4HGWA

Crystal structure of s25-2 in complex with a 5,6-dehydro-kdo disaccharide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
217
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment, light chain
publication title Exploring the cross-reactivity of S25-2: complex with a 5,6-dehydro-Kdo disaccharide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgwA01
4GQPH 3MV8A 2P48B 2BCKA 5SWZD 1RIHL 1FG2B 1JRHH 5IWLC 4BSWA 3OWEA 2FX8H 4R7NB 4O2FB 4NRXA 5IIEB 3H9YA 3IYLW 2AS5M 3U46B 4KKLD 3P73A 3LB6D 5CLWA 3MRQB 1RZGB 3DVNB 3QQ3A 4OKVA 3W5NA 2Z9TA 5FCUL 4KUZL 1NGYA 1MFCL 3CDYA 2F19L 3MUZ1 3MRFA 4NQEE 3X14A 4DKDC 3RL1B 3MV9A 4NT6A 3G5ZB 3NBNA 4LFHG 5I8OH 4NNPH 4E5XA 3LKRB 1URLA 1JGEB 1OGTB 1FORL 4K3GA 1RD6A 4PRHE 2IPUK 3RHWK 1NAML 1EV2E 5HGBB 4M6NL 3LKSB 1OTSC 5GISL 4H25B 5JDJA 4N0YH 5C8JB 2DQTH 2OK0L 3CCHA 3UO1H 1WZKA 4RAVB 1NGWB 3REVA 1UM4H 2VABB 2J1KA 4NWUH 3AREC 3JUYA 4LBEA 2I07B 2VL4A 1CR9H 1ONQB 3BPCB 4TOYH 4HUXB 3ZKND 1KN4L 3OXSA 3G6AA 5HGDB 3LKNA 4P2RD 4X6BA 1TPXC 4CUCA 5I9QC 1ZVSB 1B0RA 4IRJD 3IKCB 5C92A 3TWCH 5GS0L 1INDL 3OG6B 4U7KA 1IVLA 5J6HB 4M93C 1I8KB 4AYFA 3RL2A 2P8LA 1HINL 3V6FA 3P77A 1TLKA 5DFWH 5I1CH 1WTGT 4N9GA 4DW2L 12E8L 1PSKL 3JTTB 4JFOB 1FNLA 3RZCD 2YUZA 4RA3A 1X5IA 3OX8A 5CGMA 1ZHLB 5C6TL 1K85A 2VN4A 3QZWG 1PDKA 4JDZB 4GUPA 3U9UA 3UXFA 1ORQB 4MZ3A 1KXVC 4IIQA 4PJ7A 5C0NC 4UTAH 1MVUB 2A6KA 1P6AB 4XBPB 3O41B 4P4RB 1S78D 4QY8B 1FVDA 4HH9B 3T0WA 2VL5A 1NH6A 4Y1AE 2HMIC 3O4LB 2ITCB 3ULUF 2YUWA 3EDFA 3MREA 2DQFA 1U8HA 5F1SA 4MCZA 3O4OC 3LH2L 5EPMA 3P4OB 2XPGA 4Q9RH 2Z4QA 4Y2DD 1K2DA 4YXLH 5D70H 3GHBL 1OWWA 3L5WB 1AQDA 3U7WH 2NY3B 1IQDA 1DUYB 4L4JA 4LVHB 1YMHB 1RJZB 3TIDA 5LWYH 4G6JL 1R3IL 2ESVA 5ICZB 3ZKMD 3EFFA 2AEQH 3TPKA 4OZGB 4UUJA 4QRPE 1JZ5A 1AR1C 4JFHD 4TPRL 1KUMA 2NZ9C 1WWWX 2EC8A 1DBML 4Y5YA 3VU2A 4LLMA 4XPFH 1J88A 3HNTL 4NKMA 5C07A 4JFEA 1BJ8A 1HIML 2E5EA 1PD6A 3FQNA 5D93C 3HG1D 5EZJB 5AYUH 5FHAH 5MENB 4X7DC 5L0QC 1U2HA 1VGKA 3FOMB 3FO0L 3UPRA 3B2VH 3QG6A 5DRNA 1EGJA 5BRZB 1JZ7A 1OW0C 3G6JE 1D5XB 1LO0H 5F6IC 4NHUB 5KVFH 1NAMA 3HTLX 1EHLL 3VXUD 1QRND 4X6DA 2NY1D 4NJ9L 4PRPB 4IRJB 2ITDB 1BFOB 4XTRD 5CEYB 5IBTH 1XF2A 1QLRA 5KTEH 3V8OA 3T2PA 4OQTL 4PJBF 5T3XH 4PGDA 5E70A 3TN0A 2FJHB 1HH6A 3RWIA 5GGQH 4PV9A 5MEPB 3Q6FB 4KK5D 2E9BA 3FB5A 4OLVH 3RZCB 5GS3A 4HULB 4D8PB 4Z5RA 4TSCH 5CJ5A 3CVHL 3CPLB 3CUPB 1HHHB 2BXYA 5C0AA 3SE4A 4WIQA 1U0QA 5T1LB 4F9LA 3TT1H 1MHHB 4ZMAT 4OCRH 2HLFC 3RJQB 4UTBH 5FECA 4NKIL 1J8KA 3KHQA 4LLAA 1VFBB 4APQD 2J6EH 4MA8H 1NGZA 3W9EA 5DFVD 3NFNB 3NIDF 4CN1A 1XFPA 1HZHH 1CQYA 1AI1H 1R3LA 4MQXC 4LFHD 1WGOA 2B1HL 5CBAB 1CLZH 1E4XI 4Y5XA 5D7IA 4OLYL 4DQOH 1D9KB 4R3SB 2IG2H 2Q8BL 5IFHH 4O2EB 1F4XL 2XWTA 2ZUTA 2X4NB 1LGVA 5D7JA 1EDQA 4OZ4B 4QHMA 5AUMB 1KCSH 4H88L 4ODXA 3RHWF 4CMMB 5BQ7B 3DV6A 5L88L 2X4OB 2I5YH 4PG2A 5B38G 2CGRH 5HHMB 1RFDL 3K74B 4YPGB 2VKXA 5H94A 2MOVA 4IIQC 3SKMA 4F7MA 8FABA 5F7UA 1WF5A 4PJGA 1RZFH 2UVFA 2CIKB 3WHE0 3GO1H 5HJ3A 1NEZA 5ICXB 1HHIA 3EOAA 1D5MA 2CRMA 1WVZA 2PNDA 1RHHB 4XP1L 4HKJA 1K8DB 5DC9B 3HLAB 4JPVL 1JGVL 4YFDB 1Z9MA 4Y4FB 3WFCH 1EMTL 1QFPA 1TQCC 2VR4A 4P3CH 4JO3H 5JQHC 3O4LE 4EI5D 4WI4A 1DQLH 4AEIH 1QBLL 4DGIL 1C08A 1BLNB 1L7TH 3EYFA 1NGQL 4KPHH 4KQ4L 1A4JB 4EZMA 2MQ0A 1H8SA 2XACC 4ZUTA 4LVOB 3QHFL 2PYFA 2BNUA 2EDRA 1A9BA 1NC4A 4M1DH 4QNPE 1CLYH 2HT3D 1FRGL 3QI9A 4ZS6C 1FZKB 4MA3A 2FD6L 4OZGE 2FEEI 1SEQL 1M05A 4L1DA 1JI2A 1YMMD 4AQ1B 5IV2A 1CGXA 4I77L 1XCQB 5IP4A 3WO4C 4NQEA 5DA4A 3C5ZD 3R06A 4WFED 4XPBL 1QLFB 4GKZA 4KU1A 5D71H 3ULVD 2XWJB 5HHPB 1T5WB 4PRHA 4UAOC 1TJGL 2FJFB 3I3DA 3JTSA 4LCCB 1GGCH 5EUKA 5MENE 3GRWH 3T65A 1CGYA 1UACL 3CAFA 4MAUL 4APQB 1HDMB 4NC0B 3EYQD 1CE1L 1AC0A 2F53B 5ILTH 2HTKC 5KW9H 1G7LB 3MJ9L 2BOCB 4PJ9D 3UTQA 5ID0B 4CAGA 1A6WH 5BRZE 4NPYA 1F42A 5I75B 4L8SB 3TN0C 4MB5A 1K4DB 1UFUA 2H45A 2ATPA 4PREB 4PRPE 5J4MA 2MTPA 1WC7A 5D1QD 5KSAA 2FNBA 4J3SA 3IFNH 1ZXQA 1OT2A 2E8YA 2JK5A 3QCTH 4YR6B 5DLML 4Q0XH 1YQVH 4U1IA 2R2HA 5IB1A 5GS0C 4HFWA 2DLFL 5EBMA 4X8JB 2DQHH 3VI3F 4C54A 2D9CA 4PTTA 4LGPB 1CFQA 4JJHA 4RDQF 2GTZB 2EIEA 3OKEA 2IAMB 1RULL 3VFGL 3PGDA 3QR2A 4P3WA 5EO0B 2XZZA 4R0LB 4WDIB 1QFOA 1L0XA 1DBBH 1K6QH 2X4TB 2VAAA 1ZKAA 4D0CB 1WZLA 1YNLL 5J9PA 3UC0H 3VD9A 3GSQA 1W0WA 4G8IB 1IEBB 2ZCKL 3GNML 4Y5XC 5FYKH 1MCSA 5FYJL 3NCCB 4JO4L 4KMTL 2KPNA 4Y1AA 3LY6A 4I13B 2R8SL 2VLKD 3MSPA 4IJ3B 1YPZF 2R23A 1FNGB 4IS6B 3QUYB 3KPRD 2G2RB 4I3SH 5L8LB 4XPGL 3O6FD 3QZWB 4JHWH 2DLEA 4GMTH 5E8PB 3SDDC 4GRLA 4NUJA 3L3KB 3QT2A 2HRPL 2BY1A 1U8MA 2X4RA 3DURB 3X11B 4JRWA 5E6ZA 2A1WH 1U36A 3JWOH 4TSAL 1RIVL 1BD2D 1EPFA 3MNWB 1C1EL 4N8CH 2A77H 5FUCC 5HHME 3OR7A 4X6EB 3DPBA 3O2VH 3C5ZB 1NBQA 2IANB 4NSKB 1NMAH 43CAA 3CXHK 3QEQA 3S5LG 3LQZA 3MR9B 2BOBB 5DUMH 4Q6IB 1MI5B 4S11A 1NGPH 3IDJB 1KCUL 1R3KB 3H42L 1BQUA 2XNAA 3I50L 2PYEA 1OL0A 1BBJA 4FQXD 2N4IA 1AGCA 3UTZA 1FNEB 1G9NL 5D1ZA 1F90L 1G9MH 4JQIL 3B9DA 4XMPL 2G5RA 5GSVB 3OMZA 1H5BB 1OSZA 1DE4A 3G6JA 3TA3A 2Z8RA 5DK0A 3RIAK 4PG9A 5C0GA 2DWDA 1QACA 1JZ8A 1FG2A 1L6XA 4KKNA 4YE4H 4O2FA 