4HGUA

Crystal structure of galleria mellonella silk protease inhibitor 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
40
structure length
40
Chain Sequence
EAAVCTTEWDPVCGKDGKTYSNLCWLNEAGVGLDHEGECL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Silk protease inhibitor 2
publication title Atomic resolution structure of a protein prepared by non-enzymatic His-tag removal. Crystallographic and NMR study of GmSPI-2 inhibitor.
pubmed doi rcsb
source organism Galleria mellonella
molecule tags Hydrolase inhibitor
total genus 8
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4hguA00
1Z7KB 1Y1BA 1PCEA 1HJAI 2GKTI 1TGSI 3TJQA 2JZMA 1CE3A 2F3CI 3SEKC 1MT1A 1CHOI 5DAEA 1YU6C 1CSOI 1PJUA 4GI3C 1OYVI 1UVFA 1IY5A 1M8BA 1SGEI 1DS3I 1UUCA 2P6AC 2M5XA 1CT0I 2NU2I 2ERWA 1LR9A 1TUSA 4OVOA 1Y1CA 2GKVA 1OVOA 2QQDA 2ARPF 1H0ZA 2NU0I 1TIHA 2N52A 2B0UC 2GKRI 2JXDA 1CT2I 1FYBA 1NUBA 2N71A 3SGQI 1KMAA 2NU3I 3QTLD 3SGBI 2SGFI 2SGEI 1BUSA 2SGPI 2NU1I 1AN1I 2WCYA 2OVOA 1R0RI 1TBQR 1IW4A 2KMQA 1CGII 1TBRR 3OVOA 1SGQI 1SGYI 1LR7A 2XRCA 1SGRI 1SGNI 3HH2C 2SGDI 5JHWC 1TURA 1LR8A 2KMOA 2V53A 1UVGA 1SGPI 1OMUA 3B4VC 2SGQI 4HGUA 1HPTA 2N17A 1N13A 4SGBI 2LEOA 1BMOA 1YTPA 2KCXA 2KMRA 2QQCA 2BUSA 1HDLA 2KMPA 1OMTA 1CGJI 1PPFI 2NU4I 1IY6A 2JYYA 1SGDI 1CT4I 1M8CA 1DS2I
chains in the Genus database with same CATH superfamily
1TOTA 1Z7KB 2W0TA 1Y1BA 2LUYA 2CJSC 3TOBA 1PCEA 1PTQA 2V1CA 2RC4A 1HJAI 3TO9A 2GKTI 7WGAA 1TGSI 2DIPA 2CWFA 3VE5A 3R5DA 5FUXA 3FSXA 3TJQA 4E1RA 2A20A 2JZMA 1CE3A 2F3CI 1P9GA 2Y0MA 2VRWB 5J8CA 3SEKC 1KBFA 1MT1A 1CHOI 1V1IA 1WTJA 1XBTA 4FKDA 1YU6C 5DAEA 2ODDA 1CSOI 2N1AB 5HI7A 1PJUA 4GI3C 2YUUA 5E3RA 1ULNA 1OYVI 1UVFA 2DB6A 1IY5A 1M8BA 1SGEI 1DS3I 1UUCA 2P6AC 1K7VA 2PQ8A 2M5XA 1CT0I 2NU2I 2ERWA 2QPOA 3UGLA 2DKVA 1LR9A 1TUSA 5EX3A 3FC3A 1Z2IA 4OVOA 1MJAA 1K7UA 1Y1CA 9WGAA 3GOXA 2GKVA 1OVOA 1NXUA 1TBOA 2ENNA 2QQDA 1XX6A 5FUWA 1R79A 2ARPF 3CXLA 1Y8FA 3E59A 3OL0A 4UXJA 2OZUA 3UGDA 1H0ZA 1WGCA 1VDDA 1RFHA 2NU0I 1TIHA 4AMLA 2N52A 1FARA 2CWHA 2GVIA 2B0UC 2K9HA 2GKRI 2JXDA 