4HHDA

2.75 angstrom resolution crystal structure of the a. thaliana lov2 domain with an extended n-terminal a' helix (cryo dark structure)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
152
Chain Sequence
DDKVRQKEMRKGIDLATTLERIEKNFVITDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDLTTVKKIRNAIDNQTEVTVQLINYTKSGKKFWNIFHLQPMRDQKGEVQYFIGVQLDGSKAVKEGEDLVKKTAVNIDEAVREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-1
publication title Coiled-coil dimerization of the LOV2 domain of the blue-light photoreceptor phototropin 1 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 50
structure length 152
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hhdA00
3BY8A 4HP9A 4LLOB 3MQOA 5IU1A 5J7EA 3NOTC 2JHEA 3IBRA 4WL9A 2A24B 2WKRA 4HH3A 4I39A 4KUOA 4R70A 3A0VA 2BASA 3F1PA 1OTBA 1S1YA 1GSXA 1S1ZA 2L4RA 1XJ3A 4NXFA 5F69A 3LI9A 3LUQA 4L9GA 3LIAA 3LIEA 4H6JA 2GJ3A 3SW1A 3VE4A 2VV6A 2VV7A 3P7NA 1OJ5A 3KX0X 1EW0A 3ULFA 5HWVA 1VB6A 2OOLA 3CLOA 5HDCA 4XT2B 4GW9A 2YKHA 2PD8A 4EEPA 1OTAA 3UE6A 3IS2A 5TBMB 4E04A 1T18A 5DJTA 4HY8A 1T1CA 3C8CA 3HJIA 3UMDA 2QKPA 1UWPX 1LL8A 3MQQA 4BBTA 1UGUA 1OTDA 2PR5A 3F1NB 3EWKA 3UB7A 4HP4A 3BY9A 2EA9A 5KIZA 4GS9A 2PDRA 1ODVA 4PKYG 5AVEA 3MJQA 2OWHA 5F5YA 5HD5A 2ZBBA 4F3LB 1N9NA 3H82A 4R38A 3LIBA 1XFNA 2L0WA 2I9VA 1OT6A 1GSWA 2P7JA 5HDSA 3LI8A 2HV1A 3UMEA 3PHYA 2Z6DA 3E4OA 4KUKA 2D02A 4EERA 1LT0A 3HJKA 1Y28A 4PKYA 2W0NA 4K08A 2INWA 5AVFA 5EFWA 3CAXA 5IS1A 1N9LA 3FC7A 4DJ2A 4KQDA 3H7WA 5DKLA 3BWLA 1F98A 4RQ9A 2QJ7A 4L9FA 4HHDA 4MN5A 4EXOA 1DP6A 3E4PA 2WKQA 3LIDA 1S4SA 1OTEA 5HWTA 2V0WA 1T1BA 4GHIA 5HSQA 3F1OA 4EESA 2PYRA 1OJGA 2WKPA 1TS0A 5F6AA 1LSWA 5A8BA 4MN6A 5HZHA 5HDDA 2K7SA 4HJ6A 4HJ3A 4DJ3A 1S67L 4JGOA 5HWWA 2B02A 4M4XA 1S4RA 3ZQ5A 1BYWA 4WN5A 4I5SA 3D72A 1JNUA 1V9ZA 4NXEA 3MR0A 4XT2A 3RTYA 2V9AA 2H28A 4I3IA 5HD3A 1T19A 3H9WA 1NWZA 3K3DA 5TBMA 5DJUA 2QHKA 1DP8A 4LRYC 3GECA 1N9OA 3PYPA 1DRMA 2KX6A 2J80A 3F1PB 4HOIA 2JN7A 2YKFA 4HNBA 3NOPC 1WA9A 4H6JB 3LYXA 5J3WA 2L1MA 1XJ2A 3OLOA 1XJ6A 4HH2A 4F3LA 4HQAA 2VV8A 2D01A 3EEHA 3UB8A 2QWSA 4BBVA 2V0UA 3GDIA 3UB9A 3MFXA 1MZUA 3IS2B 3RH8B 1S66L 4GCZA 5F68A 3LIFA 2PYPA 4JGRA 2QJ5A 4WUJA 4BBUA 4EW7A 1TS7A 3K3CA 2A24A 2PR6A 1TS6A 3E4QA 4HI4A 1LSVA 1OT9A 3NHQA 3B33A 1P0ZA 3VE3A 3ICYA 4YWZA 3MXQA 4WLAA 5J4EA 2V1BA 4GS9B 1KOUA 1P97A 3H82B 4L9EA 4I3JA 4I3AA 1GSVA 3NJAA 1XJ4A 4B9OA 3C2WA 3UB6A 3A0SA 2ZOIA 4WF0A 3LICA 4LPZA 1LSXA 4JGPA 1DP9A 4EETB 4EEUA 2VLGA 1TS8A 2OWJA 1OTIA 3A0RA 4LRZE 2VEAA 4NXBA 5I5LA 1D7EA 2PHYA 3VOLA 4HIAA 1G28A 3CWFA 3H7WB 4JGQA 1XFQA 2W27A 2CMNA 1UWNX 4LRXC 4NXGA 2M1CA 2PD7A 1T1AA 1D06A 1F9IA 3F1NA 4HJ4A 5G4ZA 3G6OA 4R6LA 1V9YA 4R3AA 2ZOHA 5G4YA 5DKKA 2R78A 3T50A 2KDKA 2V1AA 4GHIB 3NOUC 4EQ1A 3FG8A 2Z6CA 3F1OB 4I38A 1X0OA
chains in the Genus database with same CATH superfamily
1FQGA 3P01A 1W8QA 3MQOA 2Y2HA 3NOTC 2ZD8A 2EFUA 2A24B 2FZ0A 3CUEA 4R70A 5DTKA 3VP0A 4M3KA 1GSXA 1YQSA 4C6YA 2FFFB 2JKTM 3E2LA 1XJ3A 3IWIA 2HGVA 5BOHA 4IBXA 3LIEA 5EPHA 1ZC2A 2GJ3A 4KZ8A 2XLNA 4OVDA 2VV7A 2XRNA 5FAQA 1NYYA 4X55A 4GKUA 5U47A 1OJ5A 1EW0A 1ZKJA 1YMSA 5EVIA 5F83A 4R4SA 5AQBA 2YKHA 3R7WA 1IEMA 4R3BA 1H8ZA 5A91A 4ZTKA 4EEPA 3IXGA 1NLYA 3UE6A 5TBMB 3VOYA 3GMWA 2XH9A 1T1CA 5C5KA 3C8CA 3RJUA 1UWPX 3KYEA 3MQQA 4BBTA 4ZAMA 4N1XA 3ZG5A 1UGUA 2PR5A 5FDSA 4N9LA 1ONGA 4OKPA 2EA9A 4E3NA 4MBFA 4G3WA 1IYSA 3VP2A 2WADA 4FCFA 5K5BA 5F5YA 5HD5A 2RL3A 2ZJ9A 2ZC5B 3W4PA 3QP8A 1KDWA 2I9VA 1IYQA 5FQJA 1XGJA 4JF6A 1TDLA 3HUNA 3LR5A 4KUKA 2D02A 4EERA 1LT0A 3N8RA 4X1MA 1U60A 4PKYA 5EVEA 1YM1A 1W63M 2W0NA 5AVFA 2P74A 4JPMA 3S4XA 2C5WB 3MKFA 3UE3A 1GA9A 5A90A 4KQDA 3UNWA 5DKLA 4R0QA 1FSYA 3HUOA 3DBAA 4CPKA 5GLAA 2WKHA 1PWCA 4OQGA 4EXOA 1IFQA 1E25A 2XD5A 2Y2QA 2GX5A 5HPFA 2B18A 5HSQA 4WMCD 4IEDA 4Y13A 1EI5A 1OMEA 4KZ6A 3V3RA 1LLBA 4X25A 2P08A 2Y59A 3O3VA 5HL6A 5DF9A 2ZQAA 1ZTUA 3QHYA 4S2LA 2HDQA 5L07A 3IHAA 1L0EA 1BTLA 3NC8A 2VZWA 3ZG9B 5L2FA 2JKRI 2K7SA 1NZUA 4DJ3A 4RYEA 4DXCA 4QPRA 2PU4A 3M6HA 4S2PA 1M6KA 4C75A 1S4RA 3N8SA 4WN5A 2ZMFA 3D72A 3ZG0A 2R9WA 3ZNYA 1V9ZA 3SS4A 4LENA 3C7VA 2ZMAA 3MR0A 4XT2A 4FH2A 3RTYA 4E3IA 4B4XA 3T1XA 5A93A 1YLYA 3UPOA 1CQAA 1GHMA 2GZAA 5EM1A 2G7UA 2W3GA 4FSFA 2M7UA 2NUTC 5EECA 2VKSA 5DJUA 1STZA 1DP8A 4JLFA 1Q2QA 3PBSA 1FIKA 2O9AA 3QP5A 2J3WA 3BFDA 5KSHA 2O99A 2VGLS 4MLLA 2J80A 4E3JA 2WGVA 2JKFA 1PRQA 1MKMA 4PMAA 2J3TC 2YKFA 4O0PA 4HNBA 4H6JB 3IX4A 1M40A 3S22A 1TEMA 1VM1A 5FI2A 3A3FA 4HQAA 3IXBA 4KZ5A 2V8FA 2QWSA 4BBVA 4DE0A 3Q82A 5DFXA 5FDHA 4UA9A 1I2WA 1SDNA 1VHMA 3IF6A 3Q7VA 4BQMA 1G68A 3BW6A 4Y17A 4GDNA 1G6AA 2ZMVA 1RP5A 4JGRA 3MBZA 2EX8A 4ETZA 2PBYA 4FD8A 4BBUA 4GDBA 4R1GA 5FEGA 3BFCA 2J9PA 1L0DA 4XXRA 4EW7A 5HW3A 1FCOA 1KE0A 4B93A 1TS6A 3E4QA 4HI4A 2ZM0A 4Y0UA 4UA7A 4X68A 5CGSA 3C38A 4A5RA 3MXQA 3JPUA 3A3EA 4WLAA 5KZHA 1MY8A 2EXBA 4E3OA 1L0FA 2IWBA 5FAOA 4UA6A 3IWQA 1KE3A 5CEDA 4I3AA 2O9CA 3NJAA 3UB6A 3BFGA 1YLZA 3HLEA 1IYOA 1MWTA 1MC0A 3LICA 1LSXA 4KZ3A 1PZPA 3PAEA 1GA0A 4S2IA 2X71A 1TS8A 2WKEA 2ZC4B 2V2FF 4OLDA 4P6ZM 1MPLA 1O7EA 3R4KA 4UQIM 3CPTA 