4HHDA

2.75 angstrom resolution crystal structure of the a. thaliana lov2 domain with an extended n-terminal a' helix (cryo dark structure)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
152
Chain Sequence
b'DDKVRQKEMRKGIDLATTLERIEKNFVITDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDLTTVKKIRNAIDNQTEVTVQLINYTKSGKKFWNIFHLQPMRDQKGEVQYFIGVQLDGSKAVKEGEDLVKKTAVNIDEAVREL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-1
publication title Coiled-coil dimerization of the LOV2 domain of the blue-light photoreceptor phototropin 1 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 50
structure length 152
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hhdA00
2PR6A 4K08A 4GS9A 4NXFA 1F9IA 2ZOIA 4WL9A 3UB6A 4F3LA 4WN5A 4R6LA 2QJ5A 4PKYG 4BBUA 5HZHA 5HWVA 1UWNX 3VE3A 5G4YA 4HH3A 1GSWA 3E4PA 4L9GA 5DJUA 3CWFA 3UMEA 1LSXA 3B33A 4BBVA 3UB7A 3RH8B 2BASA 1UGUA 2KX6A 4I3AA 3NHQA 4LRZE 4HJ4A 3BY9A 4EW7A 1S4RA 5KIZA 4LRXC 3A0VA 2YKHA 2A24A 3KX0X 1OTAA 2R78A 4I5SA 5IU1A 2V1BA 3VE4A 5HDCA 1XJ4A 2J80A 5HD5A 1LL8A 1LSWA 4H6JA 2H28A 4HJ6A 3K3CA 1G28A 3E4OA 1OTDA 2PYRA 4GS9B 4M4XA 3GECA 4JGOA 1OT9A 4F3LB 1XJ6A 5J7EA 4R3AA 5I5LA 5AVEA 3PYPA 5HSQA 2ZOHA 4HQAA 4EQ1A 1S67L 4KUKA 4HH2A 4EERA 1OTIA 3BWLA 4HHDA 2D01A 1DP8A 1VB6A 5HDDA 1DRMA 2JN7A 5TBMB 4E04A 2GJ3A 2PDRA 3UE6A 2EA9A 3IS2B 2L4RA 2QJ7A 4NXEA 3H82B 1T19A 2V0UA 3SW1A 1V9ZA 1V9YA 1XFQA 3H9WA 1LSVA 2V9AA 2Z6DA 1S1ZA 1S1YA 5HDSA 4H6JB 4GHIA 2VLGA 1GSXA 2VV6A 3LIFA 3F1PA 4KQDA 4B9OA 3EWKA 4JGRA 1T1AA 2OWJA 4WUJA 3CLOA 2PD7A 3F1NA 3MJQA 2CMNA 4LLOB 2QHKA 1MZUA 3IBRA 2L1MA 4EETB 5IS1A 4I3IA 2PHYA 1N9OA 1F98A 3PHYA 2L0WA 3F1OA 4NXGA 4R70A 2INWA 3T50A 3GDIA 4JGQA 1OT6A 4PKYA 4HI4A 2PYPA 2PD8A 3MXQA 4EEPA 4KUOA 4EESA 3FC7A 3UB9A 3A0RA 4GHIB 3LYXA 4JGPA 1S66L 4HNBA 2OWHA 3MR0A 3NOUC 4MN5A 3C8CA 1ODVA 5AVFA 1OJ5A 5HD3A 4WLAA 5DJTA 3F1NB 3LI8A 3MQOA 3P7NA 1UWPX 1N9LA 2B02A 1P0ZA 4DJ2A 4LRYC 5F69A 3EEHA 4HIAA 4HP4A 3OLOA 2WKQA 4GW9A 4I38A 5HWTA 3UB8A 3F1OB 4EEUA 2M1CA 2P7JA 3ZQ5A 1OTEA 5F5YA 1T1BA 2A24B 4XT2A 1OTBA 5DKKA 3A0SA 3NOPC 4R38A 1D7EA 1XJ3A 3VOLA 1KOUA 3LIBA 4WF0A 4L9FA 1XJ2A 5J4EA 2I9VA 5F68A 4NXBA 4YWZA 1BYWA 4BBTA 1JNUA 1D06A 1XFNA 5A8BA 3LIAA 2WKRA 2V0WA 2VV8A 3UMDA 4HJ3A 1EW0A 4I3JA 1T1CA 2HV1A 2D02A 4MN6A 2VEAA 4GCZA 1NWZA 3E4QA 3BY8A 2KDKA 5EFWA 3C2WA 1WA9A 3H7WA 2QWSA 5TBMA 3RTYA 2K7SA 3IS2A 5F6AA 3H82A 4RQ9A 3CAXA 5J3WA 1LT0A 1DP9A 1TS0A 1DP6A 4XT2B 2W0NA 1Y28A 4HOIA 3LIDA 1S4SA 2W27A 3LIEA 2Z6CA 3HJKA 1GSVA 3ICYA 3LICA 5G4ZA 5DKLA 1N9NA 3G6OA 1TS8A 3K3DA 3D72A 2QKPA 2PR5A 1X0OA 1TS7A 2WKPA 3F1PB 3LUQA 4HY8A 3MFXA 3LI9A 5HWWA 3HJIA 2V1AA 1T18A 3NJAA 4L9EA 3ULFA 3NOTC 3FG8A 2JHEA 4EXOA 4HP9A 1P97A 2VV7A 3H7WB 4DJ3A 2ZBBA 3MQQA 1TS6A 1OJGA 2OOLA 4I39A 4LPZA 2YKFA
chains in the Genus database with same CATH superfamily
3S4XA 2PR6A 1RP5A 3MZEA 3A3IA 4OH0A 3C7VA 5TJJA 1TDGA 5D3OA 2VGLM 1N4OA 3WS4A 4WL9A 2NUTC 2ZL1B 3IF6C 1PYYA 3QP6A 4O0PA 2M7UA 1H8YA 2BLSA 4OONA 5E2FA 5M19A 1YSQA 4ARZA 2QZ6A 3E0YA 2IA2A 5G4YA 5DFYA 3BFFA 3LCEA 3BM6A 1ZC2A 5DJUA 3QP4A 2W3FA 4P6ZS 3HLCA 2BASA 1UGUA 3NECA 3MKEA 4U3TA 4S2NC 2J9OA 3BY9A 5CEDA 1YMSA 2JE5A 3CITA 3KSGA 3PR6A 2OLVA 2DCFA 4FUWA 1S4RA 5DTKA 4DF6A 4WMCA 3IX8A 3Q7VA 5EV0A 1H0MA 2A24A 1XKZA 5U47A 2Y4AA 1OTAA 3UE3A 3D3OA 2O0YA 1RCJA 1LL8A 4H6JA 5EVEA 1K57C 5DVAA 3IWOA 3K3CA 1G28A 5EVLA 4CLCC 3E4OA 3AGEA 1JTGA 4M4XA 4RX3A 3GECA 4C6YA 4X69A 3C4PA 3IQAA 4QU3A 4JF4A 3RFBA 2GNXA 4KQOA 3PBRA 3RJUA 5I5LA 5AVEA 2ZOHA 2LB5A 4Y17A 4ARZB 2Y2OA 2G7UA 1S67L 4KUKA 3S1YA 4Q0JA 3BWLA 2HGVA 5EVIC 4WEJA 3M6BA 3LEQA 1VB6A 4FOFA 1QMFA 3GR2A 5EOOA 1U60A 3VFFA 2PDRA 2L4RA 2QJ7A 4LV1A 1ONHA 1YKDA 4Y0OA 1V9ZA 3LR5A 3VP4A 4E3JA 5J8XA 3Q7VB 3OOVA 4R23A 3O88A 1GHMA 4EUVA 4IUHA 1QMEA 2HDUA 3KYZA 1KE4A 4IBXA 3UN7A 1S1YA 1FSWA 5HDSA 3SOIA 2JKFA 4OPYA 4H6JB 4GHIA 1W63Q 2VLGA 3LIFA 3F1PA 4KQDA 2UWXA 5BOHA 1LLBA 1SDEA 1PFLA 3CJMA 2XROA 3CLOA 2PD7A 5DF9A 3S7NA 1SKOA 3GVBA 2XD5A 3MJQA 4WMCD 2QHKA 2H5SA 1NXYA 3UDIA 3N8SA 4EETB 4OPQA 4I3IA 5FQMA 2ACGA 3FKVA 1IELA 3MXSA 2PHYA 1N9OA 2WZXA 4BQMA 3F1OA 4R70A 2INWA 3GMWA 3T50A 3GDIA 5JYPA 5HL6A 4R4SA 3CI6A 1OT6A 2Y2GA 1MKMA 2ZLYA 4GLQA 2EXAA 4MEZA 4ZJ3A 4BMWA 4EEPA 5M18A 3G34A 1IYSA 3WS0A 3IWIA 4QY5A 4ZAMA 5MC7A 4OP5A 5AQ9A 4GHIB 4KG2A 1XGJA 4Y5FA 1ODVA 4BWIA 1OJ5A 3T4SA 4HEFA 5DJTA 2HPBA 1ACFA 3EGDC 2BTFP 1K55A 1SKOB 1UWPX 3IBJA 4MNRA 3VV4A 4XXRA 3VSKA 2B02A 5EECA 3T4KA 4GD6A 2IWDA 4YFMA 1AWIA 4HP4A 3OLOA 1IYQA 1VETA 4OLDA 4GW9A 3F1OB 4EEUA 1Z09A 3C4OA 5F5YA 3T12B 3IX3A 3A0SA 3NOPC 4R38A 4UHUA 1K57A 5HFOA 3HUOA 4E3NA 5C5KA 3ZG0A 3FPWA 4Z1WA 3Q82A 1GHIA 2ZJ9A 4P0MA 5F68A 5FEGA 3TG9A 2FFFB 5EPHA 3W4PA 4DE3A 4E6WA 3PBOA 1JNUA 1D06A 5L10A 3IT9A 5FAQA 4DDSA 5GHZA 4DN0A 4DKIA 4R4RA 2V0WA 4N1XA 2EX9A 1KGGA 2ZQ9A 4HJ3A 4I3JA 4IUKA 2HV1A 1CEGA 4X6TA 2E8JA 4LCLA 1NRFA 2JCHA 4GJ4A 1ONGA 1SHVA 1NWZA 5A90A 2B5RA 3BY8A 2W3HA 2EFXA 4WYYA 2W3EA 5TBMA 4B93A 1FSYA 3N7WA 5FSRA 1W8YA 3H82A 1VETB 4EV4A 1TS0A 1HTZA 1L0DA 1Y28A 1I2WA 4KZAA 4E3MA 3KYEA 1S4SA 3NY4A 