4HHGA

Crystal structure of the pseudomonas aeruginosa azurin, ruh107no yoh109
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEEEHFFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhgA00
1XMEB 1JZJA 2VSMB 2UXGA 3FPYA 2XXGA 3HB3B 3UADA 1JZFA 2YAMA 1NPNA 5B3SB 1F56A 3FSVA 1SF3A 7PAZA 3QJQB 1ETJA 3TU6A 4A67A 1ET5A 1IBZA 4A2EA 1NIFA 3NSFA 2BP8A 5E9NA 3X2QB 4M4RB 3UAAA 4E9WA 5I6LA 2ZONA 2BW5A 3ABKB 3EH5B 1IUZA 3AW5A 3NP4A 2VW4A 1BEXA 1X9RA 3ABLB 1ZDSA 4AZUA 3PAUA 4P5SA 2XV3A 4W9ZA 3FSZA 4BDVA 4E9SA 3FSAA 1M9WA 1AS8A 1KV7A 1M57B 1PNDA 4YSOA 2XV2A 3C75A 1JOIA 4PAZA 3WKPA 4A2FA 1RZPA 3L45A 3PAVA 1NIDA 1IBYA 1URIA 4HHGA 4F2FA 2FQGA 4YVUA 2FTAA 1BXVA 3GYRA 1NPJA 1SHWA 4W1TA 3IEAA 4JHUA 5D4JA 4G7SB 2GHZA 3IN0A 4GXFA 2XX0A 3OQRA 3WKQA 1KYAA 1L9TA 4CSPA 4NERA 1ILSA 3FPXA 3WNJA 1GR7A 3ABMB 4BK5C 3AZUA 4K9JA 3EH3B 4AKQA 4GP4B 1CUOA 4BXVA 2P80A 3D12B 2IH8A 1NINA 1SDDA 2QDWA 3DTUB 3WNIA 1FWXA 1CYWA 5B1JA 1N68A 2IWKA 4DP4X 1MZZA 3WIAA 1JZGA 1W6WA 1AIZA 2WO3B 3CVBA 5B1BB 1BQRA 5B1AB 3NJKA 2QPEB 2AZAA 1BAWA 3FT0A 1XB8A 3NJFA 3PCYA 3AG1B 4DP6X 1EZLA 2BP0A 3OM3B 3SBRA 3KW8A 3TASA 1OE1A 2YAFA 1X9UA 4HCIA 2GI0A 3FYIB 1HFUA 2FQFA 3T6XA 1QHQA 5I5MA 2R7EA 1AZCA 3BVDB 3QJRB 2JXMA 3QPKA 2YXVA 1AZRA 1V54B 4YSCA 1SJMA 4G72B 1L9PA 5I6KA 2FT6A 1A4AA 4EF3A 2DYRB 4DP7X 4KO9A 4YSDA 2BP8B 3NSDA 1L9RA 5B7FA 3OD3A 2ZWNA 2IH9A 3IBOA 2PCYA 1PLBA 3T9WA 1PZCA 2BZCA 5EHFA 4KO6A 3EHBB 1KCBA 2IDSA 1CURA 1GY1A 1JXDA 2DYSB 3NJGA 1BYPA 3EH4B 4HCGA 2P80D 3FYEB 5B7MA 1BYOA 1AZBA 3NSCA 2A3TA 4BDVB 1MZYA 3QJUB 1AS6A 3X1GA 2J55A 3S3CB 3AY2A 4G70B 4JHVA 4X4KA 1NTDA 1I53A 1KCWA 2W8CA 3QJSB 1NIAA 3T71A 1J9QA 8PAZA 3ASNB 5AFAA 3CVDA 1T5KA 2PP7A 5I5IA 2YXWA 7PCYA 2CUAA 1KDIA 4KNUA 2NRDA 3S8FB 1WS8A 2IDFA 3OMAB 2YARA 2Q9OA 4RH4A 1FA4A 1HAUA 2YAEA 1XB6A 2I85A 2IDTA 5F7BA 2UX7A 3NT0A 2DY2A 4BXSV 3H4FA 1PY0A 3EF4A 3FU7A 4P5RA 1PZBA 2HXAA 2VSKB 5B1JC 1MG2C 3JT2A 3PXLA 2FQDA 1MG3C 1OCRB 2Q5BA 2XXFA 3ZBMA 4KO5A 3FQ1A 1CYXA 1JZEA 2BWIA 4KOCA 1SDDB 4UF7C 4HIPA 3OMNB 1J9SA 1MDAA 3FQ2A 1JXFA 1R1CA 3FS9A 4A66A 4A68A 1PLCA 1WA1X 1BXUA 1ASOA 1A8ZA 1AZNA 3MX0B 2HLEB 1OCZB 3UGEA 4YSQA 2ZXWB 5AZUA 3V9CA 2EINB 3SBPA 1L9SA 3X1NA 2TSAA 3QQXA 3DKHA 1GY2A 5PCYA 1AACA 5I6NA 2BP0B 3AG3B 1PCSA 1W8EA 5PAZA 4GY4A 2HX8A 1AS7A 1QLEB 2WSDA 4HHWA 4ZK8A 3FU9A 2R7EB 1N70A 1OE2A 1TU2A 1GW0A 5I26A 2IWEA 4MFHA 1JERA 1TEFA 1OF0A 1KBWA 2EIJB 3RYMA 2Y1AA 1JZHA 2FQEA 4F7KA 3S3BB 2XX1A 2J57A 1PNCA 1NZRA 2FNWA 1PMYA 3QJTB 4E9QA 1OOWA 1PAZA 2MRYA 4FAAB 4GP8B 2XWZA 1E5YA 1ET8A 2YAOA 3ASOB 2PP8A 4G7RB 2HRHA 2IDUA 1M56B 1UATA 2BWDA 3NJJA 2I7SA 4YSTA 1JVOA 4CSZA 2BO0A 4QLWA 2DV6A 5I6PA 4UANA 2PPFA 2J56A 1KDJA 1SNRA 2OCCB 1PLAA 2GC7C 5I6OA 1ZPUA 2VW6A 2YAHA 5ANHA 2IWFA 5FC9A 1TEGA 1NICA 2ZOOA 4HZ1A 3ZIYA 3NSYA 3T6ZA 1ASPA 1HAWA 1JXGA 3NJLA 4PCYA 3UACA 2XV0A 3NP3A 1AG0A 1WS7A 1VLXA 1DYZA 1ZIAA 4QKTA 1J9RA 1FFTB 3FSWA 3AG4B 1TKWA 5TK2A 2CALA 2H5UA 3DIVA 2J5WA 4FA7B 5TK4A 2IAAC 4N4YB 2RACA 4GP5B 3FU7B 1OCCB 2HZHA 4N8UA 1ID2A 2VMJA 4YSUA 1AG6A 1E5ZA 1OE3A 4KNSA 3PAZA 1ASQA 2EIMB 5AKRA 6PCYA 4AI7A 3AG2B 2AVFA 5I6MA 1KBVA 1L9OA 1NIBA 1RZQA 4A2DA 1IC0A 2QDVA 3JTBA 4KO7A 3PPSA 1IKOP 2UXTA 1PZAA 4GYBA 5LDUA 2JFCA 1A4BA 2UXVA 4TXVB 3CDZA 3SBQA 4ENZA 1A4CA 4WKXA 6PAZA 1NDTA 4E9TA 4Q8BA 2PPCA 1J5DA 2GB2A 1ADWA 3V9EA 3X1BA 2XUWA 2QPDB 1SF5A 3UAEA 3S8GB 1E30A 4DP5X 2GBAA 3NJNA 4E9YA 5I5JA 3GDCA 3SQRA 4A2HA 4G71B 3S3DB 2BHFA 1WA2X 2WO2B 1E67A 3ZDWA 1EHKB 1PF3A 1RCYA 2XYBA 3X1FA 2VM3A 3GXUB 4DPCX 1JVLA 3NYKA 2YQBA 1V55B 1ZDQA 4WTQA 3FQYA 2XLLA 1NIEA 2PCFA 5F7AA 3IN2A 2PP9A 3TA4D 1J5CA 1XB3A 5D4IA 2BZ7A 3NJHA 1GS7A 2TSBA 4UAHA 4YVNA 4NB7A 3T6WA 3IE9A 4L0PB 1YLBB 4A2GA 2HX9A 3ABGA 4AKOA 1NWPA 5B7EA 2FWLB 4HAKA 2OJ1A 1AZUA 3N55A 1L9QA 3WI9A 3N2JA 1OCOB 3FU8A 1DZ0A 2UX6A 3TBBA 2BW4A 5A7EA 3G5WA 2AFNA 4HCFA 1ZIBA 1RKRA 3HEIB 1W6LA 4DP2X 2FT7A 2YAPA 3BQVA 4NAJA 1AANA 1OV8A 1GSKA 1BQKA 1CC3A 1ILUA 1SFDA 5I28A 2GC4C 4G7QB 4BWUA 1J9TA 5B1KA 4KNTA 4AKPA 4DPBX 4YSEA 4KOBA 4AX3A 4BWTA 2XU9A 4DP1X 2CAKA 2FJSA 2OV0A 1AR1B 4E9VA 2IDQA 3H56A 2GIMA 4F2EA 4Q89A 2DWTA 2HRGA 1WAEA 1A3ZA 1V10A 4DP8X 2CCWA 2X87A 2FT8A 4M3HA 2PPDA 1AQ8A 1SHXA 2PPAA 2QT6A 1AOZA 3UABA 4DP0X 1GS8A 2GSMB 2UXFA 2B3IA 3CDZB 2H3XC 2W88A 3NJIA 1ET7A 5IY5B 1GS6X 3CG8A 3QJVB 2AZUA 2CBPA 2DWSA 2I7OA 2XVBA 3ERXA 2AANA 2H47C 1KGYE 2PLTA 3H4HA 4E9XA 4E9RA 2VM4A 4BWWA 2JKWA 4YSAA 4YSPA 1A65A 3U25A 1NWOA 3NJMA 4YSRA 2VW7A 1ZV2A 1BQ5A 2HX7A 1WA0X 3T6VA 4YL4A 3OMIB 1BXAA 1AAJA 2N0MA 2EILB 3CVCA 1GYCA 2B08A 2VN3A 4HALA 4DPAX 4YSSA 4DP9X 1B3IA 2EIKB 3PLYA 2LLNA 2E86A 1SFHA 3WG7B 3ZX1A 5D4HA 2Y69B 3X1EA 3CZUB 3TBCA 1QNIA 2CJ3A 3KW7A 2PPEA 3MBWB 1E65A 2X88A 2YAQA 2MTAA 9PCYA 1JZIA 4JKNA
chains in the Genus database with same CATH superfamily