1P9WA 4ZBEA 4N1HA 4IJGA 4U0XA 1N4OA 4OPRA 5HL1A 2XGNA 3IF5A 1K4FA 1XFQA 2A2LA 1K38A 1T1AA 1F9IA 2EX2A 2HJEA 2Y4AA 4HJ4A 3VP4A 5DF8A 4DKIA 1L0GA 2VGKA 1C3BA 2Y2IA 5DKKA 3CUEC 4GHIB 3IHBA 3NOUC 3P98A 4B4ZA 4EQ1A 2XF3A 4KQOA 2Z6CA 2MJ6A 5I94A 1X0OA 5DF7A 1ESUA 5GLCA 4RX2A 5EUAA 1KE4A 1LL5A 3EQVA 2JHEA 4WL9A 1CJFA 2ZC7A 3LY4A 4ZJ3A 4WM9A 5CGXA 4CLCE 1KGFA 3F1PA 3L9KA 1OTBA 4FUWA 1S1ZA 3C4OA 2P9VB 3LUQA 4L9GA 1XA1A 3LIAA 4EWFA 2QYBA 5AQAA 3VE4A 2JBFA 3ZFZA 4AFIA 5FSRA 2VV6A 2Y2KA 2E8IA 3IQAA 4H8RA 2W1TA 5GLDA 2WGWA 3ULFA 4ZJ1A 2ZQ8A 5HDCA 1KVMA 5TFQA 3ZGAB 4GW9A 1CK3A 5HAIA 2PD8A 4S2NA 3NBLA 3ZVTA 1IKIA 3OOVA 1BZAA 2ZM8A 1T18A 1EROA 3HBRA 4KG6A 3HJIA 2QKPA 3IX3A 5E43A 3N6IA 4P0MA 1G6OA 1DY6A 3G30A 4MEZA 3EWKA 1XP4A 2GNXA 3RXWA 3BY9A 2Y2MA 4GN2A 3D3OA 3UN7A 3GVBA 4GS9A 2Y2JA 4OQHA 1ESIA 5FQIA 1MWUA 1W5DA 3OPLA 2XSSA 2ZBBA 3TSGA 4F3LB 4P85A 3LIBA 2L0WA 5CTNA 1PW8A 1PI4A 3VMAA 2OLUA 1OT6A 2Y2GA 3BLMA 1BT5A 3MF0A 5CRFA 4OQ0A 1GHIA 1XGIA 2P7JA 3MMHA 1QMEA 2J3TD 3UMEA 4Y5FA 2Z6DA 1J9MA 2IWDA 2X02A 4UEYA 3HJKA 2WAFA 4ZDXA 1W8YA 1K55C 3L7HA 3N8LA 1ZG4A 1NLZA 3PTEA 4MNRA 4PM9A 4BD1A 3V3SA 4JF5A 4PM5A 3E2KA 2XROA 3G31A 5IS1A 4RVAA 1VQQA 5CXWA 4OPZA 4FH4A 3H7WA 4HEFA 5FI6A 3ZG7B 3BWLA 1F98A 4RQ9A 1H8MA 1E4DA 3TW8A 4L9FA 1YSQA 1SDEA 1WYBA 1IYPA 1HVBA 3RXXA 1S0WA 1OTEA 3QP2A 4BLMA 1GHPA 3BYDA 3O86A 2V0WA 1T1BA 3C4PA 4Q0IA 1SKOA 3F1OA 4ARZA 2NUPC 1WYCA 5DTSA 4MBHA 2Y2PA 1CEFA 1H5XA 1ERMA 1JWVA 1OJGA 1PWGA 2WKPA 1TS0A 5F6AA 1HLUP 5E2HA 4MN6A 3BQ8A 4PAUA 1BLSA 5CGWA 3NDGA 2AVXA 3QP1A 1S67L 5D3OA 2ZL1A 4HESA 4JGOA 3C7UA 4BWIA 2B02A 2XFTA 4N92A 4M4XA 3NCKA 4CLCB 1VEUB 3A3IA 3LEZA 3GRJA 3DTEA 1ZHHB 3CI6A 2Y8HA 3PXPA 4NXEA 1FR1A 3DWZA 3UPNA 1Y54A 2V9AA 4HBUA 3S7OA 1T19A 5FI7A 5GHXA 4P6BA 3ZHHA 3H9WA 3K3DA 4QD4A 3T4QA 3CHWP 4JXSA 4LRYC 3GECA 1BUEA 1D1JA 1IKGA 4UAAA 1N9OA 2JC7A 2LB5A 2A3UA 3QP6A 2JE5A 4HOIA 4ME4A 3IT9A 4JKTA 1WA9A 3FPVA 2H0YA 1ES5A 3UE1A 4R4RA 5J3WA 2L1MA 2WYXA 4CJNA 3IF6C 1O07A 1XJ6A 1VETA 4IBRA 1PWDA 5EVIB 5HAQA 3UB8A 4IVIA 3R7WB 1G5UA 1NYMA 3GDIA 3UB9A 4EUZA 1NZOA 3SS3A 1E3UA 5F1FA 1L3LA 1F5MA 3RH8B 1S66L 3PBRA 3V67A 3OPPA 5CERA 4Q8IA 3NDEA 2OSUA 1EWZA 1YKDA 2BG1A 3DTIA 1OPXA 1TS7A 2PR6A 1LSVA 3IXHA 3DWKA 2HDUA 1GCEA 4Q0JA 3T1QB 4WZ5A 4O8GA 3TG9A 3FKVA 3NI9A 3V39A 4LV0A 4MCWA 4OQIA 1KOUA 4X53A 2P04A 3GQZA 3ISGA 3EEAA 2WKIA 1FOFA 4B9OA 3C2WA 4KZ9A 2XR0A 4DMZA 3SZTA 3EGDC 4LPZA 3P09A 3EGXC 4MN7A 2OV5A 3QP4A 5FQQA 2XK1A 4GOGA 2W3FA 2ZQ7A 3A0RA 4B88A 3ZCZA 4OP5A 4LGWA 2VEAA 3O5YA 2XA7M 4NXBA 5I5LA 3PBOA 1D7EA 3VFHA 3OCLA 5EOOA 3VV4A 2VJWA 3VOLA 4HIAA 2PBDP 1VETB 3CWFA 4Y0TA 2JKGA 2W27A 2CMNA 1UWNX 4LRXC 3G2YA 4NXGA 4ETXA 3BRMA 1D06A 3F1NA 3T1RA 5FAPA 2JKRM 3GR2A 2PT7A 1V9YA 4R3AA 1BLHA 2ZOHA 3M2KA 4S2KA 3D9YA 4HBTA 3WWXA 1XKZA 4GNUA 1PZOA 3BY8A 4LLOB 1PNEA 3GSGA 1CEGA 5IU1A 3VFFA 3IBRA 1Z6FA 3ZVWA 4HH3A 3WRTA 3T4OA 3KSGA 4I39A 2Y91A 2I72A 3A0VA 1YAXA 2BASA 3FPWA 1S1YA 1A0KA 2W1RA 2L4RA 4KG5A 3FYZA 3MSHA 2LB9A 4DDYA 5EM0A 5FA7A 3G4PA 4S2NC 5HX9A 1K54A 3P7NA 1TF1A 3CLOA 4XT2B 1S6RA 1K56A 3T4JA 1RCJA 3JVVA 4PPRA 1FSWA 1OTAA 3G32A 1K57A 1YLWA 3IS2A 5HFOA 4PM8A 4E04A 5DJTA 1HD8A 4IVKA 2Y2OA 4HY8A 2Q0OA 4YOFA 1QMFA 4Y7PA 2H5SA 3LO7A 2VA0A 3MZFA 1WE4A 3IX8A 4U3TA 2DMWA 2HJ9C 3F1NB 3UB7A 4CLCC 4HP4A 1YPRA 1K6SA 3V5MA 5KIZA 5KSCA 2UV0E 2ACGA 2PDRA 1ODVA 3MS6A 4PKYG 3MJQA 4KZAA 4KENB 3WS4A 5TR7A 2GDNA 2Y2LA 1N9NA 2HF6A 4K0WA 3H82A 4QY6A 1FR6A 4R38A 3FZCA 1XFNA 5IHVA 4YINA 5FQMA 3G35A 3S7NA 2WZZA 1NJ4A 5HDSA 2G2WA 4KZ4A 3E0YA 3PHYA 3IF6B 3Q7VB 3TE8A 3E4OA 4IHQA 1Y28A 3KSFA 1LI0A 4K08A 5EFWA 3T12B 1LHYA 3CAXA 4IUHA 4NETA 2HP5A 5L8MA 1N9LA 3OC2A 3FC7A 4DJ2A 4OONA 3B42A 5GLBA 2J7VA 2QJ7A 1AXBA 5EVIC 1ONHA 2KOIA 3MXSA 4BENA 3DTMA 1S4SA 3S7QA 1TDGA 5HWTA 3HLWA 2WZXA 4Y0OA 3TRCA 2EX6A 2QZ6A 4G3KA 5F1GA 4X56A 5AJGA 2EWWA 1IELA 4L0LA 4EESA 3HLDA 1H3QA 3CZDA 1W79A 3IWOA 3PR6A 4NEED 1LSWA 2HPBA 4OPYA 2HDRA 4OP8A 2C6WB 1HTZA 3CPTB 4U0TA 4HJ6A 5A92A 1ES3A 3O87A 4HJ3A 4C3QA 4CQHA 2VK3A 2R9XA 1AWIA 4E3LA 4P87A 2H0TA 2H10A 3VP3A 1BLCA 3PBTA 4Y2FA 1BYWA 5DTTA 4E3MA 4QHCA 4DE2A 2V1ZA 3FV7A 2V20A 2H28A 4I3IA 4FTXA 5HPIA 4KQQA 5EOEA 4XUZA 1NWZA 3JVUA 5TBMA 1SKFA 2OAQ1 3BJNA 3O88A 3PYPA 3LFVA 3Q81A 5FATA 2KX6A 3IBJA 2WK0A 4Y3IA 1LI9A 1MXOA 3F1PB 4DE1A 1MKIA 4S2JA 3VOZA 4PM6A 5AQ7A 3EOIA 1XPBA 3AGFA 3NOPC 3TOIA 3KSIA 3LYXA 4NKPA 4X6TA 4O7DA 3A3JA 4E6XA 3U4LP 1Z09A 1XJ2A 4HH2A 2W1TB 5E2GA 1SZVA 3U2AA 2A49A 5E2FA 2WGWB 5M18A 2VV8A 2D01A 3Q7ZA 3W8KA 3EEHA 1XA7A 1DJBA 2V0UA 4OPQA 3MZEA 5CHJA 4BL2A 3MKEA 4QJGA 4YNRA 5F68A 1TD5A 2PYPA 2EWVA 4YFMA 4WZ5C 4WUJA 1K4EA 3HUMA 3K3CA 3GV9A 2HP9A 1OT9A 3B33A 2ZQ9A 3VE3A 3UO9A 4DE3A 1KGEA 5J4EA 2WUQA 2V1BA 4GS9B 5CTMA 3SH7A 3OPHA 4WMCA 1YLJA 2OLVA 4WYYA 5FL3A 4GB7A 4R23A 3QNBA 3WS2A 3ZG8B 1GSVA 3NY4A 4P6ZS 1MBLA 4UQIS 4FOFA 1PIOA 4DDSA 2ZOIA 2DNSA 4OOYA 4CLCD 3LEQA 1DP9A 3E98A 4EEUA 3T4KA 2W3EA 3KYQA 2VLGA 3UDIA 4QU3A 1YMXA 4QB8A 2BTFP 2PAVP 2QPNA 5L10A 3S1YA 1I2SA 1PW1A 2PHYA 3MQ0A 3N7WA 5GL9A 5TGFA 1NRFA 3M6BA 3H7WB 3D4FA 5M1AA 4JGQA 5FQ9A 3CJMA 