA 4WMLA 3VHXB 3BWYA 2EBFX 2WZQA 4F3NA 1Q19A 1W85B 1TAQA 3NS7A 2N42A 2JI8A 2LWIA 3K1TA 2A1UB 3E22A 3FZGA 1GL7A 4C2AA 1WPGA 1FPQA 1QH8B 3PK0A 3MUFA 1JECA 1CS0B 2WQZA 3EQ6A 3F4BA 4O1IA 5LA6A 4REMA 3EC7A 2VWQA 2AH5A 3ORHA 2IIPA 1GZVA 3AUYA 3ICWA 3SBDA 3ZDRA 4BZQA 4DA7A 4KPEC 4PLCA 3BXZA 3AVYA 1J56A 3EEOA 1VB5A 4ZV7A 3N5CA 3SQWA 3TQRA 2HMUA 1NASA 4UBNA 1U7HA 1E1QA 5AOCA 3LXXA 1JLKA 3HEBA 2DFPA 2D5CA 1KRHA 5TY0A 1N2OA 2GHRA 2PWYA 4B4VA 1YULA 4J4BA