3OXGA 1CT2I 4L9MA 5E3PA 1HEVA 1FYBA 1Q9BA 3TOAA 3D00A 3UOEA 1NUBA 1TBNA 1ULKA 5FUVA 3R5AA 2N71A 3SGQI 4DNCA 4UXIA 1W4RA 3MEKA 5CCMA 5J8FA 3FSYA 3UFFA 2WVJA 1K7TA 2UZ3A 1KMAA 2NU3I 3QTLD 1V1HA 2ENZA 3SGBI 2SGFI 2ORVA 2SGEI 1BUSA 4A24A 2X3TA 5EX0A 1PTRA 1WGTA 2SGPI 2B8TA 2NU1I 1AN1I 4UXHA 2WCYA 2OVOA 3UEJA 1R0RI 1TBQR 1IW4A 1XA6A 2KMQA 1CGII 2OD1A 1TBRR 3OVOA 1SGQI 2QQ0A 2UVOA 3KY9A 3BJIA 1SGYI 1LR7A 1KBEA 3OXFA 2QQEA 1WKXA 1ULMA 3QAHA 2XRCA 2YQPA 1SGRI 4JCVE 2J9RA 1SGNI 5CCLA 3HH2C 2SGDI 3R5CA 2E73A 5E3QA 3UGIA 2ROWA 5JHWC 1TURA 2RIJA 3VDPA 1MJBA 3TO6A 5HQ8A 3UEYA 1LR8A 3PDNA 2KMOA 2V53A 1UVGA 2GIVA 2ORWA 3RU0A 1FY7A 1SGPI 2WGCA 1U5KA 1OMUA 3B4VC 2E5RA 2SGQI 1HPTA 2JW6A 2L8EA 2LB7A 1N13A 2CWGA 2LEOA 2N17A 4HGUA 4SGBI 1BMOA 1W3SA 4B6DA 1YTPA 2FNFX 2X52A 3TO7A 2KCXA 2KMRA 1FAQA 1P9ZA 1X74A 2ELIA 2L7XA 2QQCA 2BUSA 3R5BA 1HDLA 2KMPA 1OMTA 1CGJI 1PPFI 3E2IA 3OXLA 4MPIA 2NU4I 2J87A 1X4SA 5FUYA 1S20A 2JA1A 1IY6A 2OU2A 2JYYA 3QWPA 2V1CC 3VDUA 1SGDI 1CT4I 1UHAA 4E1PA 1M8CA 1DS2I 4WP4A 1MJ9A
chains in the Genus database with same CATH topology
1TOTA 1Z7KB 2W0TA 1Y1BA 2LUYA 2CJSC 1PCEA 1PTQA 2V1CA 1HJAI 2GKTI 1TGSI 2DIPA 3VE5A 5FUXA 4E1RA 3TJQA 2A20A 2JZMA 1CE3A 2F3CI 2VRWB 3SEKC 1KBFA 1MT1A 1CHOI 1V1IA 1XBTA 4FKDA 5DAEA 1YU6C 2ODDA 1CSOI 2N1AB 5HI7A 1PJUA 4GI3C 2YUUA 1OYVI 1UVFA 2DB6A 1IY5A 1M8BA 1SGEI 1DS3I 1UUCA 2P6AC 3UGLA 2M5XA 1CT0I 2NU2I 2ERWA 2QPOA 1LR9A 1TUSA 5EX3A 3FC3A 4OVOA 3GOXA 1Y1CA 2GKVA 1OVOA 1TBOA 2ENNA 2QQDA 1XX6A 5FUWA 1R79A 2ARPF 3CXLA 1Y8FA 3E59A 3OL0A 4UXJA 3UGDA 1H0ZA 1VDDA 1RFHA 2NU0I 1TIHA 2N52A 1FARA 2GVIA 2B0UC 2K9HA 2GKRI 2JXDA 3OXGA 1CT2I 4L9MA 1FYBA 3D00A 1NUBA 1TBNA 5FUVA 2N71A 3SGQI 4UXIA 1W4RA 3MEKA 5CCMA 3UFFA 2WVJA 2UZ3A 1KMAA 2NU3I 3QTLD 1V1HA 2ENZA 3SGBI 2SGFI 2ORVA 2SGEI 1BUSA 4A24A 5EX0A 1PTRA 2SGPI 2B8TA 2NU1I 1AN1I 4UXHA 2WCYA 2OVOA 3UEJA 1R0RI 1TBQR 1IW4A 1XA6A 2KMQA 1CGII 2OD1A 1TBRR 3OVOA 1SGQI 2QQ0A 3KY9A 3BJIA 1SGYI 1LR7A 1KBEA 3OXFA 2QQEA 2XRCA 2YQPA 1SGRI 4JCVE 2J9RA 1SGNI 5CCLA 3HH2C 2SGDI 2E73A 3UGIA 2ROWA 5JHWC 1TURA 3VDPA 