4HHDA

2.75 angstrom resolution crystal structure of the a. thaliana lov2 domain with an extended n-terminal a' helix (cryo dark structure)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
152
Chain Sequence
b'DDKVRQKEMRKGIDLATTLERIEKNFVITDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDLTTVKKIRNAIDNQTEVTVQLINYTKSGKKFWNIFHLQPMRDQKGEVQYFIGVQLDGSKAVKEGEDLVKKTAVNIDEAVREL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Coiled-coil dimerization of the LOV2 domain of the blue-light photoreceptor phototropin 1 from Arabidopsis thaliana.
pubmed doi rcsb
molecule keywords Phototropin-1
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 50
structure length 152
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hhdA00
2PR6A 3BY9A 5F68A 1UWPX 2OOLA 4EERA 2QHKA 3ICYA 5A8BA 4HJ6A 5G4YA 1KOUA 4JGOA 3UMEA 3E4OA 4NXEA 2JN7A 4HI4A 5J4EA 3LIDA 2PR5A 4L9EA 3BY8A 5HDDA 2WKQA 2Z6DA 1OJGA 3LICA 4PKYA 2JHEA 1S1ZA 4JGPA 5IS1A 1OTEA 2H28A 1S4SA 2QKPA 2WKPA 3F1OA 4F3LA 4R70A 1LSVA 4HQAA 3H7WA 3C8CA 3CAXA 4L9FA 1GSVA 2VV8A 1V9ZA 2OWJA 1S4RA 3A0RA 4XT2A 2R78A 1OTDA 4B9OA 4F3LB 2GJ3A 3GECA 1D7EA 4L9GA 2I9VA 1NWZA 3A0SA 4I5SA 2VEAA 5EFWA 4MN5A 1OT6A 1XFNA 3C2WA 5HWTA 2QJ7A 3H9WA 5AVEA 4I39A 1OTAA 1P97A 4LRXC 2QWSA 2V0WA 3NJAA 3UB9A 3MJQA 1F98A 4WUJA 1WA9A 4I3JA 3MXQA 4H6JA 5I5LA 2P7JA 2B02A 5F5YA 2WKRA 4PKYG 2PYPA 3P7NA 4JGRA 4HOIA 3LI8A 3E4PA 2ZOIA 4KUOA 2K7SA 4GS9B 1DRMA 1XJ4A 4WF0A 2M1CA 3MQOA 4H6JB 1LT0A 4NXFA 2HV1A 2V9AA 5F69A 1OJ5A 1F9IA 1T1BA 4I3IA 1EW0A 5HWVA 3CWFA 1DP9A 2PD8A 2ZBBA 3PHYA 5DKLA 2J80A 2V0UA 3F1NB 4GHIB 3UE6A 3RTYA 3FG8A 2OWHA 1S66L 3EEHA 3CLOA 4EETB 2V1AA 3IS2B 4HHDA 4HNBA 1XJ3A 1DP8A 3HJKA 4HJ3A 4M4XA 2INWA 1ODVA 3LIAA 4HIAA 4KUKA 5TBMB 4GW9A 4EXOA 2A24B 1OTBA 2D02A 3D72A 4I3AA 4E04A 2D01A 3OLOA 1N9NA 3RH8B 4HJ4A 2VV7A 5DKKA 4HH3A 3IBRA 3KX0X 3NOUC 3E4QA 4NXGA 3ULFA 1S1YA 5HWWA 1MZUA 3B33A 2L0WA 3MFXA 2PHYA 3NOPC 3F1PB 4HP9A 2VLGA 2EA9A 4GS9A 4MN6A 4EEUA 3FC7A 4HY8A 3UB6A 4BBUA 5J7EA 1TS8A 2ZOHA 5HSQA 5HD5A 5HZHA 3MR0A 1TS7A 5KIZA 1LL8A 1S67L 1T1AA 1G28A 4NXBA 1JNUA 4R3AA 2PD7A 3F1NA 4GHIA 4LPZA 1P0ZA 3VE3A 2BASA 3K3DA 2YKHA 2QJ5A 4JGQA 4LRZE 5J3WA 3T50A 2KX6A 4KQDA 4DJ3A 3BWLA 1VB6A 3IS2A 3A0VA 2PDRA 1X0OA 4EQ1A 3VE4A 1GSXA 1TS0A 3UMDA 4WL9A 3UB7A 3LI9A 4RQ9A 1T1CA 1XJ2A 1XJ6A 5TBMA 4EEPA 1V9YA 2A24A 5HD3A 3SW1A 1T19A 5IU1A 4EESA 3G6OA 1LSWA 4K08A 3ZQ5A 1TS6A 3UB8A 2L1MA 2PYRA 2YKFA 3NHQA 2VV6A 4HP4A 1OT9A 3GDIA 3LIFA 3K3CA 2KDKA 3F1PA 3LUQA 1DP6A 2W0NA 1XFQA 4WN5A 1T18A 3F1OB 4LRYC 5F6AA 2CMNA 3EWKA 3LYXA 3H7WB 5HDSA 1UGUA 4LLOB 3LIEA 1Y28A 3HJIA 4DJ2A 4BBTA 5DJTA 2V1BA 2W27A 3NOTC 4XT2B 2L4RA 5HDCA 5DJUA 1N9LA 1OTIA 4I38A 4BBVA 4R38A 4YWZA 3MQQA 5AVFA 4HH2A 1GSWA 3H82A 3LIBA 1BYWA 4EW7A 3PYPA 4WLAA 5G4ZA 2Z6CA 3VOLA 1UWNX 4GCZA 3H82B 1LSXA 1N9OA 4R6LA 1D06A
chains in the Genus database with same CATH superfamily
4Q0JA 4PHTA 3UB5P 1MY8A 2EXBA 4CQHA 4O7DA 2Y2JA 1UWPX 2W1RA 5DFYA 4X1MA 3WS4A 3ICYA 4N9LA 4IVKA 4ARZB 5A8BA 3EQUA 1EI5A 3U4LP 1KOUA 3EGXC 2VZWA 4JGOA 3UMEA 4NXEA 3CUEA 4ZBEA 4JF4A 3CHWP 1STZA 5DTTA 4UAAA 4L9EA 4YINA 3BY8A 3IX4A 5EOOA 2C5WB 1MWTA 2O0YA 2Z6DA 1OJGA 3LICA 2HDUA 4FD8A 5IS1A 5HAIA 1BLHA 3C38A 4JF5A 2WKPA 4R70A 5FQJA 2BTFP 3LY4A 3RJUA 4E3KA 3VP4A 5EM1A 4L9FA 5FQKA 3VV4A 5HPFA 3CMZA 3W4QA 4F3LB 3VFHA 1JWVA 2HP6A 3OPHA 3GECA 2I9VA 4MN7A 2ZQ9A 2GZAA 1ACFA 3MQ0A 4MN5A 4WMCD 3C2WA 4P0MA 3TE8A 3H9WA 1IOUA 2VA0A 4X55A 4PM5A 4XUXA 3SH7A 2QMIA 2V1ZA 3UE3A 2G2UA 3UB9A 1Y54A 2M7UA 2WYXA 4S2MA 3WRZA 4UQIS 4MEZA 3LCEA 2B02A 4DXCA 4OH0A 2ZMVA 2FFYA 3JVVA 1JVJA 3LI8A 3E4PA 2E8IA 1O07A 2K7SA 4ARZA 5CECA 3OBFA 3NC8A 1DRMA 3BEBA 1ZKJA 5EE8A 2WZZA 1LT0A 3GV9A 4WZ4A 4NXFA 3BYDA 5FASA 4I3IA 1EROA 4DE1A 3IHBA 3Q82A 2CC1A 2ZC6B 2JBFA 3ZG7B 2FZ0A 2EXAA 1LI9A 1XGIA 1JWPA 4GHIB 4BMWA 4UQIM 1ZG6A 4EBNA 5EUAA 2ZM2A 3L7HA 3CLOA 5HFOA 1G5UA 2HDSA 3TSGA 4EETB 1W63M 3VOZA 2V1AA 3HLFA 1XJ3A 1VHMA 3C5AA 2INWA 2XH9A 1AWIA 4JF6A 1ODVA 1H5XA 3PTEA 3NCKA 3T4JA 5TBMB 4X56A 3W2ZA 1IYQA 2WAEA 1OTBA 4MMNA 3G35A 4NKPA 3VP3A 3D72A 3MKEA 5CXWA 4I3AA 3EGDC 3ZG8B 2Y2MA 4E04A 1I2WA 1JTDA 3NDEA 2VV7A 3IWQA 1K56D 3E4QA 2E8JA 2XDMA 5M18A 5EV0A 4NXGA 5L09A 4MBFA 5HWWA 5F1FA 2L0WA 1IFQA 3IWIA 2PHYA 5A91A 4JXWA 1I2SA 3A3IA 3F1PB 3IH8A 2EA9A 4MDZA 3G2ZA 1IYOA 2ZD8A 5JYPA 4LV0A 4HY8A 1H0MA 5FDHA 1SCWA 4OOLA 2ZQAA 1IKGA 1MPLA 2PBYA 1TVFA 1YLWA 1JNUA 4R3AA 1RP5A 3HBRA 4KZ4A 4GHIA 5JYOA 3CZDA 1TF1A 4FCFA 5FI2A 3E98A 5E2HA 4YNRA 5CEDA 2YKHA 2P08A 4RYEA 2ZC7A 1FSWA 4JGQA 1FIKA 1NXYA 5J3WA 3KSIA 4R3JA 2XFSA 3OPPA 4KQDA 2WK0A 1ZTUA 4E6XA 3BWLA 5HL1A 4OONA 4WBGA 3D9YA 1EWZA 3UNWA 3UMDA 2ZMFA 3UB7A 5GLCA 2V8FA 3LI9A 4MBKA 3G2YA 5J8XA 2G7UA 5TBMA 4Y3IA 4PM9A 1SZVA 2FH5A 5HD3A 1IYSA 4WZ5A 4X68A 1W5DA 2QZ6A 3NULA 3C30A 2ZL1B 1AXBA 5IU1A 4EESA 1H8MA 3G6OA 4K08A 2XR0A 1QMFA 2L1MA 1YLTA 4KZ7A 4E3LA 3T4LA 2YKFA 4P85A 3N8RA 1L3LA 4WEKA 4BL2A 2VV6A 4E3OA 3HUNA 3GDIA 2Y2IA 1FILA 3F1PA 3K2NA 5FI6A 3OC2A 2VGKA 4QJGA 2W0NA 3C4PA 4MNRA 2O99A 4O8GA 3VP2A 1PWCA 3HUMA 3MZDA 5F6AA 4KZ6A 3EWKA 