4HHGA

Crystal structure of the pseudomonas aeruginosa azurin, ruh107no yoh109
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEEEHFFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhgA00
2UXGA 2NRDA 3X1NA 4HCIA 5IY5B 2PCYA 4KO9A 1GS6X 1L9SA 1CURA 5B7FA 3GDCA 2BHFA 1ZV2A 1RZQA 1F56A 3EH4B 3NSDA 1AQ8A 5I28A 2PPEA 2X88A 1N70A 5F7AA 3T6XA 1ASOA 2DWTA 2VSMB 1IC0A 3HEIB 2IDSA 3NJGA 3FSWA 2AANA 1A3ZA 1OE2A 2UX7A 3QJVB 2MRYA 1AS6A 1OCZB 1OCRB 4X4KA 2ZXWB 1NIBA 1A4BA 1ASQA 1SF5A 2QPDB 1FFTB 1OV8A 3RYMA 1V10A 1JVLA 2XV3A 1R1CA 4M4RB 5TK4A 3WNIA 3ZIYA 4GP5B 2LLNA 4KOBA 2BP8B 5AFAA 6PCYA 5I26A 4DP1X 2HRHA 3OMAB 3NP3A 1W6WA 2HX8A 3PAVA 3WIAA 4DP2X 2VW4A 4E9SA 1ET5A 1BQRA 4YVUA 1PZAA 3SBRA 1WA2X 6PAZA 3WNJA 2TSBA 4DP0X 1XB8A 1BXAA 2VW6A 2AFNA 1NIAA 4BWTA 2YAMA 3N2JA 3N55A 2RACA 5F7BA 4P5RA 3NSYA 1SFDA 4DP9X 4HAKA 1GYCA 1L9OA 1JXFA 2ZOOA 5B7MA 2HX9A 1N68A 1I53A 4QKTA 1OCOB 4YSOA 5I6KA 3T71A 2J5WA 1ETJA 3FU8A 3UAAA 3S3CB 1PLBA 3C75A 1W6LA 2YXVA 2FNWA 5I6NA 3X1GA 1T5KA 1PMYA 4E9XA 4E9YA 4KO7A 2PP9A 1JVOA 4L0PB 2X87A 4HCGA 2BZ7A 3NJIA 1KCWA 1UATA 5I6OA 4UF7C 2B08A 4BXSV 2EIKB 3IN2A 1MG3C 4YVNA 4YSEA 1IBYA 4ZK8A 3PLYA 3T6VA 4NERA 2YAQA 1NIFA 3GYRA 1FWXA 1KDJA 2PPDA 1TEGA 4RH4A 1E30A 1E65A 2P80D 1PCSA 2J57A 1X9RA 1JZHA 1OE1A 1JZIA 4HZ1A 2GI0A 3AG3B 3QQXA 4AX3A 1KDIA 1OOWA 3JT2A 3NJHA 1GS8A 2FWLB 2YXWA 5B1JC 3AG2B 4E9TA 1AZRA 1XB6A 3ABLB 3DKHA 3EH5B 5LDUA 1JZFA 4YL4A 1PAZA 2ZONA 2Y69B 4A2HA 2XYBA 4HCFA 4YSRA 4DP7X 3OQRA 2YAOA 3FSZA 2HZHA 4DPAX 2PP8A 2GB2A 3OM3B 3AW5A 3FQYA 2BW5A 4JHUA 4BK5C 1J9RA 2JKWA 1J9QA 3H56A 3T9WA 1L9RA 1GSKA 1NPNA 2PCFA 1KYAA 2GC4C 1KV7A 2I7OA 2UXTA 3QJSB 1AZCA 2FTAA 2PP7A 1WA0X 2W8CA 3L45A 3IEAA 1OF0A 4GXFA 1MZZA 2AVFA 2VN3A 1RCYA 4N4YB 9PCYA 3X2QB 4UANA 1AACA 4KO6A 4G7SB 1ASPA 4AI7A 3ERXA 3DIVA 1AG0A 2FJSA 2QPEB 4BWUA 4E9VA 4F2FA 4ENZA 1PLAA 2QT6A 4GY4A 5I6LA 2WO2B 3OD3A 5D4JA 1WAEA 2YAHA 3PCYA 2VSKB 4E9WA 5B1BB 4F7KA 1ID2A 2XXFA 1DYZA 2PLTA 1XB3A 2CBPA 1AANA 4WKXA 3EHBB 5D4IA 4W1TA 3NJJA 1SJMA 4P5SA 1PNCA 1L9QA 1PZBA 2EINB 3CG8A 3NJFA 1J9SA 3FPXA 2HXAA 2VW7A 2XX1A 3CVCA 3JTBA 1PLCA 1B3IA 1VLXA 4HHWA 2FT8A 4G70B 4NB7A 1ZDSA 2ZWNA 1PNDA 4KNTA 2TSAA 5B1AB 4A68A 2GBAA 2Y1AA 2YARA 4E9RA 1HFUA 2FT6A 2VMJA 1GY1A 4HALA 4A2DA 1ZIAA 1SNRA 3SQRA 2CALA 3NYKA 5ANHA 4M3HA 4FA7B 4E9QA 3D12B 5TK2A 3GXUB 3FQ1A 1AS8A 4G71B 2H47C 4TXVB 1AZUA 1PZCA 3G5WA 2WO3B 1KCBA 3NP4A 3X1BA 1V55B 2VM4A 1JXDA 1BXUA 4G7RB 1WA1X 1A4AA 1E67A 4A2EA 3V9CA 3H4HA 5B3SB 4N8UA 3QJRB 4Q89A 3X1EA 4YSQA 1ET8A 2HRGA 2Q9OA 3NSCA 3DTUB 1AG6A 3UGEA 2DYSB 4YSPA 1IKOP 1JXGA 1QNIA 1A65A 2BP0A 4UAHA 3AY2A 2BWIA 3NSFA 4JKNA 2IWKA 3NJMA 4A2FA 1TU2A 1SDDA 1L9PA 5FC9A 1SF3A 2N0MA 2MTAA 2PPCA 4DP6X 1J5DA 3MX0B 2IDUA 2CAKA 5D4HA 2FQDA 4K9JA 1YLBB 2EILB 2QDWA 2A3TA 1EHKB 1JERA 1X9UA 1RKRA 3FQ2A 1BQKA 1J9TA 2VM3A 4AZUA 3FYEB 3T6WA 5I6MA 1AS7A 1FA4A 1AR1B 4AKQA 3FU9A 4HHGA 2DYRB 1NPJA 4YSSA 3ASOB 7PAZA 2BW4A 4GP4B 1CC3A 2CCWA 2YQBA 3NJLA 2W88A 1GR7A 2I85A 2XLLA 4G72B 3PAUA 2AZUA 2E86A 1NIEA 2BZCA 4AKPA 1J5CA 3UAEA 1PY0A 1BYPA 4GYBA 2XXGA 3H4FA 4DPCX 3ABMB 4KNUA 2PPAA 1BXVA 2YAFA 3T6ZA 1NICA 1GW0A 2FQGA 1HAUA 4PCYA 1ILSA 2BP0B 1CUOA 3ZX1A 1TKWA 1EZLA 7PCYA 3S3BB 1TEFA 1SDDB 3FU7A 2Q5BA 2JXMA 4A67A 2EIMB 2J56A 1A8ZA 2JFCA 1OE3A 2UX6A 4PAZA 4KNSA 5B1KA 3QPKA 4A66A 5EHFA 2H3XC 1NIDA 1JZGA 2IWEA 4YSCA 3CVDA 2CJ3A 3QJUB 1A4CA 1MDAA 1V54B 4CSZA 1ZDQA 1CYWA 1IBZA 1NINA 8PAZA 3CZUB 2FQEA 4A2GA 1BQ5A 1OCCB 3KW8A 3UADA 1HAWA 2PPFA 2OCCB 3NJKA 3IN0A 2FT7A 1AZNA 4MFHA 3BQVA 3S8FB 2YAPA 3AG4B 1ET7A 1KBVA 4DP5X 5AKRA 5I5IA 4AKOA 2OJ1A 1DZ0A 3S3DB 1BYOA 1L9TA 2CUAA 1NWOA 4YSTA 4JHVA 5I5JA 3TASA 2XWZA 3ABKB 3FS9A 1NTDA 2IDTA 2XV2A 5AZUA 3QJTB 1BAWA 1JZJA 2IWFA 3TBCA 5PAZA 2XUWA 3TA4D 3FSVA 1XMEB 2YAEA 5A7EA 1ZIBA 3UABA 2IH8A 3S8GB 3KW7A 3TU6A 4DP4X 2I7SA 5I5MA 3WKPA 3U25A 4GP8B 2P80A 5PCYA 2HX7A 3CDZA 3FPYA 2UXFA 4DPBX 3FU7B 4WTQA 5I6PA 4F2EA 1ILUA 2R7EA 2WSDA 3AG1B 3SBPA 3V9EA 4G7QB 2B3IA 5B1JA 1ADWA 3SBQA 3QJQB 4CSPA 4EF3A 4BDVA 3IBOA 5B7EA 1M56B 3ZDWA 1ZPUA 3CVBA 1BEXA 1KGYE 3OMNB 3UACA 4YSAA 4BXVA 1URIA 2GHZA 2GC7C 1JZEA 3AZUA 4FAAB 4NAJA 3EH3B 4KO5A 4QLWA 5E9NA 3NT0A 3PPSA 1GS7A 1WS7A 2BWDA 3FYIB 1AIZA 4Q8BA 3WI9A 1CYXA 1NDTA 1MZYA 2OV0A 3EF4A 2J55A 1RZPA 2XV0A 2BO0A 4YSDA 1PF3A 4BWWA 1AAJA 2UXVA 3IE9A 2HLEB 2GSMB 2IDQA 3OMIB 1M57B 2DV6A 2IAAC 2EIJB 2XX0A 2DY2A 1IUZA 1E5YA 1GY2A 2AZAA 1QLEB 2XU9A 3WKQA 1WS8A 1MG2C 2XVBA 1JOIA 3PXLA 4KOCA 3ABGA 2BP8A 3ASNB 1SFHA 3HB3B 3FSAA 3X1FA 1E5ZA 1NZRA 1QHQA 2DWSA 2IH9A 4DP8X 4YSUA 2QDVA 3CDZB 3FT0A 3TBBA 3NJNA 4HIPA 1SHXA 1SHWA 2GIMA 2R7EB 2IDFA 2H5UA 1W8EA 4W9ZA 3PAZA 3MBWB 2FQFA 1M9WA 4BDVB 1AOZA 3BVDB 1NWPA 3WG7B 3ZBMA 1AZBA 1KBWA