5HQ8A 3UEYA 1LR8A 3PDNA 2KMOA 2V53A 1UVGA 2ORWA 3RU0A 1SGPI 1U5KA 1OMUA 3B4VC 2E5RA 2SGQI 1HPTA 2JW6A 2L8EA 2N17A 1N13A 4HGUA 2LEOA 4SGBI 1BMOA 4B6DA 1YTPA 2FNFX 2KCXA 2KMRA 1FAQA 1X74A 2ELIA 2L7XA 2QQCA 2BUSA 1HDLA 2KMPA 1OMTA 1CGJI 1PPFI 3E2IA 3OXLA 2NU4I 2J87A 1X4SA 5FUYA 2JA1A 1IY6A 2JYYA 3QWPA 2V1CC 3VDUA 1SGDI 1CT4I 1W3SA 4E1PA 1M8CA 1DS2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7K B;  1Y1B A;  1PCE A;  1HJA I;  2GKT I;  1TGS I;  3TJQ A;  2JZM A;  1CE3 A;  2F3C I;  3SEK C;  1MT1 A;  1CHO I;  5DAE A;  1YU6 C;  1CSO I;  1PJU A;  4GI3 C;  1OYV I;  1UVF A;  1IY5 A;  1M8B A;  1SGE I;  1DS3 I;  1UUC A;  2P6A C;  2M5X A;  1CT0 I;  2NU2 I;  2ERW A;  1LR9 A;  1TUS A;  4OVO A;  1Y1C A;  2GKV A;  1OVO A;  2QQD A;  2ARP F;  1H0Z A;  2NU0 I;  1TIH A;  2N52 A;  2B0U C;  2GKR I;  2JXD A;  1CT2 I;  1FYB A;  1NUB A;  2N71 A;  3SGQ I;  1KMA A;  2NU3 I;  3QTL D;  3SGB I;  2SGF I;  2SGE I;  1BUS A;  2SGP I;  2NU1 I;  1AN1 I;  2WCY A;  2OVO A;  1R0R I;  1TBQ R;  1IW4 A;  2KMQ A;  1CGI I;  1TBR R;  3OVO A;  1SGQ I;  1SGY I;  1LR7 A;  2XRC A;  1SGR I;  1SGN I;  3HH2 C;  2SGD I;  5JHW C;  1TUR A;  1LR8 A;  2KMO A;  2V53 A;  1UVG A;  1SGP I;  1OMU A;  3B4V C;  2SGQ I;  4HGU A;  1HPT A;  2N17 A;  1N13 A;  4SGB I;  2LEO A;  1BMO A;  1YTP A;  2KCX A;  2KMR A;  2QQC A;  2BUS A;  1HDL A;  2KMP A;  1OMT A;  1CGJ I;  1PPF I;  2NU4 I;  1IY6 A;  2JYY A;  1SGD I;  1CT4 I;  1M8C A;  1DS2 I; 
#chains in the Genus database with same CATH topology
 1TOT A;  1Z7K B;  2W0T A;  1Y1B A;  2LUY A;  2CJS C;  3TOB A;  1PCE A;  1PTQ A;  2V1C A;  2RC4 A;  1HJA I;  3TO9 A;  2GKT I;  7WGA A;  1TGS I;  2DIP A;  2CWF A;  3VE5 A;  3R5D A;  5FUX A;  3FSX A;  3TJQ A;  4E1R A;  2A20 A;  2JZM A;  1CE3 A;  2F3C I;  1P9G A;  2Y0M A;  2VRW B;  5J8C A;  3SEK C;  1KBF A;  1MT1 A;  1CHO I;  1V1I A;  1WTJ A;  1XBT A;  4FKD A;  1YU6 C;  5DAE A;  2ODD A;  1CSO I;  2N1A B;  5HI7 A;  1PJU A;  4GI3 C;  2YUU A;  5E3R A;  1ULN A;  1OYV I;  1UVF A;  2DB6 A;  1IY5 A;  1M8B A;  1SGE I;  1DS3 I;  1UUC A;  2P6A C;  1K7V