4UAAA 3HLWA 2ZQ7A 2J9PA 4MDZA 5DKLA 3G6OA 2HDQA 1TS8A 3K3DA 2QKPA 3EGXC 3LUQA 4S2OA 3ZVTA 4DRTA 2DMWA 4JXWA 3CUEA 2H0TA 2V20A 2VZWA 3LI9A 3I7JA 5HWWA 2V1AA 3P09A 1TF1A 4YOFA 1JVJA 3PTEA 4FTXA 3A3DA 1YSPA 2HDRA 3BQ8A 3TE8A 4HP9A 3QP8A 3V3SA 1K0KA 1P97A 1ZG6A 4DJ3A 3MSHA 4LGWA 3DTMA 2HF6A 4NEED 2ZBBA 1TS6A 2OV5A 1OJGA 3WRZA 1C3BA 2YKFA 4KZ7A 1YAXA 5FQIA 4K08A 1LI9A 4GS9A 2Q0OA 4NXFA 3IXBA 3A3JA 4S2PA 5TFQA 1M40A 5F1FA 1W79A 4F3LA 5GLBA 4IVIA 2WAEA 4ME4A 2QJ5A 5FI7A 2Y2NA 1CI8A 3RXWA 4O7DA 3VE3A 4O01A 4PM5A 3KSFA 1WYBA 4DE2A 3O86A 3BFGA 1KE0A 1GSWA 3E4PA 3CWFA 1BLHA 3UMEA 3B33A 3KSHA 5AQ7A 2ZC3B 3RH8B 4BD1A 3T1XA 3ZDJA 4EW7A 2VKSA 1ES4A 4ESPA 4DXBA 2Y91A 4QJGA 1DJCA 5E2HA 3VP0A 5A91A 3QP2A 2HDSA 2V1BA 2WGVA 3M2JA 3T4JA 2OLUA 3PXPA 1OPXA 1YLZA 3CPTB 2PYRA 4GS9B 4OP8A 3V67A 4E3LA 3ZG8B 4Y0TA 4PM8A 3MF0A 4F3LB 5E43A 5IHVA 4ETZA 4N1HA 3SH8A 5J7EA 2NUPC 3GRJA 4UEYA 3PYPA 4R1GA 2JKRM 2PU4A 5CHUA 1G68A 1JWZA 3ZGAB 1IEMA 3MZFA 4OQ0A 4HHDA 5GLCA 2XF3A 1Y54A 4JXGA 1DRMA 2JN7A 1FR1A 4WEKA 4P85A 1T19A 1G6AA 4B4ZA 3OZHA 3SW1A 1L3LA 4G3WA 3UDFA 2V9AA 3SZTA 3N4IA 3LY3A 1MXOA 4U0TA 2DRWA 1LL5A 2XEPA 4OLGA 1ESIA 4KG6A 5A92A 3GTCA 1MWUA 3BECA 4FH4A 1GSXA 2VV6A 1ZTUA 2ZQAA 2Y2QA 4MN7A 3S7PA 5HX9A 1E25A 2H10A 1T1AA 2W1TB 2OWJA 4WUJA 1PI5A 1FCOA 3LY4A 3UDXA 2JC7A 4B88A 3F1NA 2O9BA 2IWBA 1K56A 2EWVA 4LLOB 4QWOA 1MZUA 4RVAA 3EOIA 3LFVA 3BW6A 2L1MA 5F1GA 1K6SA 5IS1A 1ERMA 3HCYA 4E6XA 2ZQDA 3BFCA 1HZOA 5FEFA 4S2IA 1XPBA 4X68A 4NXGA 5L8MA 2FZ0A 2Y2PA 3LEZA 5L2FA 1KDWA 1S0WA 3CZDA 2PU2A 4PKYA 2XFSA 4HI4A 1BLCA 2K2NA 1NZUA 2Z2MB 1FILA 5CHMA 1JWVA 3MXQA 1KE3A 3UE1A 2JKTM 4KZBA 3HUNA 4Y7PA 3FC7A 3A0RA 1YLYA 4HNBA 2OWHA 1MBLA 1TD5A 3LO7A 2J3TD 1GHPA 3GSGA 4WLAA 1N9BA 5AJGA 2ZC4B 3F1NB 5FASA 5FQ9A 2P74A 1PZPA 3NCKA 4DE1A 1CK3A 2Y79A 5CEBA 4WZ4A 3FKWA 1P0ZA 5FAPA 4DJ2A 3BFEA 5F69A 3EEHA 4Q8IA 3O5YA 4KZ8A 1JTDA 1FQGA 3LR4A 5CGWA 1FCNA 3DAVA 1OTEA 2JKRI 2A24B 1NY0A 5DKKA 5GHXA 1F5MA 3OCNA 4FCFA 5CRFA 1MWRA 4JXSA 4BJPA 1HVBA 5CTMA 4G3KA 1IKIA 4ZJ1A 3DTIA 5HARA 1K56D 5J4EA 4QD4A 3ZG7B 1W7FA 4S2MA 3C7UA 1ES5A 2WKRA 3E98A 5DF7A 4QHCA 3QHYA 3HBRA 1VHMA 4MN6A 4GZBA 4Y0UA 4RX2A 5FQJA 4YINA 5DTTA 3KYQA 5FQKA 2K7SA 3IS2A 3LR3A 1PWDA 3G32A 5I94A 4D2OA 4OVDA 4LFUA 1XP4A 2E8IA 4LCMA 4PMAA 1DP9A 2C6WB 4PHTA 3LIDA 3IF6A 3LIEA 4IHQA 3LICA 3E2LA 3D72A 4ZTKA 2PR5A 1X0OA 3F1PB 2WADA 1PW8A 4L0LA 3NC8A 4HY8A 3MFXA 3HUMA 3FWLA 3VMAA 1MY8A 3NJAA 3VFHA 1GA0A 4S2NA 1IYPA 4KQRA 1NLYA 1FIKA 3EQUA 2Q9MA 3FG8A 2ZMVA 1CJFA 3B3XA 3C30A 3VP2A 4IEDA 5F83A 3V5MA 4NETA 3TW8A 1K38A 2Y2JA 1NRJA 2VV7A 3JYIA 2GX5A 3CHWP 1P9RA 3TRCA 3KSIA 4CLCA 5AQBA 3M6HA 2XH9A 4I39A 1MPLA 1E4DA 4JLFA 3QP5A 4WM9A 1F9IA 2ZOIA 3MS6A 1TEMA 4X53A 3R7WA 1Y4OA 1ESUA 2PBDP 3K2NA 4WN5A 5LBRA 2Y59A 3BEBA 4X25A 4BBUA 5EVIA 1L0GA 2WKEA 3OPLA 5HZHA 5HWVA 3PBSA 2W3DA 2PBYA 1BUEA 4UA9A 5G18A 3BLSA 2EX8A 5DFXA 3SS4A 4HBTA 4MBFA 5FQQA 2G2WA 2XK1A 4OQGA 4L9GA 1Q2QA 2KLIA 4MMNA 4ZRRA 3PAGA 2KX6A 3RXXA 3NHQA 1VEUA 4D60A 4LRZE 4HJ4A 4N92A 4JKTA 3O3VA 4HESA 1K54C 4WZ5C 4LRXC 3OPRA 1XXMA 3A0VA 3E2KA 1NYMA 3N8RA 3VE4A 3W2ZA 5E2GA 1XJ4A 5HDCA 2O9CA 1L0FA 2H28A 4HJ6A 2J3TC 4MCWA 4Y15A 2Q9NA 4JGOA 2OAP1 3TJZC 5CTNA 3SH9A 3R7WB 1YQSA 4IBRA 1XJ6A 4E3KA 1STZA 5HAPA 3TSGA 5F82A 3QNCA 5EVIB 5CXWA 1IOUA 4EQ1A 2EXBA 2ZM2A 3HREA 4KZ3A 1HLUP 1WYCA 4HH2A 3V50A 2EFUA 1LI0A 2D01A 3N6IA 1DP8A 2XGNA 3ZYTA 5HDDA 3V3RA 5TBMB 4E04A 2GJ3A 3EEAA 3UE6A 3G30A 4ZBEA 3H82B 4EBLA 2V0UA 1VEUB 1VQQA 3BJNA 3UPNA 1XFQA 3T1RA 4HBUA 3H9WA 1XGIA 3AGFA 2Z6DA 3Q7ZA 2XR0A 5EVID 3WWXA 3JVUA 5GLDA 2EWWA 2Y2LA 4JF5A 1PWGA 2Y8HA 4PM7A 2VGJA 4OOYA 5HW3A 5GHYA 3R4KA 1IFQA 4N9LA 4JGRA 1FOFA 1W63M 5FA7A 2VX8A 2WKIA 4ZDXA 2CMNA 1K4FA 3N8LA 2A49A 4S2KA 2VJWA 4BL2A 3SH7A 1MC0A 3IBRA 2QYBA 1AXBA 1KGFA 1SDNA 3CMZA 3FV7A 5E2EA 2WZZA 1EWZA 1YT4A 1MWTA 3T4OA 3PHYA 2L0WA 1NLZA 4JXVA 3DTKA 1ZG4A 2V1ZA 3V39A 5CHJA 3FPVA 4C75A 3C5AA 2RL3A 5FATA 4Y3IA 2Y2MA 3VP1A 3G31A 5JYOA 1D1JA 3IHAA 4OOLA 1PRQA 2FH5A 2PT7A 1G6OA 2XDMA 3UB9A 4JGPA 1S66L 1KGEA 1YMXA 2ZL1A 2ZD8A 1LL9A 4H8RA 4MN5A 2XA7S 3C8CA 1K6RA 3ZHHA 4EBNA 4CQHA 1IKGA 3HLGA 3NDEA 1ERQA 4UQIS 1CF0A 4N9KA 3S7OA 3LI8A 1YM1A 3P7NA 2WKHA 4U0XA 5KSHA 4CLCE 2XQZA 2XA7M 2VA0A 2V8FA 4LRYC 2XFTA 3T1SA 4HIAA 4P87A 2X01A 1ZKJA 4PAUA 2WKQA 1BZAA 1LHYA 4WZ5A 3BYDA 4UQIM 2ZC7A 4Q0IA 1VM1A 1J9MA 3ZQ5A 4R3BA 3G4PA 4O8GA 4PPRA 1OTBA 1SCWA 4XUZA 1D7EA 2B18A 3JPUA 3VOLA 3S7QA 4EU0A 1KOUA 3LIBA 4Z9QA 2FFYA 5HL1A 1BULA 4L9FA 1XJ2A 5GLAA 3G2YA 2I9VA 3BLMA 2ZQ8A 3B42A 4BBTA 1YLWA 2R9WA 3T4QA 4Y2FA 1XFNA 1BTLA 5FDSA 4DE0A 2Y2KA 2W1RA 2XSSA 3LIAA 3DBAA 3WRTA 1H8ZA 3ZNYA 4XUXA 4P6BA 2ZM8A 1KVMA 3B47A 1EW0A 4K0WA 5EM0A 3WS1A 2D02A 1PNEA 3A3FA 3E4QA 1YLPA 1H3QA 3IXGA 2KDKA 5EFWA 3QNBA 3C2WA 3H7WA 1K55C 2QWSA 4KZ6A 2QMIA 3WS5A 2Y2HA 5F6AA 4ZJ2A 4RQ9A 3CAXA 1RGZA 2Z2LB 3L9KA 4E3IA 1XA1A 1KDSA 1LT0A 4OKPA 5TGFA 3AGDA 1DP6A 1MKIA 3BFDA 4HOIA 3HJKA 1GSVA 4P6ZM 3U4LP 4NG2A 3SS3A 1SKFA 4QY6A 2MJ6A 1O07A 2HP6A 2WKPA 4OQHA 5FI6A 3WS2A 5FDHA 3G2ZA 2WGIA 2XRNA 4GDBA 1BSGA 2ZMAA 3ZCZA 3IH9A 4B4XA 