4BH8B 4HIEB 5KYNA 4YLBA 4C56A 4JQVC 2WD0A 3TO2B 1JTOA 3RJDA 2XN1A 2NSQA 1F56A 1VACB 1SF3A 2E4FA 1CB4A 1JSYA 5EC2B 4PB9L 4A2EA 5C0NC 2EDBA 1YYMH 1AI1L 2J8UA 3KJ4C 1IC4L 1WFOA 4JM2A 1FAIH 1JNNL 5IB2A 5I1GH 2HCZX 5F9WC 4UT9A 1RIUL 5G5DB 3IU3A 1AGFB 4AZ8B 3HUJA 5DJYA 2AJYL 3VXSB 1HZHH 2VW4A 1WBXB 2K6YA 4BGLA 4WZ9A 4ZW5A 5CKAA 4FZ8L 4X6DA 5EN2B 4X6BA 2LU5A 1QLRB 3ABLB 2KLRA 4PN6A 2PTTB 5I1EH 3WEOA 3FUMA 1YY8B 5C3IA 4WSKA 1N5AA 3A0OA 2WB7A 4OCSL 4WUUA 4Z3FA 5FYJU 3TBVA 1I1AC 3GSQA 3O0LA 4LLYA 5I74C 3TT1H 4I87A 1RK0A 3REVA 5HHNA 4DTGL 4D9LL 2YR3A 5EO0B 3X13A 2BY2A 2EKSA 3Q9PA 3JBG7 4WUKH 3VXME 4CN4A 1IBYA 2AXJA 4OGZA 5LCVA 3MOAL 4P5KB 2VITA 4PJDF 2W65B 2VDQH 3ZE0B 1DBAL 1HX0A 1FL3B 4I85A 1DN2A 4AE1A 1GGCL 3GYRA 4I18A 5EU5B 4NLHA 5D6CA 3V0EA 1XGTB 4JL2A 5I24A 2GHZA 2MOQA 3CDYA 4JO1H 1G9NH 4MYPA 1MQ8A 3N9GH 4NNPL 5CHNB 4FTVD 5IHUL 1WO2A 2HFEA 3LNFA 1YMHB 3FKUS 1DQIA 1QRNB 1CUOA 5E23A 5J12B 3DTXB 5C08A 4FFZH 2WMPB 1MJ7L 2J5LC 1A0QH 2GQHA 4OCWH 1SDDA 1WGOA 2OMXB 1RPUA 1OAXL 4WJ5A 3QIWC 4AT6B 1E4KC 3AT9A 43C9B 4DW2L 4S1QL 2XWCA 3UP1A 2MNJB 3SYQA 3D09A 4N2LA 4JPKL 3VW3H 4K3DL 2WBJC 1KY7A 4LPYA 5B1BB 3JZYA 2FYYB 4K8RL 4MJID 1F6FB 2FWOB 2NR6C 2MKWA 4CNIA 4DOHE 4XRCA 1OW0C 2CRMA 3NK4A 1RL1A 3LKNB 1LK3L 3LNIA 4NHCL 2ZCLH 2MSPA 4XP6H 4AW4A 4BQ9A 1QOKA 1FIGH 5C7XH 3UGUA 4R97C 3ARFA 3UAFA 1RZGA 1QHQA 2APXA 4KVCH 2WZPA 4UYPA 5D71L 3CWGA 2IPUG 5CGBA 4F9PC 4DFHA 1S7SB 3OV6A 3MRIA 5IBUG 3VFOA 4OZIF 5TPWL 3S34L 3WY1A 2QQKL 4ZXBB 5DEFB 4KX7A 4U1SB 1AXTL 3SYPA 3B4NA 3LIZH 3JVGC 1JNJA 4TUJA 4NQEA 4HUVB 2BNUB 1E9QB 3ECQA 1JHLH 5KSVB 5D6DA 3UEQA 2CLZA 1A9VA 1M05A 1T7WA 3ZSTA 5D55A 1CFTA 3EH4B 2R27A 3GSUA 5AOIA 1AYRA 1UJ3C 1VGEL 4PW4A 4NQCB 1X5LA 2F18A 4Q6IB 3M17B 3QFJA 3C5SB 5I8KL 3IETA 3MKKA 3A67H 5E2TH 2JELL 4X5WA 3TVMA 1E4XH 1A6AA 1F4YL 3S35X 2PCXA 1XF4B 1GZHC 1HZLA 3I6SA 1DSWA 4BRJA 1YPZF 1I85A 5T5FH 3CVDA 2VC2H 3C8HA 3I6GB 4JFTA 1EXHA 1YEIH 35C8H 4JO4L 4UBDD 4LLAA 2X4RA 2LVCA 1XF5A 4NO0D 4ODSH 4C83B 2XVGA 4UOQA 1I3GH 4Z7QB 2YWYA 1XGQA 3DRQA 1PY0A 2WTPA 4Y89A 4NQVB 4Z7VA 1KBGH 4EI5D 3CX5K 2DYPA 3NIDF 1GOHA 4YBLB 3FL7A 3K4DA 4IS6B 4OQ1A 4F57L 4GQ9H 4X4ME 5BS0D 1AQMA 4RAUA 1GH7A 3QAZC 3D85B 1YDPA 1CXIA 5EU3A 3H9HB 3FQ2A 3KPQB 3ZGIA 5B3JE 2ICWJ 3IDMA 1MCOL 4RMRA 3QYCA 2Y7NA 5MI0C 1PLCA 1WA1X 3OLGA 1OB0A 3WAKA 1ASOA 1A8ZA 3L3IB 1N5YL 3QC6X 4BUGA 4YSQA 4BCYA 2C8NA 1NOLA 2C1OA 4G6AD 2X2UA 2Q20A 3DTDA 1OAYH 3O41B 4NM8H 5FO7A 5T3XL 3CVHB 5K9JL 1A4JB 2HX8A 2DIBA 4FJYA 1V7MH 2R69L 1D9KB 2ZSWB 3IGAA 5BMFH 3IU4L 1Y18B 4LHJB 5CFHA 1BPLB 3ALWA 4ZTPH 3OHXB 4PRHB 3NACL 4F1ZA 1LGVA 1HQ4A 2IWEA 3V4VB 1C5DB 4P23D 4Y2LA 2EE6A 5KW9H 4AE0A 1VKXA 2GYSA 5ABZA 2WXIA 4BFIB 1CGVA 4NC0B 2AGJL 1KB5B 4HKZA 1L5GB 5BVPH 1RUAL 2J8UE 1G4MA 2J57A 1PMYA 5EC1A 2WVVB 3V6BR 4PJDB 2VDNL 4R3SA 2P4AB 4QT5B 3DX2A 4JJ5A 8FABB 2BCKA 2XQYG 3WD5L 4QR7A 3HUJE 2BWDA 4HLEA 1A9BA 1NM9A 5CSGA 4X6DE 3V8OA 1Y1UA 5C0BB 1A5FL 1N3NB 2ICEC 1HH9A 2DL2A 3M1OA 5FYKD 1IBGH 4WUUE 4HK3N 4AQ1A 4Y16A 3ULVE 2YMXH 4YFEA 5FC9A 3AQDA 4S1SL 3O45A 3EYVB 4UNTA 3BVWA 4CJ0A 1NMCC 2D4DA 5HYFA 1HAWA 4IQHA 2YOAA 4FQCH 4A7TA 4P46A 1VLXA 5LG6A 1RZJC 3EYOB 3N04A 3H8NA 2YGPA 4LCIL 2VDLL 4FA7B 4ODWB 1VFAA 1E4WL 3FN9A 3SDDC 2ADJA 3FT4A 1P4UA 4QRPD 3HMWH 2RQ8A 1A6WH 3INOA 3LMJH 1FZOA 2FBRA 4UV7L 3ZRCC 3GSWB 4G1MA 3NZ8B 3ENEA 1AGBB 2X6MA 5FOJA 1TJXA 4KY1H 4PP2A 1G1CA 4TVUA 5C08E 3VD1A 3V0WL 1Q9OB 1TZIB 3JTSB 1AFVH 3OGCB 1XEUA 2LE9A 5DSCB 3A6OA 3L1OH 4XO5A 1KCSH 4HOXA 4Z7IA 4KDTC 5HYSB 2HUEA 1UVQA 3FU0A 2CJTA 3HJ0A 3KH3A 4TXVB 5E8NA 2C7FA 4OZIB 2ODHA 1RJLB 2EH8H 1CFMA 2EDFA 5E6ZA 3RAJH 1DLFL 3ROOA 3HRPA 4QRBA 3GKWL 2PMZA 1OM3H 4KZCA 2HVBA 5D8JH 1SF5A 2XBDA 1I1YB 4N8CL 5K9QG 3UJJL 2VQTA 2YUWA 3QZBA 4QXUL 5DS2A 4AITA 3SQRA 2KZWA 5D1XC 4TTDC 3GSXA 1P1ZA 3HPLB 3NSXA 5GRVL 4ZAKA 4OIFA 3AXLB 2VM3A 3GXUB 1ITBB 4KQ4L 1P4IH 4W9IC 1T22B 4PJ5D 1ZLUH 4BA0A 1HH6A 2HT3D 1NL0L 2YD0A 4PJ9B 2A5UA 4C8XA 5C0IA 3PP4H 4R7NB 1EBAA 2E4TA 2AERT 5BVJB 3IDGA 2OL3B 1QFWL 3K7UA 4KTDH 2V5TA 3SKJL 1RUKL 2JIXD 5LNEA 5J13B 5C0CD 4U2ZA 4L0PB 2CLVA 2G2PA 3CC1A 1F6AB 1TJMA 4AKOA 2VXQH 2CG9X 1KJ2B 1AZUA 2NNFA 4FQ2H 4FNPA 5HVWA 1B9KA 2CIIB 3QFJE 1RJYB 3RVWD 3AITA 5B39G 4HCRL 4U6VH 4WFGD 4NZUH 3QORA 4J6RH 5F89A 5TJWK 4I0PB 2J6EH 1OV8A 5CP3A 4H0IA 3FF8A 2DWDA 3L54A 3MRCB 3ZKXB 5EOCH 5GJSH 3QHZH 3J27A 3ESVF 1MREL 5ETUA 2X7LA 4MVBD 5JHMA 3ZDXF 1FAKT 3RP1A 5GS1C 1GYUA 1IARB 4UNUA 1K2DB 1K5NB 1DJIA 4Z7VE 1FE8L 2RB8A 5CCKH 3MNMA 4JM2F 3JV4A 3VXMB 3THML 1SY6A 3KCPA 1QFPA 1P7BA 1UWEH 3LKOA 1S7XA 5L88L 5CEYB 3WCYA 1BIIB 4X5LA 3SGKC 4FLHA 3N6YA 5I1AB 2PPAA 3MRFB 3MROB 4X6DF 4ZPTA 2K7QA 4UQBA 2G5RA 3F62A 2NXZB 4FG2A 5JZ7C 4LP8A 5EZJB 4N22A 1CR9L 2J2ZB 4YX2L 3ULVF 1SGKA 2AQSA 2VLJD 4U49A 4YWGH 1U3HD 3CQPA 1R3JB 5FDWB 2VM4A 2ZT9C 4LCCB 2XG4A 3MLXL 2JCCA 3T2QA 1AD0A 2IPTH 3QDMD 4MMXC 3WHE0 3OWEA 1KXTA 2VNCA 1C7TA 3VWKC 2QMJA 4H1LB 4ODTL 2KDGA 4X99A 4XBGB 3DJ9A 3UDWA 3BKML 1BPVA 1IZKA 2X1PA 3L3HB 4EN3A 5IFJA 4GMSH 2HJKB 4DOHB 1A4KA 2YS4A 3QHTC 5D4HA 5E51A 4BZ1H 4M1GH 4OI7A 4KKRA 1T4KA 3QQ9D 3MBWB 3DV4A 5CF3A 2AS5M 4DKEH 4KX8A 5F6IB 1SXZA 3AWGA 5HY9A 3QYNA 1BFTA 4JPQA 2AJSH 5KSUB 4K7PL 2NX5A 5D93C 1T2QL 2NSXA 4JFWA 2R56H 2NY1B 3OB0H 1BZ9A 1WFNA 4GKOA 1EV2E 2WOYA 4HKJA 