5EE8A 4LV3A 3I7JA 4WELA 1TVFA 2PRFA 3KYZA 2HDSA 2WAEA 4WEKA 5G4YA 3ZDJA 3MFDA 4MMNA 2V1AA 4NG2A 4LCMA 2QMIA 3WS0A 3HL9A 5DFYA 1SKOB 3F1OB 4ARZB 3UDFA 2Z2MB 2ZC3B 4LFUA 4HP9A 5J7EA 2ZQCA 3RFBA 5EVID 1ES4A 2WKRA 3W4QA 4EQIA 3G34A 4KUOA 1K25A 1K55A 1K54C 3MZDA 3CMZA 4S2MA 4NXFA 3B3XA 2FH5A 3JYIA 5F69A 2PU2A 3LI9A 1PYYA 2ZL1B 4H6JA 5J8XA 3BECA 3SW1A 3SOIA 3OBFA 3KX0X 1K57C 1PFLA 1K6RA 2E8JA 4ESPA 5F82A 5HWVA 1VB6A 2OOLA 4N9KA 4X1LA 3C30A 2Y55A 3T4TA 3LR3A 1XXMA 3WS5A 1RGYA 2HZ5A 3VSKA 4X69A 5FQKA 1JTGA 3V50A 3A3DA 4WBGA 1ACFA 3UMDA 4E3KA 2ZC6B 2DCFA 3BEBA 1LL8A 3DW0A 3Q07A 3UDXA 3HLCA 4NK3A 5G18A 5CHMA 1OTDA 4II7A 3AGDA 2K2NA 2J9OA 4EV4A 4F94A 4EBNA 2Y79A 3UPPA 3PAGA 4O01A 4JBFA 5AVEA 2OWHA 5M19A 2WGIA 1ES2A 1HZOA 5MC7A 2ZLYA 4KZBA 1GSWA 1LL9A 2X01A 3LI8A 2HV1A 4DRTA 3M2JA 1PI5A 2W3HA 4EUVA 3PBQA 1JWZA 4JXVA 3MXRA 3LCEA 2RCXA 3QNCA 2INWA 1E3UD 5FASA 1YSPA 1I5QA 2W3DA 5HAPA 3KO6A 3HVFA 2VX8A 5CEBA 5CECA 2Y2NA 3HREA 3SH9A 3TJZC 1BULA 4ZJ2A 2Q9NA 3WS1A 1K0KA 1FCMA 4BL3A 4HHDA 3CITA 4MN5A 2XEPA 1JVJA 1ALQA 4WZ4A 1DP6A 5AQ9A 3E4PA 2WKQA 3LIDA 4D60A 2JCHA 3KSHA 2M7VA 3FKWA 2EFXA 5KMWA 4GHIA 2O0YA 5EV0A 1NY0A 4G3VA 1J3WA 1MWSA 1RGZA 5JYOA 3AGEA 4OH0A 4LV2A 2PYRA 1W7FA 3LY3A 3Q1FA 3SS5A 3B47A 3UY6A 2KLIA 5A8BA 5HZHA 5HDDA 3NECA 1YLPA 2EX9A 2FFYA 4GD8A 3NULA 5FEFA 4QY5A 1N9BA 1NRJA 4JXWA 3VP1A 2P9VA 2HP6A 1JWPA 1KDSA 3SH8A 2G2UA 5E2EA 3WRZA 3HLGA 5HWWA 4K91A 2B5RA 2V8CA 3ZQ5A 4I5SA 3T4LA 4EBLA 1JNUA 1IOUA 2O9BA 3ZNTA 4KG2A 3T4SA 1F2KA 4Q0HA 1CI9A 4JXGA 5HD3A 4GZBA 4GLQA 5EVLA 2K31A 2QHKA 4K0XA 3ITAA 1CI8A 1KVLA 1BSGA 4EU0A 4DN0A 4EBPA 1NXYA 2XDMA 1DJAA 5IT5A 1H0MA 1DRMA 3PBNA 3IH8A 4RA7A 5HARA 3VSLA 3NIAA 2JN7A 3ZYTA 4RX3A 3BLSA 2Z2LB 4JF4A 3UB5P 3W2ZA 2Q9MA 3ITBA 3HLFA 3OZHA 3UE0A 4Z9QA 3K2NA 1ERQA 1KGGA 4KQRA 3OLOA 4F3LA 2J8YA 3GTCA 3LR4A 2DRWA 4WEJA 1XX2A 3BM6A 4R3JA 4MDZA 3MFXA 4ZRRA 1P9RA 4OOLA 1MZUA 3IS2B 4XUXA 1K56D 3IH9A 4GCZA 4Y15A 4IUKA 2EXAA 3CG5A 3S7PA 5CHUA 2XFSA 3LIFA 5DVAA 4KZ7A 2XQZA 3T1SA 3C5AA 2QJ5A 4DF6A 3OCNA 1FCNA 1DJCA 4GD6A 2A24A 3HCYA 4BMWA 3NHQA 4PM7A 1P0ZA 3ICYA 4YWZA 4E6WA 1JTDA 3N4IA 1MWRA 1L2SA 4DXBA 3DAVA 4ID4A 3G2ZA 1P97A 3H82B 1ZG6A 4L9EA 3OPRA 5GHYA 4I3JA 4S2OA 1XJ4A 2CC1A 3A0SA 1W63Q 4OOMA 1Y4OA 2XA7S 4WF0A 1Q2PA 4LCLA 4JGPA 3LR0A 5GHZA 2VGJA 3BFEA 4EETB 3LGOA 4OLGA 1CF0A 2OWJA 2JKTI 2ZM2A 2ZQDA 3EQUA 1OTIA 4LRZE 4UHUA 3IXDA 3DTKA 1SCWA 2IA2A 4BJPA 5L09A 1BLPA 4QWOA 1G28A 3HLBA 2B95A 1SHVA 2XD1A 3W4OA 2OAP1 4CLCA 1VEUA 5TJJA 2M1CA 2PD7A 1FILA 1YLTA 4GJ4A 5G4ZA 1YT4A 3G6OA 4R6LA 5JYPA 2UWXA 4PHTA 5CX7A 4BD0A 4LV1A 2BLSA 2R78A 3BQAA 4MBKA 3T50A 2VGLM 2KDKA 3FWLA 3FG8A 3BFFA 4D2OA 4I38A 5LBRA 2IWCA 1H8YA 4Z1WA
chains in the Genus database with same CATH topology
3BY8A 3P01A 4HP9A 4LLOB 3MQOA 5IU1A 5J7EA 3NOTC 3EQVA 2JHEA 3IBRA 4WL9A 3RFBA 2A24B 2FZ0A 2WKRA 3CUEA 4HH3A 3T4OA 3KSGA 4I39A 4KUOA 4R70A 4CLCE 3A0VA 1YAXA 2BASA 3F1PA 3FPWA 1OTBA 1S1YA 1GSXA 1S1ZA 2JKTM 2L4RA 2W1RA 1XJ3A 4NXFA 2HGVA 2FH5A 5F69A 3LI9A 3LUQA 4L9GA 3LIAA 3LIEA 4H6JA 2LB9A 2GJ3A 2QYBA 3SW1A 3VE4A 4AFIA 3OBFA 2VV6A 2VV7A 2XRNA 3P7NA 1OJ5A 3KX0X 1TF1A 1EW0A 2W1TA 3ULFA 5HWVA 1VB6A 2OOLA 3CLOA 5HDCA 4XT2B 4GW9A 2YKHA 3C30A 3R7WA 2PD8A 3T4TA 4EEPA 3T4JA 3LR3A 3JVVA 1NLYA 3OOVA 1OTAA 3UE6A 3IS2A 5TBMB 4E04A 1T18A 5DJTA 4HY8A 1T1CA 5C5KA 3C8CA 3HJIA 3UMDA 2QKPA 1UWPX 1LL8A 4YOFA 3MQQA 4BBTA 2VA0A 1UGUA 1G6OA 1OTDA 4II7A 2PR5A 2K2NA 2DMWA 2HJ9C 3F1NB 3EWKA 2GNXA 3UB7A 4CLCC 4HP4A 3BY9A 2Y79A 2EA9A 3D3OA 5KIZA 4O01A 4GS9A 2PDRA 1ODVA 4PKYG 4G3WA 3MJQA 5AVEA 2OWHA 5K5BA 5F5YA 5HD5A 2XSSA 2ZBBA 4F3LB 1N9NA 2HF6A 3H82A 4R38A 3LIBA 1XFNA 2L0WA 5MC7A 2I9VA 1OT6A 3S7NA 1GSWA 3MF0A 2P7JA 3MMHA 5HDSA 3LI8A 2HV1A 2J3TD 3E0YA 3UMEA 3PHYA 4Y5FA 2Z6DA 3TE8A 3LR5A 3E4OA 4KUKA 2D02A 4EERA 1LT0A 2W3HA 4EUVA 3PBQA 4IHQA 4UEYA 3HJKA 1Y28A 4PKYA 1W63M 2W0NA 3KSFA 4K08A 2INWA 5AVFA 5EFWA 1NLZA 1YSPA 2W3DA 3KO6A 2XROA 3CAXA 4IUHA 2VX8A 5IS1A 3UE3A 5L8MA 1N9LA 3OC2A 3FC7A 4DJ2A 4KQDA 3TJZC 3H7WA 5DKLA 3B42A 3BWLA 1F98A 3DBAA 4RQ9A 1H8MA 2QJ7A 3TW8A 4L9FA 4HHDA 3CITA 1YSQA 2KOIA 4MN5A 4EXOA 1DP6A 1IFQA 3E4PA 2WKQA 3LIDA 1S4SA 3S7QA 2GX5A 1OTEA 3KSHA 2M7VA 5HWTA 5HPFA 2B18A 3TRCA 2V0WA 1T1BA 4GHIA 2O0YA 4G3KA 4Q0IA 4G3VA 5HSQA 5AJGA 2EWWA 3F1OA 4L0LA 2NUPC 4ARZA 4EESA 1H3QA 2PYRA 2P08A 3PR6A 5HL6A 3B47A 5DF9A 1ZTUA 1OJGA 2WKPA 1TS0A 4NEED 2KLIA 5F6AA 1LSWA 5A8BA 4MN6A 5HZHA 3BQ8A 5HDDA 2VZWA 4PAUA 2JKRI 2K7SA 4HJ6A 1NRJA 4HJ3A 4DJ3A 4CQHA 4QPRA 1S67L 4JGOA 4BWIA 5HWWA 2B02A 4M4XA 1S4RA 3ZQ5A 4CLCB 3PBTA 4Y2FA 1BYWA 4WN5A 4I5SA 2ZMFA 3D72A 3T4LA 1ZHHB 3CI6A 1JNUA 1V9ZA 1IOUA 2Y8HA 2O9BA 3PXPA 4NXEA 3MR0A 4XT2A 3RTYA 3T4SA 4Q0HA 2V9AA 3S7OA 2H28A 4I3IA 5HD3A 1T19A 5HPIA 2GZAA 3H9WA 1NWZA 2G7UA 2W3GA 4GLQA 3JVUA 4FSFA 2M7UA 3K3DA 2NUTC 5TBMA 2VKSA 2K31A 5DJUA 1STZA 2QHKA 1DP8A 2OAQ1 3T4QA 3PBSA 3BJNA 4EU0A 4LRYC 3GECA 2O9AA 4DN0A 2J3WA 1N9OA 5IT5A 3PYPA 3LFVA 5KSHA 1DRMA 2LB5A 3PBNA 2KX6A 3IBJA 2O99A 4Y3IA 2VGLS 2J80A 3F1PB 4HOIA 2JN7A 3ZYTA 4ME4A 1MKMA 2J3TC 3EOIA 3W2ZA 2YKFA 4O0PA 