1CXHA 3MJ9A 5EFIB 4PY8I 1ZEAL 2WWMC 2J8UF 3UJJH 3U46A 3V6ZB 1W72B 3MRQA 1RZGA 3DVNA 1AXTH 3QUKB 4PLJC 3UYOD 3T0BA 1IC5H 3WFHB 3QEUB 5DRXB 3RL1A 5HI5C 2PKDA 3G5ZA 4WHYG 2VTFA 3LKRA 4KHTL 5IJKC 1JGEA 1OGTA 1KENH 1FZMB 4EXPX 5SX5K 5HGBA 1VFMA 1GGTA 2FL5B 3LKSA 5DJZB 1PX4A 4H25A 4CVUA 5C8JA 3W2DL 3RU8L 2F53E 4RAVA 1NGWA 1GAFL 2VABA 2UVEA 5CP7B 2CDGB 3KNBB 5C70A 3Q48A 2R4RL 3RWDB 4RGNB 2I07A 4WFHD 1ONQA 1MJ7H 3BPCA 4HUXA 3RWJB 3IS1X 5J12B 2DD8L 1AD9B 1CXLA 2XG5A 3CSYB 1L7IL 2DIAA 2AGJH 5HGDA 5LBSL 1YN7A 3S88L 3HR6A 4FNLH 4D9QD 4Z7UB 1ZVSA 3IKCA 3MUHL 3V0AC 5A2IH 1O0VA 5J6HA 2P5ED 1BD2B 1I8KA 2ED7A 3EYVA 2EDJA 1TVDA 5I71B 3PV7A 5B8CB 4LIQH 2WSKA 1LHZA 1VCAA 3VFTB 3JTTA 3FJTA 4JFOA 1JPSL 3LPWA 4R90L 4CBPA 4DEPC 2BVYA 4TTGA 1GRWA 1ZHLA 4G3YH 5T5NF 1K5NB 4JDZA 1AGDB 4JHAH 3EBAA 3SCMC 3WCYA 1ORQA 2DQEL 2M26A 5E1AB 4JZOB 1MVUA 3WNOA 2YA1A 4OI9A 4XBPA 4WCYH 3O41A 4P4RA 4QY8A 3WJLA 4HH9A 1RZJH 3O4LA 5EZIL 2X1WL 2ITCA 3BKJH 1BFVL 2JCCB 5HYEA 5GGVL 4L4TD 4U1MB 3P4OA 4LHJB 4Y7MA 3SKJL 1A7NH 3OAZK 4QOKD 4XPTL 4Z7OE 4KK8D 3L5WA 4M5ZL 1DUYA 1YMHA 1RJZA 4Z78B 3PWPD 5ICZA 4P2CG 3AS0A 4OZGA 4J23A 1DLFH 4ZS7H 5LAXB 4WFEE 2IANE 5EBGA 5K59F 4XNXH 3UTTD 2BSRB 3VI4F 1X44A 2J7LA 4O02H 2I27N 4Y16D 1MI5E 1DBAH 3ULVE 4IDJL 4L3AA 1JL8A 3S97C 2DBLH 1UB5B 2AP2A 3ALWA 2H2PC 1QNZH 5GGSB 3J7HA 3MNZB 5EZJA 1ZMYA 3B9KB 5MENA 5ESAB 5I8KH 2RAMA 3T0ED 2LU7A 3FOMA 3OJDB 4R4BB 1IFHL 5CD3B 1U91B 3L5HA 3DJ9A 4HMEA 1OCWH 5BRZA 1D5XA 3HMXA 2HKHL 4NHUA 5A1AA 5JHLH 2AABL 3O3DB 2IWGA 4OF0A 4OB5H 2FX7L 3VXOB 1IGIH 4LKXB 5B3JF 4PRPA 4H26A 4IRJA 1BFOA 3WIHL 5ICYB 2EIDA 3QQNA 4K7FA 5DQDH 3RWGB 4XHQA 3F58L 3STZB 4DKFL 2FJHA 3O6KL 4CGTA 4S0SD 4ONGH 1MHPH 5BO1H 2HT4D 2NY5L 5MEPA 1OHQA 1Q9OB 3QP3A 4J3UA 4HIHA 3Q6FA 4ZS6D 3H9SB 3RZCA 3F7QA 4V1DB 4LSPH 3FRUB 1YYMH 3S36L 1JNNH 3CPLA 3CUPA 4IMKA 1HHHA 1BQLL 3N85L 1F3JB 1I85A 3ARDC 4LPTA 1F58L 1MHHA 3L6FA 2HTLD 3PQYB 4J1UB 4TQEH 3HC4H 5I8CB 1MCWM 4Z18A 5A2FA 1ZLUK 1Y6KR 3DI2B 4DGVH 3NFNA 4LRNH 5HDLA 3V52L 2NR6D 4RGNE 5EBWB 5ITFA 4R4FH 4IOSD 1LK3H 4QOKB 2GJ6D 1P4IL 5T5FH 4JKPL 1D9KA 4GRWF 2B2XH 2ZCHH 3F62A 4R3SA 3SBWA 4XP6H 3RWHB 1KCLA 4HC1A 4PJ7F 4O2EA 2PTVA 3MRBB 4Z7UE 1YEFH 2X4NA 2GT9B 4OZ4A 1BD2E 1J18A 5I18L 4TNWK 3P0GB 2B4CL 5AUMA 4X4XB 3WNLA 4CMMA 5DGQA 3MODL 5BQ7A 5K9KB 3Q6GL 1VFAB 1AE6L 2Q20A 2X4OA 3WUWG 5DRZB 5FYJU 1FC2D 2C4FT 1QKZH 5J13B 2QQLH 3KR3L 4YPGA 1AGFA 5HYFA 2YPKB 1YY8B 2E7MA 5JOFB 3BDYH 3AY4C 4BKLB 4W4OA 2CIKA 3WJLC 2I25N 3GSUB 1KGCE 5ICXA 2ZP0T 1KT2B 3RI5F 2GJZB 4ZTPH 4OLXH 1RHHA 1K8DA 3HLAA 1SBBA 3PHSA 4Y4FA 1IAOB 2ED9A 1JVKA 1ZT4B 2M1KA 4MJID 3IDUA 2JJSC 1EO8L 3NIGF 4BUHA 1UKTA 3GSNH 1G9NC 3KYMB 2NY3C 4JPKL 5I1HH 1BLNA 4LVHC 2JCCE 4UV4L 3WXVL 1MWAL 3L3OB 1A4JA 4AEHL 3ZDXE 1VHPA 5KVGH 1I1AD 4H0IA 4C57C 2VJXA 4M61B 1N7MH 4XVSL 4KMQA 3SDDD 2MWCA 5BMFH 4YC2C 3PWUB 3DMMD 1FZKA 3L95B 1XIWC 4EQ3A 5I1JL 3BZFB 4ONOA 2DQJL 3M8OL 5DZOA 2LU4A 3LD8B 3TBSB 2DQIH 1RPQA 4X6DF 1QLFA 3VXMD 4M48H 4ZOBA 5C08B 4U6VL 2VOTA 5E8EB 5E2TL 4XBEL 4Z7NE 1T5WA 3ARBC 2FJFA 3V5KB 2QJDA 4LCCA 4KVNL 3K2UH 5HYSB 1FN4B 4APQA 1HDMA 2P8PB 3AMLA 1N5YL 2XZAL 4M6AA 3LPFA 2F53A 1G7LA 1ZLVK 2BOCA 5ECJE 1LO2H 5ID0A 4WFHE 5CSZB 4Y8AA 2P47B 3KYNB 3MRPB 2EICA 3EJYC 1K4DA 3EDEA 4PREA 1LDPH 2DQUL 2FX9H 2WP3T 3FN0H 1A6AB 2VN7A 2GITB 3OAUL 1A2YB 3K4ZA 4YR6A 1H0DB 3SE9H 4ZO7A 1MFDL 1OAZL 2ZUYA 4X8JA 3U83A 1X7QB 4QGYA 1OQOA 1P53A 4FABL 2NYYD 3OHXB 3H9SE 2OJZL 2IAMA 4EUPG 4V1DE 2BP3A 1J0HA 4R0LA 5EO0A 3BOVA 4WDIA 5D7IF 5EA0H 1JRHL 1T1WB 5DMYA 2FX8L 2QHLA 1YYLH 2X4TA 2MJWA 4UINH 2CUHA 1CDCA 4D0CA 4P49A 1MLBB 3PQYE 5I1LB 4KMLB 3V7AG 4G8IA 1IEBA 3BJLA 4UDUB 4EI5A 3FO1B 3SBWC 1ZHKB 5I8OL 4NNPL 3CLFL 1FNGA 4IS6A 3QUYA 4PJGF 4AMKH 1MFEH 2G2RA 4L3EB 4QOKE 3LZFH 4F58L 3QZWA 1ZANL 1QFUH 3DXAD 1KXQE 3QXUA 5E8PA 5C2BH 4N0YL 3L3KA 5CSBA 3X11A 3S3JA 3DURA 4C58B 3UO1L 4NN6B 3HI5H 2J5LB 4KV5F 4NWUL 4YK4B 1FYHB 3MNWA 4W4OC 5ELIA 4HMCA 2PN5A 1CR9L 4X6EA 4TOYL 1NJ9B 1WJ3A 2CMRH 3C5ZA 4LP5A 3K81A 2IANA 4NSKA 3HNVH 2PXYD 2VLME 4Y4FC 1UM5H 4K3DH 5BW7A 3MR9A 1S5HB 2BOBA 2EEDA 4Q6IA 1MI5A 1KIRB 4LRIA 2WP3O 3IDJA 3TWCL 4JY6B 1R3KA 3I2CH 3SDCB 2ZUQB 4YH6A 3QEGH 5E8NB 5KS9B 2MMXA 5I1CL 1T7WA 5HHNB 4GBXB 1FNEA 1DBKH 1RUAH 1FIGH 4J12A 2X1OA 4HIJB 5FF6B 3LCYA 2YUVA 5GSVA 2X4QB 4TNWF 2IC2A 1H5BA 1EX0A 4HF5L 3JV5A 1V7NH 2FEDD 4NKQB 4BSVB 1ACYL 1IM3B 5HSFA 4UTAL 4MVBD 3KPSD 3IAPA 1JE6A 4LKCB 5EFIA 1JWSB 1PEWA 3NCMA 4NJAH 3IJSA 3HE6C 1W72A 3RWCB 1REIA 1RU9H 1DBJH 3QUKA 1J10A 2YD6A 2X4PB 2NY5C 4MQ7B 3WFHA 4LCCC 3QEUA 3VDCA 4DKAA 1EK3A 4UOW1 1A5FH 5D70L 4YXLL 3WIFA 3U7WL 5C08E 2CRZA 1RZ8B 3V0VB 5JPMB 1FZMA 4ELMB 5DO2D 5LWYL 5IVXB 3KLAB 4DZBB 2AEQL 3MRGB 2BVEA 4HWZB 2FL5A 2Z0BA 5DJZA 4L8SC 2H2PD 3LV3B 2AV1B 1DJSA 4U0QB 3BD5A 3CNKA 2VLKA 4P2QD 5L9DH 1F00I 4PJDB 5E8DH 5CP7A 2CDGA 3RWFB 3KNBA 4NWTH 3RWDA 4F37K 8CGTA 4XPFL 3RWJA 3S34L 2JLLA 3DXAB 3KJ4B 3QG7H 1S9VA 5MERB 5AYUL 3RUGB 1AD9A 3CXHJ 3CSYA 3RY6A 3VGGA 4KK6C 5GGTH 3NZHH 2IAMC 2IMMA 2VITB 4DFIA 4R0LC 2PO6C 4R97C 2FGZA 1BD2A 1HWHB 