3H7WB 3WRTA 1UGUA 4LLOB 3HJIA 2G2WA 5DJTA 1PI5A 1G6AA 1GCEA 4I38A 2P04A 4BBVA 1W79A 4YWZA 1MC0A 1L0GA 1PZOA 1FSYA 3OCLA 1F2KA 5AVFA 2W3HA 4K0WA 3FWLA 3QHYA 3IT9A 1GSWA 3H82A 2HP9A 3QP5A 4B4ZA 2HDRA 3ZGAB 2VJWA 4EW7A 3HLCA 3IHAA 3P98A 3MMHA 3LFVA 2DCFA 3Q81A 1LSXA 1N9OA 3PAEA 3V67A 3SH9A 2PR6A 3BY9A 3A3FA 3A3JA 2JE5A 3HREA 3LEQA 4JXVA 4DE3A 2XQZA 2ZL1A 2ZQ7A 3IF6A 5G4YA 2XGNA 3SS5A 3B47A 1XGJA 3C4OA 2EFXA 3Q07A 4Y0TA 3VP0A 3LIDA 2W1TB 1YM1A 2WKQA 5F1GA 1E3UA 3EOIA 5AQAA 3FV7A 5EM0A 4Y17A 4D2OA 4FH2A 1G68A 4OOMA 3G31A 2H28A 3TG9A 2QKPA 2W3EA 2H5SA 1LSVA 4S2IA 3H7WA 3C8CA 1K25A 1CI9A 2ZQDA 5AQBA 2X02A 2EX6A 4Y2FA 1V9ZA 5G18A 3PBSA 3UE1A 4FTXA 4G3VA 3GR2A 4KZ9A 2JC7A 2Y2KA 1YLYA 1D7EA 4UA9A 4RVAA 4CLCB 4I5SA 2VEAA 3AGEA 5EFWA 1FCMA 3RXWA 4Q8IA 1RGZA 2WGWB 1XFNA 4MCWA 2QJ7A 3VSLA 5AVEA 4I39A 2ZC3B 3OZHA 3ZFZA 5EPHA 1H3QA 5F82A 3LO7A 4S2PA 3BQAA 4DRTA 4LV2A 4Z1WA 3W4OA 1CF0A 3DTIA 3QNCA 4OQIA 2UV0E 1BLSA 3BRMA 4HBTA 4DXBA 4H6JA 5I5LA 3W8KA 2P7JA 1MXOA 3JVUA 5F5YA 1FCOA 1NRFA 5GL9A 3FPVA 4JGRA 4C3QA 1I5QA 2Y2PA 3G4PA 4WZ5C 2BG1A 4DDYA 2XK1A 2WUQA 4Z9QA 5EVLA 3OCNA 2M1CA 2ZM0A 2PT7A 1W63Q 1PW8A 3R7WB 1T1BA 4C6YA 4RX3A 4QY5A 3V50A 2W1TA 4EQIA 3HL9A 5HWVA 2H0YA 3N6IA 2J7VA 1K0KA 4QWOA 4QY6A 1K57A 3SZTA 3T1QB 2OLUA 5L07A 3IX8A 4ZJ3A 3C7UA 1PI4A 3UE6A 4UHUA 2OWHA 3R4KA 5AQ7A 3FYZA 1M6KA 3MBZA 4LV3A 5EVEA 3DBAA 3IS2B 3VP1A 1BULA 3B42A 1M40A 4FH4A 4BQMA 1DP8A 2ZQ8A 3HJKA 4HJ3A 1LI0A 4S2KA 4M4XA 1D1JA 4UA6A 3S4XA 3KSHA 3ZG9B 2DMWA 3MZFA 4CLCA 5E2FA 1MWUA 2Y2GA 4PPRA 1XKZA 2WZXA 4A5RA 3HLBA 2C6WB 3ITAA 2WGWA 3LEZA 4EXOA 3BFEA 3PBRA 3BFCA 5CGWA 3LR3A 2WKHA 2WGVA 2Z2LB 4EBLA 2XEPA 3RH8B 2PBDP 4LFUA 3IBRA 4Y0OA 3IF5A 5FAOA 1XXMA 1NLYA 2AVXA 5FAPA 3V3RA 4OPQA 3B33A 3D3OA 4R23A 2JKTI 5GHYA 1LL5A 4HP9A 4FUWA 2Y2LA 2V20A 1K6SA 1CEGA 3EEAA 4U0TA 1SDNA 1SKFA 1TS8A 3ZG5A 3R7WA 4DN0A 5FQIA 4Q0IA 2PAVP 1ES2A 3MSHA 5A90A 5TGFA 1G28A 2ZC4B 4QHCA 5HX9A 3S1YA 4LPZA 1NZUA 4OLDA 4B4XA 3VE3A 5GLDA 2QJ5A 4LRZE 1NJ4A 5E2EA 2LB5A 3T50A 2KX6A 2W3GA 4JXSA 3A3DA 4DJ3A 3NIAA 3IS2A 1HD8A 4U3TA 3LY3A 4DMZA 3IWOA 4EQ1A 2VGJA 1FOFA 1TD5A 3CG5A 3HLEA 1YLZA 3BM6A 4WL9A 5CERA 4R0QA 4RQ9A 1T1CA 3E0YA 3LR5A 5TR7A 1MWRA 1XJ6A 5FQQA 4LCMA 1JTGA 3UPNA 2RL3A 2A3UA 3T1SA 2Y8HA 2J9OA 4KZ5A 1TS6A 5K5BA 3UB8A 4EBPA 1YPRA 2WKIA 1KGFA 4IEDA 3NHQA 1IYPA 2V8CA 3C7VA 1RCJA 3ZCZA 5GHZA 3IX3A 1KDWA 1ES5A 3LIFA 5EVIB 4KENB 4Y7PA 2WGIA 4ME4A 1PZPA 3QP4A 1XFQA 3F1OB 4WEJA 3G30A 1KE3A 2WAFA 3LYXA 5GLBA 1ES4A 3KSFA 1ES3A 3N8SA 4KZ3A 2Y2HA 4UA7A 2W27A 3NOTC 1GA0A 4HESA 4XT2B 5DF7A 5AQ9A 3S7QA 3OPRA 1RGYA 2R9WA 4S2OA 5DJUA 1N9LA 1OTIA 1SDEA 1Y4OA 5AJGA 5CX7A 4R38A 4K0XA 1E4DA 3IXDA 2XROA 3QP2A 1K57C 3MQQA 3CUEC 3T1RA 1YMXA 4HH2A 4DE0A 3DW0A 3GRJA 2Y91A 1YAXA 2XD1A 4LV1A 4RX2A 5CHMA 3ISGA 3PR6A 1ONGA 4XXRA 3KYEA 1OPXA 3PYPA 1GHPA 3Q1FA 1G6OA 1L2SA 4IBXA 1XA7A 2Y55A 2R9XA 4GCZA 1F5MA 3H82B 4PM8A 1D06A 3T12B 4CLCC 4YOFA 4GKUA 2BLSA 1FR1A 4IHQA 5F68A 1NRJA 2OOLA 3BECA 2OAP1 4WELA 5D3OA 2QHKA 1SKOB 2VX8A 1DJAA 4K91A 4HJ6A 1HTZA 4ZRRA 1KGEA 3E4OA 4QPRA 3ZDJA 5J4EA 1L0FA 5CTMA 4QB8A 4Y0UA 5HDDA 1N4OA 3IF6B 2X01A 2HPBA 5EVIA 4PKYA 2JHEA 5DF8A 4FSFA 3T1XA 2IWCA 4R4SA 1Q2QA 2WADA 4DE2A 1ZC2A 1S4SA 3F1OA 2OSUA 3GQZA 4HQAA 3ZHHA 4N1XA 1ZG4A 4ZTKA 4BD0A 5CHJA 2OWJA 4IBRA 3SS3A 3A0RA 2P74A 4XT2A 1U60A 2EWWA 3GVBA 1YT4A 1OTDA 1CI8A 4OPZA 1PIOA 4L9GA 3GSGA 1NWZA 3A0SA 1VQQA 2J9PA 1OT6A 3ZNTA 2JCHA 2QPNA 4BWIA 4KG5A 4PMAA 1OTAA 4LRXC 2QWSA 1KE0A 2GNXA 2Q9NA 1GA9A 3TOIA 3BQ8A 3NJAA 3DWZA 1F98A 3O88A 3TRCA 3V39A 1SHVA 4ZDXA 1QMEA 4EUVA 4WUJA 4NK3A 2JKRI 3IXBA 3AGFA 3WS2A 1A0KA 1DJBA 4I3JA 3MXQA 4ETZA 1CJFA 2WKRA 2PYPA 1TEMA 3ZYTA 4BL3A 2ZMAA 1SKOA 3QNBA 1WYCA 3BW6A 2ZOIA 1YSQA 4KUOA 3BFDA 4EWFA 4GS9B 2Y2OA 1XJ4A 4WF0A 5DF9A 4H6JB 1ERQA 2HV1A 5F69A 1Z6FA 4PAUA 2ZC5B 3Q7ZA 4GLQA 1H8YA 5HW3A 1EW0A 2DRWA 5E2GA 3CWFA 5EOEA 1NZOA 4WMCA 3WS0A 2J80A 2EWVA 2V0UA 1ZHHB 4GD8A 3S7OA 4E3MA 1K54A 2UWXA 3GTCA 4OLGA 3FG8A 1K4EA 1S66L 1DY6A 4GB7A 1JWZA 4HNBA 4P87A 2JKGA 4EUZA 3DTMA 5L2FA 3DTEA 3LGOA 5DTKA 2XFTA 1FCNA 3LIAA 4HIAA 1J9MA 2ACGA 1GHIA 2A24B 3WS5A 2K2NA 1LL9A 2D02A 5IHVA 3PBQA 5TJJA 5TFQA 4XUZA 3VSKA 2RCXA 1ONHA 4N9KA 4HJ4A 4Y5FA 5DKKA 3KX0X 4JKTA 2B95A 4E3JA 4GNUA 3PAGA 1W7FA 1WE4A 3MF0A 5FQ9A 1HZOA 2XRNA 3UY6A 2NUPC 3E2LA 4KQQA 1MZUA 4P6BA 1Q2PA 2EX2A 3MFXA 3HVFA 4M3KA 2EFUA 2H10A 2ZM8A 5FI7A 1NLZA 4GS9A 4ESPA 5FEFA 2W3DA 2I72A 4DDSA 1PWDA 3MFDA 4BBUA 1K4FA 3BLSA 3O86A 3I7JA 4P6ZS 5BOHA 3MR0A 5EVID 5KZHA 1TS7A 5KIZA 3AGDA 1LL8A 5CTNA 4IVIA 4R4RA 5EVIC 1CQAA 4JXGA 2VGLS 1P0ZA 5FL3A 4AFIA 5FA7A 2BASA 4D60A 1NY0A 2A49A 2XA7S 4GJ4A 4E6WA 1K6RA 2IWBA 2ZQCA 1K56A 1PRQA 4O0PA 2PDRA 4II7A 3M2KA 3VE4A 3HLWA 2M7VA 1TS0A 4OQGA 5GHXA 3FKWA 2Y79A 3EQVA 2JKTM 3T4TA 1XJ2A 3CPTB 3PBOA 4P6ZM 2A24A 1KVLA 2GX5A 1VEUB 1ALQA 4ZAMA 3WWXA 3T4QA 3UO9A 4L0LA 3IBJA 1MWSA 5FQMA 1K38A 1YSPA 2WKEA 2VGLM 2PYRA 3VMAA 1LHYA 4BD1A 2XA7M 4OVDA 3ITBA 5FATA 5IT5A 3S22A 1PWGA 5CEBA 3OPLA 3FKVA 3NI9A 4X25A 1ERMA 2KDKA 4OPYA 3SH8A 1YKDA 4ID4A 5LBRA 3LR4A 2J3TD 5CRFA 1BSGA 1XPBA 