4WO0A 2LV4A 2E74C 1NMBH 2HJLA 4F7PA 2C3GA 4HULB 1T04A 2UZXA 5I76B 3L4UA 4M6AA 4P9HC 2OMBA 3WTSA 5EIIG 3FUDA 2CR0A 1A7OL 1I8LA 3BW9A 3GRWH 2NCMA 4HU8A 1H3WM 1ZE3H 3L95A 4F15C 4NC1C 1R34A 3W82A 5I1LA 3UMNA 3CMOH 3DSFH 3FO0L 3EOYG 4Y4FB 5CLXA 4YDVA 1RZKL 2JKLA 4AJ0A 4JO3L 2R1XA 4OGXH 4HEPG 4ORZC 3KDPB 2X4NA 5EBMA 3ARDD 5DJDA 4YS4A 3N85H 4PRPA 4NUQA 2N7AA 2CSPA 3LVTA 3O3AB 2F15A 5GRJH 5GSVB 1PCXA 1NC4D 5IV2B 4JZJA 4AV0A 4W4OC 5CP7B 1IM9D 5C8JA 1U33A 3L45A 3LS4H 1JK9A 2UVFA 3NABH 4NZDA 2CO7A 3QUGA 4L8CA 4PG9B 4P4KB 2K45A 5DJ2B 2VXTL 3ILEA 4I77L 1ZXKA 5FLVA 1X5JA 2CA3A 4U2YA 4TQ8A 1TZHB 1IEBA 3T4AA 1OWRM 1TQSA 4LOFA 1G0DA 3WAJA 1EJOH 2VDPH 3C6EA 1I8KA 5H35B 4QRAA 1DTUA 1GGYA 2EEFA 3NEXA 3VE0A 2BMKA 4WI2A 3A6CH 3L13A 1VFBB 5KYXB 25C8L 5E95B 3HN3A 4U1GC 1VF5C 3EYFA 1RUPL 5IM7A 1K8IA 4QCIA 1NOAA 2IH8A 1NINA 1L4IA 2JK5B 4NFDA 4XX1G 1EUUA 1U3JA 2H0FA 4F33A 3TBSB 4JPVL 3VFRA 1P2CB 1IC7H 4ATWA 1MHEB 5E08H 4PH8A 3TEWA 2DJMA 3UTQB 3ECUA 3R1GH 3A4FA 3TA3C 5JORB 3BQUB 1N6VA 1TITA 5IJKC 5C1MB 5HHXH 1GTFA 1IAIL 1KPUB 3PWNA 4JDZB 4AQEB 1FNEB 4ZI8A 3RGVD 4HFUL 4MXWL 3B34A 2BSTB 4K9EH 2WQSA 4ZUTB 1FFOB 4NQUA 1GGUA 5TDPA 2BP0A 3HE6D 3QO0B 3QNYB 2JKTM 3GXTA 4X98A 3PG2A 1OT4A 2W60A 4MNHA 3AXIA 2X10A 3MLPA 3O6MH 5I5MA 2R7EA 3BVDB 2H45A 2OR7A 3O8XC 2YXVA 1A7PH 1IFGA 1F1GA 1TJGH 1DEDA 1KCUL 4B3EA 3NA9L 4JFDD 2E7LC 5GGVL 2R59A 3NRQA 2J8UB 1JRHI 4XR8C 4JM2B 4AVIA 5JHLA 5IT2H 5IB2B 1HYSD 4JRXA 4LNRA 3BH9A 2Z91A 2YK1H 4LLWB 4YMPA 4P5TA 4WCYH 2EEAA 3FQWA 3IU3B 3MFGB 3HUJB 1L0PA 1KCBA 4FQHA 2PCFB 3U4AA 1Q0XL 4P49A 1S5HA 1S5IH 2OTWA 4X6DB 4YXKL 3VSQA 4X6BB 4GFTB 3T1FA 4NAQA 1E27A 3NZHL 2DDQL 3SQOL 2VRQA 1SN5A 2A3TA 1MZYA 1N5AB 4FF9A 4WUUB 3TBVB 1AS6A 5EO9B 1H3TA 4LLYB 4Y5VA 2VXVH 5D4QA 1RK0B 4GIAA 4N0YL 3REVB 5HHNB 5JR1L 2JCWA 3X13B 3K6NA 1T80A 2EKSB 5CZXC 3VDBA 5D5MF 5CAYB 3H6JA 2DQ6A 2LU3A 1J9QA 2VITB 3Q1EA 3W9EB 2JMRA 1IC5H 3QUZA 4I18B 3OMAB 2R0KL 3FRPG 4KHTL 5D6CB 3RY6A 5KVEH 3NFPA 4Y2DC 1UKQA 4XVJH 3VQ2C 3NMEA 4PWKA 4AJWA 4OFQA 4QHKI 5C6TH 1JFQL 1UXWA 1ZLUK 3LKQA 3RZCC 2WNXA 4UOW1 1KOAA 3G3LA 2E27H 2HFEB 4L8SC 4WWKC 3VB9A 2C9XA 5DQ9B 4MSWA 5F96H 1WDAA 3E6FA 4Q4EA 3SE6A 1OWWA 3L9BA 5C08B 3DARA 4PLNC 1MWOA 2BWIA 3VQMA 1SDDB 4NSKB 4XPAL 2JCCE 1QSEA 3TM6A 6FABL 4WJ5B 3WFZA 1D6EA 1N64H 3SPIA 5AZEL 4JZNA 1QBAA 3WFCH 4HWNA 3L5HA 3BP6A 1DBML 3IGUA 1FYTA 4X7TA 4M6NL 3L4WA 3UGEA 3PGDA 3ATBA 3BISA 4CNIB 5LKNA 1UM4H 4XRCB 3BUTA 3D4YA 1TPXC 4XCNB 4XPTH 1FL6A 3QK0A 4H88H 5D1ZD 3WKML 3RG1C 3ARFB 1RZGB 1JNLL 1RU9L 9PCYA 1V3KA 4FS0A 3RRQA 3AT0A 2NX5E 4U1KA 4O5LH 2IV9A 2VZ1A 1KBWA 4OD1H 4YHPA 3MRIB 4LVNC 3VFOB 2EVFA 5MEPA 2NY5C 3QIUA 1AZVA 4X8JA 5IFHL 1DQDH 2DQCL 2OMWA 2PKDA 4TSBH 4TUJB 1U3NA 3MRMA 4GKNB 4Y4KD 3CPLA 3KS0H 3VTAA 5A16A 2VE6A 4TQEL 2CLZB 5IQMA 2ZYHA 3N5AA 4IDJH 1MN4A 2IAMC 1CFTB 2JB6A 5DD6B 3GSUB 1D6VH 1EJ8A 2I5YL 4NQQA 4FCAA 1XCTA 2I7SA 5F9OL 4MNGA 2AEQH 3DX9A 4ZTOH 1V27A 3DX6A 4PRPE 3QFJB 4PYGA 4PLKC 3IETB 3CH8A 5GGQH 1CLZL 5AB1A 1HZHL 3TVMB 4X5WB 5I8EA 1A6AB 1FFNA 2VW6A 1Q1JH 4GQZA 1RQ5A 4BZ2A 3BZFA 3PNWB 5I1EL 4YEFA 4HZ1A 4Y5XA 2VUKA 3AMLA 5EZOH 2D2CC 2XSKA 3NJLA 4UM8A 3TT1L 4X80L 3HKZA 1TMQA 2G2RA 4FL4C 2DI9A 5F0MB 2X4RB 1XF5B 3W0WD 3BO8A 3DIVA 3E2HC 2XQYK 2VUYA 1I8UA 4KKCD 4QOKA 4MD5A 1W16A 1XGQB 3DRQB 4JY6A 1OCCB 4WI5A 4Z7VB 3BP5A 4LSUH 2F68X 4I0CC 1E5ZA 2AEWA 1MLCA 4ESKA 3TV3L 4LZKA 2DYPB 4XNMA 2P44B 3VGBA 4GW4A 2FLBT 3HZMA 3MV01 3SDAD 1XHHA 4EN2A 4JO1L 4RAUB 1A14H 4KNQA 3FUIA 4FMKA 1L9OA 2NXYC 4PJHA 1FDLL 5F7MC 5EU3B 3VD3A 2I9LA 2BJMH 4F91B 3T0EA 3QEUA 3IDMB 5I9QC 2Q2LA 4GO8A 3QC5X 3QUXA 3GK8L 3OB0K 5E2UL 2XZAL 4ENED 3JTBA 5ITFB 4KO7A 3QQ3B 3TCXA 1ZV5A 4OCWL 2A0LD 3U9PH 1A7QH 2B20A 4DEPB 5CZRA 4F5CA 2C1OB 2Q7AA 4K4KA 4F80A 3HMXH 4HQQH 5FO7B 3LXAA 4G3YH 5C07A 4QXVA 5EBWA 1X5YA 2D4FA 2KKQA 1MI5D 2QPDB 2VDML 4UTAA 4P4RA 4MCZB 5AW9B 3IGAB 3VW3L 1GTNA 1NCHA 4KFMA 3ZYIA 4E9YA 2DQDL 3GDCA 1B4TA 3QNXA 1Y7VA 2R4SH 1HL4A 3RNQA 1VKXB 2ZCLL 4OCYH 4Q7DA 5FA3A 5HYIA 1QPXA 2F54D 4PB0H 5C7XL 3ZKQD 3I6LD 3AREA 2QLVB 4KRPB 4WTQA 4HKZB 1INEH 3BX7C 2GUOA 3B8YA 4PJAF 3WU1A 1DCEA 1PGRB 4QHLA 1XB3A 4D9QD 4R3SB 1GS7A 4JJ5B 5AKSA 4ELKA 4YHYC 2BCKB 4GEJA 5DVNA 4K55A 4MA3A 4NB7A 1A9BB 4XBPA 3TC9A 1I9RH 5AW5B 2XNAA 1JHLL 5B7EA 2EO9A 3MDJA 5EH1A 3WOVA 1PBYA 1HH9B 2WGNB 3D33A 3C9NA 3OMZA 2X9WA 1AR2A 4LKCA 1DZ0A 2DQGH 3RWDA 4Y16B 4AQ1B 3WS6C 2NYZA 1I9IL 1B90A 1I8MA 2Z7YA 1I1RA 3O45B 4NWUL 5FYKU 4G7YL 4F1SA 5CBAA 2G3MA 3IKCA 4K3EL 4QHKJ 4DP2X 5L0QC 4P46B 4EQ2A 4OF6A 2X6AA 2FD6L 3A67L 4BYHA 3K72B 3RVXD 4TSCH 4P3CL 3CCHA 1VFAB 4HPHA 1G7QA 2X0WA 4AKPA 1JI1A 2ADJB 2BSBA 2VC2L 1UA7A 3FT4B 3WE6A 35C8L 2A2QT 3GINA 3KLDA 5FYKL 1FORH 4ODSL 3EJTA 4HG4K 4G1MB 5BW7A 4P2RA 1I3GL 2GIMA 3I9GL 4PP2B 3GBMH 4FXKC 1A6VH 2A6JA 2H6PA 2GFBA 4DFIA 2MCPH 4XB8A 3BPLB 1CQKA 3QDGA 2C9PA 1A7RL 2XFGB 4YDJA 5HDBF 1SQ2N 2QADC 3Q8AA 2X87A 4QRFA 2FT8A 5BXFA 1S3KH 5FO9A 3SKNA 1MCCA 1W72H 2R2BA 3P73A 2V2TA 2E7BA 3AY4A 1UVQB 3APMA 5E8NB 4QRSA 3FB5A 1FYTE 1IZJA 3CK0L 3B5TA 3ROOB 