4HNBA 3NOPC 1WA9A 3FPVA 3KSIA 3LYXA 4H6JB 4NKPA 3K2NA 5J3WA 2L1MA 1XJ2A 3OLOA 1XJ6A 4HH2A 4F3LA 2W1TB 3U2AA 4HQAA 3LR4A 2VV8A 4WEJA 2D01A 3EEHA 3UB8A 2QWSA 4BBVA 3R7WB 4MDZA 2V0UA 3GDIA 3UB9A 5DFXA 3MFXA 1VHMA 4ZRRA 1P9RA 4OOLA 1MZUA 3BW6A 3IS2B 1F5MA 3RH8B 1S66L 4GCZA 4IUKA 3S7PA 3PBRA 4YNRA 3V67A 2ZMVA 3LIFA 5F68A 1TD5A 2PYPA 2EWVA 4JGRA 2QJ5A 4ETZA 4WUJA 4BBUA 1YKDA 3OCNA 4EW7A 1OPXA 1TS7A 3K3CA 2A24A 2PR6A 1TS6A 3E4QA 3HCYA 4HI4A 4B93A 1LSVA 1OT9A 4BMWA 3NHQA 3C38A 4Q0JA 3B33A 1P0ZA 3VE3A 3ICYA 4YWZA 3MXQA 4O8GA 4WLAA 5J4EA 2V1BA 4GS9B 4MCWA 1KOUA 1P97A 3H82B 5FL3A 4L9EA 2P04A 3EEAA 4I3JA 4I3AA 2O9CA 1GSVA 4P6ZS 3NJAA 1XJ4A 4B9OA 3C2WA 4UQIS 4FOFA 3UB6A 3A0SA 4DMZA 3EGDC 2ZOIA 1W63Q 4OOMA 2XA7S 1MC0A 4WF0A 3LICA 4LPZA 1LSXA 4CLCD 4JGPA 3LR0A 1DP9A 4EETB 3E98A 4EEUA 3EGXC 4MN7A 3T4KA 2W3EA 3KYQA 2VLGA 1TS8A 2OWJA 2JKTI 2W3FA 3EQUA 4P6ZM 1OTIA 3R4KA 3A0RA 4UQIM 1P9WA 4LRZE 2VEAA 3O5YA 2XA7M 4NXBA 5I5LA 3PBOA 1D7EA 3OCLA 3VV4A 4IJGA 2IA2A 4BJPA 2PHYA 2VJWA 3MQ0A 3VOLA 4HIAA 1G28A 3CWFA 3H7WB 4JGQA 2OAP1 1XFQA 2W27A 2A2LA 2CMNA 4CLCA 1UWNX 4LRXC 4NXGA 4ETXA 5TJJA 2M1CA 2PD7A 1T1AA 1D06A 1F9IA 3F1NA 4GJ4A 2HJEA 4HJ4A 5G4ZA 4WELA 2JKRM 3KYZA 3G6OA 4R6LA 2PT7A 4PHTA 4WEKA 5CX7A 1V9YA 4R3AA 2ZOHA 5G4YA 5DKKA 4MMNA 2R78A 3BQAA 3T50A 2VGLM 2KDKA 2V1AA 3CUEC 4GHIB 3NOUC 4EQ1A 5DFYA 3FG8A 4KQOA 2Z6CA 3F1OB 4I38A 2MJ6A 5LBRA 4ARZB 4Z1WA 1X0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY8 A;  4HP9 A;  4LLO B;  3MQO A;  5IU1 A;  5J7E A;  3NOT C;  2JHE A;  3IBR A;  4WL9 A;  2A24 B;  2WKR A;  4HH3 A;  4I39 A;  4KUO A;  4R70 A;  3A0V A;  2BAS A;  3F1P A;  1OTB A;  1S1Y A;  1GSX A;  1S1Z A;  2L4R A;  1XJ3 A;  4NXF A;  5F69 A;  3LI9 A;  3LUQ A;  4L9G A;  3LIA A;  3LIE A;  4H6J A;  2GJ3 A;  3SW1 A;  3VE4 A;  2VV6 A;  2VV7 A;  3P7N A;  1OJ5 A;  3KX0 X;  1EW0 A;  3ULF A;  5HWV A;  1VB6 A;  2OOL A;  3CLO A;  5HDC A;  4XT2 B;  4GW9 A;  2YKH A;  2PD8 A;  4EEP A;  1OTA A;  3UE6 A;  3IS2 A;  5TBM B;  4E04 A;  1T18 A;  5DJT A;  4HY8 A;  1T1C A;  3C8C A;  3HJI A;  3UMD A;  2QKP A;  1UWP X;  1LL8 A;  3MQQ A;  4BBT A;  1UGU A;  1OTD A;  2PR5 A;  3F1N B;  3EWK A;  3UB7 A;  4HP4 A;  3BY9 A;  2EA9 A;  5KIZ A;  4GS9 A;  2PDR A;  1ODV A;  4PKY G;  5AVE A;  3MJQ A;  2OWH A;  5F5Y A;  5HD5 A;  2ZBB A;  4F3L B;  1N9N A;  3H82 A;  4R38 A;  3LIB A;  1XFN A;  2L0W A;  2I9V A;  1OT6 A;  1GSW A;  2P7J A;  5HDS A;  3LI8 A;  2HV1 A;  3UME A;  3PHY A;  2Z6D A;  3E4O A;  4KUK A;  2D02 A;  4EER A;  1LT0 A;  3HJK A;  1Y28 A;  4PKY A;  2W0N A;  4K08 A;  2INW A;  5AVF A;  5EFW A;  3CAX A;  5IS1 A;  1N9L A;  3FC7 A;  4DJ2 A;  4KQD A;  3H7W A;  5DKL A;  3BWL A;  1F98 A;  4RQ9 A;  2QJ7 A;  4L9F A;  4HHD A;  4MN5 A;  4EXO A;  1DP6 A;  3E4P A;  2WKQ A;  3LID A;  1S4S A;  1OTE A;  5HWT A;  2V0W A;  1T1B A;  4GHI A;  5HSQ A;  3F1O A;  4EES A;  2PYR A;  1OJG A;  2WKP A;  1TS0 A;  5F6A A;  1LSW A;  5A8B A;  4MN6 A;  5HZH A;  5HDD A;  2K7S A;  4HJ6 A;  4HJ3 A;  4DJ3 A;  1S67 L;  4JGO A;  5HWW A;  2B02 A;  4M4X A;  1S4R A;  3ZQ5 A;  1BYW A;  4WN5 A;  4I5S A;  3D72 A;  1JNU A;  1V9Z A;  4NXE A;  3MR0 A;  4XT2 A;  3RTY A;  2V9A A;  2H28 A;  4I3I A;  5HD3 A;  1T19 A;  3H9W A;  1NWZ A;  3K3D A;  5TBM A;  5DJU A;  2QHK A;  1DP8 A;  4LRY C;  3GEC A;  1N9O A;  3PYP A;  1DRM A;  2KX6 A;  2J80 A;  3F1P B;  4HOI A;  2JN7 A;  2YKF A;  4HNB A;  3NOP C;  1WA9 A;  4H6J B;  3LYX A;  5J3W A;  2L1M A;  1XJ2 A;  3OLO A;  1XJ6 A;  4HH2 A;  4F3L A;  4HQA A;  2VV8 A;  2D01 A;  3EEH A;  3UB8 A;  2QWS A;  4BBV A;  2V0U A;  3GDI A;  3UB9 A;  3MFX A;  1MZU A;  3IS2 B;  3RH8 B;  1S66 L;  4GCZ A;  5F68 A;  3LIF A;  2PYP A;  4JGR A;  2QJ5 A;  4WUJ A;  4BBU A;  4EW7 A;  1TS7 A;  3K3C A;  2A24 A;  2PR6 A;  1TS6 A;  3E4Q A;  4HI4 A;  1LSV A;  1OT9 A;  3NHQ A;  3B33 A;  1P0Z A;  3VE3 A;  3ICY A;  4YWZ A;  3MXQ A;  4WLA A;  5J4E A;  2V1B A;  4GS9 B;  1KOU A;  1P97 A;  3H82 B;  4L9E A;  4I3J A;  4I3A A;  1GSV A;  3NJA A;  1XJ4 A;  4B9O A;  3C2W A;  3UB6 A;  3A0S A;  2ZOI A;  4WF0 A;  3LIC A;  4LPZ A;  1LSX A;  4JGP A;  1DP9 A;  4EET B;  4EEU A;  2VLG A;  1TS8 A;  2OWJ A;  1OTI A;  3A0R A;  4LRZ E;  2VEA A;  4NXB A;  5I5L A;  1D7E A;  2PHY A;  3VOL A;  4HIA A;  1G28 A;  3CWF A;  3H7W B;  4JGQ A;  1XFQ A;  2W27 A;  2CMN A;  1UWN X;  4LRX C;  4NXG A;  2M1C A;  2PD7 A;  1T1A A;  1D06 A;  1F9I A;  3F1N A;  4HJ4 A;  5G4Z A;  3G6O A;  4R6L A;  1V9Y A;  4R3A A;  2ZOH A;  5G4Y A;  5DKK A;  2R78 A;  3T50 A;  2KDK A;  2V1A A;  4GHI B;  3NOU C;  4EQ1 A;  3FG8 A;  2Z6C A;  3F1O B;  4I38 A;  1X0O A; 
#chains in the Genus database with same CATH topology