4GD8A 2DNSA 3D4FA 2HJ9C 5EM1A 1I2SA 2C5WB 3C38A 1WE4A 3PBQA 3ULFA 1EI5A 4X1LA 3S22A 3ZVWA 2R9XA 2HJEA 3LGOA 4AFIA 3L7HA 1ES3A 3HLFA 3MXRA 2P08A 3H7WB 4OQIA 5FI2A 1L2SA 3IXDA 2V2FF 3MQQA 2BG1A 3ZG9B 1W5DA 2W3GA 2OOLA 2G2UA 3VSLA 4LPZA 1S6RA 4K0XA 1TVFA 3NIAA 4QPRA 4A5RA 2J3WA 4MBKA 3HLDA 4BD0A 4CJNA 3UB6A 1GCEA 4DDYA 3HL9A 3HVFA 4R6LA 3OPPA 3Q81A 4EQIA 4PKYG 2EX6A 4S2LA 1O7EA 3PBTA 1Q2PA 3UE0A 4K91A 2RCXA 5CGSA 1UWNX 4OOMA 3JVVA 4UA7A 4HH3A 4GNUA 3UY6A 3BQAA 1TDLA 3CUEC 3MFDA 2VGKA 4M3KA 1LSXA 4BBVA 3UB7A 1JWPA 3ISGA 2WUQA 5FAOA 4GOGA 2H0YA 4I3AA 1IYOA 1PI4A 5IT5A 4GN2A 3VOYA 4GB7A 5KZHA 2X71A 5KIZA 4KG5A 1EROA 3D9YA 2YKHA 4QB8A 3OPHA 1PZOA 2LB9A 3KX0X 2R78A 4I5SA 2VK3A 5IU1A 1YLJA 2J80A 5HD5A 5DF8A 1LSWA 1OTDA 4LV0A 4NKPA 1OT9A 4R0QA 4OPZA 1XX2A 2I72A 4JF6A 4R3AA 3G35A 2JKTI 5HSQA 1H5XA 4HQAA 3TOIA 3LR0A 2GDNA 4KZ5A 3FYZA 1DJBA 4EERA 2PAVP 1SZVA 5L09A 1OTIA 3U2AA 4CPKA 2WK0A 4GDNA 2HP5A 2B95A 2EA9A 3IS2B 4UA6A 4NXEA 2XLNA 1G5UA 1V9YA 2J8YA 5CGXA 1LSVA 1HD8A 4F94A 3IF6B 3ZG5A 1BT5A 2ZC6B 3KO6A 1YLTA 1S1ZA 1H8MA 3UB5P 2KOIA 1Z6FA 3OCLA 5FL3A 2GZAA 1P9WA 5KMWA 4LENA 4B9OA 1A0KA 3NDGA 5M1AA 3EWKA 1F2KA 3MMHA 2HZ5A 1ES2A 3IH8A 3MKFA 1K25A 3NI9A 1NJ4A 2HP9A 4II7A 3IX4A 2P9VA 3FZCA 3BRMA 3MBZA 4ID4A 5AQAA 2CC1A 3DW0A 3IF5A 5EE8A 1FR6A 1F98A 5EUAA 5GL9A 3ZNTA 5KSCA 3T1QB 4GKUA 3EQVA 4KENB 2UV0E 4JGQA 4CLCB 3M2KA 4LV3A 2A2LA 5HAIA 1DY6A 3UO9A 2PYPA 1M6KA 1PIOA 2PD8A 2V8CA 2AVXA 1OMEA 4KUOA 4EESA 4JBFA 3P98A 3Q07A 2WGWA 5HPFA 4PM9A 3LYXA 4BLMA 1KVLA 3MR0A 3W8KA 1PW1A 3NOUC 5L07A 5AVFA 4FD8A 5HD3A 2WYXA 4CLCD 4FH2A 5K5BA 5CX7A 2P04A 2XD1A 3MQOA 3OBFA 3DWKA 1N9LA 1E3UA 3OC2A 2P9VB 5TR7A 1BLPA 4ETXA 2O99A 4RYEA 1GA9A 4PM6A 4IVKA 4I38A 1YPRA 5HWTA 3UB8A 3O87A 1NYYA 4E3OA 1I5QA 2M1CA 2P7JA 1ZHHB 2ZMFA 5EOEA 1T1BA 3GV9A 4KZ4A 4XT2A 2OSUA 3ITAA 3UPPA 1XJ3A 2X02A 4DMZA 2ZM0A 3DTEA 5DTSA 5A93A 2A3UA 4KQQA 4WF0A 4DXCA 3T4LA 3CPTA 4R3JA 2WGWB 4YWZA 4NXBA 1BYWA 4YNRA 3MQ0A 1CI9A 3DWZA 3A3EA 5A8BA 2VV8A 4X56A 4FSFA 1MWSA 3UMDA 4IJGA 3UPOA 1T1CA 3ZFZA 5HPIA 1BLSA 4BENA 2JBFA 3HLBA 2VEAA 2WAFA 4GCZA 4LV2A 4C3QA 1FCMA 3ITBA 4WBGA 1CEFA 3IHBA 4EBPA 1WA9A 2JKGA 1J3WA 4EWFA 3RTYA 2Y2IA 4G3VA 2OAQ1 5J3WA 1DJAA 2K31A 5CECA 4XT2B 2W0NA 3CG5A 2W27A 2Z6CA 3ICYA 2M7VA 1ALQA 5G4ZA 4BL3A 3NBLA 1N9NA 3IWQA 4X1MA 2QPNA 2EX2A 3MZDA 1TS7A 4EUZA 1K4EA 1XA7A 5HAQA 1E3UD 4WELA 4NK3A 2Y55A 3QP1A 3PBNA 3PAEA 4X55A 1PWCA 2W1TA 4RA7A 3HLEA 2J7VA 3HJIA 4S2JA 1T18A 4Q0HA 3W4OA 3T4TA 4MLLA 1RGYA 1CQAA 3P01A 1W8QA 2IWCA 3Q1FA 4L9EA 3IXHA 3VP3A 3NOTC 2JHEA 4KZ9A 5CERA 3UNWA 4EXOA 1K54A 2ZC5B 3SS5A 3W4QA 1NZOA 1L0EA 4OPRA 4Y13A 3NULA 3VOZA 2O9AA 3GQZA 2VGLS 4JPMA 4MBHA 2ZQCA 2PRFA
chains in the Genus database with same CATH topology
1YAXA 2PR6A 4K08A 4QPRA 2J3WA 4GS9A 4NXFA 5TJJA 1F9IA 2ZOIA 2VGLM 4WL9A 3R7WA 3UB6A 2NUTC 4F3LA 3K2NA 4WN5A 4R6LA 4O0PA 5LBRA 4ME4A 2M7UA 2QJ5A 4PKYG 4BBUA 3PBTA 5HZHA 1YSQA 5HWVA 1UWNX 3PBSA 4ARZA 2W3DA 3VE3A 4OOMA 3JVVA 4O01A 3E0YA 2IA2A 5G4YA 5DFYA 4HH3A 3KSFA 3BQAA 5DFXA 3CUEC 1GSWA 3E4PA 4L9GA 5DJUA 2W3FA 3CWFA 2KLIA 4MMNA 3UMEA 3KSHA 1LSXA 3B33A 4BBVA 3UB7A 4P6ZS 4ZRRA 3RH8B 2BASA 1UGUA 2KX6A 4I3AA 3NHQA 5IT5A 4LRZE 4HJ4A 3BY9A 3CITA 3KSGA 3PR6A 4EW7A 2VKSA 1S4RA 5KIZA 4LRXC 3A0VA 2YKHA 2A24A 2LB9A 3KX0X 1OTAA 3UE3A 2R78A 3D3OA 4I5SA 5IU1A 2V1BA 3VE4A 3W2ZA 5HDCA 1XJ4A 2J80A 2O0YA 2O9CA 5HD5A 3T4JA 1LL8A 1LSWA 4H6JA 2H28A 4HJ6A 2J3TC 3PXPA 3K3CA 1OPXA 1G28A 4CLCC 3E4OA 1OTDA 4MCWA 2PYRA 4GS9B 3V67A 4M4XA 3GECA 4JGOA 2OAP1 4NKPA 3TJZC 3R7WB 1OT9A 3MF0A 4F3LB 1XJ6A 1STZA 4ETZA 3RFBA 2GNXA 4KQOA 5J7EA 3PBRA 2NUPC 4R3AA 4UEYA 5I5LA 2JKTI 5AVEA 3PYPA 5HSQA 2ZOHA 2LB5A 4HQAA 1IOUA 4EQ1A 3LR0A 4ARZB 2G7UA 2JKRM 1S67L 4KUKA 4HH2A 4EERA 4Q0JA 1OTIA 2HGVA 3BWLA 4HHDA 3U2AA 2D01A 1DP8A 4WEJA 1VB6A 3ZYTA 4FOFA 5HDDA 1DRMA 2JN7A 5TBMB 4E04A 2GJ3A 2PDRA 3EEAA 4WEKA 3UE6A 2EA9A 3IS2B 2L4RA 2QJ7A 4NXEA 3H82B 1T19A 1YKDA 2V0UA 3SW1A 1V9ZA 3BJNA 3LR5A 1V9YA 1XFQA 4G3WA 3H9WA 1LSVA 2V9AA 3OOVA 2Z6DA 4EUVA 4IUHA 3KO6A 3KYZA 1S1ZA 3JVUA 1S1YA 2EWWA 5HDSA 2Y8HA 1H8MA 4H6JB 2KOIA 3OCLA 4GHIA 1W63Q 2VLGA 1GSXA 5FL3A 2GZAA 2VV6A 3LIFA 3F1PA 1P9WA 4KQDA 1ZTUA 4B9OA 3R4KA 1IFQA 4MN7A 3S7PA 3EWKA 4JGRA 1T1AA 2W1TB 2OWJA 4WUJA 3MMHA 1W63M 2XROA 3CLOA 2VX8A 2PD7A 3F1NA 5DF9A 2O9BA 3S7NA 3MJQA 2CMNA 2EWVA 4LLOB 2VJWA 2QHKA 3IBRA 1MC0A 1MZUA 4II7A 3EOIA 3LFVA 3BW6A 2L1MA 2QYBA 4EETB 5IS1A 4I3IA 3T4OA 3HCYA 2PHYA 1N9OA 1F98A 3PHYA 2L0WA 3F1OA 4NXGA 1NLZA 5L8MA 2FZ0A 3EQVA 4R70A 2INWA 3T50A 3GDIA 4JGQA 4CLCB 3FPVA 2A2LA 5HL6A 3CI6A 1OT6A 4PKYA 1MKMA 4HI4A 2PYPA 4Y3IA 4GLQA 2K2NA 2PD8A 4BMWA 3MXQA 4OOLA 4EEPA 4KUOA 2JKTM 4EESA 2FH5A 2PT7A 5HPFA 1G6OA 3FC7A 5MC7A 3UB9A 3A0RA 4GHIB 3LYXA 4JGPA 1S66L 4HNBA 2OWHA 3MR0A 3NOUC 4MN5A 4Y5FA 2XA7S 3C8CA 1ODVA 5AVFA 1TD5A 4BWIA 1OJ5A 5HD3A 2J3TD 4WLAA 3T4SA 4CLCD 4CQHA 5AJGA 5DJTA 5K5BA 3EGDC 5CX7A 3F1NB 4UQIS 2P04A 3S7OA 3LI8A 3MQOA 3P7NA 3OBFA 1UWPX 3IBJA 1N9LA 3VV4A 5KSHA 4CLCE 3OC2A 2B02A 2Y79A 2XA7M 2VA0A 3T4KA 1P0ZA 4DJ2A 4LRYC 4ETXA 2O99A 5F69A 