chains in the Genus database with same CATH superfamily
4UNVA 3BN9C 3U0TA 3MREB 2XWRA 3ZDYB 2NR6D 4ZPVB 1SLUA 3T3MF 1P84K 5C6WH 2BERA 4F1ZA 4FDWA 3SDCA 2FJHB 3HAEA 5MENE 2V2TA 4KK6C 1JDCA 2HTLD 2WZPA 4M7ZC 2VT0A 3U9PL 5E08L 3VYNA 1BGXH 4XCFL 1YYMH 1FHGA 3RTLA 2VXQL 3PY9A 4J39A 4EI5A 2B4CL 3B9DA 4Z7UB 3F5WA 5D7HA 3B56A 1U95A 1LO2H 5IR1B 3G5YB 5JW4M 4NYLA 5B39A 5KSUB 1WV7T 2CO6A 1QPXA 5D1ZD 5TH2B 4M7KH 5HVHB 4FD0A 4GSDH 4PJGF 2NYKA 4XP1L 4EIUA 1GZPB 2C8NA 3MCLL 2PXYA 4AJVA 2HA1A 1CD8A 5JQ6H 3IS1X 1PZUB 4Y5VC 1R1CA 3ZIYA 2BCKB 3D85A 5KW9L 4DVBB 5TE7L 4NNPL 1AO7D 1IQWL 2Q76A 4NO0A 5TDPB 5I1HH 4DP1X 2CKBB 3A23A 3PAVA 1SJHB 3SIKA 4KJWC 1XCQB 4M6NH 3DLQR 4E36A 4U3HA 4P2RA 5K5YA 1IGIL 2ZQKA 1D7CA 2ARJQ 1MJJA 1EO7A 3ARGB 3IFNH 4KC3B 4LCVA 4N20A 5DMJB 1VIWA 1KIPA 3MRQA 3OPUA 5GJSL 2VISB 4DP9X 2VDKL 2VLJA 3WY2A 1OF2B 5IZ7A 1LE5B 1A3LL 1N68A 2A6KB 2FWSA 1FH5H 4JKLA 1K8DA 3O11A 5D6CA 2Y07H 1XAKA 1FFNB 2BDNL 4YSOA 2WQUA 5LAXB 5LBVA 2DMHA 5BW7C 3GTNA 3HE7B 5I6NA 3BLKA 3LRMA 2B5IC 2P8LB 4OZHF 1KCVL 1FL6B 1YNKL 2X2HA 2FWUA 4KZ0A 2KYIA 1SLWA 5GJTL 5IMKB 3DGCR 1GMIA 1JIBA 2X1OA 2RCSH 2UZXB 3WL9B 2XTJD 4PJCA 4AVJA 2Z6FA 5KYUA 4YGVB 2JCCF 4RX4D 4X80L 4HMEA 4XWOD 1IKNA 1SQMA 3V79C 2QZ5A 5JMOC 4EDXB 2OJZH 3FZUC 3BYYA 1HSAA 4NERA 2NY2B 3U7YL 4JFZH 3QZPA 3CZNA 3HC3L 5H94A 3QUMA 1SYSB 1QFOA 2NY6D 5TFSH 3K6SA 2Q3XA 3SGDI 4UYQA 4B60A 2GI0A 4AX3A 2X89A 4FERA 3CIAA 3AXLA 3EO9L 4NLHA 1E6JH 1AZRA 2IDCA 3BVNB 5BZWB 5EEWA 2K0RA 1YMHA 1UEYA 1RSFA 2X4QB 1ZRUA 3V5HA 3ZTCC 1J1OL 5F3FA 1ZT4A 4WQOA 1PQZA 4QJ3B 1HILA 4OFYD 1T6WA 4M8QB 4K7PL 2WQVA 4YSRA 1X5YA 5DJ8A 4LLVB 4NFDA 3GUTB 3V0HA 2PYFB 4KKCD 1NCBH 1QNZL 3OM3B 3FQYA 3TFKC 3UBGA 4V11A 5GSRA 3WDIA 4ZTEA 4L8SB 2V3FA 3NCXA 1RP8A 4DGYL 3UPRA 3NPSB 2V7HA 3NABH 4F33A 2Z31B 2V2XA 4GAFB 1BD2A 3QPQD 1MFNA 4JPVH 4AG4L 3OZ9H 4XBEH 2FJGA 2X0UA 1BF2A 3L45A 4A2LA 3EJZC 1Q9LA 2APXA 4J4PC 4JFHE 4L3EE 1OF0A 4ERSH 5DJAB 1SM3L 5C2BL 2DJSA 2YD4A 2K70A 3MUHL 5AVUB 1FJ1B 3D0AA 3ZOAA 3VFGH 4Q97A 3VWKC 5IM7A 3L9EA 2W65B 1ASPA 3RWGA 4MVBD 5H4YA 1E9QA 3P9LB 4OBSA 4BWUA 3APDA 4ETQB 1CD9B 4AUYA 1AGDB 4I4WB 3UBXI 1DVTA 1DE4A 2DF3A 3NSXA 4HETA 4QTIH 2IPKB 1BFTA 2Z0BA 2CDGB 4UAOB 5D4JA 4ZZFA 3QEHA 5T1MA 2I25N 3RJOA 1G7IB 1VFOA 2EJ1A 5ADOH 4N1HB 4N86A 3QWNA 4N2EA 5J6GB 4XNZB 3ARGD 1A9EB 4NKMB 2WWOA 1SBSL 2P4AB 2KKQA 4E41E 2YMXL 5BO1H 2FBJH 3P11L 2BVPA 4OT1L 4XE5B 2GEQA 4IEFB 5GGSB 1XFPA 4KMQA 4Z7VA 3MROB 3OHXB 4Y89A 4YHIA 4V1DE 2GPZA 2IGLA 1PLCA 4RRPM 3HG2A 4HHWA 2XC8A 2Z35B 4NB7A 3VSTA 3ALPA 4IU3A 1DVFA 2V7NB 4FYSA 2NUTA 1IGMH 4ONGH 4U0RB 3UDWC 3HE7D 2NCEA 4HXBL 1T7ZA 4PSRA 5CJQL 4A2DA 2JQZA 4U1NA 3EZJB 4XCCH 3VFUA 4MZ3A 3ECWA 5AVVB 1T2QL 3IKCB 4ZQKA 3HTLX 1TZOA 4NGHL 5CZVH 1WBYB 5BZXA 1OAQH 1K5NA 4OCNC 3BHBB 5AW6B 4LKCB 1QAWA 4LIQL 3H42H 1TF4A 5EBWB 3DVGA 1V8HA 3EKCA 3WFHA 3QEQD 1VRSA 2AI0L 2ADJA 3UTTE 5KVFH 3DRQB 3V4VL 3MJ6A 2NY2D 2ENSA 4F9LC 4LCIL 5L0QB 2EICA 5B38A 1VPOL 3TV3H 5C0JB 4BKLB 1H9VA 4X8JA 1DJIA 4GKOA 2I69A 5IG7A 1MI5D 1WDAA 1R4XA 3GC3A 3S4SA 3JV0A 1HWWA 2ISDA 1DUYB 2JVUA 2L7QA 2H0EA 5DJZA 3CSPA 3SYAA 3IDGA 3ALXA 3R1GL 5HP5A 2APFA 3JWDH 1XCTA 2MQGA 4HIXH 3QCUL 4JO5A 2ZKXA 2NSXA 1SF3A 1WAAA 2M2DA 1B0GB 2YPVA 4FKHA 4WV1B 1F3RB 4OFQA 3WDHA 3S5LA 3RZCC 2E27H 2A6DA 5DF0A 2NY5H 1BPLB 3K6DA 1JERA 1SEBB 2QKIB 4JPWH 4KXAA 5HYSG 1BBDH 1QVOB 3OKEA 2Z31D 5MEQB 2F7IA 4BE6A 4OLEA 1GIGH 2X4TA 4QRSA 4DW2L 4MAYC 1EJOL 4XPTL 3K4AA 3P9WB 3QUXB 4BK4A 3T2OA 1AVAA 2EDFA 4KZEL 1JUFB 5CLXA 5IWLA 3V0EA 3WLBA 3K3QA 4U3SA 4CJ0A 3TIEA 2FLMA 1CLZL 1G6RH 4EVNB 1CT8B 1GYUA 2C3VB 4HCRL 4LL9A 4FQQB 4OIIL 1FV1A 4YK4C 1MCRA 1G9MC 3DECA 1Z6JT 3WTTA 2VMCA 3FMGL 4KTDH 4EXPX 4DPCX 1OEZW 3ESVF 4BFJA 1DQQB 3NSJA 1QQDB 3ULVD 1NCNA 2A9MH 2YAFA 4ONOA 1GW0A 2JKXA 3PPEA 4IRSC 2ZYHA 4UTBH 4Z7NB 3N91A 1M4KA 2V3EA 1ORSA 2V9QA 5IJDC 2JXMA 3R19A 4EN3A 4PAZA 1A8ZA 1MCPL 1M7UA 4WJ5B 5B1KA 5CWSA 4MJ5A 3VI3E 2OJEB 2Y06H 3N50A 3OWEA 5HJGA 4UI2A 3FDWA 1RH8A 5EV7A 2CR6A 2DQUH 4YHPA 5AZ2H 4M4PA 5G2NA 5AOLA 1G0YR 4ADIA 4M5TA 1AD0B 3G08A 4X99B 3T0ED 3LEXA 3GXFA 3KBHE 3KW8A 4KKLC 3UADA 4MDRA 1JPEA 3O8XC 1M1SA 4LNVA 1KPRB 1KIQB 5GRJL 4Z7QB 4G8EB 5IEHB 4DGVL 5ALBL 4IOIA 3O9WC 5KBMA 3STZB 1AJ7L 2X5PA 3UBHA 3K2MC 3CZFA 3HAEH 5CGYD 4YE4H 1ZKAA 3C5ZA 3DHJA 3GMRA 4JFVA 2CCLA 5AWNL 4WF7A 3C8KA 1VDGA 3ROLA 4JDTL 5F6IC 4Z23A 3OQ3B 4R7LA 2BJML 4U31A 1KFAH 1VFBA 3QS3A 3K8KA 3LIZA 3RP1A 3FW6A 5E8EA 4XMTA 3DX0A 3GS0A 3LKOA 4XPGL 1A6VL 2EP6A 2XQBH 2XUWA 2I07A 1P4IL 4P4KB 2CJUL 1FRGH 1KSRA 2IH8A 3S8GB 4DP4X 5I5MA 2BY0A 3QNZA 3B8YA 1I1FB 4UM9B 2CM5A 3GKZA 4P46C 2EDEA 3TM6A 3QGVA 1U8MA 3HW7A 1JK8A 4Z7WB 1CG9A 3ZSTA 1TFPA 1RZ8A 4O02H 4W6WB 4JQXA 5L4JA 1GXEA 1MWAL 4FKEA 5GZNA 3VXOA 1HZKA 3D05A 3QFDB 1K2DB 4LESA 2JTDA 2XPGB 4PJXB 2A6IA 