 1FQG A;  3P01 A;  1W8Q A;  3MQO A;  2Y2H A;  3NOT C;  2ZD8 A;  2EFU A;  2A24 B;  2FZ0 A;  3CUE A;  4R70 A;  5DTK A;  3VP0 A;  4M3K A;  1GSX A;  1YQS A;  4C6Y A;  2FFF B;  2JKT M;  3E2L A;  1XJ3 A;  3IWI A;  2HGV A;  5BOH A;  4IBX A;  3LIE A;  5EPH A;  1ZC2 A;  2GJ3 A;  4KZ8 A;  2XLN A;  4OVD A;  2VV7 A;  2XRN A;  5FAQ A;  1NYY A;  4X55 A;  4GKU A;  5U47 A;  1OJ5 A;  1EW0 A;  1ZKJ A;  1YMS A;  5EVI A;  5F83 A;  4R4S A;  5AQB A;  2YKH A;  3R7W A;  1IEM A;  4R3B A;  1H8Z A;  5A91 A;  4ZTK A;  4EEP A;  3IXG A;  1NLY A;  3UE6 A;  5TBM B;  3VOY A;  3GMW A;  2XH9 A;  1T1C A;  5C5K A;  3C8C A;  3RJU A;  1UWP X;  3KYE A;  3MQQ A;  4BBT A;  4ZAM A;  4N1X A;  3ZG5 A;  1UGU A;  2PR5 A;  5FDS A;  4N9L A;  1ONG A;  4OKP A;  2EA9 A;  4E3N A;  4MBF A;  4G3W A;  1IYS A;  3VP2 A;  2WAD A;  4FCF A;  5K5B A;  5F5Y A;  5HD5 A;  2RL3 A;  2ZJ9 A;  2ZC5 B;  3W4P A;  3QP8 A;  1KDW A;  2I9V A;  1IYQ A;  5FQJ A;  1XGJ A;  4JF6 A;  1TDL A;  3HUN A;  3LR5 A;  4KUK A;  2D02 A;  4EER A;  1LT0 A;  3N8R A;  4X1M A;  1U60 A;  4PKY A;  5EVE A;  1YM1 A;  1W63 M;  2W0N A;  5AVF A;  2P74 A;  4JPM A;  3S4X A;  2C5W B;  3MKF A;  3UE3 A;  1GA9 A;  5A90 A;  4KQD A;  3UNW A;  5DKL A;  4R0Q A;  1FSY A;  3HUO A;  3DBA A;  4CPK A;  5GLA A;  2WKH A;  1PWC A;  4OQG A;  4EXO A;  1IFQ A;  1E25 A;  2XD5 A;  2Y2Q A;  2GX5 A;  5HPF A;  2B18 A;  5HSQ A;  4WMC D;  4IED A;  4Y13 A;  1EI5 A;  1OME A;  4KZ6 A;  3V3R A;  1LLB A;  4X25 A;  2P08 A;  2Y59 A;  3O3V A;  5HL6 A;  5DF9 A;  2ZQA A;  1ZTU A;  3QHY A;  4S2L A;  2HDQ A;  5L07 A;  3IHA A;  1L0E A;  1BTL A;  3NC8 A;  2VZW A;  3ZG9 B;  5L2F A;  2JKR I;  2K7S A;  1NZU A;  4DJ3 A;  4RYE A;  4DXC A;  4QPR A;  2PU4 A;  3M6H A;  4S2P A;  1M6K A;  4C75 A;  1S4R A;  3N8S A;  4WN5 A;  2ZMF A;  3D72 A;  3ZG0 A;  2R9W A;  3ZNY A;  1V9Z A;  3SS4 A;  4LEN A;  3C7V A;  2ZMA A;  3MR0 A;  4XT2 A;  4FH2 A;  3RTY A;  4E3I A;  4B4X A;  3T1X A;  5A93 A;  1YLY A;  3UPO A;  1CQA A;  1GHM A;  2GZA A;  5EM1 A;  2G7U A;  2W3G A;  4FSF A;  2M7U A;  2NUT C;  5EEC A;  2VKS A;  5DJU A;  1STZ A;  1DP8 A;  4JLF A;  1Q2Q A;  3PBS A;  1FIK A;  2O9A A;  3QP5 A;  2J3W A;  3BFD A;  5KSH A;  2O99 A;  2VGL S;  4MLL A;  2J80 A;  4E3J A;  2WGV A;  2JKF A;  1PRQ A;  1MKM A;  4PMA A;  2J3T C;  2YKF A;  4O0P A;  4HNB A;  4H6J B;  3IX4 A;  1M40 A;  3S22 A;  1TEM A;  1VM1 A;  5FI2 A;  3A3F A;  4HQA A;  3IXB A;  4KZ5 A;  2V8F A;  2QWS A;  4BBV A;  4DE0 A;  3Q82 A;  5DFX A;  5FDH A;  4UA9 A;  1I2W A;  1SDN A;  1VHM A;  3IF6 A;  3Q7V A;  4BQM A;  1G68 A;  3BW6 A;  4Y17 A;  4GDN A;  1G6A A;  2ZMV A;  1RP5 A;  4JGR A;  3MBZ A;  2EX8 A;  4ETZ A;  2PBY A;  4FD8 A;  4BBU A;  4GDB A;  4R1G A;  5FEG A;  3BFC A;  2J9P A;  1L0D A;  4XXR A;  4EW7 A;  5HW3 A;  1FCO A;  1KE0 A;  4B93 A;  1TS6 A;  3E4Q A;  4HI4 A;  2ZM0 A;  4Y0U A;  4UA7 A;  4X68 A;  5CGS A;  3C38 A;  4A5R A;  3MXQ A;  3JPU A;  3A3E A;  4WLA A;  5KZH A;  1MY8 A;  2EXB A;  4E3O A;  1L0F A;  2IWB A;  5FAO A;  4UA6 A;  3IWQ A;  1KE3 A;  5CED A;  4I3A A;  2O9C A;  3NJA A;  3UB6 A;  3BFG A;  1YLZ A;  3HLE A;  1IYO A;  1MWT A;  1MC0 A;  3LIC A;  1LSX A;  4KZ3 A;  1PZP A;  3PAE A;  1GA0 A;  4S2I A;  2X71 A;  1TS8 A;  2WKE A;  2ZC4 B;  2V2F F;  4OLD A;  4P6Z M;  1MPL A;  1O7E A;  3R4K A;  4UQI M;  3CPT A;  1P9W A;  4ZBE A;  4N1H A;  4IJG A;  4U0X A;  1N4O A;  4OPR A;  5HL1 A;  2XGN A;  3IF5 A;  1K4F A;  1XFQ A;  2A2L A;  1K38 A;  1T1A A;  1F9I A;  2EX2 A;  2HJE A;  2Y4A A;  4HJ4 A;  3VP4 A;  5DF8 A;  4DKI A;  1L0G A;  2VGK A;  1C3B A;  2Y2I A;  5DKK A;  3CUE C;  4GHI B;  3IHB A;  3NOU C;  3P98 A;  4B4Z A;  4EQ1 A;  2XF3 A;  4KQO A;  2Z6C A;  2MJ6 A;  5I94 A;  1X0O A;  5DF7 A;  1ESU A;  5GLC A;  4RX2 A;  5EUA A;  1KE4 A;  1LL5 A;  3EQV A;  2JHE A;  4WL9 A;  1CJF A;  2ZC7 A;  3LY4 A;  4ZJ3 A;  4WM9 A;  5CGX A;  4CLC E;  1KGF A;  3F1P A;  3L9K A;  1OTB A;  4FUW A;  1S1Z A;  3C4O A;  2P9V B;  3LUQ A;  4L9G A;  1XA1 A;  3LIA A;  4EWF A;  2QYB A;  5AQA A;  3VE4 A;  2JBF A;  3ZFZ A;  4AFI A;  5FSR A;  2VV6 A;  2Y2K A;  2E8I A;  3IQA A;  4H8R A;  2W1T A;  5GLD A;  2WGW A;  3ULF A;  4ZJ1 A;  2ZQ8 A;  5HDC A;  1KVM A;  5TFQ A;  3ZGA B;  4GW9 A;  1CK3 A;  5HAI A;  2PD8 A;  4S2N A;  3NBL A;  3ZVT A;  1IKI A;  3OOV A;  1BZA A;  2ZM8 A;  1T18 A;  1ERO A;  3HBR A;  4KG6 A;  3HJI A;  2QKP A;  3IX3 A;  5E43 A;  3N6I A;  4P0M A;  1G6O A;  1DY6 A;  3G30 A;  4MEZ A;  3EWK A;  1XP4 A;  2GNX A;  3RXW A;  3BY9 A;  2Y2M A;  4GN2 A;  3D3O A;  3UN7 A;  3GVB A;  4GS9 A;  2Y2J A;  4OQH A;  1ESI A;  5FQI A;  1MWU A;  1W5D A;  3OPL A;  2XSS A;  2ZBB A;  3TSG A;  4F3L B;  4P85 A;  3LIB A;  2L0W A;  5CTN A;  1PW8 A;  1PI4 A;  3VMA A;  2OLU A;  1OT6 A;  2Y2G A;  3BLM A;  1BT5 A;  3MF0 A;  5CRF A;  4OQ0 A;  1GHI A;  1XGI A;  2P7J A;  3MMH A;  1QME A;  2J3T D;  3UME A;  4Y5F A;  2Z6D A;  1J9M A;  2IWD A;  2X02 A;  4UEY A;  3HJK A;  2WAF A;  4ZDX A;  1W8Y A;  1K55 C;  3L7H A;  3N8L A;  1ZG4 A;  1NLZ A;  3PTE A;  4MNR A;  4PM9 A;  4BD1 A;  3V3S A;  4JF5 A;  4PM5 A;  3E2K A;  2XRO A;  3G31 A;  5IS1 A;  4RVA A;  1VQQ A;  5CXW A;  4OPZ A;  4FH4 A;  3H7W A;  4HEF A;  5FI6 A;  3ZG7 B;  3BWL A;  1F98 A;  4RQ9 A;  1H8M A;  1E4D A;  3TW8 A;  4L9F A;  1YSQ A;  1SDE A;  1WYB A;  1IYP A;  1HVB A;  3RXX A;  1S0W A;  1OTE A;  3QP2 A;  4BLM A;  1GHP A;  3BYD A;  3O86 A;  2V0W A;  1T1B A;  3C4P A;  4Q0I A;  1SKO A;  3F1O A;  4ARZ A;  2NUP C;  1WYC A;  5DTS A;  4MBH A;  2Y2P A;  