3ILQD 2ZIDA 3ZDYE 3C2AH 3SGDI 2F08A 1QI3A 3HI1A 2WWKO 3WJJC 4JY5H 2QPSA 4GI9A 3KPSA 1WF5A 2IJ0C 1X5GA 4X7DC 1DP0A 5DURB 4YJZL 1OAYL 2EVGA 1CWVA 2NUPA 4A38A 3BJ91 3GSXB 1P1ZB 3MRLA 4PGEA 4ZD3H 4ZAKB 1VEPA 3B5HA 1KMGA 3ZRSA 3FTVA 4Q0XH 3L3JA 2VN3A 4OJFH 5EIQA 4ZTPL 1HH6B 2YQ2A 4K8RC 2E86A 5JOEA 4WQOA 3WG7B 1XH1A 3I6KA 5I66A 5C0IB 4MCMA 1DVTA 3WFHA 4G9DA 1QNIA 3IDGB 4DKAA 5CN2A 3ZE2E 3VFMB 1T7VA 1YUKB 2BOCA 2FBJH 1Z32X 2K78A 4YDLB 2NY4D 3WS3A 4GUPA 2DMBA 2VSMB 2X44D 3C60D 1E8YA 2CLVB 5BVPL 4PVLA 4LMQI 2ICWA 2UXGA 3RGHA 1A9EA 3O9WD 4MNGE 4LCUA 4ZS6C 5F7WC 5B3SB 1JNHA 2EYTA 3GI9L 4JVUA 5DRNA 1ETJA 1FUNA 4JHWL 4BFJA 2Y6SD 1TZAA 3VI3A 5GPRA 4CMHB 1UWGH 3DMMD 5E9NA 2HT4C 3X2QB 3QORB 1IX2A 2ITFA 3ELAT 5F89B 2OTPA 2LT9A 1S6NA 3LZLA 3PDOA 1LEKA 1JPFA 2BW5A 2DWDB 1S9VA 2RFXA 2JH2A 5HHPB 5EULV 3B2PA 1T6WA 2YSTA 3PXJA 4NYLA 5LQBH 5ETUB 2X7LB 5F7HA 1JCVA 5IREA 1G6RB 3NFNB 3RWHA 4C4KT 4QOKE 3ZHLA 5FR3A 5LXGL 1FZJA 2ZE0A 3JV4B 3GS4A 1L0XA 1BOGA 1XCXA 4AJYV 1B0GA 3KCPB 3NCYS 3LKOB 5DVLA 5GJTH 2HVKB 2XRAH 1S7XB 3CXHK 1ZSHA 4HIXH 4P07A 2ZOKA 1MVFA 3HMWL 3QS3A 1URIA 4M8QA 7CGTA 5I1CH 4PJHE 3U4BL 3T0EE 2HN7A 2VGLM 1OGAD 2ERJB 5E8PB 4AMXA 4RGOL 4AJVA 3IDXH 4TVPL 5I6XC 1CD9B 3HI5H 5EBGA 5ITBH 3WKQA 4F5CE 2KERA 5DZOA 2CCLA 3VFNA 3ABMB 3L1OL 1KCSL 5C07E 4JANA 3FU5A 4BXVA 1G7PA 2XG4B 4GAGL 2JCCB 4M9OA 1T6VN 1AD0B 3NZSA 1CFNA 3EBGA 5EA0H 3BP7A 3GT6A 3DHPA 2I07A 3UTOA 1KXTB 4U1IA 5CD5C 3P9WB 4IKJA 3PXHA 1QBML 4X99B 4I89A 4QTIH 4EN3B 5IFJB 4XN7A 5AVXB 1MCDA 4KI5C 5GS0D 2GHWB 1KTRL 5K1JA 2D31A 5G4MA 2WXPA 5T3ZE 4JFQB 1A4KB 3O2DL 2XTLA 1IEAA 2MKLC 1QA9A 1JMZA 5H8DA 3W56A 1T4KB 3DV4B 3Q8EA 1P4IL 4H0HB 3TN0B 4DP6X 4XMLL 3WJLC 2UYLB 1EUTA 4ALAH 5HY9B 4KTGA 1HFUA 2NX5B 2YA2A 3H85A 3HHMA 3EJPA 1BZ9B 4ZW6A 5LGJA 4HKJB 3GTVA 3QE5A 4G72B 5CSBA 2EZ0D 4YGVA 2HJLB 3OAZH 4JDEA 1ZTXE 2NY2B 4N3UA 4F7PB 1QW9A 1T04B 2UZXB 3BRDA 1MCJA 5FM5M 2WCGA 4A7GF 5IVZA 3BW9B 3L95B 5HYSG 5I1LB 5F97E 1XH0A 1HOEA 3ECVA 3NRFA 1XGRA 2R1XB 1HNYA 3BUDA 3QI9C 2PW1A 2X4NB 3NJGA 4DVBA 3PWLA 4NZUL 5DJDB 1V3JA 2P80D 3LOWA 3NTCL 4PRPB 4PVBA 4Z7UF 1UURA 3HJEA 3KWUA 1A21A 1A6UH 2ZCHH 3UZVA 2VQ1A 4M6OL 3AY2A 4JZJB 4RRPM 3QHZL 2DLHA 4LSQH 4WFEE 3VXNA 4OM1H 3ZE2F 5C8JB 1JK9B 4P2RE 3MVSA 2CO7B 4L8CB 4ZBJA 3TNNA 1U41A 1JF5A 1MRDL 3QDGE 1USZA 1N67A 1IEBB 2WB1A 3F05A 4GSXA 4FI7A 3CFUA 3T4AB 5J6GA 2WLYA 4R7XA 1UWEL 5DD3L 3H2QA 4S0SD 1I8KB 5JIKA 3B3IA 2J20A 4Y4HC 1RURL 1VCBC 3VE0B 1E5AA 1OARL 2BMKB 3H54A 3AWFA 1GRWA 1IEHA 4ZX4A 1GCYA 4NT6A 4RBPH 3T0BA 1BF8A 2B0SL 5IM7B 1K8IB 5A2AA 4QCIB 1UGKA 4WO4A 3HN5A 1H9DA 5HYQB 1EAQA 3KPSE 4UF7C 3BWZA 4F33B 4APQA 4NO3A 1ZHNA 2ZPKL 1AO7A 5DJ0A 3VFRB 5I8OL 1H3PH 1LEIA 4HJJH 4UDTA 1EDHA 2F7PA 1IQDA 2AABH 1RK7A 1X7QA 5ISZA 4L5FL 5IWLC 5CUSH 5E70A 4MQSB 2CR3A 2YRBA 1WWAX 1JD7A 2HLEB 1E2VA 1LMIA 2PXYD 3PWNB 4JRYA 4APXB 5DTFA 3SO5A 4AEEA 4PJFA 4N68A 1JHKH 3MNDA 4K73A 5JXAL 3WXWL 3MBXL 4Y5YA 1IE4A 5TDPB 2A4EA 2BP0B 4PJHF 1T2XA 4OJEH 4AL8H 5HYJA 4FXLA 4X98B 4GMSL 4LASL 3BRFA 4W70A 2W60B 4HLJA 4MNHB 4M1GL 1XSIA 4O02L 2R7EB 1FGNH 1GPOH 1IC1A 3EAKA 3A21A 1JERA 2WXJA 5BQDA 3TBWA 4DKEL 4QRRA 2JV6A 5I0WA 1BQSA 3CVHH 3EZJB 3STLA 1YNTF 1DVFC 2AJSL 4NO2A 4JO2H 4PBVC 5E9DA 3VI3E 5EZLA 3K6FA 3L08A 1T3FA 2VJ8A 4LLVA 3RTQA 3ASWA 1JZHA 4LNRB 5C0RH 3F5WA 2Z91B 4P5TB 1PNCA 3FQWB 3MJ9A 4RX4D 3CTTA 3GXNA 4JFOA 5IEKA 4GP8B 4MJ6A 4W9CC 2OTWB 1JPEA 2QSCH 1S5HB 4IRSC 4G7RB 1EFXD 4LQ1A 1HHHA 1XIWC 1ZY9A 1E27B 4PJCA 3T1FB 4YHZL 3L4CA 5CR1A 3T04D 2FJHA 4HUNB 2CRZA 1KDJA 1MKFA 4Y5VB 2R0ZH 4ZFFA 2CXKA 3HVDA 3S48A 4P2OD 2X5PA 4H1LG 1RIVH 1PY9A 1UOLA 1WRFA 2NNRA 4C55A 4L1HA 1Q38A 2XV0A 4IRJA 3QUZB 1NC2A 3BXNA 3S5YA 2H2PD 5GHWH 1G7HA 2V7HA 2VL5A 2X6UA 4LRIC 1DSFH 3LS4L 2J5WA 4O2EA 1CT8A 1CN4A 1UXWB 3D69A 4HJUA 3LKQB 5GZOC 4BFNA 2LW3A 2JB5H 1QASA 3MBEA 2CLRA 2EEDA 4O9HH 5B38B 1MFBH 2X4TA 5ABDE 1Z66A 4MSWB 5TDNA 1NLDH 3IKKA 2FJFB 3E6FB 1EJOL 3P3SA 5JPNC 2LFEA 3NOIA 5L4FA 3QEQA 3L7EA 1U6AL 4WLCA 3B9AA 1MFVA 3F04A 5T1DH 4BK5A 1LO4H 3N0AA 3A6CL 2QTEA 1D6EB 3MODH 2VAAA 4B9FA 4JZNB 2CUMA 4G80A 3JWNH 2ADFL 3BP6B 3LNGA 2UXTA 1FYTB 3LQZA 2WOBA 1JUFA 5LDUA 2A9MH 4X7TB 1J48A 3ZDYB 1DBBH 3F7LA 3PGDB 4PRBA 3K80A 4IEFA 1AY1L 1P84J 3TJHD 1MAML 3GBEA 2H0EA 3CN4A 3GPSA 3E8UH 2VWEC 1FL6B 1LP9A 2D7OA 1YC7A 2GB2A 2O5NA 3R1GL 4KUCD 2WVUA 1UWFA 5IJDC 1MFMA 1OXYA 4KAQH 5J4MA 1DQMH 2QSTA 4JKPL 2P42B 3K6IA 1N0LA 5GXBB 4K9EL 3R0NA 4U1KB 5IF0A 1NGWA 1MDTA 1PF3A 5DC4B 4YHPB 2P8LA 3BESR 2YLHA 5GGTH 2MQGA 5D2NA 5MEPB 1BYNA 1KN4H 3QIUB 3QH3A 4GKZA 3BKJL 4X8JB 1XXFC 3KVDD 2XLLA 4KWUA 1ND0A 4HV8A 2IOMA 3ALXA 3ZE2B 2M1KA 1P7QB 1T66C 4LPVA 1HDMB 3KMDA 1WT5A 3CPLB 5IROA 1HYRC 4NZRL 5DDHA 2VE6B 2DLEA 5A16B 3TA4D 2GW5A 4LB8A 2JB6B 4GW5A 4YE4H 4N2IA 2WXMA 4XWOD 4DGYL 2XZCL 1XCTB 1F3RB 4MNGB 3DX9B 3DX6B 3QIBC 2Z1PA 5C0BD 4OCXL 3UTSA 2ESVA 4J3VA 1CIUA 3B9KD 3ZT5A 2BSEA 2NY6D 2YBGA 5ENWA 3MRPA 4GBXD 5IB4A 1OIOA 5I8EB 4HS8H 1FFNB 3DURA 3TBBA 2KMWA 2EUXA 5FGSA 3BZFB 4JQXC 2WJ5A 2W9DL 2COVD 4Y5XB 2XWBA 4RISL 4JQVA 