3B2VL 4JGUA 1FSKC 5B8CA 4HPOH 1LO0L 4JKMA 1A7QL 2B4CC 3DX7B 5KVFL 3X12B 4RGOH 2PXYB 3DYOA 5H37H 3VFTA 3FO9B 4PJFB 3QNYB 3IDGB 5F8RC 5C0RH 5JHDD 4LF3B 4XB8A 5IBTL 5KTEL 4HS3B 5EU7E 1R3JA 1K5NA 5T3XL 1AGDA 3K8KA 4JZOA 3QUYC 4JO2L 5GGQL 1FBIH 4OLVL 2X09A 3WUWB 5FA3B 2DI8A 2ZG1A 4QHKJ 3LEYH 1J1XH 4XMKH 4TVPH 3BQUB 3L3HB 1UXWB 4OM1H 2VC2H 4L3EE 2DM7A 4U1MA 3TT1L 3KXFD 4HG4J 1YJDH 2HH0H 4OCRL 1DVFC 5IW3A 5JXED 3MZTA 1JGLH 4LLVB 1FFQA 5AD0B 2FGWH 4KK9D 4Z78A 4XAWH 2J6EL 1PG7H 2GK2A 4Q6IC 4LRIC 5JOPD 3HZYB 5JO5A 4FQJH 3DUHA 1AI1L 2V2WA 5T3ZH 3TGXA 5LAXA 5JW5B 3G6JF 1CLZL 4XCFH 4DQOL 2ARWA 2BSRA 5FYKE 4WEBH 2IG2L 5IFHL 5J1SC 2O5YH 5MEQB 3P0VH 4Y19D 3WLBB 1UB5A 2KZWA 3OJMB 2P4AB 3TFKD 1DCLA 5GGSA 3MNZA 1HKLL 4OLZH 1H5BC 1KCSL 5E6ID 5FDYA 2Z31C 5CAYB 3B9KA 2C7UB 1GOHA 3QWQB 5KS9E 5ESAA 4WGWB 1H3GA 4OI7A 2CGRL 4P2QB 3BKMH 3OJDA 4R4BA 1NCAH 5CD3A 1U91A 2UWEB 4HEME 4WI6A 1KN2H 1RZFL 3HC3H 3GO1L 4MB4A 1IC1A 4OLWH 3S8WA 3O3DA 2ZKHL 1LWRA 5I66B 1DN0B 4LKXA 1U9KA 3WFCL 4MXWH 2HFTA 5ICYA 3RWGA 2BVUA 4P3CL 3OKMB 3STZA 1DQLL 4AEIL 4JAMB 4O2CB 3LKOB 2AKRB 1CL7I 4KPHL 1Q9OA 4S1RH 4X9HA 4N5ED 3H9SA 4XNYH 1SYVB 4V1DA 3TZVC 3FRUA 3MX0A 3UAJD 1ZE3C 1YNTB 4M1DL 3PHOB 4YHKH 5F9OH 1UKSA 2N7AA 4RFNC 3ZYZA 1CLYL 1MUJB 4LHUG 1F3JA 4YGVB 1CDUA 1FAIH 1UJTA 4ELME 3WD5H 4UMGA 3B4NA 3UROR 3SDYH 2OL3L 1A6TB 4J1UA 5I8CA 5BS0D 2LABA 2F74B 4A6YH 1VGEL 4PJAE 4PJDE 2XWBB 3QO1A 4G6FB 5EBWA 5D71L 4QOKA 4N5UA 3RUGE 4KUCD 4ORGA 3RWHA 1GGCL 4WW2C 3MRBA 2GT9A 1MQ8A 1JP5A 4NQCD 5ILTL 5KW9L 1A3QA 1DUZB 1JNJA 4X4XA 5K9KA 1A6WL 3OJ2C 1VFAA 1OTTC 5DRZA 3QIWB 4G7YL 5DS8B 4LPXA 1Q0XH 4PJFE 3GI8H 2WMPA 2YPKA 5GRVL 1YY8A 2R1YB 5FYLE 5JOFA 1QSVA 1U42A 4BKLA 3GSUA 3IFNL 4QNPF 1KT2A 4F37F 1YQVL 2GJZA 1HXYB 2DQHL 3T0EA 5DD1L 5JIIA 3PWLB 1IAOA 2YZ8A 3U2SB 4OZGF 1XGUB 1ZT4A 4K2UH 3IDNB 2NY2D 5GQBA 2EYSB 3KYMA 4HXBH 1HHGB 1DBBL 1K6QL 4JREB 3RX7A 3L3OA 1DR9A 2GJJA 3ESUF 5IOPB 1U8PB 3D3VD 1YEKH 5DXWA 3QIBD 4M61A 4HDIB 3TJHC 1FCGA 5E5RB 1YEJH 3BDXA 5DEFB 5LG1A 3PWUA 4L4VD 4X9IA 3KYKH 1QUNA 3L95A 3MRLB 3IFOB 2ICWB 1GZQB 3GI9H 3GSRB 3BZFA 4J3XA 1GIGH 4I3SL 1QD0A 2OJEB 4JHWL 2VB5A 1CQKA 4GMTL 3TBSA 1NC2B 3CFDB 5C08A 2FSEB 3QDMB 1C5DB 4PV8B 1PKQB 5E8EA 2A1WL 2F8XC 5FUOH 2JIXB 3V5KA 5EO9B 4LPCA 5BS0B 2FRGP 4N8CL 4HAFA 2A77L 5HYSA 4QRRD 1FN4A 1S7XB 2O5XH 3WKNA 4P2QE 3O2VL 1CTNA 1NMAL 2UWEE 5CSZA 4U1NB 1TITA 2IQ9L 1NGPL 4CKVX 3KYNA 3MRPA 3DIFB 2Q76B 4NZTH 3I02B 2VDNH 2BNRD 1H3TA 4R4ND 5C0CB 5CJBA 1JFQL 3DETC 1QO3B 5HVWA 4U2YA 4GG6B 1A6AA 2GITA 5BV7B 1VDGA 5E08L 1F4YH 1H0DA 4MHHI 1G9ML 3QUZC 1RURH 2ATKB 1X7QA 1MFAH 3LRHA 1M1SA 3OHXA 4BH8B 4BELD 3GRWA 4HS8H 1JNLH 2J3SA 3ULUH 1R3HB 1T1WA 1WICA 3SGEI 4BQ9A 2W91A 4YE4L 3WDHA 2W9LA 3O2WH 1MLBA 5BVJA 2WLZA 5I1LA 1YNKH 1AXTL 2K3TA 2NY2B 4CU8A 1IC5L 1V3KA 4CW1B 4UDUA 3E6HB 1F3DJ 3FO1A 2DLTA 4IRSC 4PB0H 5IVZB 4P23C 1IRAY 1ZHKA 2JB5H 4JFQA 3SGDI 4OFYA 2DJSA 4EN3D 3MV01 4JM2D 5DHXB 1KENL 1WBZB 3ZSTA 4L3EA 3D3VB 3WIIH 4OD2B 4LHUD 1CDYA 2HT2D 4OM0H 2WIIB 4P46D 3GMNB 5HHOB 4XC3L 1C12B 2R2BB 3E2HB 2O5ZH 5LGHH 1W0YT 1P7QD 2AV7A 1Z5LB 2PO6D 3QEHB 1LK2B 2XN9B 3FKUS 4NUGL 1MJ7L 5F88A 4XNUH 2Q6WB 3A6OA 1S5HA 3SDAB 4FNLL 3D5OF 1KIRA 5E94B 2RJMA 4KFZC 4JY6A 2QQKH 1TMCB 5IB3B 3H3PH 3ZT6A 3SDCA 4U31A 2BMKB 5EBLB 5D1XD 4LIQL 3OPZL 4YGAB 4X9BA 5E8NA 5KS9A 5KVMC 3O81A 5HHNA 4GBXA 3WXWH 3U1SH 5IHUH 2DIJA 5HHXH 2HFFB 4HIJA 3GSWB 3M45A 2X4QA 1BQHG 4YDVB 2BNRB 4YPJA 2APXA 1AO7D 4JHAL 4Y4KD 3BH8B 4BSVA 1IM3A 1MY5A 1GJIA 2L7JA 5KANG 3QDJD 4WCYL 4L5FH 5J57B 1JWSA 2BVPB 4JHZA 1RZJL 5EULV 1RJCA 3V4PH 5LQBH 2P49B 3HRPA 3BKJL 2L0DA 1QBMH 3RWCA 4LSRH 5SX4H 1J05B 2X4PA 5DJCB 4MQ7A 1A7NL 4NN7C 4PS4L 1X4ZA 4WO4D 4UILH 3P40A 1I8LA 3FQTB 2I9TB 5HTSA 1RZ8A 3V0VA 3QDME 5FOBB 3RTQC 1PKQE 5JPMA 2YBRB 5IVXA 3KLAA 4DZBA 3MRGA 5BS0E 4HWZA 4RIRB 2P5WB 1KJ2A 4FG6C 4KRNA 1DLFL 1A1MB 3BVNB 3LV3A 4ZS7L 4RISH 2IPTH 2AV1A 2Z31D 4MSWB 4XNXL 1N0XH 5TQ2H 4H1LG 3WE6B 4O02L 3ARFC 4PJDA 4JM2B 3RWFA 4WTXA 1DBAL 5B4MC 2APBA 3I85A 1R24B 4MA7H 2DBLL 1J9CT 4LPVA 4DVRH 3DXAA 1QNZL 3VRLE 2YC1B 5C0CE 3RUGA 3UBXG 3LQAH 5MERA 1CCZA 2E7CA 3BGMB 5I8KL 3TVMD 5C9JB 3DHMA 5FM5O 3MRKB 4GG6E 4YXKH 4P59H 3N06B 4WFGD 1QYGH 4KRPD 4MB3A 2Q86B 2IJ0C 1OCWL 4KKAC 5E95B 3C87A 1CG9B 5EU7C 3DX7A 5DDHB 4ZFZA 3X12A 1B2WH 5JHLL 5ANMA 1RUQH 2PXYA 3PWNB 4ODUB 3FO9A 4PJFA 4OB5L 1HSBB 3IDGA 1IGIL 3IU4L 4NCC1 3BJ91 4FS0A 3DYPA 4LF3A 4Z7OF 1IC7H 4X8XA 4X98B 4QXWA 3VW3L 2DMKA 4IEFB 5D1XB 3T08A 3GK8H 3HE7C 5I6XC 4JGMA 4ONGL 1MHPL 1N26A 2A83B 1M7IB 3SKOA 3WUWA 5FA3A 1B0GB 1YYML 2H26B 2YRPA 1CGTA 3BQUA 3ETBF 3L3HA 3PP4H 1AO7B 2HJFB 4Y4KB 1VEPA 2EDYA 3ULVF 3D3VE 4QHNB 2J5LC 4YHMH 2DM3A 3QFJD 1AHWC 4TQEL 5HHOE 1FYTD 3HC4L 4FFYH 4LLVA 3MXWH 5F7MC 5AD0A 5EU5B 1H3UA 4DGVL 4ZUVB 3WJJC 2W0LA 4LRNL 3UX9B 5C0EB 3HZYA 2OP4H 2YPVL 3W39B 2XN9E 4R4FL 3BEWB 5JW5A 1NMCB 1WSST 3SDCC 3VWJB 2VXVH 5T5FL 4WO4B 2AVGA 2ZWLT 2ZCHL 3FRPG 35C8H 4LNRB 1XF5B 1D7FA 4GBXC 1NFDB 3HPJB 3BI9X 5MEQA 3WLBA 4NO3B 2Q1EA 4OFKA 4DKEH 3RGVB 1WCQA 1NPUA 4XVUC 4PYHA 1RAMA 