4KI5E 3VCLA 1MXGA 4KROC 2QLYA 3LKNA 1J7VR 5D1XB 4DQOH 5EZLA 4IOSA 2C7FA 2CLRA 4MMZB 1AR1C 5DYOB 1T0PB 3RAJH 3WEBA 2MH4A 4YHZH 5KYXA 3KPRB 3MXVH 1KGIA 3QUXD 2KDYA 2Y22A 3HI5L 4BK5A 3MGAA 1F1GA 3IMSA 5HHQA 4DO5A 4Y2NA 2X70B 3BH9B 3QUYB 2KZWA 4P5MB 4U1LB 4Y16A 4F37K 4UQ9A 1OTTC 2MKWA 4JB9L 1TJHL 2YSSB 3JVFC 1IB5A 4QCIA 4V33A 4JKWA 4KH2A 4X42A 5E23A 4HOWA 3FBKA 4YSDA 3SE8L 3W57A 4JZNB 3OKMB 3ZTEA 4D8PA 1U58B 4XMKL 4WU7B 4J1UA 4CW1B 5HYJB 1M57B 3A21A 4LHUA 3BI9X 1E0OB 1E5YA 1H5BC 3CDCA 1PG7H 2CHXA 4OD2A 3FBQA 5IQ9A 2Y5TB 4YLQT 4WTWA 4OZGE 3IF1B 3ASNB 3MV7A 1E5ZA 4HUVB 5DS1A 3O2VL 3AWEA 4Y19A 1X9LA 1EO8L 4FCAA 4TV3A 3TBWA 3L5JA 3DOHA 3DUSB 3FT0A 3Q1EA 4JG0H 1XAUA 1T1ZA 2J2ZB 5JW5A 3QUMH 2ZCZA 5J4MA 2YD9A 1UB6A 5ESVB 4F9PC 4Z0BH 5JHDE 3ARBA 3PAZA 1FORH 4U6TA 4PJEB 5E51A 1QSEA 3FAWA 4O2CB 5F6HJ 5C92A 1S6NA 1W8OA 1H6UA 1JRHI 2L04A 4WUKL 5FYJU 2R56H 2A74A 2NRDA 3HI1A 1WC7B 3CFEB 4MNQB 2GAZB 4P07A 4XO4A 1RUML 4LSUL 3THMH 3J07A 3AS2A 1YNTB 5DT1L 3LRLA 1V7NL 4JVPA 1N70A 2D7NA 4N5EC 1NUGA 3SBWC 2MPAL 3ARFD 1U6AL 5HHVH 5C0BB 2GQHA 2EDKA 2NXZB 1OP3K 3RWFA 3V6ZB 3LNIA 3L5HA 4F5CE 2UX7A 1A2YB 3FTSA 1F00I 5DEJA 4RZCB 4D9RD 1TNMA 1OCZB 2DJ4A 1BVNP 1QBAA 2L4OA 4DWHA 1R3HA 1YEFL 2I32A 3M7FB 1SF5A 5ETUB 4OBRA 4YJZL 4JO8A 4CC4A 1S2EA 1YUHA 1ETB1 2VDQH 1CF8L 1OV8A 3RUGE 5CUSL 4K94H 3V4PL 4P4KD 3UYPB 3VX0A 4G42A 2JQAA 4Z3EA 3SO5A 2VJ0A 3WHE1 2AABH 4YUEL 1IVTA 4XVJH 3SOBH 5E6IA 2DLFL 3MUGA 4UM9D 3MLTA 5ESAB 2VC2H 4KKAC 1ZPLA 4HJGA 1MRDH 1NMCB 4MQXD 2YO3A 3VXQB 4WFGE 1XH2A 3TBYB 4WI7A 4M61A 1OM3H 1P5VB 1YN6A 2B1AL 4YDIL 5E8DL 5SX4H 1U8IA 4QO1B 1CL7H 3BP4A 2HSIA 1D5BB 3M1BB 3PREA 3S88H 4MCYA 2OK0L 3FCBA 3TNMB 4JFSA 5C8JA 5CCGE 1DZBA 1KXTA 5FM5O 1JXFA 3GZOA 4D94A 5AB2A 5D1XD 2VQ1B 1JPGA 3GSNA 4QKTA 4WHDA 5FYLD 3ZL2A 25C8L 1A6ZA 3H9SA 4FNUA 4D0BB 3TJPA 3KPRD 5CJOL 1FHNA 3DVNA 2IADB 4MS8D 3V95A 1YECL 2KPWA 4PMEA 5FECB 1HINH 2WBJA 3QUYD 1JWSB 1D6VL 2CLVB 3WELA 4BA0A 5H37A 4PR5B 1X5XA 4HS8L 4E9XA 4ZFGH 2ETWA 3SO3B 5CBAA 4LOVA 4LSPH 4ODWA 3ZDYF 4LOFA 4Z7OF 4ODTH 1GGYA 2BZ7A 1L4IA 4PJ7F 5HYJD 2H32A 2HKFL 3JXAA 4GRLC 5ITBH 1PG7X 2E7HA 3SE3C 3K71B 1C8QA 4CMHB 3DX8A 3VU1A 1A7NH 3GYRA 1XIWC 1TEGA 5L8JB 1WFNA 5L2KA 4N28A 1UOVA 1PIFA 4OAWA 4H8WL 5KZCB 1BQLL 1HXYB 2WZAA 2NY1C 3F7QA 1U30A 4P9HL 3S34H 3D0LB 1OOWA 1S7XA 15C8L 1TJMA 1UACL 1AIFA 2B20A 3D06A 2JMRA 5E1QA 4WNSA 2QPFA 3CIQA 2VXTL 4PLJD 5DJ0A 4JPQA 4UOW1 1MPAL 4WCYL 1I7TA 3MLYH 5DUPH 5F7EL 1O6TA 5I71B 3CGTA 3G3LA 1ZD6A 4F7PA 2VUOA 2VUYA 3PXJA 2Y7QB 4AY0A 5HJ3B 4MHHG 2VAJA 3Q5TA 4AYGA 3QJXA 1H3GA 2E3VA 4MNQD 5F3HA 4F37F 2DL2A 3KPOA 3T4YA 2YA0A 1UXWA 2YPVH 3BSZA 4LGSB 5DRNA 2CRZA 3C9NB 4UV7H 4D0DA 1FSKC 4DO4A 5C0BD 5JXED 1EFXA 1SOSA 1GSKA 2NXZD 4JG1H 2Y3AA 4QWWD 4R0LB 5C0AB 2ADIA 5G5DB 4FNQA 5BUGA 2I7OA 3PV7A 5E6RB 1XL4A 4B27A 2AJ3A 2IFFH 3OBAA 4NRYB 4GXFA 4ZQTA 5EEYA 3K0WA 5CZRA 3DTXA 3JWOC 1QO3A 4HWZB 2FX8H 3BISA 2IANE 1AACA 3LN5B 2H3NB 3P0YH 2X4UA 4NCDA 3SGEH 5CSZA 1ML0A 1MCLA 1SOQA 3MA9H 1IGJB 3LNGA 4JPIA 4RAVB 3U30B 1I3UA 4BSJA 2F7PA 3TZVB 2JKIS 1NGYA 2VDOB 4L4TA 5C86A 5JA8B 2CGRL 2QT6A 5KBLA 4I48A 1WHPA 4AQEB 4HJ0C 4TSAH 4AEIL 4H25B 3TWYA 1EK3A 3RKDC 3WEMA 5HY9A 2HUHA 3D69A 4LCCC 3E9UA 4ZMPA 3G6JB 4OR1A 4B5EA 3AFLA 1HDMB 1AXSB 3WUWA 1T22B 5JOPE 5T3ZD 5HDOA 4OCSH 4JL1A 1FE8L 3IS0X 3S37H 1QKZL 5AB0A 1JGIA 3KCWA 1YEDA 1L0XA 3CLEH 4D9LH 3ZN6A 3EO1B 2UVEA 1FVDB 2A73B 1JG9A 3PHQB 4G8GA 4R4BB 3UBXG 2EINB 3NJFA 5IW6A 5DQJB 4ZAKC 3T4AB 4MD0B 3MZGB 5HHOE 5A7BA 5IHHA 2G4GA 3IDYC 4LQ1A 3P9MA 4M6MH 2GJJA 1HESA 2GBAA 2YARA 2QV2A 1U92A 1KPUA 1SNRA 4J8QA 3TT3L 3TN0B 2NQ3A 2CALA 1OAZH 2X12A 3NFNA 1YEKL 5EU6B 2HFGH 2I24N 4DEWA 2H8PB 4E9QA 3NQIA 2CR3A 2XJLA 3GXUB 1XGUB 3PG2A 3VFRB 4IHBA 1Z9SB 5F7UA 2XNAA 1MEXH 2F54E 4BUQA 4XXDA 1IEHA 5BJTB 2YGNA 2H1PL 2DQTL 4JQIL 4KJYB 5JYMA 2YGPA 1Z3RA 3HG0A 5IB3B 5F8RC 2K9FB 1E3ZA 4G7RB 4KUZL 4JJ5A 1MFBL 3QUKB 2X40A 2C3XA 3HUJB 3KXFE 5J13C 1MVFA 2AK4B 5KZCD 2D3LA 1MFAL 2YQGA 1VGEL 5IHZB 1HSBA 3LIZH 1NC4A 1XXDC 2EH7L 3KL0A 1AHWB 3VFSA 1M1XB 2Y7NA 3BH8B 3ZYZA 2QHRL 3DX9A 4PREA 2MQCA 5E8PB 1M2VB 3KL5A 2R1YA 3NESA 1UJ3B 3SYPA 1U8KB 2QR0A 3PS6A 4KRMB 2N0MA 4HJJL 4WFHE 3Q5OA 1DQIA 3L4VA 4HS3B 3T8XA 5I73C 5F88A 3WXWH 3IDXH 2WSPA 3AQXA 1IM9B 1UA7A 3HZVB 3RA7L 5DRWB 2UV3A 2NNXA 1MHHB 1QTSA 5E2WL 4JFPB 1HXMB 1LO5B 1A6WL 2P5WB 2VDML 3TO4C 1TQUA 3CU1A 4F7CA 2PTTB 5C0AD 5ABZA 4MZ2A 3WXVL 1JPSL 3O41A 4PI2A 3SE6A 4P3CL 5FO2A 3L3HB 1PBYA 5BUPA 4ONFL 3ASOB 5JXAL 1INDH 3W9EB 4KXCA 2YQBA 5FYKE 4XP9H 1GR7A 5BZZA 3HC0B 2E86A 1CE6B 4MDJA 4NQCB 4UZSA 1TENA 5TF1L 4GAJL 2R59A 3QUZC 4HC1L 4TNFA 2JB5H 3SDAB 4C4UA 3W39A 1DBJH 1WGOA 1T4KB 4ANUA 2F58L 3CDGA 1U3NA 3L08A 2CCVA 4LU5L 3DUUA 2W80C 5GGUB 2CO1A 1K5WA 5E6ZA 5MERB 2DWEB 