3EEHA 3O5YA 4HIAA 4HP4A 3OLOA 4PAUA 2WKQA 4GW9A 4I38A 5HWTA 3UB8A 3LR4A 4UQIM 3F1OB 4Q0IA 4EEUA 2M1CA 2P7JA 1ZHHB 3ZQ5A 1OTEA 5F5YA 2JKRI 2ZMFA 1T1BA 4O8GA 2A24B 4XT2A 1OTBA 5DKKA 1F5MA 3A0SA 3OCNA 3NOPC 4R38A 1D7EA 1XJ3A 2B18A 3VOLA 4BJPA 4DMZA 3S7QA 4EU0A 1KOUA 3LIBA 4G3KA 5C5KA 4WF0A 4L9FA 1XJ2A 3FPWA 5J4EA 4Z1WA 3T4LA 2I9VA 3B42A 5F68A 4NXBA 4YWZA 1BYWA 4BBTA 4YNRA 3MQ0A 3T4QA 3PBOA 1JNUA 4Y2FA 1D06A 1XFNA 5A8BA 3LIAA 2W1RA 2XSSA 4DN0A 3DBAA 2WKRA 2V0WA 3E98A 2VV8A 4FSFA 3UMDA 3B47A 4IJGA 4HJ3A 1EW0A 1T1CA 4I3JA 5HPIA 4IUKA 2HV1A 2D02A 1VHMA 4MN6A 2VEAA 4GJ4A 4GCZA 1NWZA 3E4QA 1H3QA 3BY8A 2KDKA 2W3HA 5EFWA 3KYQA 2W3EA 3C2WA 1WA9A 3H7WA 2QWSA 5TBMA 4B93A 3RTYA 2K7SA 3IS2A 5F6AA 4G3VA 3H82A 3LR3A 2OAQ1 4RQ9A 3CAXA 5J3WA 1LT0A 1DP9A 2K31A 1TS0A 1DP6A 4XT2B 2W0NA 4PHTA 1Y28A 4HOIA 3LIDA 1S4SA 2W27A 3LIEA 2Z6CA 3HJKA 4IHQA 1GSVA 3ICYA 2M7VA 4P6ZM 3LICA 5G4ZA 4MDZA 5DKLA 1N9NA 3G6OA 2MJ6A 1TS8A 3K3DA 3D72A 2QKPA 2PR5A 1X0OA 3EGXC 1TS7A 2WKPA 3F1PB 3LUQA 4L0LA 4WELA 2DMWA 4HY8A 2XRNA 3PBNA 3CUEA 3MFXA 2VZWA 2W1TA 3LI9A 5HWWA 3HJIA 2V1AA 1T18A 1TF1A 4Q0HA 2HJ9C 4YOFA 3T4TA 3NJAA 3P01A 3C38A 1YSPA 3PBQA 4L9EA 3ULFA 1NLYA 3EQUA 3NOTC 3FG8A 2ZMVA 2JHEA 3C30A 2HJEA 4EXOA 3BQ8A 3TE8A 4AFIA 4HP9A 3TW8A 1NRJA 1P97A 2VV7A 2GX5A 2P08A 3H7WB 4DJ3A 2HF6A 2O9AA 1P9RA 2VGLS 4NEED 3TRCA 2ZBBA 3KSIA 3MQQA 4CLCA 1TS6A 1OJGA 2W3GA 2OOLA 4I39A 4LPZA 2YKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR6 A;  4K08 A;  4GS9 A;  4NXF A;  1F9I A;  2ZOI A;  4WL9 A;  3UB6 A;  4F3L A;  4WN5 A;  4R6L A;  2QJ5 A;  4PKY G;  4BBU A;  5HZH A;  5HWV A;  1UWN X;  3VE3 A;  5G4Y A;  4HH3 A;  1GSW A;  3E4P A;  4L9G A;  5DJU A;  3CWF A;  3UME A;  1LSX A;  3B33 A;  4BBV A;  3UB7 A;  3RH8 B;  2BAS A;  1UGU A;  2KX6 A;  4I3A A;  3NHQ A;  4LRZ E;  4HJ4 A;  3BY9 A;  4EW7 A;  1S4R A;  5KIZ A;  4LRX C;  3A0V A;  2YKH A;  2A24 A;  3KX0 X;  1OTA A;  2R78 A;  4I5S A;  5IU1 A;  2V1B A;  3VE4 A;  5HDC A;  1XJ4 A;  2J80 A;  5HD5 A;  1LL8 A;  1LSW A;  4H6J A;  2H28 A;  4HJ6 A;  3K3C A;  1G28 A;  3E4O A;  1OTD A;  2PYR A;  4GS9 B;  4M4X A;  3GEC A;  4JGO A;  1OT9 A;  4F3L B;  1XJ6 A;  5J7E A;  4R3A A;  5I5L A;  5AVE A;  3PYP A;  5HSQ A;  2ZOH A;  4HQA A;  4EQ1 A;  1S67 L;  4KUK A;  4HH2 A;  4EER A;  1OTI A;  3BWL A;  4HHD A;  2D01 A;  1DP8 A;  1VB6 A;  5HDD A;  1DRM A;  2JN7 A;  5TBM B;  4E04 A;  2GJ3 A;  2PDR A;  3UE6 A;  2EA9 A;  3IS2 B;  2L4R A;  2QJ7 A;  4NXE A;  3H82 B;  1T19 A;  2V0U A;  3SW1 A;  1V9Z A;  1V9Y A;  1XFQ A;  3H9W A;  1LSV A;  2V9A A;  2Z6D A;  1S1Z A;  1S1Y A;  5HDS A;  4H6J B;  4GHI A;  2VLG A;  1GSX A;  2VV6 A;  3LIF A;  3F1P A;  4KQD A;  4B9O A;  3EWK A;  4JGR A;  1T1A A;  2OWJ A;  4WUJ A;  3CLO A;  2PD7 A;  3F1N A;  3MJQ A;  2CMN A;  4LLO B;  2QHK A;  1MZU A;  3IBR A;  2L1M A;  4EET B;  5IS1 A;  4I3I A;  2PHY A;  1N9O A;  1F98 A;  3PHY A;  2L0W A;  3F1O A;  4NXG A;  4R70 A;  2INW A;  3T50 A;  3GDI A;  4JGQ A;  1OT6 A;  4PKY A;  4HI4 A;  2PYP A;  2PD8 A;  3MXQ A;  4EEP A;  4KUO A;  4EES A;  3FC7 A;  3UB9 A;  3A0R A;  4GHI B;  3LYX A;  4JGP A;  1S66 L;  4HNB A;  2OWH A;  3MR0 A;  3NOU C;  4MN5 A;  3C8C A;  1ODV A;  5AVF A;  1OJ5 A;  5HD3 A;  4WLA A;  5DJT A;  3F1N B;  3LI8 A;  3MQO A;  3P7N A;  1UWP X;  1N9L A;  2B02 A;  1P0Z A;  4DJ2 A;  4LRY C;  5F69 A;  3EEH A;  4HIA A;  4HP4 A;  3OLO A;  2WKQ A;  4GW9 A;  4I38 A;  5HWT A;  3UB8 A;  3F1O B;  4EEU A;  2M1C A;  2P7J A;  3ZQ5 A;  1OTE A;  5F5Y A;  1T1B A;  2A24 B;  4XT2 A;  1OTB A;  5DKK A;  3A0S A;  3NOP C;  4R38 A;  1D7E A;  1XJ3 A;  3VOL A;  1KOU A;  3LIB A;  4WF0 A;  4L9F A;  1XJ2 A;  5J4E A;  2I9V A;  5F68 A;  4NXB A;  4YWZ A;  1BYW A;  4BBT A;  1JNU A;  1D06 A;  1XFN A;  5A8B A;  3LIA A;  2WKR A;  2V0W A;  2VV8 A;  3UMD A;  4HJ3 A;  1EW0 A;  4I3J A;  1T1C A;  2HV1 A;  2D02 A;  4MN6 A;  2VEA A;  4GCZ A;  1NWZ A;  3E4Q A;  3BY8 A;  2KDK A;  5EFW A;  3C2W A;  1WA9 A;  3H7W A;  2QWS A;  5TBM A;  3RTY A;  2K7S A;  3IS2 A;  5F6A A;  3H82 A;  4RQ9 A;  3CAX A;  5J3W A;  1LT0 A;  1DP9 A;  1TS0 A;  1DP6 A;  4XT2 B;  2W0N A;  1Y28 A;  4HOI A;  3LID A;  1S4S A;  2W27 A;  3LIE A;  2Z6C A;  3HJK A;  1GSV A;  3ICY A;  3LIC A;  5G4Z A;  5DKL A;  1N9N A;  3G6O A;  1TS8 A;  3K3D A;  3D72 A;  2QKP A;  2PR5 A;  1X0O A;  1TS7 A;  2WKP A;  3F1P B;  3LUQ A;  4HY8 A;  3MFX A;  3LI9 A;  5HWW A;  3HJI A;  2V1A A;  1T18 A;  3NJA A;  4L9E A;  3ULF A;  3NOT C;  3FG8 A;  2JHE A;  4EXO A;  4HP9 A;  1P97 A;  2VV7 A;  3H7W B;  4DJ3 A;  2ZBB A;  3MQQ A;  1TS6 A;  1OJG A;  2OOL A;  4I39 A;  4LPZ A;  2YKF A; 
#chains in the Genus database with same CATH topology