4UM8B 2WWNA 4JG9A 3Q6FA 4L1SA 2VXVL 1RZKC 4OCRH 2ZUUA 2G2RB 5JIMA 2GK2A 2XCMC 1KJ2H 1XBDA 4CKQA 5LBVA 5G2NA 3BO8B 1OAUL 4BWUA 2QJDA 1K3IA 3QRGH 4KNTA 4MD5B 1JWMB 4JY6B 4QOKB 4PS7A 2G4GA 1IC5L 3BP5B 4ZMWA 4PJBA 2XU9A 3VI3F 5KVEL 1N7ML 1I1FA 4XNMB 4XVJL 1M53A 2EEBA 3HZMB 2Q7NA 2C4XA 3MLWH 3AWEA 2VRAA 4YXLL 4XOAA 2RALA 4Q89A 2FNBA 4PJHB 5ESAA 3T0EB 3UIZA 2I9LB 4HBQA 5HDLA 5G4NA 2A74A 4JO8A 3BH8A 4IGBD 1AO7E 2HLFC 3QUXB 4NN7C 3RFRA 4HUMB 2HRLA 3ULUD 3TEZA 4JO5A 3KWXA 5ISZE 4ZYKA 3OAZK 3PGCB 4EBQL 4FC3E 5IBTL 2ZUTA 2W88A 5ECJE 1N64L 4TNEA 4HWUA 3VXUD 4JRYE 2D3JA 5C07B 4PJFE 5EN3A 5B4MD 4QRTA 2AHIA 3POCA 3DC0A 4EZLA 1G7IB 4FLQA 4NUJA 2TAAA 3DBXA 4KX9A 4P4RB 3H4HA 4KY2A 1GAFH 5ANMA 5HYJE 1A6ZA 1ZVSB 3SYAA 3SDXA 2O93L 2ZJSL 1IGJA 5FCUL 3HS9A 2OYLA 1UM4L 3ZN6A 1IILE 5DD5H 3EH1A 3WO4B 5BRZA 3RNQB 3OKMA 1AAJA 4H88L 1GYCA 2YPVH 3AREB 4MXQC 4E5XA 4I2XA 1U8IA 4QRRE 3NBNA 2F53D 4Z8FH 3T08A 1G5AA 1XEDA 2WUCH 5CGMA 3SCMC 1QATA 3COOA 2GUOB 3P0VH 5E9DE 2Y69B 1A02N 2RHEA 3QIWA 4OD1L 2GUYA 1E4KA 4QHLB 3PHAA 4ELKB 4H1LH 1CGWA 1AD9A 2MTAA 3HPJA 1A3QA 4MA3B 4JKNA 3RWFA 1KGJA 2AXGA 2WBJA 2WLNA 3ARQA 3MLSH 1ZEAH 1R24A 2XNAB 2YN3A 4N90E 2V3DA 4PJCE 4HT1L 2XXGA 1JD9A 3UADA 2NR6A 3C9NB 3NGBC 2EVIA 4MMYA 4CA4A 4TSAL 3AB0B 3FFCA 4GS7C 3GB7A 4LKCB 1QX1A 4WSGA 1MIMH 3JYCA 4GQRA 3RWDB 1HINL 4ZOAA 1I8MB 4RBPK 1F2XK 2WPGA 2P52A 3TOPA 2AEQL 4ZTOL 3V4LA 2HTLD 5CBAB 1L6ZA 3IKCB 4M1CD 3SODB 5IHLB 4ZRGA 5GGQL 5AW0B 1R17A 3DUHA 3RVTC 1MUJA 3OLDA 4N20A 4F9PA 1UCBL 2NNAA 2XQBH 3CCHB 4JEGB 1W2KT 5EZOL 1G7QB 3WE6B 3S6CA 1X9RA 4ONFH 3VFVA 3TP4A 2JKSA 4G5AA 2NY7L 3WJMA 1HHKA 5IB5A 4I88A 3FSAA 1J5OH 1IMHC 1FCCA 1LLAA 4FXTA 4QTHB 3VXMD 4GSUA 4P2RB 2A6JB 4TNGA 2H6PB 1ADQH 1FLTX 2GFBB 5F9AC 4JAMA 1UJ3A 3DVFA 4DSYA 3QEQE 3QDGB 4XO3A 1XGPB 4YDJB 4S1DD 3CSPA 4MQXD 4XP1H 1F4XL 2WP3T 2Y72A 4UOJA 5BXFB 3GHBL 5KYUA 3SKNB 4A6YL 3OSKA 3FQTB 2R2BB 5ACLA 3O2WL 3P73B 2V2TB 5BV7C 1SHWA 4J12A 4W1TA 4QRSB 3D9AH 3FB5B 1GZHA 3IN0A 1QWUA 4M43H 4WU5A 5A6MA 3HI1B 1ACZA 4HWZA 4NWTL 4HKBA 1EIBA 2EIZA 5FUZL 1LP9E 1THCA 3KPSB 5CLZA 4AQOA 3U2SA 4U3CA 2KBGA 4HQQL 4G3YL 4AW7A 3QUHA 3HRZA 3MRLB 4YZFE 2F2HA 1A6PA 4XWGH 3LEVL 1TQTA 4QHNB 3L3JB 4FKHA 1F4AA 1TG8A 1TZOA 5D2NE 3OR6A 3U79A 2OMNA 1V05A 2ZXBA 3I6KB 3K5RA 5I66B 3WFHB 4G9DB 4OCYL 2AZAA 1P4LA 4W9JC 3FT0A 4IRZL 1RIHH 2AI0L 2BOCB 5C09E 1H3GA 3LEXB 4QGTA 4M9PA 3WS3B 2DD8L 4GUPB 2YAFA 3LPFA 3ZZSA 1UEYA 3DO3A 1INEL 4LCWD 4QLRA 2ICWB 2RR3A 3FJTA 4HPOH 4NKOA 4KZDH 3S97C 5KYYA 1MHCA 2APWA 4LCUB 1Z6JT 1JNHB 2Z31D 3UTSE 2ESVE 4NN5C 5EU6A 1MRCH 5DRNB 3RKPA 4M7JL 3CXFA 3VI3B 2BVUA 5SWQA 3BIAX 4EF3A 3A4DA 5ADPL 4ZFOA 2GK0A 2DTSA 3O3DA 3PUUA 1TZGL 5EORL 3WEAA 3IBOA 1LEKB 1QFWI 3PDOB 4YEEA 1KYFA 1KXQA 1YYLH 1YVLA 3VG9C 1N8ZA 3ZTJG 3EFFA 3K91A 4NYLB 2CR6A 3H9SD 4TLKA 1TTBA 2WM0A 4XPBH 3FYEB 3RWHB 3A6BH 3HHRB 4U6YA 4L18A 2VOTA 2ETWA 2WSPA 4JE0A 1RXLA 4H8WL 2A9DA 3NCWA 1FZJB 4K3GA 4G8EB 4PJBE 4R7VA 3SE4A 1BOGB 1UH3A 1B0GB 4ZODA 2VDOL 4MHHI 1VADA 2ENYA 1EGJL 2ZOKB 1CDCA 1XZWA 3D87B 3GDBA 2PW2A 3KLKA 3S3JA 3WKNA 2NRDA 5D2LA 1R33A 5L6YH 5FEBA 4WI0B 1UA6L 4U6HA 4Z1PA 1D5BA 2YAEA 1QFOA 1A6VL 2P5WA 1JJUA 1NKOA 2F8IA 3GBML 4YNYA 3ULVH 5F7BA 3LD8B 4OF0A 2EABA 3FXIC 1S3KL 3VFNB 4XMPL 2O26U 3R8QA 4JANB 3D3VA 5CIPA 1PX3A 1U58A 1G7PB 4HBCH 3ZRFC 4S2SA 1CFNB 1T03L 4ICXA 3W9DA 2PCPA 1DJYA 3BP7B 5C9JA 4KOCA 3B6SA 2I07B 5ANME 2OKMA 4XXWC 2P1YA 3C2AL 3KJ6H 3SDXE 3FT1A 3UPAA 1GCFA 1UENA 4DIXA 4KUZL 1NANH 4JY5L 5BRZE 1VGKA 3VXRD 1WWWX 5J6HA 3IMVA 5JYMA 2D31B 4K94H 4I2XE 5MP6L 2CK2A 4J3OF 5G4OA 1IEAB 5A2JH 2ZXWB 1QA9B 3FB6A 1Z3RA 4NZTH 3QEGH 1FL5A 4J3OD 4XPFL 4XOCA 2D03H 2X4QA 4I3GA 4DEWA 1B0RA 4Q0XL 5ECGA 2WZAA 4G6FD 3ZDZE 2WWOA 2BX5A 3NCXA 4ZUUA 4KDTA 1T21A 3CJJA 4O4YL 1AGEA 4KI1A 2BIIA 4C56D 4AEIH 3FC8A 3QZOA 4KRLB 1HSAA 1OE2A 4XNZC 4ABVA 3ZQ9A 5LGJB 4HWEH 4LLDB 2ODIA 3QNYA 4YGVB 1H15A 1J1OH 4JDEB 3FFCE 2EIJB 3ELQA 2DWXA 2EDDA 4G6AC 3LKPA 4EOWL 3CHSA 3G5XA 5F3FA 4JREB 4ZQKA 3AU1A 1XGRB 5I0DA 4OV5B 3QG7H 2YGOA 2Y36H 2X2HA 4G6MH 1QG3A 3KLSA 1MW3A 2PW1B 1LO3H 4JUTA 4DVBB 3PWLB 5E99H 4AGPA 3RWIA 4PD4K 3MUGA 4MJ5B 5GS3A 2BO0A 1W9XA 3UZVB 3QEHA 4MDIA 2VQ1B 4DN3L 5AVTB 4EDWH 1NCDH 1R75A 5LQBL 1F5WA 4XB7A 3VXNB 2EAEA 1XV8A 1ZPUA 3IXAA 4B5ZA 1E28A 3TNNB 3LN4A 3WTVA 4IK7A 1NAKH 3U0WL 2GY7B 3UTPE 1D5XA 4NGHL 4FFZA 5J6GB 2P46B 1IAKB 3O6KH 3VDAA 3BLKA 4L3EA 1F4WL 3B3IB 2I69A 3BEWB 3ESUF 3WDJA 5DD0H 2H1LM 4WI9A 2RACA 4ISVA 1ID2A 5HGHA 3D7PA 2B77A 3CZFA 3IXTA 4N2DA 1H5BA 3OAUH 2EIMB 4NT6B 5T33L 4MX7A 5C08D 2BNRB 5C71A 1KIUA 3HI5L 4WO4B 2KS0A 5DWPA 3CQFA 5DK3A 2Q1EA 2WKLA 4NO3B 1ZHNB 5DJ0B 1AO7B 1E6OL 2FX7L 1LEIB 4UDTB 1IQDB 1NCTA 1P6AB 2FO1A 1N4XH 1X7QB 3JWOH 5ISZB 3NCCB 2HLAA 1FNSL 5I18L 5C0ND 1PZAA 3MNWA 2B8OT 4PJBF 1N2RA 4U3HA 4IM8A 4JRYB 4QAMB 5DTFB 4PJFB 5F2FA 2CK0H 5TF0A 3QARA 5CMAA 1YJDH 3SGKA 1AE6H 1R46A 3EJUA 4Y5YB 4EAEA 2PPCA 3UBXI 3FN0H 2E5EA 5HYJB 3WNKA 3L5XH 1MCWM 3LIZA 2Y2TA 3FK3A 1FF5A 2BVQA 2Q2EB 3TPKA 5I5JA 4UQ2A 5ICXA 2XETA 1G9MH 2BHFA 1JWSA 