3QZNA 7FABH 1ZEAH 3QP3A 3CLFL 1GGBH 2D7PA 3REVA 3S37X 3WEXB 1J5OH 2Q7YA 1OGTB 1P5UC 3KE0A 4JHWH 3SKJL 3RGBA 1ILSA 3C6SA 3NCJH 5IQ7L 4MTMA 4QYOB 4YBLB 5FX3A 1YJDH 3S3BB 1KLUA 4H0IA 5DFTA 3V10A 1E5BA 1FO0L 2AXFB 3WY3A 1A9BB 3NK3A 3VA2C 2BS71 1KEML 3AABA 1XBDA 2FD6H 3BAIA 1MXDA 1YYLH 3PNRB 5IFHH 2W81C 2X4OB 3GKWL 4A63A 3KPLA 1BVLA 3P2DA 1P53A 4XAWL 4XRCB 1MIEL 3G04A 5BVJB 4Y9FA 5F96L 4B97A 5LGJB 3UC0L 4GINA 1CDIA 1DBML 3TN0D 4RMRA 2RH0A 2P43B 2OCCB 5DD5L 3B5GA 4TVPH 3ZE0B 1NFDE 1OP5H 3R06B 3AU1A 2CK2A 4EMZA 5FA3A 5BMFL 2OMBA 3L5XH 5EOTB 2EEDA 3VGEA 1UM4L 3RDTC 3EOBA 1FN4B 1CFQA 5C6TL 2P28B 4QPEA 4XMLL 4DOHB 4APQC 4YSTA 1NWOA 4F2ME 4S2SB 4JUSA 1WHOA 4C83B 5D7LA 4W9CC 3PFUA 3T08A 2R29A 2VKXA 1CFNA 2GTQA 1A7BA 2GUOA 3LNEA 3MV9B 4JHBA 4JN1L 2AKRA 3DX6B 4I9WD 2G5BB 1FNFA 4RQQA 3GLEA 1JGDB 2VL5A 5ICZA 1BVKA 1K8IB 1MLCA 3VXTA 1TZHB 3GS7A 4P59H 4ISVA 1U2YA 3CD4A 2H2PC 4MB4A 1IC4H 5I0XA 2APWA 3GSOB 3WEAA 2XICA 4KH9A 4MD5B 4OUUA 4MMXA 1T7WA 5DMKA 1BVNT 1MCIA 1SUHA 3O6MH 3MRJA 2IALA 3E0GA 4RAHA 5DVLA 3SCMC 1IM9D 4PJ9A 3MACL 3VXSD 1NAMB 4YLCA 4ODXB 2XN9B 1RJZB 3QT2A 3LOWA 3NZ8B 4G9DB 4PTTB 3DUHA 1CB4A 2QSQA 2NLJA 2P5WD 1T1YA 1GHFH 4QOKA 4LOUD 3IMBA 3KGSA 1MHEA 3VQMA 3C8HA 3UTPD 1OHZA 3CHXA 1RZJL 2EH8L 2OYMA 3GRGA 4RISL 2VZUA 4F8LA 3NT0A 5CEYB 3DIFA 5I1CH 2BWDA 2EDJA 4NIYE 3ATAA 5EOCH 4GMSH 4X0KB 3BFOA 1RZPA 1TTBA 1ESOA 1K4DB 1GH7A 2N01B 4N9OB 1N8ZB 1AQKL 1U8NB 2G3XA 4NQCD 5I0VA 3EFOB 4FQXA 2WVTA 3SDAD 1RUAL 3BX7C 5H37H 2ICWJ 4PD4K 4C59B 5J5EA 1UXMA 4FI8A 4I3SL 2NX5A 4UQ2A 1JJUA 2P8PB 4S1RH 1MFEL 2AZAA 3NZUA 3B9AA 3WKQA 4M4RA 5C0IB 3K46A 2H32H 3QDMA 2GTWA 5K39A 1KXVA 1XSOA 4JDVA 2E9JA 1E4XI 2IAMC 4H8PA 5KVEE 1XF1A 4KI5C 2JI2A 1S4IA 4ZMAT 2WN2A 3HG1E 4QAMB 2K1MA 1DHKA 2CO7A 1HKLH 2RBLA 3WO3B 2HKHL 2APVA 4K4KA 2X53A 4KX7A 1IVLA 5HYQA 3GSVB 4PJ5A 4YHMH 3RPIB 3PWPB 2DTMH 1P6FA 4ZO6A 4M02A 4N0CD 4EIGB 4PJ8B 1P7QB 4ODVH 3KPNA 2OSXA 4UDTA 1IAII 1ZLUK 5DA0B 1YPZE 1BZ7B 5FYJE 3AUVA 3G9AB 3UP1A 3IDJB 5INDB 3CK0H 5IBTL 1NBVL 4I8DA 4TRPH 2W92A 4LF3B 2BM3A 4PJAE 5DRXA 5KJ4A 2N1KA 3M86A 3CXHJ 4P4RB 3VSVA 4L1DA 5IIEA 1S7VB 1LL1A 1DFBL 2B1HH 1FNEB 4YIQB 5MI0B 4OLWL 3QJFB 2NY7L 3BSZH 4LDLB 2DWYA 4IIZA 5DQDL 2BVEA 1A3ZA 2J5LB 2KQMA 3KPPA 4ZUTB 1JPFB 5LDSA 3BUQA 4UQIM 5T3XL 3CVHA 2AEQH 4MGXA 3F83A 4CN1A 2YPLA 1TCRA 3MRLB 5IUSA 3MRRB 1S78C 3MBXH 5ILTH 3PIQB 2GJ6A 3FFDA 4N0YH 1PIGA 1J8SA 3B6SA 5I66A 3MV9D 1FGVL 3U4KA 4M7LT 3LN4B 4C47A 1KELH 4GP5B 2OAAA 4FRWA 4MNHA 4POYA 1PD0A 1RZIA 5GZOD 1E28B 3VB8A 2ORBL 1PFOA 2IEPA 2Y6SD 3SJVA 2DI9A 2H6OA 2J12B 2W9EH 32C2B 4JREC 4R7NA 3RFZB 4P2OA 2VW4A 3C60C 3IU4L 4XNXH 3T8VA 2FYYA 3MLRL 5ANME 2JE8A 5CCKL 1KGCE 2DEYX 3KCPA 3WTWA 4POZD 2A9AA 1XB8A 5HGBB 3V52H 4FXKC 3ZKXC 2OL3B 1P84J 4OCWH 3VW3H 3DXAE 1GOFA 4DGIH 4HAKA 3VFNB 5EUOE 3V55A 4UDUA 3AQYA 4MAUH 4X6FA 3CPUA 5HVWA 1I8IA 5T5FL 2H0JA 2Y7SA 4FLHA 2PO6A 1RUPH 3FU8A 2DH3A 1BIIB 4Y1AA 1PLBA 3Q6FA 3C75A 1CXEA 1W6LA 3WIHH 3D4GA 4F7EB 5I8OL 2OZNA 2ITCB 4PJIE 1AI1L 4QHUB 1BM3H 3UPCA 5C3LD 4HCRA 5T1LD 4NZDA 4JFQA 4KI5F 1SVBA 2IVFC 1OSPL 1GTFA 5JW4N 3BYTA 4YN3A 2HJFA 2KS0A 1UWGH 5GSVA 1YNTF 1GGCH 5JO5A 1J8HA 4ZO9A 4PVLA 4K7FA 2IBGA 1ZVSB 3GSRA 4G8IA 4FKKA 4I87A 4Y9GA 3AY4C 4AH2A 5KS9E 4BH7B 4BEIA 3C5SB 4F57L 4QRUA 3N85L 5FFLA 1AC0A 4PWHA 5FHAH 2CBOA 1RU9L 1NMAH 1KDIA 3MRGA 4JFFA 3FCUB 2C4FT 2OMUA 5E5RB 2MMXA 3V0DA 4XVUC 1BXXA 3OKKB 2GJPA 3PWPD 1OWRM 1OTUC 4YX2L 2Z64C 1CYGA 1ZA3A 4XOEA 4OZGF 1ED3A 1P7QD 1TVBB 4J7RA 3MRPA 4G3YL 1HCVA 4YHNA 4JM2B 3BPLB 1JRHL 3OQRA 4GRMB 3NCBB 4QRTA 4JCMA 3SGJA 5IW1A 3SQBA 3O3AB 5EO1A 1BJ1H 4KMTH 4POUB 4LHJB 1HHHB 1DN2A 1NSNL 1Z9PA 3EJYD 3DGGB 4F7TA 3HE6B 3ILQC 1X6LA 1HL5A 5E08H 2PCFA 2HRLA 3P77B 2R1WB 1KV7A 2BC4A 2HVJA 2ZSWB 3QJSB 3RWDB 1C16A 1U41A 3VXPB 1JWUA 2UY6B 4N2IA 3EJCA 3AM8A 1RVFH 3LEYH 1T2XA 2A4CA 1Q72L 4LXFA 3QXAA 3QXTA 3ATBA 2O5YL 4OUOA 2H0PA 1BFOB 4PRPB 4PY8J 1I1AB 4ZD3L 1A64A 4XP1H 2F68X 5DTFA 4N0FA 2YUVA 4Q9CA 1SZNA 1W91A 4HEMA 5HYSA 3NCMA 4XNUL 3JWOL 1SLXA 5KW9H 4JGNA 2C1OA 4NNPH 2QELA 1TQSA 2HT4C 3LMJL 2E0PA 4QRBA 1CFBA 4EBQL 1D5ZA 1X9QA 2ODHA 2O6DA 5HDBB 2W07A 2ZX8A 5F7NC 4JN2A 5TTRA 4S10A 3RUGF 3SDXE 5IT2L 3CQQA 1WUZA 4LPCA 5JPMC 3GMNA 1AANA 2XG4A 4WU5A 3B3BA 5MHSD 3HHRB 4MAZA 4PS4H 1CMOA 5GPRA 3HOGA 1KB9K 2B16A 2XTJE 1IGIH 3MGOA 1I1RA 4YHYC 1L9QA 1PZBA 3FFCB 3RWEB 1NCUA 4R4ND 5GJSH 1U0QA 2JV6A 2VDKH 1NFAA 2JK5A 1NEUA 2NPLX 3P0VH 5LG1A 1VLXA 2J72A 1FNAA 1HHKB 1ZS8B 2KBGA 1XF3B 1IQDA 2BDNH 2V8MA 3NN8A 5IEKA 3VH8B 3R8BB 2Y6TE 1LP9E 3QR1A 4EKXA 4EBQH 5KBPA 2EDQA 1KCVH 1YNKH 2XZAL 4WVRA 5C0GB 2O5XL 5GJTH 3H7BB 4G71B 4B7IA 1QACA 2FE0A 2ROXA 1OSZB 2Q3ZA 3L9RB 4XAKD 4NM8L 5JORA 4F20A 3V8CA 4Y2DC 3EAKA 4NAQA 2FCBA 1C8PA 4K0OA 2HFEB 3O2WL 4WJG3 1A1OB 