 3S4X A;  2PR6 A;  1RP5 A;  3MZE A;  3A3I A;  4OH0 A;  3C7V A;  5TJJ A;  1TDG A;  5D3O A;  2VGL M;  1N4O A;  3WS4 A;  4WL9 A;  2NUT C;  2ZL1 B;  3IF6 C;  1PYY A;  3QP6 A;  4O0P A;  2M7U A;  1H8Y A;  2BLS A;  4OON A;  5E2F A;  5M19 A;  1YSQ A;  4ARZ A;  2QZ6 A;  3E0Y A;  2IA2 A;  5G4Y A;  5DFY A;  3BFF A;  3LCE A;  3BM6 A;  1ZC2 A;  5DJU A;  3QP4 A;  2W3F A;  4P6Z S;  3HLC A;  2BAS A;  1UGU A;  3NEC A;  3MKE A;  4U3T A;  4S2N C;  2J9O A;  3BY9 A;  5CED A;  1YMS A;  2JE5 A;  3CIT A;  3KSG A;  3PR6 A;  2OLV A;  2DCF A;  4FUW A;  1S4R A;  5DTK A;  4DF6 A;  4WMC A;  3IX8 A;  3Q7V A;  5EV0 A;  1H0M A;  2A24 A;  1XKZ A;  5U47 A;  2Y4A A;  1OTA A;  3UE3 A;  3D3O A;  2O0Y A;  1RCJ A;  1LL8 A;  4H6J A;  5EVE A;  1K57 C;  5DVA A;  3IWO A;  3K3C A;  1G28 A;  5EVL A;  4CLC C;  3E4O A;  3AGE A;  1JTG A;  4M4X A;  4RX3 A;  3GEC A;  4C6Y A;  4X69 A;  3C4P A;  3IQA A;  4QU3 A;  4JF4 A;  3RFB A;  2GNX A;  4KQO A;  3PBR A;  3RJU A;  5I5L A;  5AVE A;  2ZOH A;  2LB5 A;  4Y17 A;  4ARZ B;  2Y2O A;  2G7U A;  1S67 L;  4KUK A;  3S1Y A;  4Q0J A;  3BWL A;  2HGV A;  5EVI C;  4WEJ A;  3M6B A;  3LEQ A;  1VB6 A;  4FOF A;  1QMF A;  3GR2 A;  5EOO A;  1U60 A;  3VFF A;  2PDR A;  2L4R A;  2QJ7 A;  4LV1 A;  1ONH A;  1YKD A;  4Y0O A;  1V9Z A;  3LR5 A;  3VP4 A;  4E3J A;  5J8X A;  3Q7V B;  3OOV A;  4R23 A;  3O88 A;  1GHM A;  4EUV A;  4IUH A;  1QME A;  2HDU A;  3KYZ A;  1KE4 A;  4IBX A;  3UN7 A;  1S1Y A;  1FSW A;  5HDS A;  3SOI A;  2JKF A;  4OPY A;  4H6J B;  4GHI A;  1W63 Q;  2VLG A;  3LIF A;  3F1P A;  4KQD A;  2UWX A;  5BOH A;  1LLB A;  1SDE A;  1PFL A;  3CJM A;  2XRO A;  3CLO A;  2PD7 A;  5DF9 A;  3S7N A;  1SKO A;  3GVB A;  2XD5 A;  3MJQ A;  4WMC D;  2QHK A;  2H5S A;  1NXY A;  3UDI A;  3N8S A;  4EET B;  4OPQ A;  4I3I A;  5FQM A;  2ACG A;  3FKV A;  1IEL A;  3MXS A;  2PHY A;  1N9O A;  2WZX A;  4BQM A;  3F1O A;  4R70 A;  2INW A;  3GMW A;  3T50 A;  3GDI A;  5JYP A;  5HL6 A;  4R4S A;  3CI6 A;  1OT6 A;  2Y2G A;  1MKM A;  2ZLY A;  4GLQ A;  2EXA A;  4MEZ A;  4ZJ3 A;  4BMW A;  4EEP A;  5M18 A;  3G34 A;  1IYS A;  3WS0 A;  3IWI A;  4QY5 A;  4ZAM A;  5MC7 A;  4OP5 A;  5AQ9 A;  4GHI B;  4KG2 A;  1XGJ A;  4Y5F A;  1ODV A;  4BWI A;  1OJ5 A;  3T4S A;  4HEF A;  5DJT A;  2HPB A;  1ACF A;  3EGD C;  2BTF P;  1K55 A;  1SKO B;  1UWP X;  3IBJ A;  4MNR A;  3VV4 A;  4XXR A;  3VSK A;  2B02 A;  5EEC A;  3T4K A;  4GD6 A;  2IWD A;  4YFM A;  1AWI A;  4HP4 A;  3OLO A;  1IYQ A;  1VET A;  4OLD A;  4GW9 A;  3F1O B;  4EEU A;  1Z09 A;  3C4O A;  5F5Y A;  3T12 B;  3IX3 A;  3A0S A;  3NOP C;  4R38 A;  4UHU A;  1K57 A;  5HFO A;  3HUO A;  4E3N A;  5C5K A;  3ZG0 A;  3FPW A;  4Z1W A;  3Q82 A;  1GHI A;  2ZJ9 A;  4P0M A;  5F68 A;  5FEG A;  3TG9 A;  2FFF B;  5EPH A;  3W4P A;  4DE3 A;  4E6W A;  3PBO A;  1JNU A;  1D06 A;  5L10 A;  3IT9 A;  5FAQ A;  4DDS A;  5GHZ A;  4DN0 A;  4DKI A;  4R4R A;  2V0W A;  4N1X A;  2EX9 A;  1KGG A;  2ZQ9 A;  4HJ3 A;  4I3J A;  4IUK A;  2HV1 A;  1CEG A;  4X6T A;  2E8J A;  4LCL A;  1NRF A;  2JCH A;  4GJ4 A;  1ONG A;  1SHV A;  1NWZ A;  5A90 A;  2B5R A;  3BY8 A;  2W3H A;  2EFX A;  4WYY A;  2W3E A;  5TBM A;  4B93 A;  1FSY A;  3N7W A;  5FSR A;  1W8Y A;  3H82 A;  1VET B;  4EV4 A;  1TS0 A;  1HTZ A;  1L0D A;  1Y28 A;  1I2W A;  4KZA A;  4E3M A;  3KYE A;  1S4S A;  3NY4 A;  4UAA A;  3HLW A;  2ZQ7 A;  2J9P A;  4MDZ A;  5DKL A;  3G6O A;  2HDQ A;  1TS8 A;  3K3D A;  2QKP A;  3EGX C;  3LUQ A;  4S2O A;  3ZVT A;  4DRT A;  2DMW A;  4JXW A;  3CUE A;  2H0T A;  2V20 A;  2VZW A;  3LI9 A;  3I7J A;  5HWW A;  2V1A A;  3P09 A;  1TF1 A;  4YOF A;  1JVJ A;  3PTE A;  4FTX A;  3A3D A;  1YSP A;  2HDR A;  3BQ8 A;  3TE8 A;  4HP9 A;  3QP8 A;  3V3S A;  1K0K A;  1P97 A;  1ZG6 A;  4DJ3 A;  3MSH A;  4LGW A;  3DTM A;  2HF6 A;  4NEE D;  2ZBB A;  1TS6 A;  2OV5 A;  1OJG A;  3WRZ A;  1C3B A;  2YKF A;  4KZ7 A;  1YAX A;  5FQI A;  4K08 A;  1LI9 A;  4GS9 A;  2Q0O A;  4NXF A;  3IXB A;  3A3J A;  4S2P A;  5TFQ A;  1M40 A;  5F1F A;  1W79 A;  4F3L A;  5GLB A;  4IVI A;  2WAE A;  4ME4 A;  2QJ5 A;  5FI7 A;  2Y2N A;  1CI8 A;  3RXW A;  4O7D A;  3VE3 A;  4O01 A;  4PM5 A;  3KSF A;  1WYB A;  4DE2 A;  3O86 A;  3BFG A;  1KE0 A;  1GSW A;  3E4P A;  3CWF A;  1BLH A;  3UME A;  3B33 A;  3KSH A;  5AQ7 A;  2ZC3 B;  3RH8 B;  4BD1 A;  3T1X A;  3ZDJ A;  4EW7 A;  2VKS A;  1ES4 A;  4ESP A;  4DXB A;  2Y91 A;  4QJG A;  1DJC A;  5E2H A;  3VP0 A;  5A91 A;  3QP2 A;  2HDS A;  2V1B A;  2WGV A;  3M2J A;  3T4J A;  2OLU A;  3PXP A;  1OPX A;  1YLZ A;  3CPT B;  2PYR A;  4GS9 B;  4OP8 A;  3V67 A;  4E3L A;  3ZG8 B;  4Y0T A;  4PM8 A;  3MF0 A;  4F3L B;  5E43 A;  5IHV A;  4ETZ A;  4N1H A;  3SH8 A;  5J7E A;  2NUP C;  3GRJ A;  4UEY A;  3PYP A;  4R1G A;  2JKR M;  2PU4 A;  5CHU A;  1G68 A;  1JWZ A;  3ZGA B;  1IEM A;  3MZF A;  4OQ0 A;  4HHD A;  5GLC A;  2XF3 A;  1Y54 A;  4JXG A;  1DRM A;  2JN7 A;  1FR1 A;  4WEK A;  4P85 A;  1T19 A;  1G6A A;  4B4Z A;  3OZH A;  3SW1 A;  1L3L A;  4G3W A;  3UDF A;  2V9A A;  3SZT A;  3N4I A;  3LY3 A;  1MXO A;  4U0T A;  2DRW A;  1LL5 A;  2XEP A;  4OLG A;  1ESI A;  4KG6 A;  5A92 A;  3GTC A;  1MWU A;  3BEC A;  4FH4 A;  1GSX A;  2VV6 A;  1ZTU A;  2ZQA A;  2Y2Q A;  4MN7 A;  3S7P A;  5HX9 A;  1E25 A;  2H10 A;  1T1A A;  2W1T B;  2OWJ A;  4WUJ A;  1PI5 A;  1FCO A;  3LY4 A;  3UDX A;  2JC7 A;  4B88 A;  3F1N A;  2O9B A;  2IWB A;  1K56 A;  2EWV A;  4LLO B;  4QWO A;  1MZU A;  4RVA A;  3EOI A;  3LFV A;  3BW6 A;  2L1M A;  5F1G A;  1K6S A;  5IS1 A;  1ERM A;  3HCY A;  