4P2QA 1QKZL 2QQLL 1F5WA 1DN2A 1NCBL 3FZUC 3BDYL 2UWEA 4JGJA 3B43A 2BNRE 2CKBL 3HMWH 4ZTPL 2OX5A 2EKJA 4OLXL 4WI5A 5I66A 4KROC 3TBWB 3O6MH 3TVMB 5TPWH 4DZ8B 4GLRH 3JV0A 4KRPB 2NXZD 5TJWK 3OKMA 3ILQD 5GSRB 3GSNL 2BZDA 2UUDH 3C09B 4JAMA 4O2CA 1G9MC 1N3NB 3S35X 5I1HL 2VRAA 2AKRA 3MLUL 4G43B 4BH7B 5KVGL 1SYVA 1KLUB 4QCIB 3ORJA 2VQUA 1ITCA 1U8IB 5C0FB 1N7ML 1K3ZA 1YNTA 3PHOA 4PJ8C 4JG1H 2NY6B 1MUJA 5CGYC 4YGVA 3QO0B 5BMFL 2P5WE 1A6TA 1EIBA 1CFBA 1E0OB 4ORZC 3MRIB 2F74A 2YD4A 3C60D 1MCKA 1F8TH 2JJTA 4EUPA 1IAIH 2DQIL 4LHQB 2XWBA 4M48L 1JPST 1QA9B 3NGBB 1OAYH 5JXEA 5D72H 1FYTB 5D8JL 1D3CA 3K2UL 2WM0A 1RK0B 1WEJH 4HIXH 1IAKB 5EWIH 3OTTA 3G9VA 1T2XA 3DETD 5ADOH 1NSNH 4OUUB 1DUZA 2X40A 3K7UA 2QADB 5DRWB 3QIWA 2YR3A 5DS8A 3NFPB 2A73B 2A0LC 1HNFA 3ZDXF 1KJ3H 2R1YA 1LDPL 1UYWH 4A6YB 3IDXH 5INDB 2FX9L 3DVFA 4M6OH 4DFHA 2EDEA 1BVZA 3SKNB 3SE9L 1MLCB 3BD4A 2NTFB 3V4VH 1HXYA 2DKUA 4FFWC 1HHKA 3PWLA 3BHBB 3VFOB 1IQWH 3U2SA 2WQRA 5BCAA 3RX8A 4GXUN 4RZCB 3IDNA 3GGWB 2XKNB 5SWSD 1FL3B 1RMFH 5EA0L 3T3MF 1MPAH 1HHGA 5E4EC 1IZKA 4K23L 2CO6B 5J56B 1YYLL 3FMGH 2RCSH 5IOPA 1TQBB 5J6GB 1N59B 1U8PA 2X4SA 5HGAB 4Z7NF 3C6LB 4HDIA 4FA8A 4X7CC 2NXZB 4HUKB 2FBOJ 5B39B 5DEFA 5TH2B 4HFUH 4K07A 4I18B 1X5GA 1CDIA 2NPLX 3MRLA 3IFOA 2ICWA 1RZJC 4DGYH 3GSRA 4D94A 4AMKL 1MFEL 3AMKA 2CQVA 3LZFL 2OJEA 4DVBB 1QFUL 1N6QH 4L9LB 1NC2A 3CFDA 5C2BL 5KANI 1NFDE 2FSEA 4OCXH 5J8OA 2OR8A 3QDMA 1C5DA 4PV8A 1PKQA 4TVPE 3HI5L 4OZFH 3Q2CA 2JIXA 2UZYB 5EO9A 5BS0A 4WU5B 4WWKC 3C60B 4OFIA 1S7XA 5D6CB 2OSLB 2CMRL 2VXQH 5DMGC 1UM5L 4K3DL 1KFAH 1OTUC 1GXEA 4U1NA 5F8QC 2Z91B 4N0FB 3DIFA 2Q76A 4Q58C 3I02A 2CO7B 2NCMA 5C0CA 4KXZH 5EOQH 2SEBB 3VWKD 5T3ZE 4M4PA 1DL7L 1F4HA 2E3VA 3QEGL 1QO3A 4GG6A 3QPQD 2H3NB 1DBKL 5EZOL 1RUAL 1FIGL 2ATKA 4PTUB 3GSOB 4ZUWB 3O8XB 5C0BD 5F89B 1EAPB 5HVFB 1QLEL 1V7NL 4E9LA 4CJ0A 4BH8A 2AQ1A 3UBXB 1R3HA 2F5AH 3VGAB 2HYMA 4DAGH 1A6UH 3LKQB 2W65B 5CZXC 4JRXD 1E6JH 4L8DB 5IVOA 4L29B 3GBLA 3O0RH 1RU9L 1DBJL 3EOYG 3QIUC 4OCWH 1JCKA 3ARQA 3SY0B 4CW1A 5BOPA 3E6HA 2A9NH 3D39B 3IJHB 1F45A 5HI3D 3AM8C 4QRSB 1A5FL 2H2SD 2WANA 1VA9A 2Q3AA 1WBZA 1J8HD 3PGFH 3D3VA 3ARWA 4FTVB 2VSCA 4OD2A 3PNWB 1LVEA 5B4MD 1S7RB 1FYTE 1TETH 2PUQT 2V2XB 2WIIA 3GMNA 3QA3B 5HHOA 3WDIA 5CLTA 1C12A 1WCBB 2R2BA 4NM8H 4XP9H 1R5VB 4PGEB 2PR4L 5L9DL 1ZGLM 4MLIA 5E8DL 1EO5A 2CR6A 4NFBA 1WZ1L 3R0MA 3QEHA 4NWTL 1LK2A 5DJ0B 2XN9A 3EOTL 2XRAH 4ZAKB 2D2OA 4MJ6B 3QG7L 2Q6WA 5EC1B 3KLHD 3UTSE 3PXJA 3SDAA 1EERB 5MI0C 5DHVB 5E94A 1ZGLB 5DJDB 1SMOA 5IB3A 1G6VK 2BMKA 5EBLA 3FO2B 3CZJA 2B1AH 4HPOL 4H5SB 5IMLB 4RGOL 1ZTXH 1P9MC 2B0SH 3OL2A 2HFFA 2QEJA 3GSWA 1SBSL 1U58B 3VMPA 4ENEC 3MOAL 4JRYD 5E2JA 4YDVA 2BNRA 3MRCB 3QDGD 2NW2B 3DUSB 3IT8D 3RY4A 3VWKB 3BH8A 3QNXB 4J8RB 1QZ1A 4DTGH 3MO1B 1VSCA 3LPGA 3NOIA 3ARGD 1FBIL 1JF6A 5C71A 4GAJH 4YHOH 2EH7H 4HJ0C 3WMSA 5C0BB 2BVPA 2NW3B 3LEYL 4HWEH 1XEDA 4OM1L 5IUSA 1J05A 2VC2L 2VR5A 5DJCA 4AEEA 3SQBA 4YZFE 1YJDL 2AEIT 2HH0L 5DJYB 1UADC 2BVOB 5F9AC 4JPIB 1JGLL 2FBJH 3FQTA 2X41A 2XV6B 4ZPTB 4KKBC 5FOBA 2R69H 1BZ7B 2FGWL 2YBRA 1WBYB 2KH2B 4GRWH 1PG7L 1MJUL 4JEGB 2P5WA 4RIRA 2XZCH 5JUEH 4FQJL 4HBQA 3BVNA 1A1MA 3AB0B 1DSFL 4MSWA 4EOWL 4XVUD 1F11B 4WFFE 4XCFL 3WE6A 4EN3A 3ELAT 3WN5A 4JM2A 1A3RH 1KV3A 2O5YL 1R24A 3P0VL 4BA8A 3FZUD 2AJZB 4LHUA 3HZMB 4KGLA 4LSVH 4DUVA 4OLZL 3QCVH 3GUTB 3BGMA 1T66D 5JW4N 2CJUH 5C9JA 3BKCL 3MRKA 2Y07H 4C83B 4KC3B 4YDKH 3E3QE 5C09D 3BKML 4DCQB 4JVWA 2VDMH 1NCAL 2Q86A 1KN2L 3HC3L 1CG9A 3CK0H 3V0WL 1QFWH 5DDHA 3ZT7A 4OLWL 4ODUA 3PWNA 1R5WB 3BIKB 3PV6B 3Q5OA 5I1GH 3ULSB 1QVOB 4R2GB 4OZIB 4WI9A 4MXWL 2EDFA 3VG9B 4KKCD 1EBAA 4X98A 5L2JB 4LDEB 4KVCH 4PJ8D 5D1XA 3CFBA 1U3JA 1P5VA 2NY0D 5FDWB 1NL0H 4QXGH 2ZG3A 4S1RL 4ZD3H 1NANI 2A83A 5FOJA 1M7IA 3B9VA 1B0GA 4XNYL 3D39E 4HLZG 1BX2B 5GGTA 4JRYB 2H26A 3CFIC 2Y1VA 2DMBA 5I8EB 4S1SL 1J5OH 2YZ1A 4YHKL 3FAXA 5F9OL 5J1AB 5L6YH 1AO7A 2HJFA 1EGJH 1T6WA 4PFEA 4Y4KA 3BKYH 1FAIL 4QHNA 3WD5L 4FTVE 3N0PB 4P9HH 3SDYL 3IDYC 3ARGB 4DUWA 3QUXC 2Y6SC 3RVXC 1Q72H 4A6YL 5KS9F 5EU5A 1ZVYA 4ZUVA 1S7VB 1UT9A 3SDAC 5JXAH 3MLTB 1FGVL 3HN3A 1SVZA 3OAZH 3VFWB 3W39A 4NO5B 3BEWA 4OFDA 4OSUH 3VWJA 3U30C 1A7OH 4WO4A 4QO1A 1ZA3B 2CDEB 2P1YA 3FN9A 4LNRA 1XF5A 2FIKB 1NFDA 3HPJA 4PJXB 3MBED 4UT9H 4NO3A 4LCUB 4H20H 1AQKL 3QHZL 5DC0A 3RGVA 3WHXB 5KVDH 1IE5A 3HFML 3IF1B 1BZQK 3EKCA 4FQLH 4XCEB 2R56H 1Q0XL 2YEZB 4R8WH 3GI8L 5E1HB 3ILPB 1EBPA 1NBZB 1RZ7H 1IGJB 2NNAA 1KC5H 4LLWA 5IVXF 3TBWA 2EZ0D 3TVMA 1YQ2A 1NLBL 1H8OA 4EVNB 2EDXA 4DZ8A 4QKXB 3K0WA 1RSFA 3WDJA 4K2UL 5C0BE 5E8OB 3MJGX 5GSRA 4C4KT 3OKDB 1BWMA 5CGTA 4HXBL 2P45B 4Q74A 1AGBB 1N3NA 4K8RD 2AEWA 4PJDF 2C1OB 1WWBX 5F9WB 1JF1B 4BH7A 3B5GA 1IL1B 1KLUA 3KPNB 2VIRA 4QCIA 1YEKL 1F97A 1U8IA 5C0FA 4HKXB 3RUGF 1GGIH 1YEJL 2MNUA 1UXSB 3O11B 3QO0A 2NY0B 3KYKL 2GK0B 4J7RA 3GI9L 3D69B 4JFFB 1GIGL 3MRIA 1JMXA 2E6JA 3RZWA 5GRUH 4WWKD 1T1XB 3NCYP 4PJFF 1YEDB 2C4XA 1QA9A 3S4SG 5DMGD 3VXSB 3SOBL 4NHCH 4GW4B 2VO5A 1FYTA 5FUOL 1NMBH 4IM8A 5HHVH 2BSSB 1RK0A 1FLTX 4H0GA 1M71B 3AROA 2O5XL 4PB9H 4KJWC 