4PY7B 4Q6IA 5KSBB 3QE5A 3FHEA 4L1LA 3I75B 3U7YH 3WFDL 4N8UA 4P3WA 4GQZA 3HC3H 4PTUA 2NZIA 4PV8A 2NW2A 1FL5B 2R29H 4OZHA 3HR5A 1HOCB 1MQKL 1HTYA 3R0MA 3ETSA 3KLLA 1QLEH 2DYSB 3V6FA 1IKOP 2ICWA 2L7EA 3L5WA 5MP6L 2CK0L 5I1LA 3LXBA 1V05A 2VQ4A 3EO9H 3QC5X 4OLXL 1D5MB 4P2QA 1CDJA 2HCZX 1CJYA 3L2MA 5L9DL 4W9KC 1LE9A 2X4SA 2GVYA 1J1OH 4JM2D 3MX0B 5DZOA 5EZJA 1A4KA 2F53B 1MRCL 2F9BT 4QRPE 3C87A 1AD9A 4K9JA 4K2UH 2WB7A 2ED9A 3NTCL 5HGGS 1QNZH 1YN7A 4IBYA 4LDOB 5DXWA 2LTQB 4N90D 3CTTA 3KYNB 4ZXBB 3RHWF 4HIJA 2LAAA 1J9TA 5E9DA 1BZQK 2Y3NA 4DGYH 2WP3O 3VRIB 1R46A 2XXCB 5E4EB 5FGSA 3EDEA 4M48H 1R9FA 4L4VA 5FM5M 3QG7L 5C2BH 1WE5A 3V4PA 4FGMA 1I9JL 1I1AD 1ZLEA 5LNGA 1LK2B 1XSIA 2WJ5A 4LL1A 1I3RA 3ILEA 4U3XA 1PY0A 3DRTA 2YN3A 5J1AA 3CN0A 3DMMC 3UROR 5I9QC 4JO4L 5E70A 1HZHL 2XRAL 3FH7A 4WW2B 1F3JA 3UTSB 3HKZA 3U6XS 3MRIA 1C08B 2LGNA 3DV4B 4Y5VA 2R23A 1A6AB 1U8QB 4N0UB 4KXBA 3NA9L 2ICCA 1Z5LB 5C0ND 4LNRB 3QZLA 1PYWA 1QOKA 2GABA 2R0WL 5F9WB 3OGOE 4XP5L 4AMKL 1M71A 4GSXA 4WSKA 1NCAL 5D5ME 3FFCD 3V0FA 3ETBJ 1SBSH 3E6FB 1S9WB 4LBAA 5EBGA 3D50A 3P11H 4OT1H 2YXMA 3OAYH 5HHME 1DSWA 4UV4L 3QEQE 3N0PB 5JPNB 1VEPA 1CLOL 2H6PA 2IWEA 3KJ6H 1DUZA 1INQB 4WUUA 4MYWB 3KLQA 2SODB 3UMNA 4HS6B 4M93C 3VJ6A 3EG9B 1TQCC 2P7TB 3F6LA 4LAJH 8PAZA 3BWAA 3DURA 5I5RA 1P1VA 2AV7B 3WFEL 4Z95L 4HXBH 1HAWA 4MFHA 3EYQD 1AZNA 3TLRA 1MI5E 2X41A 1RI8A 1JHTB 1JL8A 4OF8A 1T2QH 4IJTA 4L37A 1Y0LB 3K2UL 1DDHA 4BM7A 5BW7A 3OZLA 4NGHH 3HR6A 2OQJA 2YD8A 4BSWB 2O26U 3B2PA 1QRNB 4LIQH 5GRYA 3OAZK 2AI0H 2XWZA 4LEXH 5FDWB 3VFMA 5IB4B 5KVMC 2J1ZA 3V4VH 4NBYB 4IGBB 3KPTA 1J0HA 1YDPA 1CICD 4HBCL 2IWFA 4G83A 1MH5A 1KYOK 4AGMA 3TA4D 4K5NA 4QLRA 1T6VN 4G1EA 1KZQA 1B9ZA 4Q0XL 1HU8A 2H2SC 3WJJC 2Q1EA 3BGFC 4YBQC 5C07E 1HQRA 5ALCL 1EERB 5JHBA 3EYUL 1TKWB 3WMSA 5CFHA 2UXFA 3FT9A 3R1GH 3MOBL 3FU7B 3M07A 3HPJB 4N2HA 1BA9A 1UB5B 2OZ4A 4K7PX 3QCUH 2QGEA 3LH2L 5I17B 3OKLA 4JMNA 5K1JA 2FATH 1ADWA 3TTYA 3QJQB 2F53D 5ISZE 1THCA 2GBVA 4J3WA 5F0JB 2LLGA 5J12C 2W0FA 2WQRA 2P1YA 1CE1L 4ZXBD 4HV8B 3BW9B 4YEFA 2GHZA 1KCRL 3R7RA 3A4AA 4BQBA 1MVUA 3K74B 3CFUA 4WW1B 4DEPB 2XJKA 3CXFA 4OFIA 4A7SA 3ULVE 4FG6C 4DW2H 2XG5A 3LPFA 1EJOH 5GRUL 2WWNA 1NDTA 4OZFA 4X9HA 4ALAC 1ZTMA 1ZHKA 3QCTL 4KZEH 2BO0A 2YEQA 4CADB 4IMLA 4PYGA 4NZTL 3GGWB 5IFAL 4H4NA 2OMXB 4J4PA 2P47B 1RK1A 2ZKHL 4NKOB 2PR9A 1CLZH 3QNXA 4HP5A 4Y4KB 5EIVA 3IE9A 4HCRH 3VWKA 4QTHB 4OGQC 1BOGB 3OWRA 3FMGH 3UTSD 3UBFA 3A47A 3Q01A 1OCWL 3GSUA 5IOKA 3T0EE 2OLDA 4IK7A 4PB9L 3TO2B 5JDJA 4ORGA 1FVEA 2HG5A 2HN7B 4U1JA 5A16B 2JQMA 2GTZB 2EABA 4HIPA 3MR9B 2WGNB 4JR9L 4OQTL 2P52A 4HUWB 4ZDHB 1W8EA 1JGEA 3S6CA 1CFSB 3UYOD 1MCPH 1KGUA 3LXCA 4EPSA 4LK4A 1M05A 3ZBMA 3EHBC 1S5HA 1HZLA 4IOFD 3TCLA 1KBWA 4NJAL 3VFVA 5BRZE 4AJYV 1NANI 4LSRL 4DUVA 4ELMA 3QS2A 1UXSB 3II2A 2BY2A 5KJ7E 1DVYA 5E6UB 1JK9B 1TQBC 3HHSA 1ZHLA 3RGVA 3BGMB 3EH4B 1K6QL 1TJGL 1CZ8L 4PJHB 3MTXA 1DJYA 5GRJH 4KI1A 3PF2A 3UDWA 3ZLQC 4DGVH 2R2EB 2Y0SA 3WGUB 3FSWA 4JQIA 3ZDXB 1HEZA 5AWNH 1N64L 2VN7A 3ZL1A 3R4DA 2H6UA 4JDTH 5GS1C 2EIDA 3CFKB 3TF7C 4KTEL 4IGBD 1WD9A 4PRAA 3VDCA 2BJMH 3T0DA 1T04B 1NGXB 4R4FL 3RWCA 4NN5B 4TUOB 1DLFH 4DZBA 4I5BB 1JZ2A 4XPGH 1A6VH 4P05A 4XH2A 1D5XA 1P4IH 1A3RL 2AJVL 2FL5B 2DIBA 5DJXB 5I26A 2VDPH 4JCWA 3L4YA 4PGEB 4L4JA 3L6FA 5M95B 4JM4L 4X4XA 4RSVA 3UG3A 1PZSA 4AM0A 3VXMB 1URZA 3P3SA 5T3ZL 4BJLA 4YVUA 4E9SA 4NXSA 3AB0B 2CXKA 1UH4A 3FCTA 5F1IA 4KJPD 1I85C 5I2IB 5ABAA 3N2JA 1AOHA 2K78A 5E4AA 4Y4FB 5HI5C 4PPTA 2VSDA 1A0QL 1SFDA 2ZX7A 3U0TB 3U2SA 4KHTL 4MXWH 5HSFA 2VLJE 5AZEL 3P3YA 2VRQA 2BIPA 3SDCB 4NFBA 3HAEB 1N10A 2GG1A 3KBFA 2V2TB 3RZCA 2BHUA 4WEEA 4YOKA 2J5WA 1ETJA 3UAAA 5DMGC 3PJSA 3SDYL 3I3DA 4W9EC 4ZS7L 5FFOA 5A2LH 1CD1A 1RPQA 4TTDD 2VMFA 5E2VL 4EI5B 2ESVA 3DJ9A 3ZTNH 4K8RL 3RI5K 3LTVA 4MAYA 3LD8B 4HC1A 3F5WB 2EVHA 1U95B 3IGFA 4XBMA 4NYLB 1OY3B 2CO6B 4Y4KD 5GGTL 1UATA 4R84A 2D7QA 3SE8H 4J3OC 4PCTA 2AQ1A 1HVXA 2PXYB 3GMPA 4RFNC 3PLYA 4XMKH 4ZK8A 4JE0A 4AVKA 4WSGA 3D85B 3CCHA 3NIFB 4A37A 2A2QT 3PNWA 3VYPA 5E1AA 4AYID 3DX4A 4FLRA 5EC2A 2Q76B 4NO0B 1KBKA 1E4XL 1KY6A 3QDJA 4O02B 1TVHA 3O2VH 5CU9A 3AG3B 1WK0A 1EO8H 1N59A 2F8OA 2XPZA 4YNYA 5AOZA 1X7QB 4P2RB 5C0CE 3BPOC 3O6FB 3DKHA 3P30L 5JMRA 4B3VA 1MJJB 3BAKA 4IRSA 4PS3A 1UFGA 3L4CA 4HPOL 4N2MA 1LWHA 1KIPB 2VLRA 2VQTA 3MRQB 1JZ4A 1PZ5A 3NZSA 1JYNA 2CWRA 4QGYA 3FSZA 2OXGA 1WFUA 4WUKH 4X4MA 3ZE1B 1K8DB 3O11B 3FN3A 4JHUA 5D6CB 1KCSL 4PJFE 2IV8A 1EAQA 3ZDZB 3L1OH 4NZRH 2A5UA 3T0VA 5DT1H 1WBXA 1YAZA 2R69L 3SODB 1V7NH 2NR6C 4AE0A 2MPAH 4FP8H 1U6AH 4WK2B 4ZYKA 2B0SH 3O8XA 1OB0A 1YPZF 1W2KT 4B9KC 4BHUI 5HYEA 4PJCB 4MRBA 2HTLC 5KYUB 3O9WA 1U8PA 2JB6A 5HXMA 1YEFH 4AGNA 2HFFA 4M1CD 4YPGA 2FGZA 1HSAB 1FLRH 3V4PH 4XCEA 2DQIL 3NAAH 5K9JL 3PP3K 5H94B 3QUMB 4YUEH 