2J3WA 1DJCA 4S2JA 2B5RA 2P9VB 1T18A 4GZBA 3QP6A 1KVMA 1GHMA 1H8ZA 5HDSA 5HAPA 2J3TC 3N7WA 3LIEA 3NY4A 3U2AA 4BBTA 3HUOA 3S7PA 4JBFA 3NDGA 5GLAA 4MLLA 2L4RA 5KSHA 1C3BA 3IF6C 2GDNA 1P9WA 2O9AA 3DAVA 2LB9A 5DFXA 3PBNA 1PW1A 1PFLA 1E3UD 3T4SA 1K54C 4KZBA 2Y2QA 1KE4A 5FEGA 2Q9MA 3LIBA 4CPKA 1BYWA 1TDLA 3BFGA 2Y59A 4WLAA 3DTKA 2A2LA 1UWNX 3ZVTA 1YQSA 3UE0A 3OOVA 4R6LA 3CPTA 3CITA 1VEUA 4EERA 4KZ8A 1XP4A 3JPUA 3Q7VB 4OP5A 3A3EA 3T4OA 1J3WA 3N4IA 5DVAA 1FQGA 3M2JA 1NYYA 2JN7A 4HI4A 5C5KA 2PR5A 4IUKA 3P01A 2HJ9C 4IJGA 1YLPA 1S1ZA 4BLMA 3SS4A 4JGPA 1FR6A 1OTEA 4OPRA 5MC7A 2P9VA 5L8MA 1PNEA 4F3LA 3FPWA 1O7EA 4N92A 2XSSA 3CAXA 4HEFA 4IUHA 2NUTC 4GDBA 1GSVA 4MBHA 2VV8A 1L0DA 3QP8A 3N8LA 1L0EA 1S4RA 1BZAA 4R3BA 1S0WA 4GD6A 2R78A 3IH9A 4B9OA 3GMWA 4CLCE 5L10A 1ESUA 2GJ3A 2Y2NA 2EX8A 3E2KA 3NBLA 5HWTA 5M19A 3UDIA 5HL6A 1P97A 2V2FF 3TJZC 5HAQA 2V0WA 4JLFA 4X1LA 4O01A 5F83A 3IXHA 3MJQA 4LGWA 2IA2A 2X71A 3CJMA 1WA9A 1CEFA 1NYMA 4B93A 3O5YA 5U47A 1S6RA 1LLBA 5KMWA 4PKYG 3P7NA 4HBUA 4NEED 4C75A 4HOIA 4CLCD 1E25A 2HDQA 3Q7VA 3G34A 4WYYA 2B18A 3MQOA 5M1AA 3KO6A 3M6BA 2V9AA 1OJ5A 4WM9A 1F9IA 2Z2MB 3HLDA 3RFBA 3MKFA 4RA7A 3HCYA 3VOYA 4S2NA 1DP9A 2PD8A 2Y4AA 2ZBBA 3PHYA 2XLNA 5DKLA 1VETB 3VFFA 4OQHA 4GOGA 4R1GA 3MXRA 2HJEA 3F1NB 3IQAA 2H0TA 1K55A 1XA1A 3MZEA 2EX9A 3RTYA 3EEHA 1WYBA 3CI6A 4HHDA 2HF6A 4E3IA 1CK3A 2JKRM 2HZ5A 1YLJA 2O9CA 2OLVA 4ZJ2A 2JKFA 4UEYA 3ZNYA 3MXSA 1VM1A 4KUKA 4GW9A 4NETA 2PU4A 3PBTA 1BLCA 4KG6A 4EU0A 5CGSA 5I94A 5FSRA 1KGGA 4FOFA 2D01A 1IEMA 3OLOA 2OAQ1 4Q0HA 4KQOA 1N9NA 2VKSA 3ZG0A 4HH3A 2XF3A 2PRFA 2PU2A 1Z09A 3NOUC 5A92A 4G3KA 4OP8A 3JYIA 4BENA 3W4PA 3ULFA 1BT5A 4PM7A 1S1YA 5EECA 3HLGA 4OKPA 3QP1A 1N9BA 5CHUA 3NOPC 3UPPA 3TW8A 3RXXA 3O3VA 3IXGA 2VLGA 3ZVWA 4QU3A 1P9RA 3L9KA 5E43A 4MN6A 4EV4A 4EEUA 3FC7A 5FDSA 2QYBA 4X53A 3UB6A 5J7EA 2ZOHA 5HSQA 5HD5A 2MJ6A 3LR0A 1TDGA 5HZHA 4E3NA 3KSGA 3B3XA 1S67L 2ZJ9A 2W3FA 4DF6A 1W8QA 1T1AA 4NXBA 1VETA 2IWDA 2PD7A 1MKMA 4Y15A 1YMSA 3F1NA 2O9BA 3K3DA 5HARA 4CJNA 4N1HA 5HPIA 3S7NA 4DKIA 3V5MA 2ZLYA 1BUEA 1VB6A 4OOYA 3V3SA 3A0VA 1X0OA 3DWKA 4S2LA 1GSXA 1HVBA 1XX2A 3BFFA 2HP5A 2OV5A 3MS6A 1MBLA 4EEPA 1V9YA 4GN2A 1ESIA 3SW1A 3WS1A 4X6TA 1T19A 3UDFA 1W8YA 1LSWA 3P09A 3ZQ5A 4NG2A 4G3WA 5DTSA 3BLMA 4HP4A 2Q0OA 1MKIA 4U0XA 2KOIA 1OT9A 4OQ0A 3BJNA 3O87A 3K3CA 4LCLA 3M6HA 2HGVA 3LUQA 1DP6A 4X69A 4Y13A 4WN5A 4BJPA 4LRYC 3KYZA 5KSCA 3SOIA 2CMNA 4YFMA 5FAQA 4ETXA 1HLUP 4GDNA 2DNSA 4QD4A 4KZAA 1Y28A 3G32A 4DJ2A 3UPOA 1IKIA 2V1BA 4KG2A 2J8YA 5HDCA 4S2NC 2KLIA 1OMEA 4LENA 3D4FA 3UN7A 2FFFB 3NECA 1BLPA 1PYYA 4PM6A 5A93A 3UDXA 1K55C 4ZJ1A 3PXPA 4KQRA 4B88A 2XD5A 3T4KA 4H8RA 2VK3A 3FZCA 5G4ZA 2Z6CA 1BTLA 3VOLA 4JPMA 3KYQA 1KDSA 4F94A 2K31A 5CGXA 1IELA
chains in the Genus database with same CATH topology
4CLCC 4Q0JA 4YOFA 4PHTA 3V67A 2PR6A 3BY9A 4IHQA 4CQHA 3CITA 5F68A 1NRJA 1UWPX 2W1RA 2OOLA 4WELA 2OAP1 4EERA 2QHKA 5DFYA 2VX8A 3ICYA 4ARZB 5A8BA 3EQUA 4HJ6A 3T4OA 5G4YA 3B47A 4ZRRA 1KOUA 3EGXC 2VZWA 4JGOA 3UMEA 3E4OA 4NXEA 4QPRA 3CUEA 2JN7A 4HI4A 5C5KA 5J4EA 3LIDA 2W1TB 1STZA 2PR5A 4L9EA 3BY8A 3P01A 4IUKA 5HDDA 2WKQA 2HJ9C 4IJGA 2O0YA 2Z6DA 1OJGA 3LICA 4PKYA 2JHEA 3EOIA 4FSFA 1S1ZA 4JGPA 5IS1A 1OTEA 4OOMA 5MC7A 3C38A 2H28A 1S4SA 3F1OA 2QKPA 2W3EA 2WKPA 5L8MA 4F3LA 3FPWA 4R70A 1LSVA 4HQAA 3H7WA 3C8CA 2XSSA 3CAXA 4IUHA 2NUTC 4L9FA 4Y2FA 1GSVA 2VV8A 1V9ZA 2OWJA 3PBSA 1S4RA 4G3VA 3A0RA 3VV4A 4XT2A 5HPFA 2R78A 2EWWA 1OTDA 4B9OA 4F3LB 4CLCE 2GJ3A 3GECA 1D7EA 4L9GA 2I9VA 4MN7A 4CLCB 1NWZA 2GZAA 3A0SA 4I5SA 2VEAA 5EFWA 3MQ0A 4MN5A 1OT6A 1XFNA 3C2WA 5HWTA 4BWIA 4MCWA 2QJ7A 3TE8A 3H9WA 5AVEA 4I39A 1IOUA 5HL6A 1OTAA 1P97A 2VA0A 2QWSA 4LRXC 1H3QA 3TJZC 2V0WA 3BQAA 2GNXA 3BQ8A 3NJAA 4O01A 3UE3A 4Z1WA 3UB9A 3MJQA 1F98A 3TRCA 2IA2A 2M7UA 4EUVA 4WUJA 1WA9A 2JKRI 4UQIS 4I3JA 3MXQA 4ETZA 4B93A 3O5YA 4H6JA 5I5LA 2P7JA 2B02A 3JVUA 2WKRA 5F5YA 4PKYG 2PYPA 2ZMVA 3P7NA 3FPVA 4JGRA 4NEED 3ZYTA 3JVVA 4HOIA 4CLCD 3LI8A 3E4PA 3BW6A 2ZOIA 1YSQA 4KUOA 2K7SA 4ARZA 4GS9B 3OBFA 3OCNA 1DRMA 1XJ4A 4WF0A 2B18A 5DF9A 2M1CA 3MQOA 4H6JB 2PT7A 1LT0A 3KO6A 4NXFA 1W63Q 2HV1A 2V9AA 5F69A 4PAUA 1OJ5A 3R7WB 1F9IA 1T1BA 4I3IA 4GLQA 2W1TA 3RFBA 3HCYA 1EW0A 5HWVA 3CWFA 1DP9A 2PD8A 2ZBBA 3PHYA 5DKLA 2J80A 2FZ0A 2EWVA 2V0UA 1ZHHB 2HJEA 3F1NB 3S7OA 4GHIB 4BMWA 4UQIM 3UE6A 3RTYA 3FG8A 2OWHA 1S66L 3R4KA 3EEHA 3CLOA 4EETB 1W63M 3CI6A 2V1AA 3DBAA 3IS2B 4HHDA 4HNBA 2HF6A 3B42A 1XJ3A 1VHMA 2JKRM 1DP8A 3HJKA 4HJ3A 2O9CA 4M4XA 2INWA 3KSHA 2DMWA 4CLCA 1ODVA 3LIAA 4UEYA 4HIAA 3T4JA 4KUKA 5TBMB 4GW9A 3W2ZA 4EXOA 2A24B 2K2NA 3PBTA 1OTBA 2D02A 3PBRA 4MMNA 4NKPA 4EU0A 3D72A 3PBQA 5TJJA 4I3AA 3EGDC 3LR3A 4FOFA 4E04A 2D01A 3OLOA 2OAQ1 4Q0HA 4KQOA 1N9NA 3RH8B 2VKSA 4HJ4A 4Y5FA 2VV7A 5DKKA 4HH3A 3IBRA 3KX0X 3NOUC 1NLYA 4G3KA 3E4QA 3MF0A 2XRNA 4NXGA 3ULFA 2NUPC 1S1YA 5HWWA 1MZUA 3B33A 3D3OA 2L0WA 1IFQA 3MFXA 2PHYA 2JKTI 3NOPC 3F1PB 4HP9A 3TW8A 2VLGA 2EA9A 4MDZA 1NLZA 1P9RA 4GS9A 4MN6A 4EEUA 2W3DA 3FC7A 2QYBA 4HY8A 3UB6A 3EEAA 4BBUA 5J7EA 1TS8A 2ZOHA 5HSQA 5HD5A 2MJ6A 3LR0A 3R7WA 4DN0A 4Q0IA 4P6ZS 