4E6X A;  2ZQD A;  3BFC A;  1HZO A;  5FEF A;  4S2I A;  1XPB A;  4X68 A;  4NXG A;  5L8M A;  2FZ0 A;  2Y2P A;  3LEZ A;  5L2F A;  1KDW A;  1S0W A;  3CZD A;  2PU2 A;  4PKY A;  2XFS A;  4HI4 A;  1BLC A;  2K2N A;  1NZU A;  2Z2M B;  1FIL A;  5CHM A;  1JWV A;  3MXQ A;  1KE3 A;  3UE1 A;  2JKT M;  4KZB A;  3HUN A;  4Y7P A;  3FC7 A;  3A0R A;  1YLY A;  4HNB A;  2OWH A;  1MBL A;  1TD5 A;  3LO7 A;  2J3T D;  1GHP A;  3GSG A;  4WLA A;  1N9B A;  5AJG A;  2ZC4 B;  3F1N B;  5FAS A;  5FQ9 A;  2P74 A;  1PZP A;  3NCK A;  4DE1 A;  1CK3 A;  2Y79 A;  5CEB A;  4WZ4 A;  3FKW A;  1P0Z A;  5FAP A;  4DJ2 A;  3BFE A;  5F69 A;  3EEH A;  4Q8I A;  3O5Y A;  4KZ8 A;  1JTD A;  1FQG A;  3LR4 A;  5CGW A;  1FCN A;  3DAV A;  1OTE A;  2JKR I;  2A24 B;  1NY0 A;  5DKK A;  5GHX A;  1F5M A;  3OCN A;  4FCF A;  5CRF A;  1MWR A;  4JXS A;  4BJP A;  1HVB A;  5CTM A;  4G3K A;  1IKI A;  4ZJ1 A;  3DTI A;  5HAR A;  1K56 D;  5J4E A;  4QD4 A;  3ZG7 B;  1W7F A;  4S2M A;  3C7U A;  1ES5 A;  2WKR A;  3E98 A;  5DF7 A;  4QHC A;  3QHY A;  3HBR A;  1VHM A;  4MN6 A;  4GZB A;  4Y0U A;  4RX2 A;  5FQJ A;  4YIN A;  5DTT A;  3KYQ A;  5FQK A;  2K7S A;  3IS2 A;  3LR3 A;  1PWD A;  3G32 A;  5I94 A;  4D2O A;  4OVD A;  4LFU A;  1XP4 A;  2E8I A;  4LCM A;  4PMA A;  1DP9 A;  2C6W B;  4PHT A;  3LID A;  3IF6 A;  3LIE A;  4IHQ A;  3LIC A;  3E2L A;  3D72 A;  4ZTK A;  2PR5 A;  1X0O A;  3F1P B;  2WAD A;  1PW8 A;  4L0L A;  3NC8 A;  4HY8 A;  3MFX A;  3HUM A;  3FWL A;  3VMA A;  1MY8 A;  3NJA A;  3VFH A;  1GA0 A;  4S2N A;  1IYP A;  4KQR A;  1NLY A;  1FIK A;  3EQU A;  2Q9M A;  3FG8 A;  2ZMV A;  1CJF A;  3B3X A;  3C30 A;  3VP2 A;  4IED A;  5F83 A;  3V5M A;  4NET A;  3TW8 A;  1K38 A;  2Y2J A;  1NRJ A;  2VV7 A;  3JYI A;  2GX5 A;  3CHW P;  1P9R A;  3TRC A;  3KSI A;  4CLC A;  5AQB A;  3M6H A;  2XH9 A;  4I39 A;  1MPL A;  1E4D A;  4JLF A;  3QP5 A;  4WM9 A;  1F9I A;  2ZOI A;  3MS6 A;  1TEM A;  4X53 A;  3R7W A;  1Y4O A;  1ESU A;  2PBD P;  3K2N A;  4WN5 A;  5LBR A;  2Y59 A;  3BEB A;  4X25 A;  4BBU A;  5EVI A;  1L0G A;  2WKE A;  3OPL A;  5HZH A;  5HWV A;  3PBS A;  2W3D A;  2PBY A;  1BUE A;  4UA9 A;  5G18 A;  3BLS A;  2EX8 A;  5DFX A;  3SS4 A;  4HBT A;  4MBF A;  5FQQ A;  2G2W A;  2XK1 A;  4OQG A;  4L9G A;  1Q2Q A;  2KLI A;  4MMN A;  4ZRR A;  3PAG A;  2KX6 A;  3RXX A;  3NHQ A;  1VEU A;  4D60 A;  4LRZ E;  4HJ4 A;  4N92 A;  4JKT A;  3O3V A;  4HES A;  1K54 C;  4WZ5 C;  4LRX C;  3OPR A;  1XXM A;  3A0V A;  3E2K A;  1NYM A;  3N8R A;  3VE4 A;  3W2Z A;  5E2G A;  1XJ4 A;  5HDC A;  2O9C A;  1L0F A;  2H28 A;  4HJ6 A;  2J3T C;  4MCW A;  4Y15 A;  2Q9N A;  4JGO A;  2OAP 1;  3TJZ C;  5CTN A;  3SH9 A;  3R7W B;  1YQS A;  4IBR A;  1XJ6 A;  4E3K A;  1STZ A;  5HAP A;  3TSG A;  5F82 A;  3QNC A;  5EVI B;  5CXW A;  1IOU A;  4EQ1 A;  2EXB A;  2ZM2 A;  3HRE A;  4KZ3 A;  1HLU P;  1WYC A;  4HH2 A;  3V50 A;  2EFU A;  1LI0 A;  2D01 A;  3N6I A;  1DP8 A;  2XGN A;  3ZYT A;  5HDD A;  3V3R A;  5TBM B;  4E04 A;  2GJ3 A;  3EEA A;  3UE6 A;  3G30 A;  4ZBE A;  3H82 B;  4EBL A;  2V0U A;  1VEU B;  1VQQ A;  3BJN A;  3UPN A;  1XFQ A;  3T1R A;  4HBU A;  3H9W A;  1XGI A;  3AGF A;  2Z6D A;  3Q7Z A;  2XR0 A;  5EVI D;  3WWX A;  3JVU A;  5GLD A;  2EWW A;  2Y2L A;  4JF5 A;  1PWG A;  2Y8H A;  4PM7 A;  2VGJ A;  4OOY A;  5HW3 A;  5GHY A;  3R4K A;  1IFQ A;  4N9L A;  4JGR A;  1FOF A;  1W63 M;  5FA7 A;  2VX8 A;  2WKI A;  4ZDX A;  2CMN A;  1K4F A;  3N8L A;  2A49 A;  4S2K A;  2VJW A;  4BL2 A;  3SH7 A;  1MC0 A;  3IBR A;  2QYB A;  1AXB A;  1KGF A;  1SDN A;  3CMZ A;  3FV7 A;  5E2E A;  2WZZ A;  1EWZ A;  1YT4 A;  1MWT A;  3T4O A;  3PHY A;  2L0W A;  1NLZ A;  4JXV A;  3DTK A;  1ZG4 A;  2V1Z A;  3V39 A;  5CHJ A;  3FPV A;  4C75 A;  3C5A A;  2RL3 A;  5FAT A;  4Y3I A;  2Y2M A;  3VP1 A;  3G31 A;  5JYO A;  1D1J A;  3IHA A;  4OOL A;  1PRQ A;  2FH5 A;  2PT7 A;  1G6O A;  2XDM A;  3UB9 A;  4JGP A;  1S66 L;  1KGE A;  1YMX A;  2ZL1 A;  2ZD8 A;  1LL9 A;  4H8R A;  4MN5 A;  2XA7 S;  3C8C A;  1K6R A;  3ZHH A;  4EBN A;  4CQH A;  1IKG A;  3HLG A;  3NDE A;  1ERQ A;  4UQI S;  1CF0 A;  4N9K A;  3S7O A;  3LI8 A;  1YM1 A;  3P7N A;  2WKH A;  4U0X A;  5KSH A;  4CLC E;  2XQZ A;  2XA7 M;  2VA0 A;  2V8F A;  4LRY C;  2XFT A;  3T1S A;  4HIA A;  4P87 A;  2X01 A;  1ZKJ A;  4PAU A;  2WKQ A;  1BZA A;  1LHY A;  4WZ5 A;  3BYD A;  4UQI M;  2ZC7 A;  4Q0I A;  1VM1 A;  1J9M A;  3ZQ5 A;  4R3B A;  3G4P A;  4O8G A;  4PPR A;  1OTB A;  1SCW A;  4XUZ A;  1D7E A;  2B18 A;  3JPU A;  3VOL A;  3S7Q A;  4EU0 A;  1KOU A;  3LIB A;  4Z9Q A;  2FFY A;  5HL1 A;  1BUL A;  4L9F A;  1XJ2 A;  5GLA A;  3G2Y A;  2I9V A;  3BLM A;  2ZQ8 A;  3B42 A;  4BBT A;  1YLW A;  2R9W A;  3T4Q A;  4Y2F A;  1XFN A;  1BTL A;  5FDS A;  4DE0 A;  2Y2K A;  2W1R A;  2XSS A;  3LIA A;  3DBA A;  3WRT A;  1H8Z A;  3ZNY A;  4XUX A;  4P6B A;  2ZM8 A;  1KVM A;  3B47 A;  1EW0 A;  4K0W A;  5EM0 A;  3WS1 A;  2D02 A;  1PNE A;  3A3F A;  3E4Q A;  1YLP A;  1H3Q A;  3IXG A;  2KDK A;  5EFW A;  3QNB A;  3C2W A;  3H7W A;  1K55 C;  2QWS A;  4KZ6 A;  2QMI A;  3WS5 A;  2Y2H A;  5F6A A;  4ZJ2 A;  4RQ9 A;  3CAX