3K6SB 5AKVA 2DLFH 1NCDL 2VSKB 4LVOB 3CZLA 3VXMD 1OD9A 1J05A 1UWEH 4W81A 3AXLB 1FUNA 3NRPA 1SXNA 2DJMA 2E4FA 2VB5A 1YMHB 1GCFA 5SWZE 4PJBA 3V5HB 4Y4FD 1ZT4B 1PQZB 2B1AH 4YDIH 1HILB 5E8DH 2P49B 4LMQE 5FUZL 5EPMA 5IOPA 3BEVA 5DJ8B 4XVTL 3GI9L 3QYCA 2OK0H 1GJWA 3K5SA 3SDCD 3IJEA 4G70B 2WQWA 1ZDSA 3NCCB 4BFNA 2TSAA 5EIQA 2WZPD 2YD6A 2A83A 4AGQA 1DQKA 1RPKA 1CQYA 1N19A 3KLDA 4EE2A 2V7HB 3O4LE 5CJOH 3UPRB 2EECA 1YECH 2V2XB 2PW1A 1BD2B 3U7AA 2FJGB 4S1SL 1D6VH 5EUOF 1FFRA 4NQDA 1JF5A 5ID0A 3FQ1A 5KYWA 4FZEL 4TXVB 5IM7B 5IQNA 1OO2A 4QJ4B 3RWGB 1KCBA 1E9QB 3KLSA 1KCLA 5D96C 5I6XB 4OGAD 3RWHA 2VC2B 2DWXA 3D85D 4YWGL 2XTJC 3UCRA 4PJIF 3TV8A 5E6YA 1CXFA 1DE4B 4XWOC 4NO0D 3GJEA 1JF1A 2N7BA 2CQVA 1IE5A 3QEHB 5T1MB 4N24A 1H5BA 2Y2WA 2NOYA 3EUUA 1BQLH 3HN3A 1MW1A 1AG6A 2OMNA 3T04D 4QEGA 3BUYA 4P9HH 3TPUA 4Y4HC 3O6FD 5HI3D 15C8H 3ZE2E 1UACH 2NY4D 1A8JH 4KVNL 4A2FA 2AITA 4ZTPL 4ZNEE 2C9XA 3HS0C 5KS9F 2A0LD 1DANU 2BVPB 4PJ7A 2VXTH 1WG3A 2RHEA 4Z7VB 1EXHA 1MPAH 4WCYH 4YHIB 2JJUA 5F7EH 2VYRE 1SOKA 4F9PA 5DZ9A 1Z0NA 5E1HB 5T1JA 3RX5A 5B1CA 1T1WA 1M6OA 1SMAA 1X7TA 4IU3B 1DVFB 2A3TA 2NUTB 3QXUA 3W5NA 5F97E 3QXWA 2F15A 4QHMA 4U1HA 5IBLD 1HNYA 4U1NB 3KM2A 4KKCC 3ZTJG 4AZUA 4LAQH 2E7CA 3VFUB 3AADB 1I8UA 4ZQKB 3L7EA 2OSWA 3SBWA 2E56A 1K5NB 1Y1DA 5DURB 1TTGA 4AYEC 1J8KA 3L4WA 3DVGB 4RMUA 3WFHB 4G72B 4C55A 2ADJB 1PKQE 4OZFH 1WEJL 2GKIA 4LRIA 4ENEC 3MN8A 4U1GC 3UPAA 5B38B 3H4FA 3BXNA 2UUDK 3U7WL 2CGRH 1ZVYA 3EFFA 1JMZA 5KBDA 1P69B 4HZLA 4X8JB 5IG7B 1DJSA 1RULL 2X89D 3FU5A 4HUNB 5DJDA 3FQRA 3S4SB 2CMRL 3TEXA 3IRCA 4M8UA 5DJZB 3IDGB 1R3IL 2WXIA 2WNGA 5I0ZA 1XCTB 2XZZA 2G2PA 1QKZH 1TEFA 2CE6A 5MENA 3T0XA 5LKNA 3E2HC 4Y1SA 4GO9A 2DZEA 4ZMOA 1WWAX 1TNNA 2QJDA 3CDFA 5AB1A 1P1ZB 2HRPL 3LRKA 4IBLT 3TT1L 1IILE 3HRPA 1A14L 1HC1A 1U42A 2A6DB 2CJ3A 3QJUB 1TPXC 4L3CB 4NZUL 3SDXF 1O7VA 3JV5A 2EDRA 3NFPA 4ABQA 5LG6A 5I15L 1WYJA 1BD2D 2XA8L 3DYPA 2X4TB 4QRSB 2VZOA 5D6DA 4CSTA 1G5AA 2IQAA 3TT3H 3ZW3A 2MCAA 5FYKL 1YEKH 3WIFA 3SEPA 2ENJA 3FO9A 3FOLA 4F8OA 3HE7C 1ZLVK 3WLBB 4A7VA 4U3SB 3EYVA 1U8OA 4FI7A 4TNVF 3TIEB 3UH8A 2MHAB 4YHLH 3CPLA 1FV1B 1LP9F 1L9NA 2H1PH 1N0XL 2DQTH 4JQIH 2HT3C 1MCFA 4LKXA 3ZXAC 3MJ9A 4LCWE 4KUZH 4K73A 3SE3A 1ETA1 3BD4A 3KW7A 1MFAH 2NY2C 5TE4L 1QI3A 3SGDH 3DC0A 2APTA 2P80A 3FT4A 3VGAC 4PUBH 5CZKA 3IJ7A 3C5JA 3VM7A 5HDWA 1ORSB 4FJ6A 2JXMB 3V4UH 4F2EA 4EN3B 2Z1KA 3AG1B 3S97C 5CWSB 4MJ5B 4HJJH 3SBQA 4HJ1A 1UD6A 3IFLL 4WW2F 4ZMVA 4OI8A 1JGLH 3C08L 3ESPA 3KS0H 3RA7H 1LO0L 4YHPB 1U8HA 3D2TA 4WKZA 5E2WH 3CWGA 1XGQA 2P8MA 2VDMH 3G08B 4GUPA 3AZUA 3LEXB 2M1KA 3EBGA 3EH3B 3G6JE 4NQEE 5L6YL 1T21A 3BCFA 4IOIB 1JPSH 1WS7A 4Z0XA 3WI9A 1KMGA 3CZFB 4HG4J 4R7XA 3SE4C 3CBKB 3GMRB 4OLUL 5JXAH 2PYEE 3C8KB 3ROLB 2D31A 1HH6A 2CXGA 2ZYSA 5KVDL 1A02N 1MCQA 4FJYA 3HZKA 4U7SA 3K2IA 5TF1H 1SVZA 1VFBB 2IDQA 4GAJH 4HC1H 5E8EB 1QUPA 3LKOB 2WLLA 2DQGL 2F58H 2I07B 4FNPA 3US0A 4HAFA 5G4NA 2ZSVA 3KLHD 3NVQA 2FIKA 3QXDA 4FG4A 2GI7A 1R47A 3CLFH 1UADC 2BOBA 5AVSB 2MPVA 1OT4A 4UAOC 4LCCA 1U8MB 3NJNA 3SKJH 5ITFA 5ESQA 3JV6A 1JK8B 5IQ7H 1CG9B 1E4WH 1MCDA 3ULVC 1VJSA 3C12A 1RZ8B 3CHOA 4YAQA 3LIUA 3J2PA 4W9ZA 1FO0H 3ZYIA 3VXOB 5E2TL 3CZKA 1KEMH 1XT5A 5MEOA 2J8OA 5FB8A 3I9GL 2A6IB 3BE1L 3VXRE 4L3EA 3GKWH 4G8AC 3VCLB 3X1NA 5IY5B 3LKNB 5AYUH 3OHXC 4ZAKA 5EZLB 1MIEH 2Y1YA 2QMKA 4JFEE 4NSKA 3UC0H 1ZV2A 3HBQA 5KYXB 5D5MF 1DBMH 4DETA 4E5XG 1UKSA 3T6XA 4YDJA 1ASOA 2MTPA 3BD3A 1MF2L 5HHQB 2BIQA 5L4MA 4U0RC 4IKJA 5CN2A 3N44F 4DEUA 2FBRA 1Z1WA 2BSTA 3DSFL 4ES8A 4Y16B 4PVBA 4LFHD 4M62L 5SV3A 3T0EC 2QGDA 4PD4J 5C09D 4QCIB 1E27A 1UM4H 4AZ8A 1VZGA 1S7TA 5C6TH 4XMLH 1JHKL 4D8PB 2EEFA 3EDFA 4A6YL 1M7IA 3MRHA 4KKBC 4J1UB 2W94A 1E8ZA 1GMEA 1L6XA 2W0KA 5F1NA 4LHUB 4PJDE 4Z18A 2H4EA 2GUYA 3VXSE 4OD2B 4P9ML 3GI8H 3UX9B 5IQ9B 3MV11 4KVPA 3T0AA 4JN1H 2B77A 4E41A 3MV7B 5I1IH 1MLBA 2PCXA 4JVUA 1NGQL 3OAUL 4Y19B 3W0WE 5I1EH 4V1DA 3GLZA 3H3BC 4GG6B 1SEQL 1GZHC 1T1ZB 5JW5B 2JKRM 1JZ3A 4EN3D 4UIKL 3KWWB 1UB6B 3ISWA 3ARBB 3TWCL 2AFNA 4BSVA 1QSEB 3CVIL 5E1IA 3NGBB 1BZOA 4KY2A 3RWJA 3MACH 4L8CA 4OI7A 3I6KA 3P3TA 2A74B 4Z76A 3HI1B 4M5YH 5HHNB 2FYVA 4IDJL 2X9YA 4Z3IA 2DLEA 1UWXH 2IGFH 3UTTA 4XCNA 2OPCA 3S3CB 1JI1A 4NHUA 4OCXH 4RISH 4W9DC 3TO4A 3RWFB 2X10A 1JWMA 4ZX6A 3X1GA 4EOWH 4F8TA 3VXNA 5IROC 3ZGHA 1R3HB 4UCFA 4LP8A 4B9JA 3DV6A 2GIXA 2WQAA 2ZXCA 4IRZA 4GFXA 5JIPA 1YUHB 1OW0C 1WH0A 2EIKB 4Z7AA 1RUAH 1UWFA 3IGAA 3KWTA 5CU5A 2WXNA 3VH8G 2IPUG 3KR3L 4G42B 2YAQA 3MLSL 4I3SH 3QUZA 4U1IA 3WU1A 2LLLA 2K4WA 1MFEH 4NCC1 1R5WA 3E6HA 4ZO8A 5B8CC 5E6IB 3MUGB 3MLTB 3OXSA 5DVOA 5SX4I 4B95C 1CL7I 4HJGB 4WHYH 5AW1B 5F8QC 3ZDXF 4L3AA 1UCTA 5IESL 1IAIM 3ULAB 4NN7B 3H0TA 3VE0B 2AEOA 4HUXA 3B34A 4LMQI 4TL5A 1J48A 2Y25A 4M61B 1C5DA 1QW9A 2MJWA 5LDUA 1JZFA 