4OOLA 5HZHA 3MR0A 1TS7A 3KSGA 5KIZA 1LL8A 1S67L 2W3FA 1T1AA 1G28A 4NXBA 1JNUA 4R3AA 2PD7A 1MKMA 3F1NA 4GHIA 2VGLS 4LPZA 1P0ZA 2O9BA 1TF1A 5FL3A 4AFIA 3VE3A 2BASA 3E98A 3K3DA 4YNRA 2YKHA 2P08A 2XA7S 4GJ4A 2QJ5A 4JGQA 4LRZE 5HPIA 5J3WA 3S7NA 3KSIA 2LB5A 3T50A 2KX6A 2W3GA 4KQDA 4DJ3A 1ZTUA 3BWLA 4O0PA 1VB6A 3IS2A 3A0VA 2PDRA 4DMZA 1X0OA 4EQ1A 4II7A 3VE4A 1TD5A 2M7VA 1GSXA 1TS0A 3UMDA 2ZMFA 4WL9A 3UB7A 3LI9A 4RQ9A 1T1CA 3E0YA 3LR5A 2Y79A 3EQVA 2JKTM 2G7UA 3T4TA 1XJ2A 1XJ6A 5TBMA 4Y3IA 3PBOA 4P6ZM 4EEPA 1V9YA 2A24A 2GX5A 2FH5A 5HD3A 3SW1A 3C30A 1T19A 5IU1A 4EESA 3T4QA 1H8MA 3G6OA 1LSWA 2Y8HA 3IBJA 4K08A 4L0LA 3ZQ5A 1TS6A 5K5BA 1YSPA 3UB8A 2L1MA 2VGLM 2PYRA 3T4LA 2YKFA 4WEKA 4G3WA 3NHQA 2XA7M 2VV6A 4HP4A 5IT5A 2KOIA 1OT9A 3GDIA 3BJNA 3LIFA 3K3CA 2KDKA 3F1PA 3K2NA 1YKDA 2HGVA 5LBRA 3LR4A 3OC2A 4ME4A 2J3TD 3LUQA 1DP6A 2J3WA 2W0NA 2O99A 4O8GA 1XFQA 4WN5A 1T18A 4BJPA 3F1OB 4LRYC 4WEJA 5F6AA 3KYZA 2CMNA 3EWKA 3LYXA 4ETXA 3H7WB 5HDSA 2J3TC 3KSFA 1UGUA 4LLOB 3LIEA 1Y28A 3HJIA 3U2AA 4BBTA 4DJ2A 5DJTA 2V1BA 3S7PA 2W27A 3NOTC 4XT2B 2L4RA 3S7QA 5KSHA 5HDCA 2O9AA 1P9WA 2KLIA 5DJUA 1N9LA 1OTIA 2LB9A 4I38A 2P04A 4BBVA 5DFXA 5AJGA 5CX7A 4R38A 3PBNA 4YWZA 1MC0A 2XROA 3OCLA 3MQQA 3CUEC 5AVFA 3T4SA 2W3HA 4HH2A 1GSWA 3H82A 3PXPA 1YAXA 3LIBA 3PR6A 1OPXA 1BYWA 2VJWA 4EW7A 3PYPA 3T4KA 1G6OA 4WLAA 5G4ZA 2Z6CA 3VOLA 2A2LA 1UWNX 3KYQA 3MMHA 3LFVA 4GCZA 1F5MA 3H82B 1LSXA 1N9OA 3OOVA 4R6LA 2K31A 1D06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR6 A;  3BY9 A;  5F68 A;  1UWP X;  2OOL A;  4EER A;  2QHK A;  3ICY A;  5A8B A;  4HJ6 A;  5G4Y A;  1KOU A;  4JGO A;  3UME A;  3E4O A;  4NXE A;  2JN7 A;  4HI4 A;  5J4E A;  3LID A;  2PR5 A;  4L9E A;  3BY8 A;  5HDD A;  2WKQ A;  2Z6D A;  1OJG A;  3LIC A;  4PKY A;  2JHE A;  1S1Z A;  4JGP A;  5IS1 A;  1OTE A;  2H28 A;  1S4S A;  2QKP A;  2WKP A;  3F1O A;  4F3L A;  4R70 A;  1LSV A;  4HQA A;  3H7W A;  3C8C A;  3CAX A;  4L9F A;  1GSV A;  2VV8 A;  1V9Z A;  2OWJ A;  1S4R A;  3A0R A;  4XT2 A;  2R78 A;  1OTD A;  4B9O A;  4F3L B;  2GJ3 A;  3GEC A;  1D7E A;  4L9G A;  2I9V A;  1NWZ A;  3A0S A;  4I5S A;  2VEA A;  5EFW A;  4MN5 A;  1OT6 A;  1XFN A;  3C2W A;  5HWT A;  2QJ7 A;  3H9W A;  5AVE A;  4I39 A;  1OTA A;  1P97 A;  4LRX C;  2QWS A;  2V0W A;  3NJA A;  3UB9 A;  3MJQ A;  1F98 A;  4WUJ A;  1WA9 A;  4I3J A;  3MXQ A;  4H6J A;  5I5L A;  2P7J A;  2B02 A;  5F5Y A;  2WKR A;  4PKY G;  2PYP A;  3P7N A;  4JGR A;  4HOI A;  3LI8 A;  3E4P A;  2ZOI A;  4KUO A;  2K7S A;  4GS9 B;  1DRM A;  1XJ4 A;  4WF0 A;  2M1C A;  3MQO A;  4H6J B;  1LT0 A;  4NXF A;  2HV1 A;  2V9A A;  5F69 A;  1OJ5 A;  1F9I A;  1T1B A;  4I3I A;  1EW0 A;  5HWV A;  3CWF A;  1DP9 A;  2PD8 A;  2ZBB A;  3PHY A;  5DKL A;  2J80 A;  2V0U A;  3F1N B;  4GHI B;  3UE6 A;  3RTY A;  3FG8 A;  2OWH A;  1S66 L;  3EEH A;  3CLO A;  4EET B;  2V1A A;  3IS2 B;  4HHD A;  4HNB A;  1XJ3 A;  1DP8 A;  3HJK A;  4HJ3 A;  4M4X A;  2INW A;  1ODV A;  3LIA A;  4HIA A;  4KUK A;  5TBM B;  4GW9 A;  4EXO A;  2A24 B;  1OTB A;  2D02 A;  3D72 A;  4I3A A;  4E04 A;  2D01 A;  3OLO A;  1N9N A;  3RH8 B;  4HJ4 A;  2VV7 A;  5DKK A;  4HH3 A;  3IBR A;  3KX0 X;  3NOU C;  3E4Q A;  4NXG A;  3ULF A;  1S1Y A;  5HWW A;  1MZU A;  3B33 A;  2L0W A;  3MFX A;  2PHY A;  3NOP C;  3F1P B;  4HP9 A;  2VLG A;  2EA9 A;  4GS9 A;  4MN6 A;  4EEU A;  3FC7 A;  4HY8 A;  3UB6 A;  4BBU A;  5J7E A;  1TS8 A;  2ZOH A;  5HSQ A;  5HD5 A;  5HZH A;  3MR0 A;  1TS7 A;  5KIZ A;  1LL8 A;  1S67 L;  1T1A A;  1G28 A;  4NXB A;  1JNU A;  4R3A A;  2PD7 A;  3F1N A;  4GHI A;  4LPZ A;  1P0Z A;  3VE3 A;  2BAS A;  3K3D A;  2YKH A;  2QJ5 A;  4JGQ A;  4LRZ E;  5J3W A;  3T50 A;  2KX6 A;  4KQD A;  4DJ3 A;  3BWL A;  1VB6 A;  3IS2 A;  3A0V A;  2PDR A;  1X0O A;  4EQ1 A;  3VE4 A;  1GSX A;  1TS0 A;  3UMD A;  4WL9 A;  3UB7 A;  3LI9 A;  4RQ9 A;  1T1C A;  1XJ2 A;  1XJ6 A;  5TBM A;  4EEP A;  1V9Y A;  2A24 A;  5HD3 A;  3SW1 A;  1T19 A;  5IU1 A;  4EES A;  3G6O A;  1LSW A;  4K08 A;  3ZQ5 A;  1TS6 A;  3UB8 A;  2L1M A;  2PYR A;  2YKF A;  3NHQ A;  2VV6 A;  4HP4 A;  1OT9 A;  3GDI A;  3LIF A;  3K3C A;  2KDK A;  3F1P A;  3LUQ A;  1DP6 A;  2W0N A;  1XFQ A;  4WN5 A;  1T18 A;  3F1O B;  4LRY C;  5F6A A;  2CMN A;  3EWK A;  3LYX A;  3H7W B;  5HDS A;  1UGU A;  4LLO B;  3LIE A;  1Y28 A;  3HJI A;  4DJ2 A;  4BBT A;  5DJT A;  2V1B A;  2W27 A;  3NOT C;  4XT2 B;  2L4R A;  5HDC A;  5DJU A;  1N9L A;  1OTI A;  4I38 A;  4BBV A;  4R38 A;  4YWZ A;  3MQQ A;  5AVF A;  4HH2 A;  1GSW A;  3H82 A;  3LIB A;  1BYW A;  4EW7 A;  3PYP A;  4WLA A;  5G4Z A;  2Z6C A;  3VOL A;  1UWN X;  4GCZ A;  3H82 B;  1LSX A;  1N9O A;  4R6L A;  1D06 A; 
#chains in the Genus database with same CATH topology