1CEF A;  1H5X A;  1ERM A;  1JWV A;  1OJG A;  1PWG A;  2WKP A;  1TS0 A;  5F6A A;  1HLU P;  5E2H A;  4MN6 A;  3BQ8 A;  4PAU A;  1BLS A;  5CGW A;  3NDG A;  2AVX A;  3QP1 A;  1S67 L;  5D3O A;  2ZL1 A;  4HES A;  4JGO A;  3C7U A;  4BWI A;  2B02 A;  2XFT A;  4N92 A;  4M4X A;  3NCK A;  4CLC B;  1VEU B;  3A3I A;  3LEZ A;  3GRJ A;  3DTE A;  1ZHH B;  3CI6 A;  2Y8H A;  3PXP A;  4NXE A;  1FR1 A;  3DWZ A;  3UPN A;  1Y54 A;  2V9A A;  4HBU A;  3S7O A;  1T19 A;  5FI7 A;  5GHX A;  4P6B A;  3ZHH A;  3H9W A;  3K3D A;  4QD4 A;  3T4Q A;  3CHW P;  4JXS A;  4LRY C;  3GEC A;  1BUE A;  1D1J A;  1IKG A;  4UAA A;  1N9O A;  2JC7 A;  2LB5 A;  2A3U A;  3QP6 A;  2JE5 A;  4HOI A;  4ME4 A;  3IT9 A;  4JKT A;  1WA9 A;  3FPV A;  2H0Y A;  1ES5 A;  3UE1 A;  4R4R A;  5J3W A;  2L1M A;  2WYX A;  4CJN A;  3IF6 C;  1O07 A;  1XJ6 A;  1VET A;  4IBR A;  1PWD A;  5EVI B;  5HAQ A;  3UB8 A;  4IVI A;  3R7W B;  1G5U A;  1NYM A;  3GDI A;  3UB9 A;  4EUZ A;  1NZO A;  3SS3 A;  1E3U A;  5F1F A;  1L3L A;  1F5M A;  3RH8 B;  1S66 L;  3PBR A;  3V67 A;  3OPP A;  5CER A;  4Q8I A;  3NDE A;  2OSU A;  1EWZ A;  1YKD A;  2BG1 A;  3DTI A;  1OPX A;  1TS7 A;  2PR6 A;  1LSV A;  3IXH A;  3DWK A;  2HDU A;  1GCE A;  4Q0J A;  3T1Q B;  4WZ5 A;  4O8G A;  3TG9 A;  3FKV A;  3NI9 A;  3V39 A;  4LV0 A;  4MCW A;  4OQI A;  1KOU A;  4X53 A;  2P04 A;  3GQZ A;  3ISG A;  3EEA A;  2WKI A;  1FOF A;  4B9O A;  3C2W A;  4KZ9 A;  2XR0 A;  4DMZ A;  3SZT A;  3EGD C;  4LPZ A;  3P09 A;  3EGX C;  4MN7 A;  2OV5 A;  3QP4 A;  5FQQ A;  2XK1 A;  4GOG A;  2W3F A;  2ZQ7 A;  3A0R A;  4B88 A;  3ZCZ A;  4OP5 A;  4LGW A;  2VEA A;  3O5Y A;  2XA7 M;  4NXB A;  5I5L A;  3PBO A;  1D7E A;  3VFH A;  3OCL A;  5EOO A;  3VV4 A;  2VJW A;  3VOL A;  4HIA A;  2PBD P;  1VET B;  3CWF A;  4Y0T A;  2JKG A;  2W27 A;  2CMN A;  1UWN X;  4LRX C;  3G2Y A;  4NXG A;  4ETX A;  3BRM A;  1D06 A;  3F1N A;  3T1R A;  5FAP A;  2JKR M;  3GR2 A;  2PT7 A;  1V9Y A;  4R3A A;  1BLH A;  2ZOH A;  3M2K A;  4S2K A;  3D9Y A;  4HBT A;  3WWX A;  1XKZ A;  4GNU A;  1PZO A;  3BY8 A;  4LLO B;  1PNE A;  3GSG A;  1CEG A;  5IU1 A;  3VFF A;  3IBR A;  1Z6F A;  3ZVW A;  4HH3 A;  3WRT A;  3T4O A;  3KSG A;  4I39 A;  2Y91 A;  2I72 A;  3A0V A;  1YAX A;  2BAS A;  3FPW A;  1S1Y A;  1A0K A;  2W1R A;  2L4R A;  4KG5 A;  3FYZ A;  3MSH A;  2LB9 A;  4DDY A;  5EM0 A;  5FA7 A;  3G4P A;  4S2N C;  5HX9 A;  1K54 A;  3P7N A;  1TF1 A;  3CLO A;  4XT2 B;  1S6R A;  1K56 A;  3T4J A;  1RCJ A;  3JVV A;  4PPR A;  1FSW A;  1OTA A;  3G32 A;  1K57 A;  1YLW A;  3IS2 A;  5HFO A;  4PM8 A;  4E04 A;  5DJT A;  1HD8 A;  4IVK A;  2Y2O A;  4HY8 A;  2Q0O A;  4YOF A;  1QMF A;  4Y7P A;  2H5S A;  3LO7 A;  2VA0 A;  3MZF A;  1WE4 A;  3IX8 A;  4U3T A;  2DMW A;  2HJ9 C;  3F1N B;  3UB7 A;  4CLC C;  4HP4 A;  1YPR A;  1K6S A;  3V5M A;  5KIZ A;  5KSC A;  2UV0 E;  2ACG A;  2PDR A;  1ODV A;  3MS6 A;  4PKY G;  3MJQ A;  4KZA A;  4KEN B;  3WS4 A;  5TR7 A;  2GDN A;  2Y2L A;  1N9N A;  2HF6 A;  4K0W A;  3H82 A;  4QY6 A;  1FR6 A;  4R38 A;  3FZC A;  1XFN A;  5IHV A;  4YIN A;  5FQM A;  3G35 A;  3S7N A;  2WZZ A;  1NJ4 A;  5HDS A;  2G2W A;  4KZ4 A;  3E0Y A;  3PHY A;  3IF6 B;  3Q7V B;  3TE8 A;  3E4O A;  4IHQ A;  1Y28 A;  3KSF A;  1LI0 A;  4K08 A;  5EFW A;  3T12 B;  1LHY A;  3CAX A;  4IUH A;  4NET A;  2HP5 A;  5L8M A;  1N9L A;  3OC2 A;  3FC7 A;  4DJ2 A;  4OON A;  3B42 A;  5GLB A;  2J7V A;  2QJ7 A;  1AXB A;  5EVI C;  1ONH A;  2KOI A;  3MXS A;  4BEN A;  3DTM A;  1S4S A;  3S7Q A;  1TDG A;  5HWT A;  3HLW A;  2WZX A;  4Y0O A;  3TRC A;  2EX6 A;  2QZ6 A;  4G3K A;  5F1G A;  4X56 A;  5AJG A;  2EWW A;  1IEL A;  4L0L A;  4EES A;  3HLD A;  1H3Q A;  3CZD A;  1W79 A;  3IWO A;  3PR6 A;  4NEE D;  1LSW A;  2HPB A;  4OPY A;  2HDR A;  4OP8 A;  2C6W B;  1HTZ A;  3CPT B;  4U0T A;  4HJ6 A;  5A92 A;  1ES3 A;  3O87 A;  4HJ3 A;  4C3Q A;  4CQH A;  2VK3 A;  2R9X A;  1AWI A;  4E3L A;  4P87 A;  2H0T A;  2H10 A;  3VP3 A;  1BLC A;  3PBT A;  4Y2F A;  1BYW A;  5DTT A;  4E3M A;  4QHC A;  4DE2 A;  2V1Z A;  3FV7 A;  2V20 A;  2H28 A;  4I3I A;  4FTX A;  5HPI A;  4KQQ A;  5EOE A;  4XUZ A;  1NWZ A;  3JVU A;  5TBM A;  1SKF A;  2OAQ 1;  3BJN A;  3O88 A;  3PYP A;  3LFV A;  3Q81 A;  5FAT A;  2KX6 A;  3IBJ A;  2WK0 A;  4Y3I A;  1LI9 A;  1MXO A;  3F1P B;  4DE1 A;  1MKI A;  4S2J A;  3VOZ A;  4PM6 A;  5AQ7 A;  3EOI A;  1XPB A;  3AGF A;  3NOP C;  3TOI A;  3KSI A;  3LYX A;  4NKP A;  4X6T A;  4O7D A;  3A3J A;  4E6X A;  3U4L P;  1Z09 A;  1XJ2 A;  4HH2 A;  2W1T B;  5E2G A;  1SZV A;  3U2A A;  2A49 A;  5E2F A;  2WGW B;  5M18 A;  2VV8 A;  2D01 A;  3Q7Z A;  3W8K A;  3EEH A;  1XA7 A;  1DJB A;  2V0U A;  4OPQ A;  3MZE A;  5CHJ A;  4BL2 A;  3MKE A;  4QJG A;  4YNR A;  5F68 A;  1TD5 A;  2PYP A;  2EWV A;  4YFM A;  4WZ5 C;  4WUJ A;  1K4E A;  3HUM A;  3K3C A;  3GV9 A;  2HP9 A;  1OT9 A;  3B33 A;  2ZQ9 A;  3VE3 A;  3UO9 A;  4DE3 A;  1KGE A;  5J4E A;  2WUQ A;  2V1B A;  4GS9 B;  5CTM A;  3SH7 A;  3OPH A;  4WMC A;  1YLJ A;  2OLV A;  4WYY A;  5FL3 A;  4GB7 A;  4R23 A;  3QNB A;  3WS2 A;  3ZG8 B;  1GSV A;  3NY4 A;  4P6Z S;  1MBL A;  4UQI