1P5UA 1YN6B 4Z7IA 3KYOA 1U8IB 3MLZL 4A2HA 3BP4B 3HRZA 4NCC2 4MCYB 2ITDA 5C8JB 3DX7A 1KXTB 2BFGA 1IE4A 1LM8V 1JPGB 2BNQE 3GSNB 4IOSD 2WLNA 1DJHA 2C9QA 4QHNA 3SPCA 1A6ZB 2YD3A 3H9SB 3QHZL 3CFTA 1DANT 3WNOA 5IBTH 1NBVH 3DVNB 3H56A 5FGCE 5FO8A 1DEEA 3QO1A 1CGTA 2C3GA 2XWJA 3Q8BA 3KL3A 1W0VA 2E8YA 4YC2B 1DFBH 1NPNA 43CAA 4DKFH 4F24A 4YXLL 5IB2A 4Y16D 4OLWH 1YEJL 2I9LA 5DC0A 2UXTA 4QXVA 1AZCA 4N3UA 3BUPA 5CBAB 5DQDH 4ODWB 5A6IA 2DIEA 2YFNA 2KQNA 1G7HA 4FEMA 1MCKA 2EAEA 5AVYB 2Y4SA 5T3XH 3ARFC 3JWNE 3FT3A 2H32B 4ZUUA 5I75B 1FNGA 1AG0A 2JKLA 3NACL 4K71B 3DX8B 1JF6A 2JJSC 4APQA 2MOVA 2SEBA 2OTWA 4I3RL 4O9HL 4Y5YA 3VAEA 3MLWH 2QQKL 5L2KB 4Y19D 4OAWB 1SY6L 4CKVX 5FAAA 2YAHA 3INUL 4D9QD 3VI3A 2EE3A 4BRVA 2ORBH 3OVUB 4HISA 1S7XB 5IBUB 3TBTA 1AIFB 2AXJA 3QHFL 4K5OA 1XB3A 2F5AL 4UBDD 3OSKA 3ARBD 3MLRH 4WTXA 3OKNA 4OCYH 3CFMA 5DJ0B 1L7IL 1QSED 1U21A 5FKPA 5CCKH 1I7TB 1ZCRA 1XTLA 4QF1A 1H3PL 1QSFE 4F7PB 4FG2A 2UYLB 3AROA 3KH4A 1G1KA 4TVPD 1PAMA 2VM9A 2WCSA 5FGBC 3KLAA 1BZEA 1OT1A 3HLKA 1B3IA 5F3HB 3KPOB 3SCMA 2YKKA 3T4YB 1UXWB 5DRNB 4OSUL 4D0DB 4YLBA 4GBXC 1IGFL 2WLMA 1EFXB 2IFGA 2BVUA 2DQJH 1F4XL 2ADIB 4BKTC 3LH8A 1U8CB 2ZPKL 3NYKA 4GSDL 4M7KL 5D1XC 4AJWA 5I8OH 1MQ8A 2AJ3B 4JY5L 3VFWA 4WHTA 5HHXL 3K72A 3DTXB 1QO3B 4MS8C 2H47C 3CC5A 5F1SA 2X4UB 3BIAX 4OGZA 4TLKA 1SOXA 5CSZB 3ZE1F 3SHSA 5I1HL 3DVIA 4JPIB 3P4OA 3VUAA 4QI3A 4KK8C 5AOKA 5DJCB 1NGYB 4L4TB 5CHNA 4M6NL 3IPEA 1WA1X 4I48B 5E6ID 1RSYA 5IF0A 3FF7A 3QJRB 4OGYL 5JUEL 2C4XA 4ZOBA 1BOYA 1OP3H 3X1EA 5A6MA 5HY9B 3D69B 1YVLA 4F57H 1MAKA 3N85H 4OQTA 1U3HB 3MJ9H 3WUWB 4IJ3B 4HK3J 4HSCX 1RU9H 3UGEA 2IAMA 1JXGA 2AP2A 2YPKA 2IWKA 4FNSA 4KTGA 3QJZA 3LQZA 3WO4C 1KJ2L 1F3DJ 1L9PA 2EXYD 4UZGA 1PKOA 4YX2H 4G8GB 1QEXA 1J5DA 5IW6B 4N1CA 2IDUA 3D33A 4G3YH 1MCJA 2B8OT 2CAKA 4HDIA 3BJ91 5DO2C 3H9SD 3VG9B 1ZY9A 2NW3A 5L7XL 4PLJC 3P9MB 3RURA 2CZNA 3HKFA 3D51A 1NEPA 1OK8A 1U92B 5TDOA 2FHFA 3KPSE 1NSNH 4EUPA 3IMUA 4BQ9A 3D2UA 3T6WA 1S7QA 3NFNB 5I6MA 2DJUA 2WXRA 5CP3A 3FU3A 2NNCA 1LHZA 1AQMA 3S3SA 4Y0GA 4PJFF 2BHZA 5JXEC 1SYVB 2XNAB 2NXZC 4OZGA 1Q72H 4QWWC 2EZ0D 3WBDA 4EDWL 4I13B 1PSKL 4X6CE 3IRPX 3E9TA 1NIEA 2BZCA 3ZPDA 1OAJA 1J5CA 4D7PA 4ZD3H 2QTVA 4JJ5B 4GYBA 5T33L 1BFVL 3CH1A 1WIUA 3ABMB 1E6JL 2FB4L 4MDIA 3JWOH 5JHDA 1LEGA 1HSBB 1NC4B 2DAVA 1HK6A 1IFGA 5TQ0L 1ZV9A 2UZIH 3LMJH 1M7DA 2FQGA 3CHRA 3EJSA 3VFSB 3FCGA 4B9CA 4Y5XC 5IUCA 5JR1L 2E7BA 3L3KA 3ZQXA 1U3ZA 5IT2H 3DX9B 4PREB 3SY0A 1KJVA 2R1YB 4L9DA 2QR0B 3C60A 4J3UA 1HS6A 3MJ8A 4A67A 1JVKA 1XSJA 4XPBH 3T8XB 1ZA6A 4QT5A 5F88B 5JYLA 4F5CA 4PGCA 5GXBB 1A4CA 1V54B 4FEIA 1L5GA 3L4ZA 4X6BA 4ERSL 3QR2A 1EXUA 3DPDA 4F7CB 2B59A 1BQ5A 1QFPA 3ZRFC 3VWJD 3O41B 3LRSB 3JTTA 4X6DE 3MRKA 3RUGA 3BAYA 4JVWA 1BVZA 4NN6B 4DP5X 4FQJL 2O5XH 4FHKA 3GEWB 4XPHH 1W80A 2HWZL 4NM8H 3VA6A 4RWYL 4L4TD 3W39B 4X6EB 1XTMA 2R2CA 4NXKA 4I18C 1B6DA 2A1WL 3CDGB 3I9IA 3NBNA 1PLGL 3DUUB 3O2WH 4HT1H 4XODA 1BBJA 3IXTA 3H55A 3WFDH 3KEDA 5A7EA 1P4LA 3L54A 2EUWA 4N90E 1U3HD 2AGJH 3VFOA 2FBJL 4U6VL 4WI6A 1SVCP 4U7KA 3REVB 1L6ZA 3AY4A 2X1QA 3HC4L 2Q7YB 1MQKH 3C6SB 4MNGE 2ZNWA 5HGDA 3I02A 5MP6H 2EDOA 2VDKB 1KLUB 4KZCA 1S9YA 3VD1A 3MXWH 4G8GD 1NCTA 3O6KH 2B3IA 2XPYA 4UT9L 4EF3A 1CS6A 4GS7C 2JTYA 2QSTA 3KPLB 3ZDWA 1BVLB 3ZL4H 1MRCH 2R69A 3UACA 3G04B 3ZE2F 3NTCH 1FCCA 2VERN 2YA1A 4HEPA 3U2IA 5CZVL 1F86A 2AF2A 4FLQA 4U6HA 5CEZE 5AAMC 2DICA 1GJUA 3X3FL 1LWJA 3IDIB 3AU1B 3VGFA 2VO8A 5CEXA 1EEYB 1MZYA 1TJIL 2XQYG 4BFBD 2J55A 5LWYL 3JV4A 1TDQA 4EI0A 4R0LC 5EEVA 3EOBB 4GQRA 4Y9CA 1CFQB 4G1MA 5D2NE 3CN3A 1PF3A 4HD9A 4HJTA 5D7LB 3W11D 1KYOJ 3OMIB 5GRVK 1P4UA 3ZHFA 1CFNB 4XPAL 3CSTA 2GUOB 2X7LA 1GY2A 1HOEA 1QLEB 3ARDD 3JWDL 1HZHH 2AKRB 1NC4D 2XRAH 4OJCA 3HA0A 5F2FA 2XBZA 2VL5B 1MFUA 1BVKB 5ICZB 1MLCB 3VXTB 3RLSA 1H8SA 2AJXL 4ISVB 2O30A 5B39G 3NA9H 4JKPH 2MEJB 5BRQA 5I0DA 2OTUA 3Q3GA 2ICES 3QIWB 3MVSA 1DVZA 2E27L 3GXDA 4HUUA 3GLAA 4MMXB 2R0WH 4JPWL 5DMKB 1OT2A 4XP5H 2O5ZL 1BBDL 5E5MA 1Q0XL 2IALB 2CHNA 3MRJB 4DCQA 5JPMA 1RLBA 3TA3B 3NCWA 4PJ9B 1JYXA 1GIGL 1IBHA 4UV4H 4WDIA 1CLOH 2NLJB 1HCFX 1T1YB 4PRHE 4EO5A 3LQAL 1EDHA 4KO9A 4QOKB 5EO9A 1MHEB 2IANA 3F7LA 2NY0C 3KJ4B 1RZQA 4JW3A 1RMFL 3UJTH 2E7DA 3OG4B 4Z95H 5CD5D 2FRGP 3DIFB 4H0LC 1R5IA 3HEIB 2VABA 2I60L 5F7FA 3GXIA 2MRYA 2Y5EA 3K2UH 4X4KA 4FQXB 1KY7A 2E9IA 2A9ML 4XMZA 3V6BR 3LSOA 3D48R 4TS6A 5DZPA 3TOPA 2NX5B 4UQ2B 4UTBL 4ZW5A 4OLVH 4Q9RL 5I19L 1J0YA 1G9NC 3RPKA 4M4RB 2W5PA 4HBCH 4QRAA 2UWEE 3QDMB 2GTWB 5K39B 4FMVA 1R3KA 4HUCA 1EJFA 1XH3A 3D39E 2GFBA 1AE6L 3WE6A 4ZSOE 2CO7B 2PCPA 1Z3GL 2MIZA 1V5JA 5HHOA 2G5RA 1N26A 1ET5A 2WD0A 2WXJA 5HYQB 3GINA 3FRUA 1ID5I 4XMWA 1JCKA 3U9UA 1WA2X 3WNJA 2QSCL 3LH2H 1NFIA 3N55A 3U36A 1TZ8A 4UDTB 3KPNB 4G9FE 4F80A 4XNQA 1JAEA 4PRNA 3C2SA 2ZTBA 