4OUUA 4LSQH 5FB8B 4G8GD 1IAIM 1WFOA 5DRWA 1MCNA 5FGBA 4NZTL 4XI5C 5KJRL 4POZC 2A73A 3DO7B 1NLDH 2VDNL 5ACLA 3D85B 1JYXA 4A6YA 4OZIE 5INDA 1IGMH 2ICEA 3BP7B 5EO1B 5LCVH 3SKNA 1MLCA 1UGNA 2NTFA 4CNIB 3QDHA 1RURL 4C4KO 4JPWH 1A7BA 3UJTH 5CINH 4NZDA 1MFAL 5KG9B 3BHBA 3VFOA 1WFTA 4N0RA 3VFMB 4OI8A 4RZCA 3GGWA 2XKNA 3GM0A 1J0ZA 1JNLL 1FL3A 4JRYE 4D2NA 3EUUA 3ULUL 4I3RH 3SPVB 4GW1B 4GMSH 4K7PH 3S37H 3O2WL 5J6GA 1N59A 4Z76B 5HGAA 4PBWD 2JKXA 3C6LA 3TO4C 1Q8MA 1YNKL 3T0DA 3EYSH 2Y72A 3VWJC 5B39A 1VENA 5F96H 5TH2A 4GW5B 4PB0L 4I18A 1B90A 2VWEE 3MGAA 2JB5L 2UWEF 5TFSH 2YA2A 1LNUB 3WIIL 1JPTH 2O61B 2EDNA 1F3DH 4DVBA 5DVLA 4OM0L 1YJDC 1U8JB 4PJXE 1X5XA 1WTLA 3MFFB 2O5ZL 5CEXA 5LGHL 1JHTB 5FAAA 4YFEA 4WU5A 1IM9D 3C60A 1OY3B 4P2OD 2FIRT 1FE8H 2E9WA 5D2NB 5D6CA 2OSLA 2XIDA 4XNUL 5I1AB 3NABH 4J4PA 4ZSOB 3BSZL 4M62H 3DRTB 2QTEA 4Z9KB 2Z91A 4N0FA 4NQDB 3F6LA 2HAZA 3H3PL 3C09C 2SEBA 4OUOA 2DYPD 3SO3C 1T03H 2H3NA 3PL6D 5GZOD 3U1SL 5IHUL 1NCUA 4ZO6A 1N4XH 5HHXL 3GMPB 4PTUA 4ZUWA 3O8XA 4XWOC 1EAPA 1KTLB 1A6PA 4OZFB 1UKQA 4P5TD 2R9HD 1SQ2N 1I3RB 3STLB 3PP3H 4EDWH 5AG8A 3QXTA 3TH2T 3UBXA 2QSQA 2VDOH 4L5FL 3LKQA 2EIZB 1BP3B 5TQ0H 1QSEB 2P43B 2NTSP 4Y8DC 1OLZA 2W65A 2BK8A 2O26U 3V4PL 5LQBL 1B4JH 4L8DA 5FHBH 1L4IA 3NGBC 1QBML 4P5MB 4L29A 4M43H 3STBA 4JFFE 2V9QA 3KYAA 4NCC2 5SWSA 3DV4B 3SY0A 3DROB 5CJXC 2YHGA 2C3WA 3D39A 4F8TA 3IJHA 4FZ8L 4N1HB 5IW1B 4QRSA 3VGBA 3QAZB 4UILL 2WUBH 3VXSE 4A2LA 2I9LB 1U3HB 5GRJH 2ARJQ 4FTVA 3OB8A 3PNWA 3VA6A 1S7RA 5HVGB 2G60L 2QADC 1JJUA 5FGBC 2V2XA 3QA3A 5DD6B 1WCBA 4RISL 1XCTB 2IPTL 4V2BA 5L2KD 5TF0A 1N0XL 5TQ2L 1R5VA 2GW5A 4PGEA 5JLZB 1T20B 4OF8A 4HJJH 3P11H 2AK1H 4M00A 4ZAKA 4DVRL 4MJ6A 4IRZH 4Q9BA 3LQAL 5EC1A 5GJTH 2R1XB 5DHVA 1ZGLA 4UU9B 4WHTB 1H15B 5DJDA 3BX7C 3IXTB 4YXKL 4P59L 2G75A 1I1FB 1IM9B 1QYGL 1FLRH 3FO2A 1BECA 4HZLB 2V5YA 1CFVH 3RDTB 3BUTA 3BPOB 1HI6B 4H5SA 4YBLC 5IMLA 3NACH 5IBLC 1X4YA 5CS7A 3FB7B 1MRFH 1U58A 1NDMA 3BRGC 1WAAA 4NRXB 3RA7H 2DN7A 1IC7L 3MRCA 2NW2A 1E28B 3DUSA 3VWKA 3QNXA 5CZVH 4J8RA 4S0TD 2DYPB 1CBVH 1K4CB 3GK8L 1MCLA 5EIQA 1WT5A 4YIQB 3MO1A 3MLSH 4JFDD 3MYJB 1NCCH 3D18B 4LCYB 2I24N 5C2UB 3VXTB 5C0BA 5ERWB 2NW3A 2Y6SD 4L9LC 3I6GB 2YXMA 5D96B 3PP4L 2OQJB 5I1EL 4YHML 5DJYA 3W0WD 2BVOA 5I1KH 3EGSB 4JPIA 3VRLF 4FFYL 4BJLA 1U8OB 3LS4H 4AL8H 4ZPTA 1LILA 5TDOB 1BZ7A 4YEEA 1WBYA 4GG6F 4M1GH 2BX5A 2Z8WC 2AXHA 3L3IB 2OP4L 5FM4A 1P6FA 5KAQG 4X7SH 3O3EB 4LSSH 2VXVL 1F11A 2XQYK 3TT3H 35C8L 4X6BB 4ZSOE 4YX2H 5ACZB 1FV1B 3E3QC 1CGUA 4NQDE 2AJZA 4GXVL 4WV1B 1CLOH 4DKEL 2DOCA 1MAJA 1OQXA 5L2KB 4C83A 2Y25A 3O9WC 4XHJD 4DCQA 1VADB 3JWNC 1IGYB 4UT6H 3KLSA 3CLEH 4HD9A 5ALBH 1LO3L 3HMWL 4K3EH 1R5WA 1YA5A 3BIKA 3PV6A 5CSGA 3O6ML 3RVUC 3ULSA 1QVOA 4OZIA 5TPWL 4UIMB 3HZVB 4PD4J 5L2JA 1QSEE 4F7TB 3MREB 4ZXBB 3VXRB 5FDWA 5IGXL 3Q3GB 3M1BA 4RX4D 2D7MA 2X89D 2XPGB 3V95A 2OI9C 3ZTNH 4F33B 1BX2A 4N1EA 1XZ0B 3OSKA 4JRYA 1JHKH 1VPOH 5DD3H 5DK2B 3MLVH 5I8EA 4U7MA 4JG1L 4MS8D 5J1AA 2P7TB 3ULUC 3HMXH 1B0WA 5ID1B 3NMEA 4YWGH 1SMAA 1MIEH 3ARGA 1G9EA 4K71B 3EO1B 4NZRH 4RCAA 1ADQL 4RMRA 1F8TL 1S7VA 1IAIL 3MLTA 5D7KE 1HYSD 5TE4H 3S37X 4NO5A 1T1YA 1OAYL 4RMQA 1HQ4B 1J1OH 4DJMA 1ZA3A 2CDEA 5D72L 3GSVB 1WEJL 4HIXL 2FIKA 4N1CA 4PJXA 5EWIL 2C1PA 5ADOL 1NSNL 4LCUA 2AK4D 3S3SA 5F6HI 4HXAH 2D03L 4KI5E 5D5MB 1A3LH 3WHXA 4NC1E 3IF1A 2OTUB 4YFLF 4ZOEA 3T0AA 5J1TC 1CFSB 4X9GA 4XNZC 2VUOA 1J1PH 2ZUWA 5I74B 2YEZA 2IH1B 3H2WA 1RJLA 1KJ3L 4YXHH 3IDXL 1NBZA 4M6OL 3D9AH 4Q6YA 1IGJA 3C08H 3T04D 3V4VL 2W1NA 4Q9QH 5F9DC 3N1GC 3IVKB 4EVNA 1E4XH 4OAWB 1LEKB 5GGVY 1B6UA 1MIMH 5C09A 4HC1H 5E8OA 3FFCD 5J7CC 1RMFL 3OKDA 5F93C 1MPAL 1AGBA 5D7LB 4PPTA 3LEXA 4FQ2L 2C1OA 1AFVH 4GFTB 3FMGL 4JM2F 4HV8B 1JF1A 5B3JE 3NAAH 4PRID 1IL1A 4X7FC 3KPNA 3P4NB 4UV7H 4LLQB 4DN4L 1V5JA 4HKXA 4JZJB 3AB0C 3REWB 2DL9A 3RVWC 2XOTA 5TGBB 1UXSA 3O11A 2FCBA 5DD5H 1X4XA 4HFUL 2ZNXA 2VXTH 2GK0A 1C5BH 3KAAA 2ADJB 1G84A 3D69A 3MGTB 4JFFA 3WS6A 2APTA 1CXEA 3BP6B 1P84K 4QRQA 1T1XA 4PJEB 1YEDA 3EIFA 1N6QL 4XPHH 1I4FB 2HFGL 4OCXL 4M1CC 4I8DA 5T1DH 1TXKA 3VXSA 3O3UN 4YAQB 3Q1SH 5EU4A 4GW4A 1T0PB 2H41A 5DD0H 1I9IL 3MRNB 3EAKA 2BSSA 4CMHC 1M71A 3SKMB 1EVTC 4ELKB 2E27H 1AXIB 5FB8A 4R2GC 2MSPA 5JW4R 4WEMB 1YZZA 1KFAL 3VG9C 3LAFA 2BERA 1MREH 1G0YR 1HHIB 3EOAB 3IB4A 1T5XB 3DO7A 3T0VA 4QTHB 4XWOD 3W81A 4KZEH 1AKJD 3D85A 5EOQL 2MHAA 3SE3C 5L8KB 2YMXH 3LQAC 3V6BR 2VH5L 3BP7A 5EO1A 2AK4B 2MPAH 4M6ML 1FVEA 3R8QA 4HZAA 3VXRE 5KG9A 3G9AB 5IB2B 1TNNA 3VFMA 2UY7A 2QSTA 3LRSB 1Q9KB 3K8LA 5FGCB 4UB0H 1GOFA 1UB6B 2F5AL 3MLYH 5T33H 4GW1A 1T7XA 1G1YA 4QYOB 4DAGL 1A6UL 3RJDA 1NFDF 4Z76A 2VWEC 2VLLA 3VD7A 1E6JL 4BM7A 4M03A 3VA2C 5J3HC 2DKMA 5T1KB 4OCWL 1RK1B 3U6RB 1KEMH 2A9NL 4GW5A 5K9JL 3HB3C 1A0QH 1X5ZA 4OGXH 1JZ2A 3DSNA 3P0YH 1LNUA 4LDLB 3WEXB 2CLZB 2O61A 1WWCA 3JTSB 1TETL 3DSFH 5EUKB 2YSSB 4GQ9L 2GUOB 2Z8SA 1U8JA 5IJVA 4TUJB 4U1LB 3MFFA 1CDJA 2D7QA 2YWYA 4NM8L 2R1WA 3LN9A 1JHTA 3FCTB 4XP9L 5IT2H 3EO9L 2A9MH 3BPNB 1J11A 5D5ME 1MH5B 2Y5EA 1DQTA 5D2NA 2XRAL 4HUNB 2ATPB 5I1AA 4ZSOA 2QQNH 3V6OE 