S;  4FOF A;  1PIO A;  4DDS A;  2ZOI A;  2DNS A;  4OOY A;  4CLC D;  3LEQ A;  1DP9 A;  3E98 A;  4EEU A;  3T4K A;  2W3E A;  3KYQ A;  2VLG A;  3UDI A;  4QU3 A;  1YMX A;  4QB8 A;  2BTF P;  2PAV P;  2QPN A;  5L10 A;  3S1Y A;  1I2S A;  1PW1 A;  2PHY A;  3MQ0 A;  3N7W A;  5GL9 A;  5TGF A;  1NRF A;  3M6B A;  3H7W B;  3D4F A;  5M1A A;  4JGQ A;  5FQ9 A;  3CJM A;  5EE8 A;  4LV3 A;  3I7J A;  4WEL A;  1TVF A;  2PRF A;  3KYZ A;  2HDS A;  2WAE A;  4WEK A;  5G4Y A;  3ZDJ A;  3MFD A;  4MMN A;  2V1A A;  4NG2 A;  4LCM A;  2QMI A;  3WS0 A;  3HL9 A;  5DFY A;  1SKO B;  3F1O B;  4ARZ B;  3UDF A;  2Z2M B;  2ZC3 B;  4LFU A;  4HP9 A;  5J7E A;  2ZQC A;  3RFB A;  5EVI D;  1ES4 A;  2WKR A;  3W4Q A;  4EQI A;  3G34 A;  4KUO A;  1K25 A;  1K55 A;  1K54 C;  3MZD A;  3CMZ A;  4S2M A;  4NXF A;  3B3X A;  2FH5 A;  3JYI A;  5F69 A;  2PU2 A;  3LI9 A;  1PYY A;  2ZL1 B;  4H6J A;  5J8X A;  3BEC A;  3SW1 A;  3SOI A;  3OBF A;  3KX0 X;  1K57 C;  1PFL A;  1K6R A;  2E8J A;  4ESP A;  5F82 A;  5HWV A;  1VB6 A;  2OOL A;  4N9K A;  4X1L A;  3C30 A;  2Y55 A;  3T4T A;  3LR3 A;  1XXM A;  3WS5 A;  1RGY A;  2HZ5 A;  3VSK A;  4X69 A;  5FQK A;  1JTG A;  3V50 A;  3A3D A;  4WBG A;  1ACF A;  3UMD A;  4E3K A;  2ZC6 B;  2DCF A;  3BEB A;  1LL8 A;  3DW0 A;  3Q07 A;  3UDX A;  3HLC A;  4NK3 A;  5G18 A;  5CHM A;  1OTD A;  4II7 A;  3AGD A;  2K2N A;  2J9O A;  4EV4 A;  4F94 A;  4EBN A;  2Y79 A;  3UPP A;  3PAG A;  4O01 A;  4JBF A;  5AVE A;  2OWH A;  5M19 A;  2WGI A;  1ES2 A;  1HZO A;  5MC7 A;  2ZLY A;  4KZB A;  1GSW A;  1LL9 A;  2X01 A;  3LI8 A;  2HV1 A;  4DRT A;  3M2J A;  1PI5 A;  2W3H A;  4EUV A;  3PBQ A;  1JWZ A;  4JXV A;  3MXR A;  3LCE A;  2RCX A;  3QNC A;  2INW A;  1E3U D;  5FAS A;  1YSP A;  1I5Q A;  2W3D A;  5HAP A;  3KO6 A;  3HVF A;  2VX8 A;  5CEB A;  5CEC A;  2Y2N A;  3HRE A;  3SH9 A;  3TJZ C;  1BUL A;  4ZJ2 A;  2Q9N A;  3WS1 A;  1K0K A;  1FCM A;  4BL3 A;  4HHD A;  3CIT A;  4MN5 A;  2XEP A;  1JVJ A;  1ALQ A;  4WZ4 A;  1DP6 A;  5AQ9 A;  3E4P A;  2WKQ A;  3LID A;  4D60 A;  2JCH A;  3KSH A;  2M7V A;  3FKW A;  2EFX A;  5KMW A;  4GHI A;  2O0Y A;  5EV0 A;  1NY0 A;  4G3V A;  1J3W A;  1MWS A;  1RGZ A;  5JYO A;  3AGE A;  4OH0 A;  4LV2 A;  2PYR A;  1W7F A;  3LY3 A;  3Q1F A;  3SS5 A;  3B47 A;  3UY6 A;  2KLI A;  5A8B A;  5HZH A;  5HDD A;  3NEC A;  1YLP A;  2EX9 A;  2FFY A;  4GD8 A;  3NUL A;  5FEF A;  4QY5 A;  1N9B A;  1NRJ A;  4JXW A;  3VP1 A;  2P9V A;  2HP6 A;  1JWP A;  1KDS A;  3SH8 A;  2G2U A;  5E2E A;  3WRZ A;  3HLG A;  5HWW A;  4K91 A;  2B5R A;  2V8C A;  3ZQ5 A;  4I5S A;  3T4L A;  4EBL A;  1JNU A;  1IOU A;  2O9B A;  3ZNT A;  4KG2 A;  3T4S A;  1F2K A;  4Q0H A;  1CI9 A;  4JXG A;  5HD3 A;  4GZB A;  4GLQ A;  5EVL A;  2K31 A;  2QHK A;  4K0X A;  3ITA A;  1CI8 A;  1KVL A;  1BSG A;  4EU0 A;  4DN0 A;  4EBP A;  1NXY A;  2XDM A;  1DJA A;  5IT5 A;  1H0M A;  1DRM A;  3PBN A;  3IH8 A;  4RA7 A;  5HAR A;  3VSL A;  3NIA A;  2JN7 A;  3ZYT A;  4RX3 A;  3BLS A;  2Z2L B;  4JF4 A;  3UB5 P;  3W2Z A;  2Q9M A;  3ITB A;  3HLF A;  3OZH A;  3UE0 A;  4Z9Q A;  3K2N A;  1ERQ A;  1KGG A;  4KQR A;  3OLO A;  4F3L A;  2J8Y A;  3GTC A;  3LR4 A;  2DRW A;  4WEJ A;  1XX2 A;  3BM6 A;  4R3J A;  4MDZ A;  3MFX A;  4ZRR A;  1P9R A;  4OOL A;  1MZU A;  3IS2 B;  4XUX A;  1K56 D;  3IH9 A;  4GCZ A;  4Y15 A;  4IUK A;  2EXA A;  3CG5 A;  3S7P A;  5CHU A;  2XFS A;  3LIF A;  5DVA A;  4KZ7 A;  2XQZ A;  3T1S A;  3C5A A;  2QJ5 A;  4DF6 A;  3OCN A;  1FCN A;  1DJC A;  4GD6 A;  2A24 A;  3HCY A;  4BMW A;  3NHQ A;  4PM7 A;  1P0Z A;  3ICY A;  4YWZ A;  4E6W A;  1JTD A;  3N4I A;  1MWR A;  1L2S A;  4DXB A;  3DAV A;  4ID4 A;  3G2Z A;  1P97 A;  3H82 B;  1ZG6 A;  4L9E A;  3OPR A;  5GHY A;  4I3J A;  4S2O A;  1XJ4 A;  2CC1 A;  3A0S A;  1W63 Q;  4OOM A;  1Y4O A;  2XA7 S;  4WF0 A;  1Q2P A;  4LCL A;  4JGP A;  3LR0 A;  5GHZ A;  2VGJ A;  3BFE A;  4EET B;  3LGO A;  4OLG A;  1CF0 A;  2OWJ A;  2JKT I;  2ZM2 A;  2ZQD A;  3EQU A;  1OTI A;  4LRZ E;  4UHU A;  3IXD A;  3DTK A;  1SCW A;  2IA2 A;  4BJP A;  5L09 A;  1BLP A;  4QWO A;  1G28 A;  3HLB A;  2B95 A;  1SHV A;  2XD1 A;  3W4O A;  2OAP 1;  4CLC A;  1VEU A;  5TJJ A;  2M1C A;  2PD7 A;  1FIL A;  1YLT A;  4GJ4 A;  5G4Z A;  1YT4 A;  3G6O A;  4R6L A;  5JYP A;  2UWX A;  4PHT A;  5CX7 A;  4BD0 A;  4LV1 A;  2BLS A;  2R78 A;  3BQA A;  4MBK A;  3T50 A;  2VGL M;  2KDK A;  3FWL A;  3FG8 A;  3BFF A;  4D2O A;  4I38 A;  5LBR A;  2IWC A;  1H8Y A;  4Z1W A; 
#chains in the Genus database with same CATH homology