1WA2X 3EOBA 3TBWB 3ZTJH 1YA5A 4QRRB 1OALA 1CLOL 5DYOA 3STLB 4DPCX 1DVUA 5EU6E 2A77L 4NO2B 1NFAA 1IAII 5E9DB 3LSOA 5FOBA 5EZLB 1KJ3H 1SVBA 1T3FB 1R5VA 1YEHH 4LBEA 4LLVB 3RTQB 4EDXA 2FK9A 4I9WD 3F5WB 2ENSA 4NQED 3QWOA 5LGHL 4XH2A 3GXFA 3IDNA 1IKNC 3GSOA 4JFOB 1BWMA 5IEKB 1KXQE 1DVXA 3SDCA 2ZX9A 4UAHA 5DZVA 3QNZA 1JGVL 5T5FA 2H0JA 1HHHB 3T6WA 1ORQA 5D1QA 4X5RA 1Z9SA 1T7ZA 2FJHB 3G6JA 1FV1A 1KCLA 3RFZC 1QSFD 2D73A 3SYCA 1MXDA 4ZFFB 2HT3C 4G9FD 3VGFA 4Z7AA 1U91A 3BAKA 4J39A 5C6PB 3ZDZF 1T89A 3IMTA 5JIDA 4Q9RL 2XT1B 5FYLL 2ZCHL 2XVLA 4IRJB 3ZTNL 4GSDH 4ZUWA 3BQVA 3TV8A 3BXNB 5KOMC 1AANA 1G7HB 4OM1L 2V7HB 2VL5B 3ZGHA 4IKKA 5D2LE 3DJSA 3LIUA 2Q76A 1L6XA 4B41A 4O2EB 4OQTL 4ZO7A 3ZY7A 1CT8B 2P5WE 3D69B 1BD2A 1IB5A 5LHDA 1FRGL 2XPZA 3MBEB 2CLRB 3PFUA 5F7LB 3MV8A 3WTXA 2K9UA 2X4TB 3RVWC 2LVEA 5TDNB 2QBWA 4OFKA 4HZLB 4H8UA 3LJ3A 5JOPD 3GRGA 3D3VE 4OZFB 3QEQB 3HNVH 3L7EB 4LHQB 3SGJC 3DUSA 1A7NH 2VAAB 4XCCH 4Z3JA 4NOBA 2K70A 4G80B 3R7QA 2F1AA 4M5ZL 1AQ8A 1TCRA 2ZUXA 5KSBF 3LQZB 1JUFB 2H1XA 4DP0X 3CFDA 3N91A 5EWIH 1Z3GL 2UXFA 1E2WA 2QVIA 3BUBA 4PRBB 4IEFB 1NA8A 4HJJL 1DFBL 4FHBD 3V7AE 2DQUH 2R4RH 4WV1C 4AGQA 3VB8A 4DGVH 5EC1B 1LP9B 2AZUA 2CBPA 3P3TA 3WSQL 4RDQF 1CPUA 1N0LB 3FTWA 2AEPH 5A2CA 1OSZA 2VZOA 1MWAH 1NGWB 3JZ7A 3O3UN 1MQKL 1K9TA 3B2UD 2J8OA 5IF0B 4XP4L 1WLHA 2DWEA 1GYVA 4GG6A 2P8LB 2WKOF 1AQKH 4B9IA 4RFNC 5IK3A 2JE8A 5D2NB 2VDRB 5AVVB 1GYAA 3MJ7A 4N0CD 3QH3B 4GKZB 4ONGH 1FGNL 1GPOL 2G60H 4ZSOA 1ND0B 5D7JC 4HV8B 1IGFH 1FNFA 1U3HC 4KH9A 5C09B 2J21A 2J71A 4PWIA 5DDHB 2CJ3A 4RNRA 2OXGA 4MNQA 3K6SA 1RAMA 4JO2L 4XAKD 4KITB 3TBTB 4GW5B 4GRWF 4JG0H 4R8WH 5TTRA 5DMIL 3P2BA 2DQFA 1VFUA 3MLTA 3V4UL 2GJ6A 4M6MH 3UTSB 2ESVB 3V4VL 3WGVB 1LO5A 5LN8A 1AYOA 5ENWB 5IB4B 5IGXL 3DURB 3BMWA 5IBLC 3FMGH 1KB5L 5J06A 4PQXA 12E8H 4Y2NA 2XWBB 2R83A 3ULSA 4HLZG 1K72A 3WNNA 3QQ9C 3Q6FB 2EE2A 2WNGA 1UM5H 5TE4L 4L8BA 3MTXA 1XR8A 3CIAA 1G7MA 4LHUD 4B27A 5KSAD 3ZK0A 1DJWA 1KLUA 1OSEA 2LFGA 3KL3A 1P53A 1TYJA 3NP4A 2OYPA 1E3ZA 2NTFA 1E0OB 4L3EE 3I9IA 3KJ4B 2TRYA 3V52H 5KANG 4PJBB 2N7BA 5INDA 1I1FB 5F9WB 3MLVL 1ZA3A 3ECBA 5FFOA 1KIRA 2PO6C 3TBYA 4AYBA 2Z8SA 4U0RB 4CVUA 1XZ0A 4YSOA 1NLBH 5TFSH 2XV2A 4ZMZA 5LBGA 5ESAB 3AUWB 4JN1H 1KENH 1NIDA 5C2UB 1MFBL 1ODUA 2A74B 2W81C 2WHVA 3BH8B 1C8QA 3SGEH 3V5DA 4AQAA 1NBVL 1G6RH 3VYOA 4YFDB 3X14A 3EO9H 3F01A 3KPLA 4WY7L 5DWUH 5I74B 5DEJA 1CE6A 2BHUA 2MEJB 4JMNA 3F7RA 4ZYKB 3BOVA 1SY6H 2YJLA 2K6WA 3FONA 1T20A 4QRTB 3RDTD 1ONQA 4NUJB 4WHDA 3DBXB 2A9ML 1CF8H 1LD9A 4CGUB 5ANMB 4JRLA 4Y2DA 1A6ZB 2ENPA 3SDXB 3LZRA 2DQIH 1IGJB 2RQEA 5FK9A 1U8HA 3QG6A 1U8LA 3RIFF 4GXUM 2DEYX 5BRZB 1BZQK 4FABH 3OKMB 1FGVH 4L8SA 4J3BA 4WWKA 4KK6C 4AGMA 3CZGA 4KAQL 2J8HA 4HOZA 4E5XB 4I2XB 1U8IB 3ULUL 2VXQA 3IJEA 1MCFA 2XPYA 2J5LB 3VD0A 1AIZA 4AQZA 5L4JA 1MJUH 4WFHE 3QIWB 1Z9NA 3ZDZB 3N1MC 4RIRA 2R2CA 4BFGA 4GIOA 1Z0NA 1AD9B 1OD7A 3HPJB 2AXGB 4FP8H 3CZEA 1HIMH 3ZJAA 5L4MA 4TTGA 2WBJB 4H20H 2J6EA 4Z77A 2GI0A 1R24B 2WXRA 4HFWA 4XCFL 4GO6B 2GVYA 2R29L 5D1QE 4MMYB 1DZBA 3G6JE 3FFCB 5I1IL 3GB7B 4YSCA 5ICYA 4YE4L 1I82A 3UYOD 4TOYH 1WCBA 1U8OA 2QQLH 1LM8V 3TYGH 1FIEA 3J2PA 1J0KA 1RMFH 1P1VA 3RGVC 2LAAA 2VISA 1C9SA 3QORD 2GT9A 1FVEB 2DWYA 1SHMA 3BE1H 3EFDL 3HE6C 2OL3L 5AAWC 3GKZA 2NNAB 2PTUA 4H8PA 3SB3A 2BHYA 4M62H 1JXDA 5EDSA 2RTTA 3D0VB 2J3SA 1CS6A 5SWZA 1RVFL 1TF4A 2ZWKA 3PWJA 3V10A 1BD2E 3VFVB 3WJMB 1TUPA 1HHKB 3NSCA 5IB5B 4AUJA 3BZ4A 5FW6A 2K4WA 4JN2A 3GM8A 3MV8E 4YBHA 1EAPA 4OLXL 2J55A 4NC1E 1HT6A 1LWHA 3CNKA 2VZSA 3RDJA 1TEYA 3QRGL 3VTTA 3FUJA 3S96A 5BOZG 1HYSC 4JAMB 1UJ3B 2WNWA 3T71A 4OV6F 4TTDD 1EO8H 1BGXH 2X42A 2E76C 4EI6A 3GMOA 4O51A 5KYUB 1WS8A 3H42L 3V8CA 3BLBA 4XC1H 3MLWL 1TIUA 3Q48A 3TWYA 4XMUA 3VJ6B 1CCZA 1ED3A 2ZTBA 4LLMA 2DMCA 1XB6A 3W1ZA 2MPAL 1PZ2A 3DYMA 3TEUA 4WTXA 4YH6A 3HN8A 1PAMA 3HC0A 4G59C 4WU5B 4HEMA 4NNYA 4LPUA 1OP5H 5CLWA 4HWZB 2X3AA 4HKBB 3JT2A 2EIZB 3PXLA 4TQIA 5E6ID 3GGWA 2C3WA 5EOQL 3OPZH 4BA8A 4ODXA 1OCRB 5EU4B 1HCFX 5CEZE 3OG4B 2XY1A 3ARGD 1AHKA 4BZ1A 3U2SB 4BRVA 1EBPA 1JZEA 4WK0B 1TVBA 3WDIA 1DQQA 1WWCA 1RSYA 5B1CA 2ATKA 3FFDA 1SYSA 3HR5A 2CCVA 1FFRA 1L7TH 2KL6A 3HG1D 1GAFL 2DJSA 3C5JA 4WW2C 4GG6E 4FJZA 4JX0A 4GOSA 3OR6B 3UTTA 3QAZB 2WLLA 3EDKA 4IBWA 4ZSOE 4R0LA 2FX8H 1UUNA 5L9DH 5MI0B 3DUUA 2ZOTA 3WN5A 3KGTA 3T2LA 4CSTA 3SO3B 3GRWA 4MNQE 3MUZ1 4HLZH 3P0VL 4GSRA 3L2MA 4JFYA 1KGCE 4B9CA 3TS8A 3FU9A 4NKOB 1SOXA 2AEOA 1MHCB 2ZX5A 2GJ6E 1T0NA 4WU7A 3SPVB 1BZ7A 3FF7A 3B9DA 5EU6B 3P3UA 5SWQB 4NCC2 3RYMA 5CINH 4ZFOB 4ANVA 1MW0A 2GK0B 3O3DB 4RWHA 3TGXA 3HC3L 5C9KA 4M7LL 4X6FA 3S3BB 5HGGS 3CN0A 5D1ZC 1N8ZB 3FBKA 1P5VA 3EFFB 1FFQA 1E5YA 1T2JA 3GSNL 4QHUA 2UZYA 2DLGA 4FD0A 5AYQA 2Y1VA 4U6YB 1P69B 2A4ZA 4Z3TA 5JHLH 1BA9A 4FFYL 4NJAH 3RX9A 2W0FA 3G08A 1PL3A 4HD5A 1IM3A 5C97A 4GRMA 1KYDA 4HS3A 1ZLSH 4R6UA 4ONFL 1D5ZA 1JG9A 1VADB 3SPHA 4Y4KC 4KQ3L 1HNFA 5I5RA 2PW2B 1LEGA 3D48R 1J5OL 1AGCA 4JB9L 5D2LB 1HXYA 3KL0A 3IFLH 4U6HB 1D5BB 4YNYB 3PL6A 3WIHL 1ADQL 3G6JF 2ARWA 3T77A 1AZZC 1NM4A 2WXFA 3Q2NA 2JKRM 3MLYH 1KCRL 