2DDQH 3DRTA 1MJ8L 4F15C 2JK5B 4RSVA 2FLRT 4N0CC 4NQDA 3RBSA 4XH2B 3TCXA 1PZUB 3N9GH 2EEAA 4PP1C 1SJEB 3B8SA 4XB7A 2B1AL 2YPLD 2BNQB 5DYOB 2Y23A 4C56D 5CWSB 1ZTXL 2B0SL 1OF2B 3VFUB 1TJIH 3GMPA 5D7LE 3DLQR 5JORB 2V5RA 1LO4L 1MCWW 1PLGH 1KTLA 5E2VH 4OZFA 1I3RA 3STLA 3MCG1 4NGHH 5KOMC 2GSIB 3VDBA 4GSDH 4DTGL 4NBXB 3X17A 1W0VB 4XVTH 1QHPA 4S10A 2EIZA 3BGFB 4GAJL 2HVJB 3ULVH 4B7LA 4PLKD 1QSEA 4ODSH 2EH7L 4YHOL 3PWJB 3KPLB 2Q7YB 4YHZH 3SEPA 4HWEL 2R23B 4P5MA 4QTIH 2H32B 5MEOB 3DV4A 4OBSA 3DROA 2A38A 5CEZD 1T89A 3K1DA 2WBJB 4PJEE 5IW1A 3PF2A 3EHBD 2FBJL 2DTML 5E7BA 2IPUG 2I9LA 2DRUA 2R69L 1U3HA 2XZCL 1QSFB 3B6SB 5DD6A 2WWKT 1XCTA 1BOGB 3JV6B 3QEQB 2C4FU 1KOAA 4OIIL 5JLZA 1T20A 1II4E 5LGKA 1EEQA 1FDLH 3O9WD 1G6RH 5GS1C 3LDBB 4HLJA 5HI4D 4LSVL 4KJQD 4MMZC 2CJUL 2VXSH 2R1XA 1TZGH 3BO8B 2Y07L 3LIZH 4WHTA 1H15A 2AK4E 5GRYA 4WUUD 1UWEL 1IM9A 2VDML 2FATL 3RDTA 4UI2A 1HI6A 1QFWL 4P9MH 5JZ7C 2V9RA 1E6OH 3DWTA 5E0QA 5IR1A 4ODVH 5FGCE 2Y5TB 3FB7A 5I1GL 4YZFF 2ERJC 4FXLA 2WNGA 2NY4D 4D9LL 1E28A 3Q0HA 4Y5VB 3C2SA 4KVCL 2DYPA 1K4CA 5IQ7H 4YIQA 4HQQH 1HILB 3P9WB 3MYJA 3D18A 3PL6A 1XAUA 1QG3A 4QXGL 4FMFA 4MAYD 4ZD3L 4LCYA 3NPZB 3VXTA 2EDOA 5ERWA 3I6GA 1J5OL 1RY7B 3CH8A 5L6YL 2OQJA 1EGJL 1CVRA 4RRPG 5E5UB 4P9HL 3EGSA 5ISZD 2VQTA 4RWHA 3FT3B 2DLHA 1U8OA 1Q72L 3BT2L 5TDOA 1BEYH 2Q8AH 4POYA 4D0DB 5JXAL 2F5BH 1VACB 3L3IA 4P4KC 1T0NA 4OIBA 3O3EA 3TC9A 1HH9B 2HKFH 1A7OL 5SV3A 3MLXH 1YN7B 5ACZA 1FV1A 4WEUD 4UT9L 4ZODA 3EYVB 4WV1A 2D7NA 4I3GA 4L3CB 4H20L 4RDQG 5KVDL 2BNQE 3BDBA 1OD7A 5CKAA 3L7EB 5L2KA 5GGUA 4QXUH 1J87A 5JR1H 4R8WL 2QL1A 5I30L 1C7SA 1VADA 1KTKE 1IGYA 2XTJD 1RZ7L 4I0PD 4NBYB 1G0DA 1KC5L 4JCLA 2J4WH 4MD0B 2BDNH 1RZKH 4UIMA 4HGWB 2V5SA 4WUUB 3HZVA 4PIRF 4F7TA 3F7YB 1GZPB 3GMOB 2DJ4A 4ZXBA 3VXRA 3Q3GA 1U3HC 5ESQB 3TEUA 1RUMH 4QWWC 5SWZB 2R0KH 1MCOL 2V5MA 4M3JA 4F33A 4B53A 1XZ0A 1CZ8H 1DANU 1GGIL 4FQ1H 5DK2A 5CJQL 1Q38A 2P7TA 4H0HB 4IOFD 3U4BH 5E99H 4M02A 5ID1A 3WYRA 5LJYH 3AU1B 1QSFE 2R39A 3EO1A 1YDPB 4ZQKB 5I73C 1QRKA 3HPLB 3KGRA 3QEQE 5GRUL 3TV3H 2IH3A 1QFHA 4F9PC 1ZWIB 2OM5A 1WAAF 1NBVH 1HQ4A 1IEAB 4HKBB 4NHCL 4KI5C 2PYEE 3NVQA 3RDTC 2W38A 5C3LD 4MXQC 4OLEA 3KJ6H 5HHVL 1F4AA 3GSVA 1UH2A 3NA9H 4PB9L 4LSQL 5E03A 1OPGH 1OSPH 5D5MA 2V7NB 2OTUA 3M17B 1YECH 1CFSA 5C0IB 2UUDK 4Z0XB 4PJCB 2WW8A 1NLDL 4P2RB 2IH1A 4H26B 6FABH 3DX9B 1LP9B 1MHCB 4OIAA 3LN4B 1FCCA 4JQVA 1SYSB 4ZTOH 3V6OA 1L0YA 4K7FB 1IGML 5KSBB 5LCVL 3CFCH 3QRGH 4U1KB 2MQCA 4YBQD 4AZ8A 3IVKA 4JPWL 3UJTL 5CINL 3FQUB 5I16B 4OAWA 1LEKA 2NMSA 4HIHB 1X6NA 3QQ9C 4N8VB 3FHQA 2AEPH 1V3LA 2D7PA 5C0JB 3LEVH 3A67L 1KYOJ 4I3RL 4OJFH 4I0PB 5D7LA 1CDBA 4GMSL 4LU5L 2VXUL 4CADB 1UA6H 4K7PL 2GHWB 4HV8A 3L6FB 3QCUL 3P4NA 4LLQA 4U6HB 4JZJA 3REWA 3MLWH 1EEUA 3BP5B 3BW9B 3OKOB 3EYSL 1PFCA 4ODBD 3UJIH 3ZDZE 1ZT7B 5TGBA 4CL7A 5F96L 3V5HB 2WBKA 1DFBH 4ALAH 3KDMA 3UPAA 3OGOE 2FHFA 4RX4A 5ITFB 2ADJA 4OTXH 4LP4A 3MGTA 4WV1C 4Y2DB 5CEZE 1WFUA 2WIMA 1JPTL 3BP6A 5SX4I 4PJEA 3EZ8A 5KSUB 1I4FA 1JHLL 4XZUA 4Y4HD 4OZIF 4OF7A 5DEZA 1TJHH 4YAQA 4LOUD 43C9A 1KJVB 1FH5H 4KI1A 3P3YA 3CGTA 3MRNA 4LMQI 1ZOXA 1FE8L 3NIFF 2DM2A 3BN9C 4PP1D 1AGFB 2I26N 2VZ1A 4ELKA 1FC1A 1BVKB 5DFTA 1K8IB 1Z9SA 1LEGB 3SGJA 4M62L 3CDFA 4X6CB 1KJMB 1T5XA 3HG1B 3B5TA 5J06A 3QWOB 4QTHA 1S9XB 1I75A 3FOLA 1BZ9B 4NN5B 4F7CB 4U1JA 3DO3A 1T03L 4WUUE 2MKLC 2AK4A 4XCYA 1Q9LB 4O00A 3E6FB 1N4XL 4LVNB 3W5MA 4F8QA 3VXUB 3DGGB 3MV7D 5IB2A 1QRNB 5EU3B 3CFJB 2NY1B 1V3JA 5SWZE 3G08B 3K80A 3LRSA 1Q9KA 5E56A 3EJZC 4EDWL 1GHFH 4X6FB 1UB6A 5GISH 4JG0L 1CICD 1GC1L 2VDOL 4QYOA 4WVRA 4WHYH 4PJXF 5TQ0L 4Y5YC 3HAEB 2E9JA 5JPNB 1FPTH 2D3VA 1B4JL 1K3IA 5F9JB 4KDTA 5FHBL 2NLJB 3K4AA 4M43L 1JN6B 5T1KA 1GOGA 3TCLB 1RK1A 3U6RA 2OBGA 1KN4H 4YHLH 2GI7A 2WLYA 4HPYH 2WUBL 1A8JH 1IARB 1IGTB 5GRJL 3WEXA 2CLZA 2D4FA 4PUBH 3L3DB 1KCKA 4X4ME 4PY7B 4NQUA 1P84J 1BPVA 2YSSA 4P9HC 1JZ6A 2GUOA 4D9RD 4TUJA 4U1LA 2X7LB 5I74C 3HI6H 2GCYB 1EHNA 1PSKH 2EXYC 2FHBA 3FCTA 4M5YH 1HCFX 4JQVC 2DF3A 4G8FB 3V6OC 5DVKA 4HJJL 1MH5A 3WHE1 3RVTC 1EHAA 5ENWB 1VESA 3P11L 3PDGA 2AK1L 4PJCE 4P2RE 3TBYB 4FQQB 4FFZL 4XAKD 1P4BH 1LP9E 4Y4HB 2NXYD 5EOCJ 5GJTL 4GKOA 1A6VH 1V8HA 5KSBE 3P9MB 3HNSH 2BRQA 4XH2A 1T3FB 3SE4C 1SJEA 2R0LH 3TBTB 5J11B 4F9LC 2BNQA 5DYOA 4JO1H 2BSTB 3NACL 3GMMB 4U0RB 3T2QA 5CWSA 2E9IA 1CK0H 5HVHB 1OF2A 3Q5TA 3VFUA 4URTB 5JORA 3RA7L 4ODWB 3FTGB 2K7PA 5HDQH 4Z8FH 4YDLB 1FFOB 2COQA 4BQ6A 3IGAB 3OKKB 3H8NA 1CBVL 1SJXA 2ADFH 2GSIA 3MRRB 3MLSL 4YJZL 1J86A 4BK4A 2VZOA 4BK5A 1W0VA 4EI5B 1OTSD 2HVJA 3UTPD 1JF5A 3BYYA 3PWJA 4GLRI 1KB5H 3KPLA 3SDXB 2Q7YA 4LCWD 2VDPH 4YNYA 5D7JC 3IETB 1D5IH 3ARED 3O45B 2H32A 5MEOA 3QXDB 3V9FA 4P4KD 2P46B 3S96A 3BZ4B 2WBJA 5I1KL 4MJ4A 4PG2C 1CICB 2OR9H 1Z6JT 3LS4L 4AL8L 4S1QH 2HFEB 4JFHE 2ZSWB 4JFZH 4M1GL 3BRFA 1YMMB 3V2AR 1WIUA 2DBJA 3C8KB 4FQHB 1QSFA 3EFDH 3B6SA 4X7SL 4LSSL 1BOGA 3JV6A 3AS2A 4LL9A 3DYMA 3N1FC 3TT3L 1U92A 3KHOA 4YX2L 4MA1B 4X6CE 3H7LA 4TN9A 4MD4B 3HG1E 1C5CH 1CLOL 2X9WA 1CGVA 2E6PA 1UJ3B 1AIFB 5C0ND 3BO8A 1V05A 4PJ9B 3K8MA 5DK3A 3CVHH 3LSOB 