 4Q0J A;  4PHT A;  3UB5 P;  1MY8 A;  2EXB A;  4CQH A;  4O7D A;  2Y2J A;  1UWP X;  2W1R A;  5DFY A;  4X1M A;  3WS4 A;  3ICY A;  4N9L A;  4IVK A;  4ARZ B;  5A8B A;  3EQU A;  1EI5 A;  3U4L P;  1KOU A;  3EGX C;  2VZW A;  4JGO A;  3UME A;  4NXE A;  3CUE A;  4ZBE A;  4JF4 A;  3CHW P;  1STZ A;  5DTT A;  4UAA A;  4L9E A;  4YIN A;  3BY8 A;  3IX4 A;  5EOO A;  2C5W B;  1MWT A;  2O0Y A;  2Z6D A;  1OJG A;  3LIC A;  2HDU A;  4FD8 A;  5IS1 A;  5HAI A;  1BLH A;  3C38 A;  4JF5 A;  2WKP A;  4R70 A;  5FQJ A;  2BTF P;  3LY4 A;  3RJU A;  4E3K A;  3VP4 A;  5EM1 A;  4L9F A;  5FQK A;  3VV4 A;  5HPF A;  3CMZ A;  3W4Q A;  4F3L B;  3VFH A;  1JWV A;  2HP6 A;  3OPH A;  3GEC A;  2I9V A;  4MN7 A;  2ZQ9 A;  2GZA A;  1ACF A;  3MQ0 A;  4MN5 A;  4WMC D;  3C2W A;  4P0M A;  3TE8 A;  3H9W A;  1IOU A;  2VA0 A;  4X55 A;  4PM5 A;  4XUX A;  3SH7 A;  2QMI A;  2V1Z A;  3UE3 A;  2G2U A;  3UB9 A;  1Y54 A;  2M7U A;  2WYX A;  4S2M A;  3WRZ A;  4UQI S;  4MEZ A;  3LCE A;  2B02 A;  4DXC A;  4OH0 A;  2ZMV A;  2FFY A;  3JVV A;  1JVJ A;  3LI8 A;  3E4P A;  2E8I A;  1O07 A;  2K7S A;  4ARZ A;  5CEC A;  3OBF A;  3NC8 A;  1DRM A;  3BEB A;  1ZKJ A;  5EE8 A;  2WZZ A;  1LT0 A;  3GV9 A;  4WZ4 A;  4NXF A;  3BYD A;  5FAS A;  4I3I A;  1ERO A;  4DE1 A;  3IHB A;  3Q82 A;  2CC1 A;  2ZC6 B;  2JBF A;  3ZG7 B;  2FZ0 A;  2EXA A;  1LI9 A;  1XGI A;  1JWP A;  4GHI B;  4BMW A;  4UQI M;  1ZG6 A;  4EBN A;  5EUA A;  2ZM2 A;  3L7H A;  3CLO A;  5HFO A;  1G5U A;  2HDS A;  3TSG A;  4EET B;  1W63 M;  3VOZ A;  2V1A A;  3HLF A;  1XJ3 A;  1VHM A;  3C5A A;  2INW A;  2XH9 A;  1AWI A;  4JF6 A;  1ODV A;  1H5X A;  3PTE A;  3NCK A;  3T4J A;  5TBM B;  4X56 A;  3W2Z A;  1IYQ A;  2WAE A;  1OTB A;  4MMN A;  3G35 A;  4NKP A;  3VP3 A;  3D72 A;  3MKE A;  5CXW A;  4I3A A;  3EGD C;  3ZG8 B;  2Y2M A;  4E04 A;  1I2W A;  1JTD A;  3NDE A;  2VV7 A;  3IWQ A;  1K56 D;  3E4Q A;  2E8J A;  2XDM A;  5M18 A;  5EV0 A;  4NXG A;  5L09 A;  4MBF A;  5HWW A;  5F1F A;  2L0W A;  1IFQ A;  3IWI A;  2PHY A;  5A91 A;  4JXW A;  1I2S A;  3A3I A;  3F1P B;  3IH8 A;  2EA9 A;  4MDZ A;  3G2Z A;  1IYO A;  2ZD8 A;  5JYP A;  4LV0 A;  4HY8 A;  1H0M A;  5FDH A;  1SCW A;  4OOL A;  2ZQA A;  1IKG A;  1MPL A;  2PBY A;  1TVF A;  1YLW A;  1JNU A;  4R3A A;  1RP5 A;  3HBR A;  4KZ4 A;  4GHI A;  5JYO A;  3CZD A;  1TF1 A;  4FCF A;  5FI2 A;  3E98 A;  5E2H A;  4YNR A;  5CED A;  2YKH A;  2P08 A;  4RYE A;  2ZC7 A;  1FSW A;  4JGQ A;  1FIK A;  1NXY A;  5J3W A;  3KSI A;  4R3J A;  2XFS A;  3OPP A;  4KQD A;  2WK0 A;  1ZTU A;  4E6X A;  3BWL A;  5HL1 A;  4OON A;  4WBG A;  3D9Y A;  1EWZ A;  3UNW A;  3UMD A;  2ZMF A;  3UB7 A;  5GLC A;  2V8F A;  3LI9 A;  4MBK A;  3G2Y A;  5J8X A;  2G7U A;  5TBM A;  4Y3I A;  4PM9 A;  1SZV A;  2FH5 A;  5HD3 A;  1IYS A;  4WZ5 A;  4X68 A;  1W5D A;  2QZ6 A;  3NUL A;  3C30 A;  2ZL1 B;  1AXB A;  5IU1 A;  4EES A;  1H8M A;  3G6O A;  4K08 A;  2XR0 A;  1QMF A;  2L1M A;  1YLT A;  4KZ7 A;  4E3L A;  3T4L A;  2YKF A;  4P85 A;  3N8R A;  1L3L A;  4WEK A;  4BL2 A;  2VV6 A;  4E3O A;  3HUN A;  3GDI A;  2Y2I A;  1FIL A;  3F1P A;  3K2N A;  5FI6 A;  3OC2 A;  2VGK A;  4QJG A;  2W0N A;  3C4P A;  4MNR A;  2O99 A;  4O8G A;  3VP2 A;  1PWC A;  3HUM A;  3MZD A;  5F6A A;  4KZ6 A;  3EWK A;  3H7W B;  3WRT A;  1UGU A;  4LLO B;  3HJI A;  2G2W A;  5DJT A;  1PI5 A;  1G6A A;  1GCE A;  4I38 A;  2P04 A;  4BBV A;  1W79 A;  4YWZ A;  1MC0 A;  1L0G A;  1PZO A;  1FSY A;  3OCL A;  1F2K A;  5AVF A;  2W3H A;  4K0W A;  3FWL A;  3QHY A;  3IT9 A;  1GSW A;  3H82 A;  2HP9 A;  3QP5 A;  4B4Z A;  2HDR A;  3ZGA B;  2VJW A;  4EW7 A;  3HLC A;  3IHA A;  3P98 A;  3MMH A;  3LFV A;  2DCF A;  3Q81 A;  1LSX A;  1N9O A;  3PAE A;  3V67 A;  3SH9 A;  2PR6 A;  3BY9 A;  3A3F A;  3A3J A;  2JE5 A;  3HRE A;  3LEQ A;  4JXV A;  4DE3 A;  2XQZ A;  2ZL1 A;  2ZQ7 A;  3IF6 A;  5G4Y A;  2XGN A;  3SS5 A;  3B47 A;  1XGJ A;  3C4O A;  2EFX A;  3Q07 A;  4Y0T A;  3VP0 A;  3LID A;  2W1T B;  1YM1 A;  2WKQ A;  5F1G A;  1E3U A;  3EOI A;  5AQA A;  3FV7 A;  5EM0 A;  4Y17 A;  4D2O A;  4FH2 A;  1G68 A;  4OOM A;  3G31 A;  2H28 A;  3TG9 A;  2QKP A;  2W3E A;  2H5S A;  1LSV A;  4S2I A;  3H7W A;  3C8C A;  1K25 A;  1CI9 A;  2ZQD A;  5AQB A;  2X02 A;  2EX6 A;  4Y2F A;  1V9Z A;  5G18 A;  3PBS A;  3UE1 A;  4FTX A;  4G3V A;  3GR2 A;  4KZ9 A;  2JC7 A;  2Y2K A;  1YLY A;  1D7E A;  4UA9 A;  4RVA A;  4CLC B;  4I5S A;  2VEA A;  3AGE A;  5EFW A;  1FCM A;  3RXW A;  4Q8I A;  1RGZ A;  2WGW B;  1XFN A;  4MCW A;  2QJ7 A;  3VSL A;  5AVE A;  4I39 A;  2ZC3 B;  3OZH A;  3ZFZ A;  5EPH A;  1H3Q A;  5F82 A;  3LO7 A;  4S2P A;  3BQA A;  4DRT A;  4LV2 A;  4Z1W A;  3W4O A;  1CF0 A;  3DTI A;  3QNC A;  4OQI A;  2UV0 E;  1BLS A;  3BRM A;  4HBT A;  4DXB A;  4H6J A;  5I5L A;  3W8K A;  2P7J A;  1MXO A;  3JVU A;  5F5Y A;  1FCO A;  1NRF A;  5GL9 A;  3FPV A;  4JGR A;  4C3Q A;  1I5Q A;  2Y2P A;  3G4P A;  4WZ5 C;  2BG1 A;  4DDY A;  2XK1 A;  2WUQ A;  4Z9Q A;  5EVL A;  3OCN A;  2M1C A;  2ZM0 A;  2PT7 A;  1W63 Q;  1PW8 A;  3R7W B;  1T1B A;  4C6Y A;  4RX3 A;  4QY5 A;  3V50 A;  2W1T A;  4EQI A;  3HL9 A;  5HWV A;  2H0Y A;  3N6I A;  2J7V A;  1K0K A;  4QWO A;  4QY6 A;  1K57 A;  3SZT A;  3T1Q B;  2OLU A;  5L07 A;  3IX8 A;  4ZJ3 A;  3C7U A;  1PI4 A;  3UE6 A;  4UHU A;  2OWH A;  3R4K A;  5AQ7 A;  3FYZ A;  1M6K A;  3MBZ A;  4LV3 A;  5EVE A;  3DBA A;  3IS2 B;  3VP1 A;  1BUL A;  3B42 A;  1M40 A;  4FH4 A;  4BQM A;  1DP8 A;  2ZQ8 A;  3HJK A;  4HJ3 A;  1LI0 A;  4S2K A;  4M4X A;  1D1J