1UQSA 1NMCB 4ES8A 2HZHA 2D9CA 3AS2A 4R7DA 5BRQA 1OE3A 4R2GD 3D3VB 5CIPB 4PMFA 5AKRA 1U58B 4BFOA 3D9AL 4S2SB 1BF5A 3QQNA 3W9DB 2PCPB 5C9JB 1GGTA 3B6SB 3LZNA 3F83A 1QYGH 3SKOB 3JYBA 3O3EA 4EKXA 4MAYA 4XOEA 1NIBA 1U0QA 2VKWA 5EZIH 1RZQA 1CLYL 5G55A 5FV1L 4CUCA 1LO0H 5KBPA 2BVTA 1FPTH 1VGKB 2XHNA 3L3OA 1N12A 4KKCC 5J6HB 4G8GA 4NJ9L 2NW3A 5EEUA 2FUQA 1ID5I 2H9GA 4BKTC 4FXKA 1GIGH 1A4BA 2V9UA 3ZZLA 4PGBA 2GJJA 3LYRA 3FB6B 4Y1AA 5GISH 1FL5B 2X4QB 3BKYL 1B0RB 5K59E 4U1JA 4LSRH 5AEAA 3SDAC 3V9EA 2OSLA 1YEFH 2C9VA 3MXVH 2XWXA 1GGBH 1T21B 4GRLD 5LO7A 3ARBA 1AGEB 1MCPH 1J10A 4OKVA 3DXAD 1HSAB 3HZKA 4HF5L 5D7KD 4P48A 3T3PE 2RA1A 4CVXA 3FT9A 4OLUL 1H15B 1C1EL 3WJJA 2ENQA 2PWGA 3QW9A 1EAOA 3NYKA 2ATPA 4CRPA 4HPOL 5FHAH 3LKPB 3BZEA 1OGTA 3G5XB 4JRXD 5D1XB 3Q43A 3FHQA 2OJZL 4F9LA 3F84A 4NKIL 4ZQKB 2OR8A 1KYOK 3F58H 4NKDA 3ZOAA 3ROLA 3LRSA 4XODA 2VDQB 3BRGC 1CZ8H 1RZFH 3RWIB 2EKJA 3FHAA 4GLRH 3PJSA 4L4TA 4CU7A 3MUGB 5K39A 1AR1D 5CJ5A 2BFVH 3QZMA 5SWZE 1WFUA 2VR5A 3RQ3A 3IDYC 2FO8A 3QEHB 4HAKA 1HEZA 4MDIB 5CEXA 3RIKA 2SEBA 3W11D 4LPXA 3N2JA 3KBEA 3IXAB 2R1YA 1E28B 2VXSL 5A7EA 2XZQL 3G5WA 3OAWA 1RV6X 3LN4B 4OB5L 3EIFA 5DMGC 3HEIB 5EPMA 2BIOA 5ELIA 1D5XB 4UT9L 3G6DH 1P6WA 1IGML 3KDMA 4RMWA 1OGSA 3VTMA 4YHLL 3VM7A 3U6XA 3TA3D 4L3EB 3BPOC 4L1DA 1M42A 1M2VA 2UZIH 1HC1A 3BWSA 1MFEL 1WIOA 2VIRA 3HFML 1J9TA 3HE7D 4HSCX 4CADA 4BZ2H 3IAGC 4ISVB 4L3AA 5HGHB 4OLVL 2X1XR 2WLJA 2X0UA 3CZFB 3HNSH 3IXTB 1H5BB 4HEME 4DGWC 1RUMH 3IJHA 5FGBC 4MX7B 2CHNA 4M03A 5IJCC 1H8NA 4E9VA 1KIUB 4FLRA 1L0YA 3MLZH 4YC2C 5LCVL 2OYKA 1QSED 3GZPA 2XIIA 4HOMA 1WZAA 1KGWA 4OTXL 3RPKA 3MO1A 4LVHC 3RVXC 1YNKL 3MACH 3TJEL 4G5ZH 2ORBH 4HJSA 1ZGLA 1XSJA 2HLAB 4X7CC 4K71C 3MNWB 4FOMA 4NHUA 1N2RB 3CD4A 1DDHA 3OC5A 3D2TA 5D70H 5FXCH 4HHAA 1SOKA 3NCEB 3QXAA 5INCA 3GBDA 5HDQH 3UTTE 4PUBH 5JW4M 2OSYA 2MFNA 3DHUA 3UEZA 2EH7H 3NJIA 5CMAB 4WWOA 5JOFA 1CICA 2WQAA 4XO8A 5C2BH 4GXVL 3B2XA 4AIOA 4K94L 5I1DA 4KKBD 4XMTA 1D7FA 2AQRA 1FO0B 2AKRA 3FUKA 2XG5A 4GQQA 2BVQB 3C5ZA 3Q3GA 2R9HD 4UMGA 4UQ2B 5ICXB 4EEEA 1AKJB 1DUZA 2D03L 1JWSB 1BJ1J 3EOBB 1RPKA 3T6VA 2VQ4A 2XTJD 5MHSD 1YUHB 1PLGL 1T5WA 5DYOB 3F64A 2E6PA 3EUDA 2EO7A 2Q7YA 4Q9QL 4UTAH 3LSOB 4TLUA 5FOBB 4OUOA 3WLBA 4YSSA 4URKA 4BGDA 2EIKB 1R5VB 3PLYA 4LBEB 3TWCH 5KBNC 4EDXB 4MMXB 2QHRH 4HWEL 3QWOB 4XI5D 1PKOA 1R5WA 1KLFA 4XH2B 4PJIA 2QV2A 4OBRA 2KPNA 4NPKA 4RGNE 5FHBL 3UROR 3IDNB 3GSOB 2CH8A 2EQDA 1SOQA 2CMRL 5EU7E 3SDCB 3QNZB 2ZCZA 2DM3A 1X3DA 1ORQB 1W91A 5D1QB 3U7YH 2O5YL 1Z9SB 3BAWA 3RZCD 5D72H 2EUWA 3G6JB 5JPMA 1FV1B 3ISWA 2RAMA 3SY0A 1UACL 2YAMA 3QG7L 4G7VH 4G6ML 1OP5K 2R69A 5E99L 4OGQC 1U91B 3VFWA 3WJLA 4NQDD 5K59F 2G3NA 5I1KH 1UADC 1UD4A 4HWBH 1NMAH 3QXVA 4ZUWB 2XWTA 4EDWL 1NCDL 2NY4C 2C9AA 3IMWA 2Q76B 2J44A 4KQ0A 1ZLVK 1NCOA 1BD2B 3KPOA 1NAKL 1QMUA 4DETA 4AZUA 4ZMAT 3MV8B 4H8WC 4X9FA 2A6DA 5LVEA 4F15B 2DJUA 4LL4A 2ATAA 3MUUA 3V55A 1JGEA 5DT1H 4K3HA 3KVPA 3HMXA 4W6XB 5DD0L 4AK1A 2ADYA 3QI9A 4FQXC 1S7WA 2VKXA 5ALBL 2FGWH 5SV4A 4A39A 2O6FA 4YDMA 4L9LC 2WUBH 5E6SB 3DPBA 1ETB1 4HHGA 2VDKL 4IJTA 1TCRB 3PF2A 2K7PA 3EGXA 1VHPA 4LXFA 1JDCA 3FO9A 3CFDB 5DGRA 1ES0A 4G8GE 4J3XA 1KTKE 5D4JA 3IJ8A 2AJVH 5IQLA 4WHYH 2XX0A 5K9QI 3LEYH 3OF6D 3PJNA 1DQLH 1XVSA 4Y1AE 2Y06H 4OD3H 3HCVA 1W8OA 5HDWA 4AKQA 1RFDH 3D12B 2CK0L 3IVKA 3AAZA 1PX8A 3P02A 5FYJE 1HVXA 4Y4HA 1AE6L 1MJ8H 1OSZB 3APFA 4WK4B 4NQTA 4X0NA 1CYWA 1BQHA 2DWEB 4GG6B 3CE1A 5IK3B 3MJ7B 1XDTT 4ZSOB 4X6EB 1G9ML 3KBHE 3BUIA 1TTUA 5B1AB 1X4YA 3LH2H 2G3XA 4AUUA 4RNRB 3OG6B 2OXGB 4N0UA 4MNQB 2VH5L 3F7YA 3PCYA 4WEMB 3JSSA 3OBAA 4N2HA 5IWLA 1OTTD 1JIBA 3BDYH 3FOLB 3MLTB 4KVNH 4ATTA 2AXWA 2GJ6B 4IJ3B 5CR8A 3CFQA 3FQ4A 1AZCA 5CZVH 2BFGA 4L4TE 1LO5B 2GEEA 3IMUA 4AOFA 4YDIH 2H32A 5GS0C 4JJHA 1FC2D 1PG7H 5E7BA 4TNVF 1EVUA 2IFFH 4WEBL 3TZVA 4YSDA 5BZDA 2DIAA 3ULSB 4J2QA 1KPRA 4YHML 4ZO9A 2FE0A 4L8BB 1H3VA 4UTBA 3O8XB 1L3WA 1XR8B 2C7UB 3LKSA 5D1ZI 1G7MB 1EHAA 3UG4A 3F12A 1TTRA 1KLUB 4PGEB 1WD9A 2IDSA 2NTFB 2EC8A 5E24E 4ZMPA 3PWUA 2E3VA 3CSGA 5KOVC 3P4LA 2IANA 1W72A 5INDB 2Q10A 1ZA3B 3ECBB 3TBYB 1KIRB 4GI8A 2ZOUA 3ET9F 4WFED 2O1AA 1XZ0B 1T7YA 3C6LA 5E2WH 4P2RD 3T65A 5FDYA 4DUWA 5BZXA 4JGUA 4M48H 2EADA 4MAUH 4L23A 3GJFA 3SOBH 2W8CA 3GMQA 2ZOLA 1NIAA 3V5DB 3VRJA 5DU7A 4AQAB 3X14B 3BWAA 3KPLB 5I5IA 3MLUH 4PBDA 1QAWA 1J9CT 4F8QA 1CE6B 1KTCA 5HPOA 3NZUA 4FNTA 3VFTA 3IF1A 5TGBA 3D18A 1IU1A 4F93B 3NT0A 3FONB 4RFOH 1T20B 2E46A 4LNVA 4XCCL 3RA7L 3GNML 4R26L 2VSKB 4RMQA 3FCUB 4UV4L 1R3IH 1E8WA 1NOFA 1TYRA 1PKQE 1HU8A 3NVQA 5FCSH 1LD9B 5JDJA 5EWIL 4Y2DB 3GXIA 1JMXA 1VEOA 2Q5BA 2ROYA 4H8QA 1U8HB 3QG6B 5J1SC 1U8LB 4OM0H 4OFVA 2R39A 4AYEC 5GZOA 2EXWD 3EFOA 2MOGA 4L8SB 4WWKB 1NEUA 3HS0C 5T1KA 3UXFA 1JGLH 1FJ1A 3IJEB 1FI8C 2F5AL 4F24A 5AB2A 1V8HA 4OLZL 4RIRB 3SBPA 3STZA 5L7XH 2UY7A 3VAEA 3GHEH 1Y6MR 4PJIE 2DQEH 4QXGL 4BH8A 2J6WA 5FW7A 2G60L 2JJSA 2MQ0A 3BCFA 4D94A 5MEND 3RGBA 3GQFA 4Z77B 1JZ3A 4KI5E 1R5IA 4PY8I 4HFWB 2KQMA 4LIQL 3T3PB 4LDEB 2VN5A 2EIDA 1HE7A 4W68A 5CJOL 1I4FA 1TPXB 1CFSA 5ICYB 