A;  1RGZ A;  2Z2L B;  3L9K A;  4E3I A;  1XA1 A;  1KDS A;  1LT0 A;  4OKP A;  5TGF A;  3AGD A;  1DP6 A;  1MKI A;  3BFD A;  4HOI A;  3HJK A;  1GSV A;  4P6Z M;  3U4L P;  4NG2 A;  3SS3 A;  1SKF A;  4QY6 A;  2MJ6 A;  1O07 A;  2HP6 A;  2WKP A;  4OQH A;  5FI6 A;  3WS2 A;  5FDH A;  3G2Z A;  2WGI A;  2XRN A;  4GDB A;  1BSG A;  2ZMA A;  3ZCZ A;  3IH9 A;  4B4X A;  4GD8 A;  2DNS A;  3D4F A;  2HJ9 C;  5EM1 A;  1I2S A;  2C5W B;  3C38 A;  1WE4 A;  3PBQ A;  3ULF A;  1EI5 A;  4X1L A;  3S22 A;  3ZVW A;  2R9X A;  2HJE A;  3LGO A;  4AFI A;  3L7H A;  1ES3 A;  3HLF A;  3MXR A;  2P08 A;  3H7W B;  4OQI A;  5FI2 A;  1L2S A;  3IXD A;  2V2F F;  3MQQ A;  2BG1 A;  3ZG9 B;  1W5D A;  2W3G A;  2OOL A;  2G2U A;  3VSL A;  4LPZ A;  1S6R A;  4K0X A;  1TVF A;  3NIA A;  4QPR A;  4A5R A;  2J3W A;  4MBK A;  3HLD A;  4BD0 A;  4CJN A;  3UB6 A;  1GCE A;  4DDY A;  3HL9 A;  3HVF A;  4R6L A;  3OPP A;  3Q81 A;  4EQI A;  4PKY G;  2EX6 A;  4S2L A;  1O7E A;  3PBT A;  1Q2P A;  3UE0 A;  4K91 A;  2RCX A;  5CGS A;  1UWN X;  4OOM A;  3JVV A;  4UA7 A;  4HH3 A;  4GNU A;  3UY6 A;  3BQA A;  1TDL A;  3CUE C;  3MFD A;  2VGK A;  4M3K A;  1LSX A;  4BBV A;  3UB7 A;  1JWP A;  3ISG A;  2WUQ A;  5FAO A;  4GOG A;  2H0Y A;  4I3A A;  1IYO A;  1PI4 A;  5IT5 A;  4GN2 A;  3VOY A;  4GB7 A;  5KZH A;  2X71 A;  5KIZ A;  4KG5 A;  1ERO A;  3D9Y A;  2YKH A;  4QB8 A;  3OPH A;  1PZO A;  2LB9 A;  3KX0 X;  2R78 A;  4I5S A;  2VK3 A;  5IU1 A;  1YLJ A;  2J80 A;  5HD5 A;  5DF8 A;  1LSW A;  1OTD A;  4LV0 A;  4NKP A;  1OT9 A;  4R0Q A;  4OPZ A;  1XX2 A;  2I72 A;  4JF6 A;  4R3A A;  3G35 A;  2JKT I;  5HSQ A;  1H5X A;  4HQA A;  3TOI A;  3LR0 A;  2GDN A;  4KZ5 A;  3FYZ A;  1DJB A;  4EER A;  2PAV P;  1SZV A;  5L09 A;  1OTI A;  3U2A A;  4CPK A;  2WK0 A;  4GDN A;  2HP5 A;  2B95 A;  2EA9 A;  3IS2 B;  4UA6 A;  4NXE A;  2XLN A;  1G5U A;  1V9Y A;  2J8Y A;  5CGX A;  1LSV A;  1HD8 A;  4F94 A;  3IF6 B;  3ZG5 A;  1BT5 A;  2ZC6 B;  3KO6 A;  1YLT A;  1S1Z A;  1H8M A;  3UB5 P;  2KOI A;  1Z6F A;  3OCL A;  5FL3 A;  2GZA A;  1P9W A;  5KMW A;  4LEN A;  4B9O A;  1A0K A;  3NDG A;  5M1A A;  3EWK A;  1F2K A;  3MMH A;  2HZ5 A;  1ES2 A;  3IH8 A;  3MKF A;  1K25 A;  3NI9 A;  1NJ4 A;  2HP9 A;  4II7 A;  3IX4 A;  2P9V A;  3FZC A;  3BRM A;  3MBZ A;  4ID4 A;  5AQA A;  2CC1 A;  3DW0 A;  3IF5 A;  5EE8 A;  1FR6 A;  1F98 A;  5EUA A;  5GL9 A;  3ZNT A;  5KSC A;  3T1Q B;  4GKU A;  3EQV A;  4KEN B;  2UV0 E;  4JGQ A;  4CLC B;  3M2K A;  4LV3 A;  2A2L A;  5HAI A;  1DY6 A;  3UO9 A;  2PYP A;  1M6K A;  1PIO A;  2PD8 A;  2V8C A;  2AVX A;  1OME A;  4KUO A;  4EES A;  4JBF A;  3P98 A;  3Q07 A;  2WGW A;  5HPF A;  4PM9 A;  3LYX A;  4BLM A;  1KVL A;  3MR0 A;  3W8K A;  1PW1 A;  3NOU C;  5L07 A;  5AVF A;  4FD8 A;  5HD3 A;  2WYX A;  4CLC D;  4FH2 A;  5K5B A;  5CX7 A;  2P04 A;  2XD1 A;  3MQO A;  3OBF A;  3DWK A;  1N9L A;  1E3U A;  3OC2 A;  2P9V B;  5TR7 A;  1BLP A;  4ETX A;  2O99 A;  4RYE A;  1GA9 A;  4PM6 A;  4IVK A;  4I38 A;  1YPR A;  5HWT A;  3UB8 A;  3O87 A;  1NYY A;  4E3O A;  1I5Q A;  2M1C A;  2P7J A;  1ZHH B;  2ZMF A;  5EOE A;  1T1B A;  3GV9 A;  4KZ4 A;  4XT2 A;  2OSU A;  3ITA A;  3UPP A;  1XJ3 A;  2X02 A;  4DMZ A;  2ZM0 A;  3DTE A;  5DTS A;  5A93 A;  2A3U A;  4KQQ A;  4WF0 A;  4DXC A;  3T4L A;  3CPT A;  4R3J A;  2WGW B;  4YWZ A;  4NXB A;  1BYW A;  4YNR A;  3MQ0 A;  1CI9 A;  3DWZ A;  3A3E A;  5A8B A;  2VV8 A;  4X56 A;  4FSF A;  1MWS A;  3UMD A;  4IJG A;  3UPO A;  1T1C A;  3ZFZ A;  5HPI A;  1BLS A;  4BEN A;  2JBF A;  3HLB A;  2VEA A;  2WAF A;  4GCZ A;  4LV2 A;  4C3Q A;  1FCM A;  3ITB A;  4WBG A;  1CEF A;  3IHB A;  4EBP A;  1WA9 A;  2JKG A;  1J3W A;  4EWF A;  3RTY A;  2Y2I A;  4G3V A;  2OAQ 1;  5J3W A;  1DJA A;  2K31 A;  5CEC A;  4XT2 B;  2W0N A;  3CG5 A;  2W27 A;  2Z6C A;  3ICY A;  2M7V A;  1ALQ A;  5G4Z A;  4BL3 A;  3NBL A;  1N9N A;  3IWQ A;  4X1M A;  2QPN A;  2EX2 A;  3MZD A;  1TS7 A;  4EUZ A;  1K4E A;  1XA7 A;  5HAQ A;  1E3U D;  4WEL A;  4NK3 A;  2Y55 A;  3QP1 A;  3PBN A;  3PAE A;  4X55 A;  1PWC A;  2W1T A;  4RA7 A;  3HLE A;  2J7V A;  3HJI A;  4S2J A;  1T18 A;  4Q0H A;  3W4O A;  3T4T A;  4MLL A;  1RGY A;  1CQA A;  3P01 A;  1W8Q A;  2IWC A;  3Q1F A;  4L9E A;  3IXH A;  3VP3 A;  3NOT C;  2JHE A;  4KZ9 A;  5CER A;  3UNW A;  4EXO A;  1K54 A;  2ZC5 B;  3SS5 A;  3W4Q A;  1NZO A;  1L0E A;  4OPR A;  4Y13 A;  3NUL A;  3VOZ A;  2O9A A;  3GQZ A;  2VGL S;  4JPM A;  4MBH A;  2ZQC A;  2PRF A; 
#chains in the Genus database with same CATH homology