A;  4UA6 A;  3S4X A;  3KSH A;  3ZG9 B;  2DMW A;  3MZF A;  4CLC A;  5E2F A;  1MWU A;  2Y2G A;  4PPR A;  1XKZ A;  2WZX A;  4A5R A;  3HLB A;  2C6W B;  3ITA A;  2WGW A;  3LEZ A;  4EXO A;  3BFE A;  3PBR A;  3BFC A;  5CGW A;  3LR3 A;  2WKH A;  2WGV A;  2Z2L B;  4EBL A;  2XEP A;  3RH8 B;  2PBD P;  4LFU A;  3IBR A;  4Y0O A;  3IF5 A;  5FAO A;  1XXM A;  1NLY A;  2AVX A;  5FAP A;  3V3R A;  4OPQ A;  3B33 A;  3D3O A;  4R23 A;  2JKT I;  5GHY A;  1LL5 A;  4HP9 A;  4FUW A;  2Y2L A;  2V20 A;  1K6S A;  1CEG A;  3EEA A;  4U0T A;  1SDN A;  1SKF A;  1TS8 A;  3ZG5 A;  3R7W A;  4DN0 A;  5FQI A;  4Q0I A;  2PAV P;  1ES2 A;  3MSH A;  5A90 A;  5TGF A;  1G28 A;  2ZC4 B;  4QHC A;  5HX9 A;  3S1Y A;  4LPZ A;  1NZU A;  4OLD A;  4B4X A;  3VE3 A;  5GLD A;  2QJ5 A;  4LRZ E;  1NJ4 A;  5E2E A;  2LB5 A;  3T50 A;  2KX6 A;  2W3G A;  4JXS A;  3A3D A;  4DJ3 A;  3NIA A;  3IS2 A;  1HD8 A;  4U3T A;  3LY3 A;  4DMZ A;  3IWO A;  4EQ1 A;  2VGJ A;  1FOF A;  1TD5 A;  3CG5 A;  3HLE A;  1YLZ A;  3BM6 A;  4WL9 A;  5CER A;  4R0Q A;  4RQ9 A;  1T1C A;  3E0Y A;  3LR5 A;  5TR7 A;  1MWR A;  1XJ6 A;  5FQQ A;  4LCM A;  1JTG A;  3UPN A;  2RL3 A;  2A3U A;  3T1S A;  2Y8H A;  2J9O A;  4KZ5 A;  1TS6 A;  5K5B A;  3UB8 A;  4EBP A;  1YPR A;  2WKI A;  1KGF A;  4IED A;  3NHQ A;  1IYP A;  2V8C A;  3C7V A;  1RCJ A;  3ZCZ A;  5GHZ A;  3IX3 A;  1KDW A;  1ES5 A;  3LIF A;  5EVI B;  4KEN B;  4Y7P A;  2WGI A;  4ME4 A;  1PZP A;  3QP4 A;  1XFQ A;  3F1O B;  4WEJ A;  3G30 A;  1KE3 A;  2WAF A;  3LYX A;  5GLB A;  1ES4 A;  3KSF A;  1ES3 A;  3N8S A;  4KZ3 A;  2Y2H A;  4UA7 A;  2W27 A;  3NOT C;  1GA0 A;  4HES A;  4XT2 B;  5DF7 A;  5AQ9 A;  3S7Q A;  3OPR A;  1RGY A;  2R9W A;  4S2O A;  5DJU A;  1N9L A;  1OTI A;  1SDE A;  1Y4O A;  5AJG A;  5CX7 A;  4R38 A;  4K0X A;  1E4D A;  3IXD A;  2XRO A;  3QP2 A;  1K57 C;  3MQQ A;  3CUE C;  3T1R A;  1YMX A;  4HH2 A;  4DE0 A;  3DW0 A;  3GRJ A;  2Y91 A;  1YAX A;  2XD1 A;  4LV1 A;  4RX2 A;  5CHM A;  3ISG A;  3PR6 A;  1ONG A;  4XXR A;  3KYE A;  1OPX A;  3PYP A;  1GHP A;  3Q1F A;  1G6O A;  1L2S A;  4IBX A;  1XA7 A;  2Y55 A;  2R9X A;  4GCZ A;  1F5M A;  3H82 B;  4PM8 A;  1D06 A;  3T12 B;  4CLC C;  4YOF A;  4GKU A;  2BLS A;  1FR1 A;  4IHQ A;  5F68 A;  1NRJ A;  2OOL A;  3BEC A;  2OAP 1;  4WEL A;  5D3O A;  2QHK A;  1SKO B;  2VX8 A;  1DJA A;  4K91 A;  4HJ6 A;  1HTZ A;  4ZRR A;  1KGE A;  3E4O A;  4QPR A;  3ZDJ A;  5J4E A;  1L0F A;  5CTM A;  4QB8 A;  4Y0U A;  5HDD A;  1N4O A;  3IF6 B;  2X01 A;  2HPB A;  5EVI A;  4PKY A;  2JHE A;  5DF8 A;  4FSF A;  3T1X A;  2IWC A;  4R4S A;  1Q2Q A;  2WAD A;  4DE2 A;  1ZC2 A;  1S4S A;  3F1O A;  2OSU A;  3GQZ A;  4HQA A;  3ZHH A;  4N1X A;  1ZG4 A;  4ZTK A;  4BD0 A;  5CHJ A;  2OWJ A;  4IBR A;  3SS3 A;  3A0R A;  2P74 A;  4XT2 A;  1U60 A;  2EWW A;  3GVB A;  1YT4 A;  1OTD A;  1CI8 A;  4OPZ A;  1PIO A;  4L9G A;  3GSG A;  1NWZ A;  3A0S A;  1VQQ A;  2J9P A;  1OT6 A;  3ZNT A;  2JCH A;  2QPN A;  4BWI A;  4KG5 A;  4PMA A;  1OTA A;  4LRX C;  2QWS A;  1KE0 A;  2GNX A;  2Q9N A;  1GA9 A;  3TOI A;  3BQ8 A;  3NJA A;  3DWZ A;  1F98 A;  3O88 A;  3TRC A;  3V39 A;  1SHV A;  4ZDX A;  1QME A;  4EUV A;  4WUJ A;  4NK3 A;  2JKR I;  3IXB A;  3AGF A;  3WS2 A;  1A0K A;  1DJB A;  4I3J A;  3MXQ A;  4ETZ A;  1CJF A;  2WKR A;  2PYP A;  1TEM A;  3ZYT A;  4BL3 A;  2ZMA A;  1SKO A;  3QNB A;  1WYC A;  3BW6 A;  2ZOI A;  1YSQ A;  4KUO A;  3BFD A;  4EWF A;  4GS9 B;  2Y2O A;  1XJ4 A;  4WF0 A;  5DF9 A;  4H6J B;  1ERQ A;  2HV1 A;  5F69 A;  1Z6F A;  4PAU A;  2ZC5 B;  3Q7Z A;  4GLQ A;  1H8Y A;  5HW3 A;  1EW0 A;  2DRW A;  5E2G A;  3CWF A;  5EOE A;  1NZO A;  4WMC A;  3WS0 A;  2J80 A;  2EWV A;  2V0U A;  1ZHH B;  4GD8 A;  3S7O A;  4E3M A;  1K54 A;  2UWX A;  3GTC A;  4OLG A;  3FG8 A;  1K4E A;  1S66 L;  1DY6 A;  4GB7 A;  1JWZ A;  4HNB A;  4P87 A;  2JKG A;  4EUZ A;  3DTM A;  5L2F A;  3DTE A;  3LGO A;  5DTK A;  2XFT A;  1FCN A;  3LIA A;  4HIA A;  1J9M A;  2ACG A;  1GHI A;  2A24 B;  3WS5 A;  2K2N A;  1LL9 A;  2D02 A;  5IHV A;  3PBQ A;  5TJJ A;  5TFQ A;  4XUZ A;  3VSK A;  2RCX A;  1ONH A;  4N9K A;  4HJ4 A;  4Y5F A;  5DKK A;  3KX0 X;  4JKT A;  2B95 A;  4E3J A;  4GNU A;  3PAG A;  1W7F A;  1WE4 A;  3MF0 A;  5FQ9 A;  1HZO A;  2XRN A;  3UY6 A;  2NUP C;  3E2L A;  4KQQ A;  1MZU A;  4P6B A;  1Q2P A;  2EX2 A;  3MFX A;  3HVF A;  4M3K A;  2EFU A;  2H10 A;  2ZM8 A;  5FI7 A;  1NLZ A;  4GS9 A;  4ESP A;  5FEF A;  2W3D A;  2I72 A;  4DDS A;  1PWD A;  3MFD A;  4BBU A;  1K4F A;  3BLS A;  3O86 A;  3I7J A;  4P6Z S;  5BOH A;  3MR0 A;  5EVI D;  5KZH A;  1TS7 A;  5KIZ A;  3AGD A;  1LL8 A;  5CTN A;  4IVI A;  4R4R A;  5EVI C;  1CQA A;  4JXG A;  2VGL S;  1P0Z A;  5FL3 A;  4AFI A;  5FA7 A;  2BAS A;  4D60 A;  1NY0 A;  2A49 A;  2XA7 S;  4GJ4 A;  4E6W A;  1K6R A;  2IWB A;  2ZQC A;  1K56 A;  1PRQ A;  4O0P A;  2PDR A;  4II7 A;  3M2K A;  3VE4 A;  3HLW A;  2M7V A;  1TS0 A;  4OQG A;  5GHX A;  3FKW A;  2Y79 A;  3EQV A;  2JKT M;  3T4T A;  1XJ2 A;  3CPT B;  3PBO A;  4P6Z M;  2A24 A;  1KVL A;  2GX5 A;  1VEU B;  1ALQ A;  4ZAM A;  3WWX A;  3T4Q A;  3UO9 A;  4L0L A;  3IBJ A;  