4R8WL 1WCBB 1U8OB 5AVQB 3X12A 2PXYC 4M7LT 2SODB 4KKLD 4M6ML 4ICWA 2AK4A 1EO5A 2VISB 2VR7A 1CMOA 2GT9B 5J89A 4BM7A 4W9EC 1NJ9A 2FQEA 5HHVH 4N2BA 4NBZB 4U1NA 1YNLH 2AQNA 3CLEL 3QWRA 4MLSA 1WBXA 1JHTB 2JJTC 3T2NL 1TLKA 4LVNB 1VFOA 3VU1A 3LZQA 2Q87A 2QKSA 4PHZA 2AJXH 3ASOB 5SWZB 2XN9A 3PWJB 1VENA 5DHYA 2H1PL 3D2UD 5GZND 3BZ4B 3ZMEA 3ESMA 4LO9A 4UANA 3PP3H 4JN2B 4JKMA 4ZXBC 2OMVA 3GEWB 3M46A 2IAMB 1MNUH 3S96B 5LGYA 3V52L 5FUOL 4CAGA 4ACTA 2NY0B 2DKSA 2KZBA 3CU1A 2JJWA 1FL3A 1HNGA 4HIHA 4OGYH 4ANUA 4EI6B 3GMOB 4O51B 1PEZA 3UYPB 3N06B 1NLBL 1ZIAA 2I24N 2D7TH 2BDNL 1ED3B 2DLTA 1IGYA 4LLMB 1LTXA 4JN1L 1KENL 3HC0B 4JQXA 3TX4A 2NZ9D 3EO9L 2APVA 2JLPA 1EHLH 5D96C 2HPOA 1Q94A 6PCYA 3GGWB 4P2OC 3S7GA 4GUQA 2UZPA 4ODXB 1TENA 4NBYB 5AW4B 1YEEL 4MJJA 3E2HB 1WK0A 4Z7OE 2BVYA 4LBAA 3DV6A 3FQNA 1TVBB 2VLKD 5AVYB 1DQQB 1WEJL 2DLFH 1B2YA 2ATKB 3FFDB 1SYSB 3HNTH 2H2PC 3HR5B 3EH2A 1A1MA 3IFOA 1P0SE 5FGRA 1CF8L 4PEEA 3C5JB 4HW6A 3R4DA 1IKFL 3QDHA 3SQBA 3PPSA 2H0PA 4OFIA 4FE9A 3UTTB 4UINL 2HT4D 2WLLB 1SVCP 2OX5A 3PAYA 2B7DT 1XL6A 1ZAGA 3H0TA 4R0LB 1ZVNA 3DHJA 5DQDH 5I9QB 4W9DC 3PHQA 2HWZH 4X7EC 4YBLC 5C92A 1M6UA 3DUUB 3WL9A 4Q14A 3N41F 3WN5B 1K85A 5BO1H 1WYJA 1TJIH 5DC0A 4N0UE 2ZYIA 5F7KC 4JFYB 1D7BA 5KAQF 2WW8A 1NCNA 5ERWA 4UAOC 2AQ3A 1OP4A 3NJNA 1F90L 1SEBA 2XC8A 2VN4A 4G71B 1T0NB 4WU7B 5F88A 1S7SA 1BZ7B 3S3DB 2YD7A 4K07A 3DSNA 4XNYH 4PS4L 1NCIA 4FQ1H 4OF8A 1HIML 3RWCA 3ZE1E 4FQJL 2XIBA 3H3PH 5DLMH 1KV3A 3FW6A 3ES6A 3BH4A 4NZFA 5FO2A 3TJHC 3FTGB 4JFFD 3KYKL 4RGNB 4KKAD 1KGUA 2AV1B 3GC3A 4X6FB 4N2EA 3H7BA 3WFBH 1D9KC 2QQLL 1P5VB 4LOUC 1HESA 5EEZA 3QO1A 3X3FH 3LS5H 4IOSA 5ALCL 2UZYB 3SCMA 1FHGA 3LN5A 1HKFA 2HA1A 2W0FB 3G08B 4HVBA 1IM3B 4N5EC 1G5GA 2IANE 1DBJL 2DBLH 3MJ9H 3IYLW 4LEEA 4YHYB 4GRMB 1YQ2A 4ACPA 4PV9A 3V0JA 4E5XG 4TLTA 1OGPA 2YQGA 3BWUC 3QA3A 1LEGB 5EO1A 2I26N 4M4RA 1XTMA 1AGCB 2B4CC 3TO4A 1HXYB 1YRKA 3RX7A 1TETL 3PL6B 4PTUA 3AQZA 3TNMA 3ZHDA 4XNQA 1WIPA 3T77B 2IEPA 1WFTA 2EYRA 1UQSB 1BGXL 5KEZA 5T3XD 2Y5TA 1DHKA 3II2A 5L0QB 4R7DB 3U6RA 4GBXC 1PG7X 1M6OA 1IQWH 3QUYD 2IVFC 1ZVYA 4EIGB 3DI3B 4Y9GA 2DTMH 4F2EA 3O3EB 5IKCA 4APQD 1YY9D 1AO7D 4MAYB 4POYA 1UTDA 1L9NA 4OJYA 1FNGA 1TCMA 1X6LA 4J23A 4ZS7H 3OPZL 4K2UH 1MY7A 4J3OH 1YECH 4M3HA 5GRXG 1A64A 1IGIH 4G8GB 4GINA 3A4EA 5ISZD 1INDL 1RUQH 3P4OA 2G75A 2H9GB 4FXKB 1B6UA 3DOHA 4OZFH 2UV3A 4PGBB 4Y1AB 2IADA 1L7TL 1ZRUA 2NW2A 3CVHA 4PY8J 5FA4A 3IS1X 4ES9A 2QADB 2BXZA 4U1JB 2OSLB 5HYJD 3ERXA 3MYJA 3R19A 4JE4B 4NUGL 5DRXA 2PLTA 4NN6C 3ARBB 2P49B 4Z3HA 4I3SH 1Q72H 3NDZE 2CPCA 3LZOA 5DJZA 1DBKH 3MV7D 2JNZA 1C5DA 3HZKB 4IGBC 2AV7A 3PQYA 2VW7A 4Y1SA 1NGQL 1NAMA 1GGIH 3ISRA 4CVXB 2Z1KA 3ULUC 3MNZA 4GAYA 4BELD 1BAGA 1QI4A 4RDQG 2VWEE 2ATPB 5E9DD 1SEQL 3NCFB 1OGTB 3OKDA 3RTQD 3N1GC 1CDGA 5JIPA 2V17H 5B4MC 2AK4E 2DKUA 1E8ZA 4A63A 3OJDA 4FKEA 3QDJE 4QT5A 3TBCA 4CL7A 3GMRB 4NKDB 4FFVC 5SV3A 3ROLB 3LRSB 4E41D 3RI5F 5I17A 3FCBA 2YD9A 5FS5A 5HJ3A 4FTVA 2K9FB 3PJSB 3H3BC 1OF2B 4JCMA 1BAFH 4L4TB 4NP9A 5CILH 5K39B 2Q8AH 2VMFA 2XN9E 1B2WH 1OO2A 1TR7A 2IALB 2VLLA 4IOFC 4HUWA 5CEXB 2Y22A 3P54A 3ATFA 2SEBB 4Y19D 2GSGA 1S7UA 2R1YB 3DETD 4LARL 3EYVA 4A67A 3Q8BA 3F7QA 4D0BA 1CDUA 1IBZA 1OKEA 4K3JH 2CDEA 1NGPL 4UZUA 3HA0A 4LL1A 2FCBA 4NJAL 5EPMB 4AIZA 1KB9J 4JR9L 4R5TA 1NC2D 1IJNA 3BGMB 3KDMB 4HKXA 4JMXA 4ONHA 3LVEA 1ZLSL 1OK8A 2X3BA 1M2VB 4GT7A 4XHQA 4I5BA 4CADB 2VIRB 1YEGH 4RAHA 2QR0B 2QVTA 4MJIA 5KTEL 3ZE1F 1BEXA 3A5VA 4PY7A 4ILDA 1Q0EA 3P11L 1S9XA 5AW3B 3GSWA 5A3ID 3IJHB 3NCMA 1Z5YD 4M93B 1LWJA 1AGBA 4PP1D 1MRFL 3DJRA 5IG7A 4M1CC 3GMPB 5TE7H 1Z5HA 3N41B 3QAQA 3K2UL 1D7CA 3OGCA 4I0PC 4PAZA 1Z2KA 5AAMA 1CGXA 3MO1B 1EVTC 3N40P 2DEWX 2FTAA 1BXVA 4NHUB 4WNSA 4C57C 1DDHB 1QYGL 1RJLA 3U1SH 4HHAB 3QXAB 5INCB 4G7SB 3L16A 4IBVA 5L2KD 2CO4A 4HP5A 4L05A 5JOFB 1FPTL 5GGTA 1CICB 1PKQB 3E8VA 4UYQA 1L9TA 5B8CA 5EEYA 3L2NA 3EGSA 2A6IA 4XAWH 3WNJA 1NCCH 5I1DB 2AKRB 3KD4A 4IRSD 1QBBA 2XG5B 1XIWD 3C5ZB 3Q3GB 4MQXC 4S1DC 5DHDA 5I6XB 3NESA 3U82B 1B4JH 2JTYA 1MCQA 3EZ8A 1DUZB 4LSRL 4MTMA 4L1TA 3MXVL 4RAVB 1SBSH 2Q7YB 3O11A 3PP3K 1IAOA 1WPCA 3CLWA 4QMEA 1FH2A 1MCPL 2Z8VC 3LHPL 4YR6A 3B2VL 3WLBB 1OAKL 2WIMA 1W6WA 1XCQA 2DI7A 5HDOA 5JMRA 3JQOB 4Y88A 1QPPA 3RB7A 3FOMA 3VXQB 1R5WB 3CVBA 4OZGF 1YPZA 2BVPA 3NG5A 4PJIB 2HFTA 1P5UA 1J1XH 4YLQT 5TQ0H 3V7MA 4LCCC 1I9JH 2ZKHH 3AJ7A 5IW6A 4LRNH 1R0AL 4R9HA 2PETA 3KW8A 2YOCA 4R84A 3BD3A 1ZV9A 1TFPA 5T5NF 4CVZA 4MRCA 3ZL4L 1JDDA 5E8EA 5JPMB 4EI5A 2JXMA 3B1UA 4X42A 1CQYA 2Y24A 3LTVA 3N42F 5KG9A 2DH2A 3R0MA 3VFWB 1CZ8L 1RZFL 5BS0A 1JXJA 1M1SA 1MFNA 1QTSA 1L9RA 3O2VL 3AS0A 2HFGH 5I8CA 1J0IA 2XWTB 2OFQA 3C08H 2EC9U 3V7AG 1WISA 3T9WA 5F6IC 3T09A 1XX9C 3KPOB 1B9ZA 4XXCC 2DL9A 3GSRA 3G6DL 4K7PY 2A6DB 1BYOA 2Z31C 2DQMA 4B0MB 1WG3A 2VDNB 5DC9B 1USQA 1DANU 1JGEB 3KLAB 5AWNH 3QQ4A 1SXAA 3MV9E 4F7TA 5JQ6H 4X4KA 4EIBA 4KZEH 3I9AA 3QI9B 4LVOB 4XVTH 3TIEA 1S7WB 3BPCA 4X5XA 3HNSL 3DPBB 3QJSB 4P23A 2NT1A 3P1VA 3LX9A 8PAZA 5HGAA 3FTZA 1VZHA 1MFDH 3PYCA 1PSKL 3EGXB 1UWYA 3FO9B 1ES0B 1U21A