 1YAX A;  2PR6 A;  4K08 A;  4QPR A;  2J3W A;  4GS9 A;  4NXF A;  5TJJ A;  1F9I A;  2ZOI A;  2VGL M;  4WL9 A;  3R7W A;  3UB6 A;  2NUT C;  4F3L A;  3K2N A;  4WN5 A;  4R6L A;  4O0P A;  5LBR A;  4ME4 A;  2M7U A;  2QJ5 A;  4PKY G;  4BBU A;  3PBT A;  5HZH A;  1YSQ A;  5HWV A;  1UWN X;  3PBS A;  4ARZ A;  2W3D A;  3VE3 A;  4OOM A;  3JVV A;  4O01 A;  3E0Y A;  2IA2 A;  5G4Y A;  5DFY A;  4HH3 A;  3KSF A;  3BQA A;  5DFX A;  3CUE C;  1GSW A;  3E4P A;  4L9G A;  5DJU A;  2W3F A;  3CWF A;  2KLI A;  4MMN A;  3UME A;  3KSH A;  1LSX A;  3B33 A;  4BBV A;  3UB7 A;  4P6Z S;  4ZRR A;  3RH8 B;  2BAS A;  1UGU A;  2KX6 A;  4I3A A;  3NHQ A;  5IT5 A;  4LRZ E;  4HJ4 A;  3BY9 A;  3CIT A;  3KSG A;  3PR6 A;  4EW7 A;  2VKS A;  1S4R A;  5KIZ A;  4LRX C;  3A0V A;  2YKH A;  2A24 A;  2LB9 A;  3KX0 X;  1OTA A;  3UE3 A;  2R78 A;  3D3O A;  4I5S A;  5IU1 A;  2V1B A;  3VE4 A;  3W2Z A;  5HDC A;  1XJ4 A;  2J80 A;  2O0Y A;  2O9C A;  5HD5 A;  3T4J A;  1LL8 A;  1LSW A;  4H6J A;  2H28 A;  4HJ6 A;  2J3T C;  3PXP A;  3K3C A;  1OPX A;  1G28 A;  4CLC C;  3E4O A;  1OTD A;  4MCW A;  2PYR A;  4GS9 B;  3V67 A;  4M4X A;  3GEC A;  4JGO A;  2OAP 1;  4NKP A;  3TJZ C;  3R7W B;  1OT9 A;  3MF0 A;  4F3L B;  1XJ6 A;  1STZ A;  4ETZ A;  3RFB A;  2GNX A;  4KQO A;  5J7E A;  3PBR A;  2NUP C;  4R3A A;  4UEY A;  5I5L A;  2JKT I;  5AVE A;  3PYP A;  5HSQ A;  2ZOH A;  2LB5 A;  4HQA A;  1IOU A;  4EQ1 A;  3LR0 A;  4ARZ B;  2G7U A;  2JKR M;  1S67 L;  4KUK A;  4HH2 A;  4EER A;  4Q0J A;  1OTI A;  2HGV A;  3BWL A;  4HHD A;  3U2A A;  2D01 A;  1DP8 A;  4WEJ A;  1VB6 A;  3ZYT A;  4FOF A;  5HDD A;  1DRM A;  2JN7 A;  5TBM B;  4E04 A;  2GJ3 A;  2PDR A;  3EEA A;  4WEK A;  3UE6 A;  2EA9 A;  3IS2 B;  2L4R A;  2QJ7 A;  4NXE A;  3H82 B;  1T19 A;  1YKD A;  2V0U A;  3SW1 A;  1V9Z A;  3BJN A;  3LR5 A;  1V9Y A;  1XFQ A;  4G3W A;  3H9W A;  1LSV A;  2V9A A;  3OOV A;  2Z6D A;  4EUV A;  4IUH A;  3KO6 A;  3KYZ A;  1S1Z A;  3JVU A;  1S1Y A;  2EWW A;  5HDS A;  2Y8H A;  1H8M A;  4H6J B;  2KOI A;  3OCL A;  4GHI A;  1W63 Q;  2VLG A;  1GSX A;  5FL3 A;  2GZA A;  2VV6 A;  3LIF A;  3F1P A;  1P9W A;  4KQD A;  1ZTU A;  4B9O A;  3R4K A;  1IFQ A;  4MN7 A;  3S7P A;  3EWK A;  4JGR A;  1T1A A;  2W1T B;  2OWJ A;  4WUJ A;  3MMH A;  1W63 M;  2XRO A;  3CLO A;  2VX8 A;  2PD7 A;  3F1N A;  5DF9 A;  2O9B A;  3S7N A;  3MJQ A;  2CMN A;  2EWV A;  4LLO B;  2VJW A;  2QHK A;  3IBR A;  1MC0 A;  1MZU A;  4II7 A;  3EOI A;  3LFV A;  3BW6 A;  2L1M A;  2QYB A;  4EET B;  5IS1 A;  4I3I A;  3T4O A;  3HCY A;  2PHY A;  1N9O A;  1F98 A;  3PHY A;  2L0W A;  3F1O A;  4NXG A;  1NLZ A;  5L8M A;  2FZ0 A;  3EQV A;  4R70 A;  2INW A;  3T50 A;  3GDI A;  4JGQ A;  4CLC B;  3FPV A;  2A2L A;  5HL6 A;  3CI6 A;  1OT6 A;  4PKY A;  1MKM A;  4HI4 A;  2PYP A;  4Y3I A;  4GLQ A;  2K2N A;  2PD8 A;  4BMW A;  3MXQ A;  4OOL A;  4EEP A;  4KUO A;  2JKT M;  4EES A;  2FH5 A;  2PT7 A;  5HPF A;  1G6O A;  3FC7 A;  5MC7 A;  3UB9 A;  3A0R A;  4GHI B;  3LYX A;  4JGP A;  1S66 L;  4HNB A;  2OWH A;  3MR0 A;  3NOU C;  4MN5 A;  4Y5F A;  2XA7 S;  3C8C A;  1ODV A;  5AVF A;  1TD5 A;  4BWI A;  1OJ5 A;  5HD3 A;  2J3T D;  4WLA A;  3T4S A;  4CLC D;  4CQH A;  5AJG A;  5DJT A;  5K5B A;  3EGD C;  5CX7 A;  3F1N B;  4UQI S;  2P04 A;  3S7O A;  3LI8 A;  3MQO A;  3P7N A;  3OBF A;  1UWP X;  3IBJ A;  1N9L A;  3VV4 A;  5KSH A;  4CLC E;  3OC2 A;  2B02 A;  2Y79 A;  2XA7 M;  2VA0 A;  3T4K A;  1P0Z A;  4DJ2 A;  4LRY C;  4ETX A;  2O99 A;  5F69 A;  3EEH A;  3O5Y A;  4HIA A;  4HP4 A;  3OLO A;  4PAU A;  2WKQ A;  4GW9 A;  4I38 A;  5HWT A;  3UB8 A;  3LR4 A;  4UQI M;  3F1O B;  4Q0I A;  4EEU A;  2M1C A;  2P7J A;  1ZHH B;  3ZQ5 A;  1OTE A;  5F5Y A;  2JKR I;  2ZMF A;  1T1B A;  4O8G A;  2A24 B;  4XT2 A;  1OTB A;  5DKK A;  1F5M A;  3A0S A;  3OCN A;  3NOP C;  4R38 A;  1D7E A;  1XJ3 A;  2B18 A;  3VOL A;  4BJP A;  4DMZ A;  3S7Q A;  4EU0 A;  1KOU A;  3LIB A;  4G3K A;  5C5K A;  4WF0 A;  4L9F A;  1XJ2 A;  3FPW A;  5J4E A;  4Z1W A;  3T4L A;  2I9V A;  3B42 A;  5F68 A;  4NXB A;  4YWZ A;  1BYW A;  4BBT A;  4YNR A;  3MQ0 A;  3T4Q A;  3PBO A;  1JNU A;  4Y2F A;  1D06 A;  1XFN A;  5A8B A;  3LIA A;  2W1R A;  2XSS A;  4DN0 A;  3DBA A;  2WKR A;  2V0W A;  3E98 A;  2VV8 A;  4FSF A;  3UMD A;  3B47 A;  4IJG A;  4HJ3 A;  1EW0 A;  1T1C A;  4I3J A;  5HPI A;  4IUK A;  2HV1 A;  2D02 A;  1VHM A;  4MN6 A;  2VEA A;  4GJ4 A;  4GCZ A;  1NWZ A;  3E4Q A;  1H3Q A;  3BY8 A;  2KDK A;  2W3H A;  5EFW A;  3KYQ A;  2W3E A;  3C2W A;  1WA9 A;  3H7W A;  2QWS A;  5TBM A;  4B93 A;  3RTY A;  2K7S A;  3IS2 A;  5F6A A;  4G3V A;  3H82 A;  3LR3 A;  2OAQ 1;  4RQ9 A;  3CAX A;  5J3W A;  1LT0 A;  1DP9 A;  2K31 A;  1TS0 A;  1DP6 A;  4XT2 B;  2W0N A;  4PHT A;  1Y28 A;  4HOI A;  3LID A;  1S4S A;  2W27 A;  3LIE A;  2Z6C A;  3HJK A;  4IHQ A;  1GSV A;  3ICY A;  2M7V A;  4P6Z M;  3LIC A;  5G4Z A;  4MDZ A;  5DKL A;  1N9N A;  3G6O A;  2MJ6 A;  1TS8 A;  3K3D A;  3D72 A;  2QKP A;  2PR5 A;  1X0O A;  3EGX C;  1TS7 A;  2WKP A;  3F1P B;  3LUQ A;  4L0L A;  4WEL A;  2DMW A;  4HY8 A;  2XRN A;  3PBN A;  3CUE A;  3MFX A;  2VZW A;  2W1T A;  3LI9 A;  5HWW A;  3HJI A;  2V1A A;  1T18 A;  1TF1 A;  4Q0H A;  2HJ9 C;  4YOF A;  3T4T A;  3NJA A;  3P01 A;  3C38 A;  1YSP A;  3PBQ A;  4L9E A;  3ULF A;  1NLY A;  3EQU A;  3NOT C;  3FG8 A;  2ZMV A;  2JHE A;  3C30 A;  2HJE A;  4EXO A;  3BQ8 A;  3TE8 A;  4AFI A;  4HP9 A;  3TW8 A;  1NRJ A;  1P97 A;  2VV7 A;  2GX5 A;  2P08 A;  3H7W B;  4DJ3 A;  2HF6 A;  2O9A A;  1P9R A;  2VGL S;  4NEE D;  3TRC A;  2ZBB A;  3KSI A;  3MQQ A;  4CLC A;  1TS6 A;  1OJG A;  2W3G A;  2OOL A;  4I39 A;  4LPZ A;  2YKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...