1MWS A;  5FQM A;  1K38 A;  1YSP A;  2WKE A;  2VGL M;  2PYR A;  3VMA A;  1LHY A;  4BD1 A;  2XA7 M;  4OVD A;  3ITB A;  5FAT A;  5IT5 A;  3S22 A;  1PWG A;  5CEB A;  3OPL A;  3FKV A;  3NI9 A;  4X25 A;  1ERM A;  2KDK A;  4OPY A;  3SH8 A;  1YKD A;  4ID4 A;  5LBR A;  3LR4 A;  2J3T D;  5CRF A;  1BSG A;  1XPB A;  2J3W A;  1DJC A;  4S2J A;  2B5R A;  2P9V B;  1T18 A;  4GZB A;  3QP6 A;  1KVM A;  1GHM A;  1H8Z A;  5HDS A;  5HAP A;  2J3T C;  3N7W A;  3LIE A;  3NY4 A;  3U2A A;  4BBT A;  3HUO A;  3S7P A;  4JBF A;  3NDG A;  5GLA A;  4MLL A;  2L4R A;  5KSH A;  1C3B A;  3IF6 C;  2GDN A;  1P9W A;  2O9A A;  3DAV A;  2LB9 A;  5DFX A;  3PBN A;  1PW1 A;  1PFL A;  1E3U D;  3T4S A;  1K54 C;  4KZB A;  2Y2Q A;  1KE4 A;  5FEG A;  2Q9M A;  3LIB A;  4CPK A;  1BYW A;  1TDL A;  3BFG A;  2Y59 A;  4WLA A;  3DTK A;  2A2L A;  1UWN X;  3ZVT A;  1YQS A;  3UE0 A;  3OOV A;  4R6L A;  3CPT A;  3CIT A;  1VEU A;  4EER A;  4KZ8 A;  1XP4 A;  3JPU A;  3Q7V B;  4OP5 A;  3A3E A;  3T4O A;  1J3W A;  3N4I A;  5DVA A;  1FQG A;  3M2J A;  1NYY A;  2JN7 A;  4HI4 A;  5C5K A;  2PR5 A;  4IUK A;  3P01 A;  2HJ9 C;  4IJG A;  1YLP A;  1S1Z A;  4BLM A;  3SS4 A;  4JGP A;  1FR6 A;  1OTE A;  4OPR A;  5MC7 A;  2P9V A;  5L8M A;  1PNE A;  4F3L A;  3FPW A;  1O7E A;  4N92 A;  2XSS A;  3CAX A;  4HEF A;  4IUH A;  2NUT C;  4GDB A;  1GSV A;  4MBH A;  2VV8 A;  1L0D A;  3QP8 A;  3N8L A;  1L0E A;  1S4R A;  1BZA A;  4R3B A;  1S0W A;  4GD6 A;  2R78 A;  3IH9 A;  4B9O A;  3GMW A;  4CLC E;  5L10 A;  1ESU A;  2GJ3 A;  2Y2N A;  2EX8 A;  3E2K A;  3NBL A;  5HWT A;  5M19 A;  3UDI A;  5HL6 A;  1P97 A;  2V2F F;  3TJZ C;  5HAQ A;  2V0W A;  4JLF A;  4X1L A;  4O01 A;  5F83 A;  3IXH A;  3MJQ A;  4LGW A;  2IA2 A;  2X71 A;  3CJM A;  1WA9 A;  1CEF A;  1NYM A;  4B93 A;  3O5Y A;  5U47 A;  1S6R A;  1LLB A;  5KMW A;  4PKY G;  3P7N A;  4HBU A;  4NEE D;  4C75 A;  4HOI A;  4CLC D;  1E25 A;  2HDQ A;  3Q7V A;  3G34 A;  4WYY A;  2B18 A;  3MQO A;  5M1A A;  3KO6 A;  3M6B A;  2V9A A;  1OJ5 A;  4WM9 A;  1F9I A;  2Z2M B;  3HLD A;  3RFB A;  3MKF A;  4RA7 A;  3HCY A;  3VOY A;  4S2N A;  1DP9 A;  2PD8 A;  2Y4A A;  2ZBB A;  3PHY A;  2XLN A;  5DKL A;  1VET B;  3VFF A;  4OQH A;  4GOG A;  4R1G A;  3MXR A;  2HJE A;  3F1N B;  3IQA A;  2H0T A;  1K55 A;  1XA1 A;  3MZE A;  2EX9 A;  3RTY A;  3EEH A;  1WYB A;  3CI6 A;  4HHD A;  2HF6 A;  4E3I A;  1CK3 A;  2JKR M;  2HZ5 A;  1YLJ A;  2O9C A;  2OLV A;  4ZJ2 A;  2JKF A;  4UEY A;  3ZNY A;  3MXS A;  1VM1 A;  4KUK A;  4GW9 A;  4NET A;  2PU4 A;  3PBT A;  1BLC A;  4KG6 A;  4EU0 A;  5CGS A;  5I94 A;  5FSR A;  1KGG A;  4FOF A;  2D01 A;  1IEM A;  3OLO A;  2OAQ 1;  4Q0H A;  4KQO A;  1N9N A;  2VKS A;  3ZG0 A;  4HH3 A;  2XF3 A;  2PRF A;  2PU2 A;  1Z09 A;  3NOU C;  5A92 A;  4G3K A;  4OP8 A;  3JYI A;  4BEN A;  3W4P A;  3ULF A;  1BT5 A;  4PM7 A;  1S1Y A;  5EEC A;  3HLG A;  4OKP A;  3QP1 A;  1N9B A;  5CHU A;  3NOP C;  3UPP A;  3TW8 A;  3RXX A;  3O3V A;  3IXG A;  2VLG A;  3ZVW A;  4QU3 A;  1P9R A;  3L9K A;  5E43 A;  4MN6 A;  4EV4 A;  4EEU A;  3FC7 A;  5FDS A;  2QYB A;  4X53 A;  3UB6 A;  5J7E A;  2ZOH A;  5HSQ A;  5HD5 A;  2MJ6 A;  3LR0 A;  1TDG A;  5HZH A;  4E3N A;  3KSG A;  3B3X A;  1S67 L;  2ZJ9 A;  2W3F A;  4DF6 A;  1W8Q A;  1T1A A;  4NXB A;  1VET A;  2IWD A;  2PD7 A;  1MKM A;  4Y15 A;  1YMS A;  3F1N A;  2O9B A;  3K3D A;  5HAR A;  4CJN A;  4N1H A;  5HPI A;  3S7N A;  4DKI A;  3V5M A;  2ZLY A;  1BUE A;  1VB6 A;  4OOY A;  3V3S A;  3A0V A;  1X0O A;  3DWK A;  4S2L A;  1GSX A;  1HVB A;  1XX2 A;  3BFF A;  2HP5 A;  2OV5 A;  3MS6 A;  1MBL A;  4EEP A;  1V9Y A;  4GN2 A;  1ESI A;  3SW1 A;  3WS1 A;  4X6T A;  1T19 A;  3UDF A;  1W8Y A;  1LSW A;  3P09 A;  3ZQ5 A;  4NG2 A;  4G3W A;  5DTS A;  3BLM A;  4HP4 A;  2Q0O A;  1MKI A;  4U0X A;  2KOI A;  1OT9 A;  4OQ0 A;  3BJN A;  3O87 A;  3K3C A;  4LCL A;  3M6H A;  2HGV A;  3LUQ A;  1DP6 A;  4X69 A;  4Y13 A;  4WN5 A;  4BJP A;  4LRY C;  3KYZ A;  5KSC A;  3SOI A;  2CMN A;  4YFM A;  5FAQ A;  4ETX A;  1HLU P;  4GDN A;  2DNS A;  4QD4 A;  4KZA A;  1Y28 A;  3G32 A;  4DJ2 A;  3UPO A;  1IKI A;  2V1B A;  4KG2 A;  2J8Y A;  5HDC A;  4S2N C;  2KLI A;  1OME A;  4LEN A;  3D4F A;  3UN7 A;  2FFF B;  3NEC A;  1BLP A;  1PYY A;  4PM6 A;  5A93 A;  3UDX A;  1K55 C;  4ZJ1 A;  3PXP A;  4KQR A;  4B88 A;  2XD5 A;  3T4K A;  4H8R A;  2VK3 A;  3FZC A;  5G4Z A;  2Z6C A;  1BTL A;  3VOL A;  4JPM A;  3KYQ A;  1KDS A;  4F94 A;  2K31 A;  5CGX A;  1IEL A; 
#chains in the Genus database with same CATH homology