A;  2PQ8 A;  2M5X A;  1CT0 I;  2NU2 I;  2ERW A;  2QPO A;  3UGL A;  2DKV A;  1LR9 A;  1TUS A;  5EX3 A;  3FC3 A;  1Z2I A;  4OVO A;  1MJA A;  1K7U A;  1Y1C A;  9WGA A;  3GOX A;  2GKV A;  1OVO A;  1NXU A;  1TBO A;  2ENN A;  2QQD A;  1XX6 A;  5FUW A;  1R79 A;  2ARP F;  3CXL A;  1Y8F A;  3E59 A;  3OL0 A;  4UXJ A;  2OZU A;  3UGD A;  1H0Z A;  1WGC A;  1VDD A;  1RFH A;  2NU0 I;  1TIH A;  4AML A;  2N52 A;  1FAR A;  2CWH A;  2GVI A;  2B0U C;  2K9H A;  2GKR I;  2JXD A;  3OXG A;  1CT2 I;  4L9M A;  5E3P A;  1HEV A;  1FYB A;  1Q9B A;  3TOA A;  3D00 A;  3UOE A;  1NUB A;  1TBN A;  1ULK A;  5FUV A;  3R5A A;  2N71 A;  3SGQ I;  4DNC A;  4UXI A;  1W4R A;  3MEK A;  5CCM A;  5J8F A;  3FSY A;  3UFF A;  2WVJ A;  1K7T A;  2UZ3 A;  1KMA A;  2NU3 I;  3QTL D;  1V1H A;  2ENZ A;  3SGB I;  2SGF I;  2ORV A;  2SGE I;  1BUS A;  4A24 A;  2X3T A;  5EX0 A;  1PTR A;  1WGT A;  2SGP I;  2B8T A;  2NU1 I;  1AN1 I;  4UXH A;  2WCY A;  2OVO A;  3UEJ A;  1R0R I;  1TBQ R;  1IW4 A;  1XA6 A;  2KMQ A;  1CGI I;  2OD1 A;  1TBR R;  3OVO A;  1SGQ I;  2QQ0 A;  2UVO A;  3KY9 A;  3BJI A;  1SGY I;  1LR7 A;  1KBE A;  3OXF A;  2QQE A;  1WKX A;  1ULM A;  3QAH A;  2XRC A;  2YQP A;  1SGR I;  4JCV E;  2J9R A;  1SGN I;  5CCL A;  3HH2 C;  2SGD I;  3R5C A;  2E73 A;  5E3Q A;  3UGI A;  2ROW A;  5JHW C;  1TUR A;  2RIJ A;  3VDP A;  1MJB A;  3TO6 A;  5HQ8 A;  3UEY A;  1LR8 A;  3PDN A;  2KMO A;  2V53 A;  1UVG A;  2GIV A;  2ORW A;  3RU0 A;  1FY7 A;  1SGP I;  2WGC A;  1U5K A;  1OMU A;  3B4V C;  2E5R A;  2SGQ I;  1HPT A;  2JW6 A;  2L8E A;  2LB7 A;  1N13 A;  2CWG A;  2LEO A;  2N17 A;  4HGU A;  4SGB I;  1BMO A;  1W3S A;  4B6D A;  1YTP A;  2FNF X;  2X52 A;  3TO7 A;  2KCX A;  2KMR A;  1FAQ A;  1P9Z A;  1X74 A;  2ELI A;  2L7X A;  2QQC A;  2BUS A;  3R5B A;  1HDL A;  2KMP A;  1OMT A;  1CGJ I;  1PPF I;  3E2I A;  3OXL A;  4MPI A;  2NU4 I;  2J87 A;  1X4S A;  5FUY A;  1S20 A;  2JA1 A;  1IY6 A;  2OU2 A;  2JYY A;  3QWP A;  2V1C C;  3VDU A;  1SGD I;  1CT4 I;  1UHA A;  4E1P A;  1M8C A;  1DS2 I;  4WP4 A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 