3VXUE 5HBBA 4YHYB 2HMID 2NX5D 1ETZB 1QRNE 1XGPB 1KJ2H 4UT6L 3EYUL 5IHZB 2AJ3B 3QI9C 5ALBL 3RNQB 1RIUH 2NXYB 2WAHA 1BGXH 4KDTC 5D1QB 2Y5TA 4GAGL 5DQ9B 3NCEB 4FFVC 2YD3A 4GH7B 4YDJB 4NKIH 1FFPB 4ZFFB 5HDBE 1A1OB 4Y5VA 4G8EB 3IJSB 1G6RB 2N1KA 5GIRB 3VXPA 2BFVH 1HILA 4AT6B 3N1MC 2GYSA 4HG4K 4MCYB 2B1HH 5IB4B 1AR1D 1MCQA 1QHOA 3GJFH 2NZ9D 4GJTB 3WIFB 1JHKL 5DD3L 2Q8BH 3MLVL 1IKNA 2BC4B 1GPOH 3HMXL 3BPNC 2D7TL 3F5WB 3U4EB 3GB7B 3ROLB 15C8H 4G9FD 4YWGL 3U0TB 4WW1B 3FT3A 4CU6A 5FYLH 4NZRL 1RFDH 2VLKB 3VD3A 1PYWB 5KSAC 4D0DA 3KPRB 3MV8D 1VACA 4K55A 3RI5K 5TE4L 4KH2A 3O6FB 1HH9A 1HSAB 1J1OL 1S9VB 4JPVH 1KCVL 4AH2B 3B9AA 2ZG2A 1TPXB 5I9QB 1MCCA 4L3CA 4M93B 4HXAL 5DEGB 1P7HL 1A3LL 3MV9D 4OGAC 3L7EA 3QJFB 3E0GA 1J1PL 2XXCB 5F44A 1MJJB 4GAFB 3T3PF 4YXHL 5DVNA 4KTEH 7CGTA 1KTRL 3D9AL 1R3JB 3BPLB 3C08L 4DN3H 4FQXB 4MD0A 4Q9QL 2XXMB 1SEQH 1DEDA 1E4XL 3GDBA 4ZFOB 1MIML 1N2RB 4HMDA 2HLFD 4HC1L 4HGWA 4KXZI 1LQSR 4WUUA 5B38B 1WBXB 3ESVF 3F7YA 4GRLC 4XPBH 3SDXE 1GZPA 3RGHA 3GMOA 1F4WH 1YEHH 4XP5H 1NEZG 3KPQB 1YEIL 1XF3A 5ESQA 1QPXA 5SWZA 3NAAL 3O4OB 4UQ3B 4UV7L 1EO7A 4MQXD 5JA9A 2YUXA 5EU6D 4NKOB 1BF2A 1A21A 5DD5L 1PQZA 1GC1C 4MGXA 1YMME 3EW3B 2EE3A 2VXTL 3EO0B 1CD9B 3AU1A 1C5BL 1UWGH 5CIPH 5JO5B 2FB4L 2V2WB 3O6LH 4KI5F 2YRZA 3IFLH 1YDPA 4ZQKA 2ZUVA 5L7XH 3HPLA 1E27B 4LLDB 2CK0H 1FO0B 3BN9D 3W11C 5I19H 4ACPA 1ZWIA 5D1ZC 4EBQH 5DLMH 5T1DL 3WFEL 4G9FB 1IEAA 3Q1SL 4HKBA 1CL7H 2DLFH 3PWVA 4BSJA 4NQSB 4X4MA 5DD0L 3TA3C 5CZKA 5I0ZA 5IM7B 4M7KH 1S7UB 5DMJB 4FZEH 5L0QB 2DKSA 4U3HA 3VFGH 2E27L 1AP2B 4JN1L 4PRAB 4P3DB 2V7NA 3M17A 3B2UC 4ZG1A 4Y5VC 5JQ6L 2FEEL 3VFSB 5C0IA 4Z0XA 4PJCA 1CXFA 1UG9A 3NPSB 2PCPA 4P2RA 2AXJA 4KZEL 2ESVD 1LP9A 3DX9A 1MHCA 3LN4A 1CVSC 4EUPH 1SYSA 1Q9WA 5IB5B 2P5EB 3MRJA 4MQTB 5KSBA 4U1KA 3WNMA 3U9PH 2MPAL 1BAFH 1IKNC 3GIVB 3FQUA 5I16A 3HUJB 3HR5B 5F1IA 2Y06H 3ZKSD 4QRUB 4N8VA 1NQBA 4TYUA 4QRTB 5C07D 4UB0L 5C0JA 1FL5B 1OP3K 3ROOB 3KPOB 5A3IC 4I0PA 3GM8A 5ETUB 1UVQB 4M8VA 4U6XB 4CADA 5DR5H 1QQDB 1RIVH 1MCHA 4U6HA 1R5IA 4HJGB 3BP5A 3BW9A 3HCVB 3OKOA 1ZT7A 1KEML 2VLKE 2EECA 3V5HA 4GXUM 2HVKB 3D1MC 3KPRE 3QO1B 4L4TB 4GT7A 2AXGB 1A0QL 1INEH 4OGXL 4AIZB 2HTKD 2IGFH 4ZOAA 1JK8B 2ZUUA 3P0YL 5CD5C 2XT1B 4Y2DA 2VZTA 4LDOB 4ORGB 3DSFL 1EZVX 5EU6B 3TN0D 4OQ1A 5KSUA 4ZYKB 3PWPB 2RB8A 4QHKI 5IT2L 2A9ML 1KJVA 5GS0D 5HPMB 5C0AD 3UTTB 2EIBA 1B9ZA 4Y16B 1BVKA 1P4LA 1K8IA 1ZV5A 3VCLB 1LEGA 2QQNL 2DDQL 3TIEB 5HHQB 4X6CA 4KZDH 4TVSa 1KJMA 1DQQB 3HG1A 1JTPA 1ZEAH 4K9EH 3QWOA 3N9GL 1S9XA 3T0EB 1BZ9A 1NCWH 4EXKA 4F7PB 1EFXD 4F7CA 1DEEB 4M8QB 2G5BB 3BMWA 1YC7A 4N8PA 3R4DA 1Q9LA 3ZZ1A 3E6FA 3ZL4L 1TJIL 3S5LB 2YD8A 5GXBB 3VXUA 3DGGA 3MRDB 2HG5B 1PLGL 1QRNA 4MMXC 5E2VL 1OAUH 3G5VB 3DI3B 3CFJA 4X9FA 5EU3A 4HAGA 3G08A 3MJ7A 4NKDB 3ZE0E 4NGHL 1QFWI 2VR9A 4X6FA 4GSDL 1CGWA 1P7KB 4XVTL 4JKKA 4QT5B 2IALB 3ULVL 4KTYA 3HAEA 4ODSL 1GAFH 1NUNB 5DMIH 5JPNA 4YHZL 1SM3H 5F9JA 1X3DA 2CRYA 4QTIL 5GRZA 2NLJA 4WNQB 1JN6A 3TCLA 5D5MF 1JPFB 1U41A 1KIUA 5C1MB 2ORBH 4XGZB 5IROA 3T3ME 2DD8H 5BV7H 4JM4L 3MMEB 5LBSH 1LMKA 1PG7W 3OKNB 1UWXK 1X5JA 1IGTA 4G9FE 1A7RH 3DVGB 3L3DA 4N90D 4PY7A 3ZKNC 2X7LA 2EDDA 3B5HA 3P9LB 2GCYA 3P4MB 3SGEH 4LCIH 3LN5B 3WLWC 4IRJC 5FO8B 4G8FA 4X4YB 1P2CB 2K9UA 1UENA 1FDLL 1G6RL 2GJ6B 1W72L 5ENWA 3DVIA 4ZDHB 3TBYA 4FQQA 4RRPA 4X5XA 4D9QE 4L1HA 2ZJSH 4ZO9A 4Y4HA 3QI9D 1L9NA 4F7EB 4I48A 1XGTB 2P5EE 2VXSL 1HKFA 2WINB 1TZGL 5F7WC 3RZCC 3PP3K 3LIZL 4KHXH 3JUZA 3P9MA 2BJMH 2CD0A 3MCLL 4IMKC 1T2QH 1T3FA 1JI1A 4D0BB 4AEFA 4GAYB 4NQED 3GJEA 3TBTA 2WWMD 1I85C 3HUJE 1M7XA 5GRWA 2BSTA 4P9ML 3GMMA 1E6OL 3SKJH 2EDHA 5DURD 4ODVL 2D31B 4PLJD 4XPTH 4PRHD 3CX5J 1WV7T 2CR3A 1YN6B 1DQDH 1CWVA 3I3EA 4ODWA 3ALPA 3FTGA 4PJEF 5HI5D 1KEGH 1FFOA 2ZZUT 3IGAA 1UCBH 1AD0B 3OKKA 4JE4B 5FKAB 1EFXB 3S7GA 3TBVB 5BVJB 3CU7A 5IQ7L 5JW4Q 3MRRA 3PDDA 4HQQL 4MJIB 2XTLA 4Y2DC 4TRPL 1D9KC 4HIEB 4LASH 4AK1A 1M6OB 3SDXA 1MAMH 4JFQB 4L4TE 3ZKMC 3IETA 1I1AB 1QEWB 3O45A 5KSAD 1NKOA 3QXDA 1JYVA 1DANT 4JHBA 2J8HA 5D6DA 5EU6E 3MROA 3BZ4A 1KULA 3INUH 1CICA 3SDDB 3PWPE 2G9HB 2DQTL 2JB6B 2VLRD 3DMMB 2Q8AL 1BEYL 1UM4L 2HFEA 2ZSWA 2AJYH 1YMMA 2AV7B 2F5BL 3C8KA 4FQHA 5IMKB 3WV0A 3UTTE 5F88B 3S9DB 4I5BB 4ZFOL 3VXMB 3MLXL 4NN5C 3I84A 4I1NB 3TM6A 1KB5B 4MD4A 3DARA 4HWBA 1U8QB 3T0EE 4H8WH 5GHWH 5FEBA 4Y1AD 2GFBB 1UJ3A 2ZCLH 3RP1A 5B3NA 2NY5H 4LVOC 1AIFA 1U3YA 3SCMD 2DWEB 4QXUL 4PJ9A 4XTRC 3TPUB 5JR1L 1MHEB 3C5SB 3FL7A 3LSOA 5AAWA 1ETZA 3TNMB 1XGPA 5IHZA 2AJ3A 3EDDA 4NRZB 3RNQA 2J4WL 4W68A 4KK5C 5D1QA 2BDNL 3NN8B 1Q1JH 2IQAA 5DQ9A 3UZEA 1RZKL 1OD9A 1G7MB 1I7TB 5IWLA 5IROC 1D6EB 4QRPD 4YDJA 1FFPA 4ZFFA 4HCRA 1XGYH 1A1OA 3EZJB 4G8EA 1G6RA 4Z7VB 5T1MB 3ZMRA 3MFGB 5GIRA 3MXVH 2M2DA 4AT6A 2PW1B 3DUUB 1RUML 5DURB 4G6KH 4MCYA 4Q9RL 5IB4A 1P4IH 2OYPA 1CZ8L 3BMVA 4APQC 5DFVC 2BC4A 4RMSA 2QLVB 3PHQB 3MUY1 4XXCA 1I9RH 4ZO8A 3CVHB 3U4BL 1Z9OA 4R9HA 1KSRA 3F5WA 3U4EA 2VNCA 5D1ZD 5DVMA 3GB7A 3ROLA 3U0TA 5I18H 1KJ2B 5I75C 4WW1A 1GGBH 5A40E 1C16B 3FB8A 3N1PC 4JB9H 1OAKH 5I76B 4MHHG 5AG9A 3TA3D 5DJAB 1PYWA 4NOFA 