 4CLC C;  4Q0J A;  4YOF A;  4PHT A;  3V67 A;  2PR6 A;  3BY9 A;  4IHQ A;  4CQH A;  3CIT A;  5F68 A;  1NRJ A;  1UWP X;  2W1R A;  2OOL A;  4WEL A;  2OAP 1;  4EER A;  2QHK A;  5DFY A;  2VX8 A;  3ICY A;  4ARZ B;  5A8B A;  3EQU A;  4HJ6 A;  3T4O A;  5G4Y A;  3B47 A;  4ZRR A;  1KOU A;  3EGX C;  2VZW A;  4JGO A;  3UME A;  3E4O A;  4NXE A;  4QPR A;  3CUE A;  2JN7 A;  4HI4 A;  5C5K A;  5J4E A;  3LID A;  2W1T B;  1STZ A;  2PR5 A;  4L9E A;  3BY8 A;  3P01 A;  4IUK A;  5HDD A;  2WKQ A;  2HJ9 C;  4IJG A;  2O0Y A;  2Z6D A;  1OJG A;  3LIC A;  4PKY A;  2JHE A;  3EOI A;  4FSF A;  1S1Z A;  4JGP A;  5IS1 A;  1OTE A;  4OOM A;  5MC7 A;  3C38 A;  2H28 A;  1S4S A;  3F1O A;  2QKP A;  2W3E A;  2WKP A;  5L8M A;  4F3L A;  3FPW A;  4R70 A;  1LSV A;  4HQA A;  3H7W A;  3C8C A;  2XSS A;  3CAX A;  4IUH A;  2NUT C;  4L9F A;  4Y2F A;  1GSV A;  2VV8 A;  1V9Z A;  2OWJ A;  3PBS A;  1S4R A;  4G3V A;  3A0R A;  3VV4 A;  4XT2 A;  5HPF A;  2R78 A;  2EWW A;  1OTD A;  4B9O A;  4F3L B;  4CLC E;  2GJ3 A;  3GEC A;  1D7E A;  4L9G A;  2I9V A;  4MN7 A;  4CLC B;  1NWZ A;  2GZA A;  3A0S A;  4I5S A;  2VEA A;  5EFW A;  3MQ0 A;  4MN5 A;  1OT6 A;  1XFN A;  3C2W A;  5HWT A;  4BWI A;  4MCW A;  2QJ7 A;  3TE8 A;  3H9W A;  5AVE A;  4I39 A;  1IOU A;  5HL6 A;  1OTA A;  1P97 A;  2VA0 A;  2QWS A;  4LRX C;  1H3Q A;  3TJZ C;  2V0W A;  3BQA A;  2GNX A;  3BQ8 A;  3NJA A;  4O01 A;  3UE3 A;  4Z1W A;  3UB9 A;  3MJQ A;  1F98 A;  3TRC A;  2IA2 A;  2M7U A;  4EUV A;  4WUJ A;  1WA9 A;  2JKR I;  4UQI S;  4I3J A;  3MXQ A;  4ETZ A;  4B93 A;  3O5Y A;  4H6J A;  5I5L A;  2P7J A;  2B02 A;  3JVU A;  2WKR A;  5F5Y A;  4PKY G;  2PYP A;  2ZMV A;  3P7N A;  3FPV A;  4JGR A;  4NEE D;  3ZYT A;  3JVV A;  4HOI A;  4CLC D;  3LI8 A;  3E4P A;  3BW6 A;  2ZOI A;  1YSQ A;  4KUO A;  2K7S A;  4ARZ A;  4GS9 B;  3OBF A;  3OCN A;  1DRM A;  1XJ4 A;  4WF0 A;  2B18 A;  5DF9 A;  2M1C A;  3MQO A;  4H6J B;  2PT7 A;  1LT0 A;  3KO6 A;  4NXF A;  1W63 Q;  2HV1 A;  2V9A A;  5F69 A;  4PAU A;  1OJ5 A;  3R7W B;  1F9I A;  1T1B A;  4I3I A;  4GLQ A;  2W1T A;  3RFB A;  3HCY A;  1EW0 A;  5HWV A;  3CWF A;  1DP9 A;  2PD8 A;  2ZBB A;  3PHY A;  5DKL A;  2J80 A;  2FZ0 A;  2EWV A;  2V0U A;  1ZHH B;  2HJE A;  3F1N B;  3S7O A;  4GHI B;  4BMW A;  4UQI M;  3UE6 A;  3RTY A;  3FG8 A;  2OWH A;  1S66 L;  3R4K A;  3EEH A;  3CLO A;  4EET B;  1W63 M;  3CI6 A;  2V1A A;  3DBA A;  3IS2 B;  4HHD A;  4HNB A;  2HF6 A;  3B42 A;  1XJ3 A;  1VHM A;  2JKR M;  1DP8 A;  3HJK A;  4HJ3 A;  2O9C A;  4M4X A;  2INW A;  3KSH A;  2DMW A;  4CLC A;  1ODV A;  3LIA A;  4UEY A;  4HIA A;  3T4J A;  4KUK A;  5TBM B;  4GW9 A;  3W2Z A;  4EXO A;  2A24 B;  2K2N A;  3PBT A;  1OTB A;  2D02 A;  3PBR A;  4MMN A;  4NKP A;  4EU0 A;  3D72 A;  3PBQ A;  5TJJ A;  4I3A A;  3EGD C;  3LR3 A;  4FOF A;  4E04 A;  2D01 A;  3OLO A;  2OAQ 1;  4Q0H A;  4KQO A;  1N9N A;  3RH8 B;  2VKS A;  4HJ4 A;  4Y5F A;  2VV7 A;  5DKK A;  4HH3 A;  3IBR A;  3KX0 X;  3NOU C;  1NLY A;  4G3K A;  3E4Q A;  3MF0 A;  2XRN A;  4NXG A;  3ULF A;  2NUP C;  1S1Y A;  5HWW A;  1MZU A;  3B33 A;  3D3O A;  2L0W A;  1IFQ A;  3MFX A;  2PHY A;  2JKT I;  3NOP C;  3F1P B;  4HP9 A;  3TW8 A;  2VLG A;  2EA9 A;  4MDZ A;  1NLZ A;  1P9R A;  4GS9 A;  4MN6 A;  4EEU A;  2W3D A;  3FC7 A;  2QYB A;  4HY8 A;  3UB6 A;  3EEA A;  4BBU A;  5J7E A;  1TS8 A;  2ZOH A;  5HSQ A;  5HD5 A;  2MJ6 A;  3LR0 A;  3R7W A;  4DN0 A;  4Q0I A;  4P6Z S;  4OOL A;  5HZH A;  3MR0 A;  1TS7 A;  3KSG A;  5KIZ A;  1LL8 A;  1S67 L;  2W3F A;  1T1A A;  1G28 A;  4NXB A;  1JNU A;  4R3A A;  2PD7 A;  1MKM A;  3F1N A;  4GHI A;  2VGL S;  4LPZ A;  1P0Z A;  2O9B A;  1TF1 A;  5FL3 A;  4AFI A;  3VE3 A;  2BAS A;  3E98 A;  3K3D A;  4YNR A;  2YKH A;  2P08 A;  2XA7 S;  4GJ4 A;  2QJ5 A;  4JGQ A;  4LRZ E;  5HPI A;  5J3W A;  3S7N A;  3KSI A;  2LB5 A;  3T50 A;  2KX6 A;  2W3G A;  4KQD A;  4DJ3 A;  1ZTU A;  3BWL A;  4O0P A;  1VB6 A;  3IS2 A;  3A0V A;  2PDR A;  4DMZ A;  1X0O A;  4EQ1 A;  4II7 A;  3VE4 A;  1TD5 A;  2M7V A;  1GSX A;  1TS0 A;  3UMD A;  2ZMF A;  4WL9 A;  3UB7 A;  3LI9 A;  4RQ9 A;  1T1C A;  3E0Y A;  3LR5 A;  2Y79 A;  3EQV A;  2JKT M;  2G7U A;  3T4T A;  1XJ2 A;  1XJ6 A;  5TBM A;  4Y3I A;  3PBO A;  4P6Z M;  4EEP A;  1V9Y A;  2A24 A;  2GX5 A;  2FH5 A;  5HD3 A;  3SW1 A;  3C30 A;  1T19 A;  5IU1 A;  4EES A;  3T4Q A;  1H8M A;  3G6O A;  1LSW A;  2Y8H A;  3IBJ A;  4K08 A;  4L0L A;  3ZQ5 A;  1TS6 A;  5K5B A;  1YSP A;  3UB8 A;  2L1M A;  2VGL M;  2PYR A;  3T4L A;  2YKF A;  4WEK A;  4G3W A;  3NHQ A;  2XA7 M;  2VV6 A;  4HP4 A;  5IT5 A;  2KOI A;  1OT9 A;  3GDI A;  3BJN A;  3LIF A;  3K3C A;  2KDK A;  3F1P A;  3K2N A;  1YKD A;  2HGV A;  5LBR A;  3LR4 A;  3OC2 A;  4ME4 A;  2J3T D;  3LUQ A;  1DP6 A;  2J3W A;  2W0N A;  2O99 A;  4O8G A;  1XFQ A;  4WN5 A;  1T18 A;  4BJP A;  3F1O B;  4LRY C;  4WEJ A;  5F6A A;  3KYZ A;  2CMN A;  3EWK A;  3LYX A;  4ETX A;  3H7W B;  5HDS A;  2J3T C;  3KSF A;  1UGU A;  4LLO B;  3LIE A;  1Y28 A;  3HJI A;  3U2A A;  4BBT A;  4DJ2 A;  5DJT A;  2V1B A;  3S7P A;  2W27 A;  3NOT C;  4XT2 B;  2L4R A;  3S7Q A;  5KSH A;  5HDC A;  2O9A A;  1P9W A;  2KLI A;  5DJU A;  1N9L A;  1OTI A;  2LB9 A;  4I38 A;  2P04 A;  4BBV A;  5DFX A;  5AJG A;  5CX7 A;  4R38 A;  3PBN A;  4YWZ A;  1MC0 A;  2XRO A;  3OCL A;  3MQQ A;  3CUE C;  5AVF A;  3T4S A;  2W3H A;  4HH2 A;  1GSW A;  3H82 A;  3PXP A;  1YAX A;  3LIB A;  3PR6 A;  1OPX A;  1BYW A;  2VJW A;  4EW7 A;  3PYP A;  3T4K A;  1G6O A;  4WLA A;  5G4Z A;  2Z6C A;  3VOL A;  2A2L A;  1UWN X;  3KYQ A;  3MMH A;  3LFV A;  4GCZ A;  1F5M A;  3H82 B;  1LSX A;  1N9O A;  3OOV A;  4R6L A;  2K31 A;  1D06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...