1TOT A;  1Z7K B;  2W0T A;  1Y1B A;  2LUY A;  2CJS C;  1PCE A;  1PTQ A;  2V1C A;  1HJA I;  2GKT I;  1TGS I;  2DIP A;  3VE5 A;  5FUX A;  4E1R A;  3TJQ A;  2A20 A;  2JZM A;  1CE3 A;  2F3C I;  2VRW B;  3SEK C;  1KBF A;  1MT1 A;  1CHO I;  1V1I A;  1XBT A;  4FKD A;  5DAE A;  1YU6 C;  2ODD A;  1CSO I;  2N1A B;  5HI7 A;  1PJU A;  4GI3 C;  2YUU A;  1OYV I;  1UVF A;  2DB6 A;  1IY5 A;  1M8B A;  1SGE I;  1DS3 I;  1UUC A;  2P6A C;  3UGL A;  2M5X A;  1CT0 I;  2NU2 I;  2ERW A;  2QPO A;  1LR9 A;  1TUS A;  5EX3 A;  3FC3 A;  4OVO A;  3GOX A;  1Y1C A;  2GKV A;  1OVO A;  1TBO A;  2ENN A;  2QQD A;  1XX6 A;  5FUW A;  1R79 A;  2ARP F;  3CXL A;  1Y8F A;  3E59 A;  3OL0 A;  4UXJ A;  3UGD A;  1H0Z A;  1VDD A;  1RFH A;  2NU0 I;  1TIH A;  2N52 A;  1FAR A;  2GVI A;  2B0U C;  2K9H A;  2GKR I;  2JXD A;  3OXG A;  1CT2 I;  4L9M A;  1FYB A;  3D00 A;  1NUB A;  1TBN A;  5FUV A;  2N71 A;  3SGQ I;  4UXI A;  1W4R A;  3MEK A;  5CCM A;  3UFF A;  2WVJ A;  2UZ3 A;  1KMA A;  2NU3 I;  3QTL D;  1V1H A;  2ENZ A;  3SGB I;  2SGF I;  2ORV A;  2SGE I;  1BUS A;  4A24 A;  5EX0 A;  1PTR A;  2SGP I;  2B8T A;  2NU1 I;  1AN1 I;  4UXH A;  2WCY A;  2OVO A;  3UEJ A;  1R0R I;  1TBQ R;  1IW4 A;  1XA6 A;  2KMQ A;  1CGI I;  2OD1 A;  1TBR R;  3OVO A;  1SGQ I;  2QQ0 A;  3KY9 A;  3BJI A;  1SGY I;  1LR7 A;  1KBE A;  3OXF A;  2QQE A;  2XRC A;  2YQP A;  1SGR I;  4JCV E;  2J9R A;  1SGN I;  5CCL A;  3HH2 C;  2SGD I;  2E73 A;  3UGI A;  2ROW A;  5JHW C;  1TUR A;  3VDP A;  5HQ8 A;  3UEY A;  1LR8 A;  3PDN A;  2KMO A;  2V53 A;  1UVG A;  2ORW A;  3RU0 A;  1SGP I;  1U5K A;  1OMU A;  3B4V C;  2E5R A;  2SGQ I;  1HPT A;  2JW6 A;  2L8E A;  2N17 A;  1N13 A;  4HGU A;  2LEO A;  4SGB I;  1BMO A;  4B6D A;  1YTP A;  2FNF X;  2KCX A;  2KMR A;  1FAQ A;  1X74 A;  2ELI A;  2L7X A;  2QQC A;  2BUS A;  1HDL A;  2KMP A;  1OMT A;  1CGJ I;  1PPF I;  3E2I A;  3OXL A;  2NU4 I;  2J87 A;  1X4S A;  5FUY A;  2JA1 A;  1IY6 A;  2JYY A;  3QWP A;  2V1C C;  3VDU A;  1SGD I;  1CT4 I;  1W3S A;  4E1P A;  1M8C A;  1DS2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...