2HN7B 2K1MA 1JBJA 5DZNA 3KPRA 1JGDB 3AREA 2GJ6E 3O6FA 1NBVL 3OXRB 1HSAA 3ZKXB 5J11C 5FHAL 2Y4SA 3KJ6L 2VLRB 4AH2A 3GJFB 4KY1H 2ZOLB 3NA9L 4D3CH 3MYZA 1EO8H 4Z6AT 4OZHB 5DEGA 2X9XA 1OPGL 1OSPL 5H35B 4UV4H 4ZFZB 1YECL 3WXVH 3QJFA 5ANMB 3U79A 2F9BT 1MJJA 1T7VA 5F21B 3VGFA 1CGSH 1U3ZA 2BY0A 6FABL 1KB9J 3K3QA 4EI5C 3VGEA 3CFCL 3QRGL 4I4WB 4FQXA 4IJ3C 1JIBA 3ARDD 3SCMB 4MJIE 3KPPB 3V7MA 4ZFOA 5DUBB 3GBNH 1N2RA 3SKOB 2DQJH 5B38A 1WBXA 2AEPL 2VDRH 1DZBA 4LLYB 4TSCL 4HK3J 4LEXH 4U6TA 4P57B 2HT3C 4OJFL 3KPQA 1U8NB 2YD5A 1GVIA 3SN6N 5FYJD 1N64H 1UA6L 1NBYB 5DC4B 2B5IB 5IHBA 4UQ3A 3KPSB 5FM5M 4JY4B 5CD5D 4KVNH 3QSKB 4UTBL 3C5ZC 3MLWL 4KQ3H 3T09A 4KRLB 5DVOA 3UJIL 3BE1H 3L3GA 4NKOA 2MFNA 5LGJB 3ALXA 3WNKA 3MBXH 3OB0H 4MA8L 4P5KB 5BW7C 1FQ9C 3CFEB 4ALAL 3EO0A 3ULVC 4QLRA 1HZHL 2DMCA 4OTXL 4UDTB 5FUCE 4OCSH 5CJ8A 1U93B 1OLLA 3VXME 4BYHA 1E27A 4LLDA 2DTSA 1FJ1B 1FO0A 2VZVA 4KJYB 1MCIA 1Q0YH 4XWGH 3GEWB 4G9FA 1FH5L 1MFDH 1OAZH 2F15A 3EDKA 4NQSA 4YHYC 3BD3A 3O4LD 3RPKA 5IM7A 2BRRH 2I5YL 4FABH 4YBHA 1S7UA 3C8DA 2W59A 4XP4H 5I15H 4YHIB 1AP2A 4WWID 4FP8H 1ZHNB 4PRAA 2MCG1 4P3DA 3BEVB 3VFRB 5I1IH 1OW0A 2NY3D 3FB6B 3VFSA 3GMQB 1A02N 2CDFB 5CIPB 2VMFA 5IMMB 1F2XK 1XF4B 5IB5A 2P5EA 1U6AH 3ZDZF 4JO3L 5EIIB 4OCYH 4Z7VE 2VYRE 1MNUH 3T8XB 1R0AH 3IAGC 1L7TL 3CLFH 3GIVA 5F6HJ 2BVTA 2IMNA 3HRZB 3HUJA 3HR5A 4XXCC 4M7LH 5JNYB 1CN4A 1KBGH 4QRUA 1XIWD 3MLZH 2B39A 1OARH 5KSVB 5JHDB 4F58H 4QRTA 1ZANH 1GHFL 3AXLB 1FL5A 2XZQH 3ROOA 3BUYB 3KPOA 5ETUA 1UVQA 4U6XA 5MEND 5IVXE 3ZHDA 4AY0A 3ARDB 1QQDA 1FPTL 3JV4B 4RGNC 4WI8A 5F7KC 5KN5B 4HJGA 1VKXB 3O6FC 3T1WA 3CVIH 3ARBD 1PBYA 3HCVA 3MCKB 5J12C 5BRZD 1H8NA 3GKWH 3RY6C 4YHLL 4EUPB 2HVKA 2KQMA 1QPPA 1SEBB 4L4TA 2AXGA 4OCNC 3VGDA 4AIZA 4HPYL 2HP4A 3KXFB 1JMZA 4PRPD 1JK8A 3WLWD 3DXAE 2YN3A 5I71C 1ZGLP 1BFTA 3KPTA 4PUBL 5B8CC 3U0PB 5EU6A 3GRWL 2UYLB 2VLRE 3EJYD 4GG8B 3LHPH 4ZYKA 3PWPA 5JIHA 4HH8A 3HI6L 3SO5A 4OZHE 3V4UH 4M5YL 2VZUA 4X5LA 4HF5H 3BPLC 4JJ5B 4MDJA 2FECL 4PR5B 5HPMA 5ANME 3UTTA 4KDVA 3CC5B 4FQXC 1MCEA 5FO7B 4Y16A 5T1LD 1ACYH 3O2DA 5FIEA 2J8OA 4WI3A 2HA1A 1P4BL 1TNMA 3OR6B 4Y19B 1BHGA 3VCLA 3JWDH 5BOZG 3TIEA 5HHQA 4OCMC 3QCTL 1A6VL 1HWGB 4PRDB 4Q0XL 1DQQA 3HNSL 5E6IB 2KBGA 3BN3B 1HHKB 2R0LL 9CGTA 4F7PA 1DEEA 4M8QA 5EOCH 4JO1L 2G5BA 3KWWB 1MCPH 4XX1G 1CK0L 4JKWA 4NNYB 1D9KD 3S5LA 4BZ1H 3RY5A 3MRDA 3D6GA 2HG5A 5HDQL 1RZIA 1NCNA 3G5VA 4Z8FL 2PTUA 2X4SB 4NKDA 4KGJA 3UC0L 1TENA 3KPSE 2ADFL 4JVUA 4PGBB 5EORH 3ZTJG 3RAJH 5FYKL 1P7KA 1RZKC 4QT5A 2IALA 1MSPA 2XQBH 5HHMD 3S36X 5JA8B 3ARZA 1KB5L 3L3JA 4YC2B 2VDPL 1UEYA 5A16B 4NZUH 1XIWB 4WNQA 1JPFA 1D5IL 2KZ1B 1RJYB 1HXMB 4XGZA 4OGYH 3S34H 3B9KC 4PJCF 5BVPH 3MMEA 5C7XH 2W92A 1Z0NA 2OR9L 2ENSA 1LP9F 4H1LH 3ARSA 4Y4FD 3OKNA 3VGHA 4S1QL 3JWOL 5KSBF 4JFZL 1WQVT 4CVXB 3DVGA 5J89A 2DQCH 3ARBB 4LQFH 2XI9A 1A7QH 3EFDL 3NPSC 3P9LA 3P4MA 3VFPB 3LN5A 5FO8A 4Y0GA 4X4YA 4ZPVB 5DUML 1P2CA 3S35H 2GJ6A 1LEIB 1CI5A 4FXGB 1I1YA 3DBXB 4ZDHA 1C5CL 5CKGA 1ULVA 1ZA6B 4F7EA 4JO2H 1XGTA 2WINA 2RIKA 4NQCB 5GJSH 4G6MH 4RWYH 2FWOB 3KYOB 4D0BA 4GAYA 2YD2A 1O7SA 1KJ2L 3HE6D 5E2WH 3EYOB 5JHDE 2NQCA 1RIUL 2D31A 1BGXL 1BMGA 4OKDA 4BFEA 3NZ8B 1AXSB 2DQGH 1YN6A 1X5YA 2R2EB 1MELA 1S5IH 1SJHB 4RMUA 5FV1L 1KNOB 5I1DB 1AD0A 3UJJL 5FKAA 1EFXA 5D2LB 3TBVA 3W9DB 2F53D 4HIIB 4LSTH 5DJ2B 1OM3H 1ZT1B 2BFVL 4MJIA 2DB8A 1TTGA 4KK8C 4HIEA 3QXAB 5DHVH 4OF6A 1M6OA 5FYJE 2KUTA 1KPVB 4B41A 1I1AA 3KXFE 1QEWA 2UY6A 1GPOL 3QIBB 4X6CF 1QOKA 2GAZB 4MDIB 15C8L 1HKLH 3BESR 3SDDA 5J13C 5FYLL 2G9HA 2JB6A 4L4VB 1EA9C 4Y16C 3V7AE 3DMMA 3T1FB 1V3MA 2A2QT 2DQDH 4KK6D 5JOPE 2IAMD 4I2XB 3ARVA 2P44B 3QHTC 1I3UA 1CYGA 5IMKA 4S1DC 1HK6A 1KPUB 2C3XA 2PTTA 3T0EC 2ZKHH 4I5BA 3VXMA 2AGJL 4Y19E 2B8OT 3ARYA 3VH8G 1BWWA 5K33A 1KB5A 4JKLA 1BIHA 4WI2A 5DQJB 1U8QA 4Z7WB 5FGSA 2AERT 5HDBF 4QRRB 2GFBA 4NIKB 1OT1A 1T83A 3X3FH 4M4RA 4JQXA 1I9EA 2DWEA 3QUYD 3TPUA 1MHEA 4M7JH 1ZHBB 2H6PB 3C5SA 4KTEL 4G3YL 4NFDA 3MA7B 3TNMA 3VXNB 1DP0A 3T77B 4NRZA 5INCB 2HT4C 4DN3L 1IJ9A 4AENB 2OL3H 5IEHB 1WZMA 3NN8A 3CD4A 1G7MA 1I7TA 1D6EA 1DVFD 4EEEA 4PJHB 3LD8C 1VGEH 2YWZA 2IAND 4Z7VA 3JXAA 1F4WL 5T1MA 1YEHL 3R1GH 2A74B 4XP5L 4OQTA 3HE6B 2HTLC 2PW1A 3DUUA 1MI5D 3MRHB 4BUGA 2JELH 1XF1A 5D7SH 2V7HB 4OFVA 3PHQA 3QYCA 5IJKA 3CVHA 2NR6C 1KIQB 2NY7H 1ZVHA 1UWGL 3V79C 3O6LL 5F72S 1C16A 2R29H 4WJ5B 4G7YH 3IFLL 5FUZH 2VSDA 5EUOB 5I76A 4NNXB 5L7XL 2AJSH 2C3GA 4EN3B 5DJAA 5IEKB 2HN7A 2CK0L 3WN5B 2I60H 5I19L 3QB7C 4XBGB 1JGDA 3RKPA 4EBQL 3IJYB 1VB9A 4LHUB 3OXRA 1MQKH 3MACH 4G6AC 1CL7L 4P46B 1NANH 4G80B 3LVEA 5DF0A 4KRMB 5DD1H 2VLRA 2LTQB 1P7QB 2DIBA 5F1OB 4M7KL 1JPGB 4NQCE 3GJFA 3BZEB 1I7RB 4FZEL 2ZOLA 4X0KB 2PO6B 1I8IB 3DRQB 4OZHA 4R97B 1KTDB 3SDXF 5H35A 3C8HA 1FSKB 3MNVB 3OBAA 1CE6B 1MEXH 1NKRA 1QTYT 2VDLH 4J3WA 1EEYB 2E7LA 3ES6B 3L5IA 1NCDH 1Y18B 2ID5A 3D0VB 3U7YH 5ACMA 5GS2D 3TZVD 5M95B 5DQDL 3MV11 4I4WA 5D2LE 3CFBB 3U9PL 1FFNB 5ALCH 1BAFL 1I1AC 2Y7QB 4HS6B 1TDQA 3SCMA 5BO1L 5MHSD 3KPPA 1EEZB 2AJVH 5DUBA 2Y06L 1DDHB 4RGND 1P1ZB 4LSPL 1U2CA 1UM6H 4LLYA 1JNNL