 3BY8 A;  3P01 A;  4HP9 A;  4LLO B;  3MQO A;  5IU1 A;  5J7E A;  3NOT C;  3EQV A;  2JHE A;  3IBR A;  4WL9 A;  3RFB A;  2A24 B;  2FZ0 A;  2WKR A;  3CUE A;  4HH3 A;  3T4O A;  3KSG A;  4I39 A;  4KUO A;  4R70 A;  4CLC E;  3A0V A;  1YAX A;  2BAS A;  3F1P A;  3FPW A;  1OTB A;  1S1Y A;  1GSX A;  1S1Z A;  2JKT M;  2L4R A;  2W1R A;  1XJ3 A;  4NXF A;  2HGV A;  2FH5 A;  5F69 A;  3LI9 A;  3LUQ A;  4L9G A;  3LIA A;  3LIE A;  4H6J A;  2LB9 A;  2GJ3 A;  2QYB A;  3SW1 A;  3VE4 A;  4AFI A;  3OBF A;  2VV6 A;  2VV7 A;  2XRN A;  3P7N A;  1OJ5 A;  3KX0 X;  1TF1 A;  1EW0 A;  2W1T A;  3ULF A;  5HWV A;  1VB6 A;  2OOL A;  3CLO A;  5HDC A;  4XT2 B;  4GW9 A;  2YKH A;  3C30 A;  3R7W A;  2PD8 A;  3T4T A;  4EEP A;  3T4J A;  3LR3 A;  3JVV A;  1NLY A;  3OOV A;  1OTA A;  3UE6 A;  3IS2 A;  5TBM B;  4E04 A;  1T18 A;  5DJT A;  4HY8 A;  1T1C A;  5C5K A;  3C8C A;  3HJI A;  3UMD A;  2QKP A;  1UWP X;  1LL8 A;  4YOF A;  3MQQ A;  4BBT A;  2VA0 A;  1UGU A;  1G6O A;  1OTD A;  4II7 A;  2PR5 A;  2K2N A;  2DMW A;  2HJ9 C;  3F1N B;  3EWK A;  2GNX A;  3UB7 A;  4CLC C;  4HP4 A;  3BY9 A;  2Y79 A;  2EA9 A;  3D3O A;  5KIZ A;  4O01 A;  4GS9 A;  2PDR A;  1ODV A;  4PKY G;  4G3W A;  3MJQ A;  5AVE A;  2OWH A;  5K5B A;  5F5Y A;  5HD5 A;  2XSS A;  2ZBB A;  4F3L B;  1N9N A;  2HF6 A;  3H82 A;  4R38 A;  3LIB A;  1XFN A;  2L0W A;  5MC7 A;  2I9V A;  1OT6 A;  3S7N A;  1GSW A;  3MF0 A;  2P7J A;  3MMH A;  5HDS A;  3LI8 A;  2HV1 A;  2J3T D;  3E0Y A;  3UME A;  3PHY A;  4Y5F A;  2Z6D A;  3TE8 A;  3LR5 A;  3E4O A;  4KUK A;  2D02 A;  4EER A;  1LT0 A;  2W3H A;  4EUV A;  3PBQ A;  4IHQ A;  4UEY A;  3HJK A;  1Y28 A;  4PKY A;  1W63 M;  2W0N A;  3KSF A;  4K08 A;  2INW A;  5AVF A;  5EFW A;  1NLZ A;  1YSP A;  2W3D A;  3KO6 A;  2XRO A;  3CAX A;  4IUH A;  2VX8 A;  5IS1 A;  3UE3 A;  5L8M A;  1N9L A;  3OC2 A;  3FC7 A;  4DJ2 A;  4KQD A;  3TJZ C;  3H7W A;  5DKL A;  3B42 A;  3BWL A;  1F98 A;  3DBA A;  4RQ9 A;  1H8M A;  2QJ7 A;  3TW8 A;  4L9F A;  4HHD A;  3CIT A;  1YSQ A;  2KOI A;  4MN5 A;  4EXO A;  1DP6 A;  1IFQ A;  3E4P A;  2WKQ A;  3LID A;  1S4S A;  3S7Q A;  2GX5 A;  1OTE A;  3KSH A;  2M7V A;  5HWT A;  5HPF A;  2B18 A;  3TRC A;  2V0W A;  1T1B A;  4GHI A;  2O0Y A;  4G3K A;  4Q0I A;  4G3V A;  5HSQ A;  5AJG A;  2EWW A;  3F1O A;  4L0L A;  2NUP C;  4ARZ A;  4EES A;  1H3Q A;  2PYR A;  2P08 A;  3PR6 A;  5HL6 A;  3B47 A;  5DF9 A;  1ZTU A;  1OJG A;  2WKP A;  1TS0 A;  4NEE D;  2KLI A;  5F6A A;  1LSW A;  5A8B A;  4MN6 A;  5HZH A;  3BQ8 A;  5HDD A;  2VZW A;  4PAU A;  2JKR I;  2K7S A;  4HJ6 A;  1NRJ A;  4HJ3 A;  4DJ3 A;  4CQH A;  4QPR A;  1S67 L;  4JGO A;  4BWI A;  5HWW A;  2B02 A;  4M4X A;  1S4R A;  3ZQ5 A;  4CLC B;  3PBT A;  4Y2F A;  1BYW A;  4WN5 A;  4I5S A;  2ZMF A;  3D72 A;  3T4L A;  1ZHH B;  3CI6 A;  1JNU A;  1V9Z A;  1IOU A;  2Y8H A;  2O9B A;  3PXP A;  4NXE A;  3MR0 A;  4XT2 A;  3RTY A;  3T4S A;  4Q0H A;  2V9A A;  3S7O A;  2H28 A;  4I3I A;  5HD3 A;  1T19 A;  5HPI A;  2GZA A;  3H9W A;  1NWZ A;  2G7U A;  2W3G A;  4GLQ A;  3JVU A;  4FSF A;  2M7U A;  3K3D A;  2NUT C;  5TBM A;  2VKS A;  2K31 A;  5DJU A;  1STZ A;  2QHK A;  1DP8 A;  2OAQ 1;  3T4Q A;  3PBS A;  3BJN A;  4EU0 A;  4LRY C;  3GEC A;  2O9A A;  4DN0 A;  2J3W A;  1N9O A;  5IT5 A;  3PYP A;  3LFV A;  5KSH A;  1DRM A;  2LB5 A;  3PBN A;  2KX6 A;  3IBJ A;  2O99 A;  4Y3I A;  2VGL S;  2J80 A;  3F1P B;  4HOI A;  2JN7 A;  3ZYT A;  4ME4 A;  1MKM A;  2J3T C;  3EOI A;  3W2Z A;  2YKF A;  4O0P A;  4HNB A;  3NOP C;  1WA9 A;  3FPV A;  3KSI A;  3LYX A;  4H6J B;  4NKP A;  3K2N A;  5J3W A;  2L1M A;  1XJ2 A;  3OLO A;  1XJ6 A;  4HH2 A;  4F3L A;  2W1T B;  3U2A A;  4HQA A;  3LR4 A;  2VV8 A;  4WEJ A;  2D01 A;  3EEH A;  3UB8 A;  2QWS A;  4BBV A;  3R7W B;  4MDZ A;  2V0U A;  3GDI A;  3UB9 A;  5DFX A;  3MFX A;  1VHM A;  4ZRR A;  1P9R A;  4OOL A;  1MZU A;  3BW6 A;  3IS2 B;  1F5M A;  3RH8 B;  1S66 L;  4GCZ A;  4IUK A;  3S7P A;  3PBR A;  4YNR A;  3V67 A;  2ZMV A;  3LIF A;  5F68 A;  1TD5 A;  2PYP A;  2EWV A;  4JGR A;  2QJ5 A;  4ETZ A;  4WUJ A;  4BBU A;  1YKD A;  3OCN A;  4EW7 A;  1OPX A;  1TS7 A;  3K3C A;  2A24 A;  2PR6 A;  1TS6 A;  3E4Q A;  3HCY A;  4HI4 A;  4B93 A;  1LSV A;  1OT9 A;  4BMW A;  3NHQ A;  3C38 A;  4Q0J A;  3B33 A;  1P0Z A;  3VE3 A;  3ICY A;  4YWZ A;  3MXQ A;  4O8G A;  4WLA A;  5J4E A;  2V1B A;  4GS9 B;  4MCW A;  1KOU A;  1P97 A;  3H82 B;  5FL3 A;  4L9E A;  2P04 A;  3EEA A;  4I3J A;  4I3A A;  2O9C A;  1GSV A;  4P6Z S;  3NJA A;  1XJ4 A;  4B9O A;  3C2W A;  4UQI S;  4FOF A;  3UB6 A;  3A0S A;  4DMZ A;  3EGD C;  2ZOI A;  1W63 Q;  4OOM A;  2XA7 S;  1MC0 A;  4WF0 A;  3LIC A;  4LPZ A;  1LSX A;  4CLC D;  4JGP A;  3LR0 A;  1DP9 A;  4EET B;  3E98 A;  4EEU A;  3EGX C;  4MN7 A;  3T4K A;  2W3E A;  3KYQ A;  2VLG A;  1TS8 A;  2OWJ A;  2JKT I;  2W3F A;  3EQU A;  4P6Z M;  1OTI A;  3R4K A;  3A0R A;  4UQI M;  1P9W A;  4LRZ E;  2VEA A;  3O5Y A;  2XA7 M;  4NXB A;  5I5L A;  3PBO A;  1D7E A;  3OCL A;  3VV4 A;  4IJG A;  2IA2 A;  4BJP A;  2PHY A;  2VJW A;  3MQ0 A;  3VOL A;  4HIA A;  1G28 A;  3CWF A;  3H7W B;  4JGQ A;  2OAP 1;  1XFQ A;  2W27 A;  2A2L A;  2CMN A;  4CLC A;  1UWN X;  4LRX C;  4NXG A;  4ETX A;  5TJJ A;  2M1C A;  2PD7 A;  1T1A A;  1D06 A;  1F9I A;  3F1N A;  4GJ4 A;  2HJE A;  4HJ4 A;  5G4Z A;  4WEL A;  2JKR M;  3KYZ A;  3G6O A;  4R6L A;  2PT7 A;  4PHT A;  4WEK A;  5CX7 A;  1V9Y A;  4R3A A;  2ZOH A;  5G4Y A;  5DKK A;  4MMN A;  2R78 A;  3BQA A;  3T50 A;  2VGL M;  2KDK A;  2V1A A;  3CUE C;  4GHI B;  3NOU C;  4EQ1 A;  5DFY A;  3FG8 A;  4KQO A;  2Z6C A;  3F1O B;  4I38 A;  2MJ6 A;  5LBR A;  4ARZ B;  4Z1W A;  1X0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...