1FYTE 1ZJBA 5T1KD 1I53A 1LEKA 1CE1H 1H15B 2CD0A 4YE4L 2ZUTA 1VACA 5TPWL 1DN0B 3EFDL 2F54A 5DRXB 5FF6A 4KRPB 3F7RA 3ILPA 4Q9BA 4X7DC 3RTQC 3MRBA 4GPVA 3BWUC 2R2HA 5FFGA 3VXUE 3EDJA 4ABVA 5GRUH 3KPPB 3KXFA 1EDQA 2PP9A 3QCTH 1T7XA 2EO1A 4HX1A 2I26N 3K2KA 5AW8B 5ACZA 4HCGA 1FRGL 3MFGB 2YPLB 1TCRB 4PBWD 5D7LD 4TQPA 5IFAH 5D7SL 3WSQL 2GJ6B 3KBPA 3FFDB 2QL1A 2ZKHH 1DVSA 4ZMZA 3B6SB 5I66B 4YSEA 4X8CA 1VFAA 3PQYB 1N4XL 1NIFA 3RY4A 4YHOH 1RIVL 4MNHB 4RH4A 3SDAC 2GCYA 1RZIB 3OLEA 1FZKA 1C12A 3FONA 1T6BX 1ZT1A 1OCWH 3MGTA 1JPTL 3SJVB 1BV8A 5DHXB 3BLPX 4ANVA 5DRZA 4R7NB 3QIWD 5E0QA 4P2OB 4PB9H 4MYPA 2FYYB 2DM7A 3QDAA 4URKA 4OGXL 3KCPB 3EH5B 4AIEA 4ESKA 3ZSSA 2Q3AA 2WVVA 2HMID 3QI9B 4OQTH 3JUZA 3QWQB 4PJ9D 4RGNE 1XGPA 3TA3D 3LNFA 4YHZL 5AYTA 3MXVL 3IETA 12E8H 4JRXD 3RX9A 4NJAH 3K8LA 5D9SA 2BRRL 3OX8A 4QOKD 4LSRH 4UDUB 4DHLA 4X6FB 1I8IB 5FV2A 5C08E 2PO6B 3CLWA 4BQCA 1FF5A 4Y1AB 3Q6FB 2WXHA 1CZ8H 1LTXA 4NKDA 2W91A 3NJXA 4V2BA 1WVZA 3HMWL 4IKKA 5ADPH 3DA0A 4I2XE 4JFQB 3X14A 2O93L 5KOMC 2VN3A 3TL5A 3DBSA 4LLQA 5CP3H 2F1AA 2WANA 2HJFB 1GCYA 1N64H 4CU7A 4OTXL 5GSVB 2NX5D 3OB8A 3FSOA 5JO5B 2ADGA 4KTEH 4LPTA 1J8HB 2WN3A 2MCMA 3ZRCC 2ID5A 1ZE3H 4JG0L 4K7FB 3SPGA 3QDMD 4R4FH 3GSRB 4G8IB 1IC1A 1RV6X 4IM8A 4AH2B 4QRUB 2OSLA 4L2LA 5E9AA 1WAEA 1QZNA 4XN7A 1XGRA 4WO4C 2EDBA 1TYJA 5SWSD 3MRGB 4FFWD 1UOWA 4JFFB 1ID2A 4APXA 2GSIA 2OMUB 3HMXA 3WJJA 4YQXL 1NA8A 4PJDF 5FW6A 1YAIA 1RJLA 3UG5A 5GZOC 1EZVY 3B8SA 5J0BA 1ZA3B 2ITFA 1QR4A 2Y6SC 1ED3B 5B38G 3H9YA 3MRPB 4YHNB 2YS4A 4L05A 5KJRL 1NFDA 2OYLA 5IW1B 1KCUH 3SQBB 2AQTA 3JWNC 3IYLW 4LGRB 4POZC 5B4MD 2ADYA 5DC9B 4XB7A 1NH6A 3OGCA 4KRPD 5AZEH 4F7TB 3BESR 1HFUA 2FT6A 2VMJA 5I74B 3DJTA 4C56E 1PPIA 3Q9QA 4F2MA 1YEEL 2PCFB 3SDYH 2BC4B 3OF6A 1C16B 4GKZA 5TK2A 1JWUB 5E2VH 3V9FA 4ZJ9A 4K8RH 2YPLD 3G6DL 3S5LG 1S9VA 3QXAB 2AABL 1JGVL 1ZLUH 2LU7A 1HT6A 1PZCA 3GPSA 4ODHH 4ZW7A 5GGTH 5IJKC 1EVUA 3PQYD 5DTFB 4N0FB 1RJCA 2VDPB 2WWMD 5D7EA 3T3MB 2C26A 5HYSB 5ID1A 5AVWB 3K80A 2VR3A 2C1OB 3O0RL 1WFOA 3SJVD 1TVDA 1UD2A 3E7JA 1D5ZB 1LLAA 3PJNA 3ZO9A 2WLIA 2W07B 4UMGA 4JN2B 1BEYL 1QNIA 1A65A 3A4EA 5CBEA 3GMNB 5C71A 2BWIA 2XG4B 3QI9D 4PRIE 4WU5B 5A3ID 2ODIA 3P30H 1SDDA 1QFUL 2K6ZA 2VDLL 3MGOB 4N2LA 3D3VE 4JEGB 2ZOKA 1TOXA 4HPOH 5J3HD 2BXZA 3V7AE 2BY3A 1HINL 1HCZA 1UD3A 2JK5B 2O4EA 4MS6A 4RFOL 5J8OA 2QDWA 3CMOL 5SWQA 4ZFGL 2PO6D 1HL4A 1IQDB 1KCSH 4LSPL 4OF5A 4Y1AD 4ZFFA 3NN8B 3D34A 3FQ2A 2DEWX 2VSCA 1S7UA 3QDGD 1PEZA 5ITBL 2R69H 4OF3A 5CINL 4HHGA 3ZQWA 2ZXDA 4DGUA 4YSSA 4IQHA 1FVCA 4FX5A 4N5UA 2CCWA 3IE4A 5JORB 2XY1A 4N85A 5KWYC 2XLLA 4LPUA 2WUBL 4YDKH 2VGLM 4OZIE 1J8HD 2K4AA 3HG1A 2A4ZA 2W1NA 2Z3FA 4IKIA 1ZXQA 4J12A 1DBAL 3RNKA 4N26A 5GS1A 4Q6IB 1QPKA 3N42F 4R2GB 2MSPA 2R4RH 2WAQA 2DQIH 2ZOTA 4PTUB 5K9JH 2RALA 4PV8B 5D7JC 2NW2B 5ACMA 1JYVA 1OAXL 5DUPL 4OZHB 5JHAA 4JFFD 2AQ3A 3HR5B 5F89A 1NCDH 4YDZA 3V6FB 2ICWB 3BVTA 3L5WB 4PIRF 1NCCL 1YPZA 2HH0L 4PS7A 5I1LB 1WP6A 2GYSA 1E50A 4P2QB 2JCCB 1OP4A 5DDHB 3UAJC 2YPVL 4HIEA 1LE9B 1L7TH 2X4SB 4PBDA 4PJAA 3NA4A 5TJWK 2UX6A 4KRNA 4UV7L 2HLAA 3EXLA 4M1DH 3QPKA 1FFPA 3LY6A 5CZXD 5EZJB 1A4KB 2DIAA 3B9KA 1D5RA 4FQ2L 4UNUA 1I85A 3GI9H 4YZFE 5HPOA 1AD9B 2HJKA 2RGSA 2DKSA 1YN7B 4XNYH 1QUNA 3QNYA 1Q1PA 4HMDA 1TZGL 4HIJB 2FX8L 4RNRA 4XTRD 3P1VA 4R4NC 5E9DB 3S2AA 3BVXA 5A2KH 2IOIA 3O81A 3IN0A 2FT7A 2FR4A 3DSNA 4BINA 1KN2L 2X4PA 2R0LL 4L4VB 4M7ZB 1E8XA 4S1SH 2YWYA 5C2UB 3HJEA 4A2MA 4AKOA 1FNHA 1G9HA 3CFQA 4RMTA 3S3DB 3V4PB 2YD7A 4HAGA 2I9TA 5AOJA 3MLVH 2QKSA 5FR3A 1GSMA 1WZLA 2WKOF 1I3RB 3PWNB 1B6UA 4EZJA 3DRTB 1ODAA 3VM5A 5ANMA 4OIBA 4BKSC 5AZUA 5D1QE 3LJ3A 3QIUA 1F3JB 5DK2A 4D9LL 3MRIB 1ECYA 4Y5VB 4PYHA 1BJMA 2Q8AL 4E5XA 2R23B 2PWEA 4AGOA 3MRDA 2JIXB 3DXAA 2A77L 1OALA 2K8MA 2WK2A 4U2YA 4KK9C 3IAGC 5EUOA 1PYWB 1B2YA 2KC0A 2WZ5A 2JH2A 4KVNH 1M71B 1Q94B 4LHUG 2R7EA 1QRKA 4TQHA 3RX7A 2K3HA 3CNKA 4DO6A 1SXAA 2HTKC 4KWUA 1E42A 4JK0D 3JUYA 5B7EA 4Z3GA 1OAZL 3ZYJA 3T77A 5HHPA 5DGRA 4GXVL 4PJIA 3CVBA 4I0KA 1DUZB 4WUUB 5DFAA 5D4QA 2FO4A 1TCMA 2WPGA 3VJ6B 2PABA 5AW2B 4AM0Q 3WDJA 1F11A 1M3IA 2GC7C 3BWAB 3DURB 5IVXE 5C0RH 1PY9A 3W9DA 1GC1L 4JDZA 2ZICA 3ZGIA 3IWUA 5E9NA 3JSSA 3QQDA 3FYIB 3U0WL 1AIZA 3ZR6A 3R4RA 4L37B 3FQWA 4BGLA 1Q90A 2B5IB 1G7MA 1F4HA 2NR6A 5ICYA 3OR7A 5C0DA 1Z7JA 5GS2D 1IMHC 4KX8A 3LIZL 5GISL 3VFMB 2GSMB 4QDGA 3BEWA 3HZMA 1LQSR 1YDPB 3AT8A 4K3EL 3B2DC 2DY2A 2QQQA 5FXCH 2KDGA 2DLIA 1MH5B 5DZAA 2XVBA 4G1EB 3U7WH 3DYMA 3SPIA 2Z93A 5JW4R 4KOCA 3ABGA 1D7FA 3ZHLA 3X1FA 4X6CF 2M83A 1RULH 4RWHA 5E8OB 1HQRB 2J20A 3WXWL 1UT1A 4RSYA 5DUML 1RXLA 2QDVA 4P2QD 1CK0L 5K9QI 5EBMA 1R3IH 5BV7C 1NC2A 4AV5A 4WFED 5F3BA 1F4YH 5I8KL 3T5WA 4EKJA 3OKLB 2YOAA 3DOIA 1J1XL 2W0FB 2VO5A 1G94A 4GLRI 4QUOA 1JYWA 3L5IA 4Z5RA 3TT1H 5D2NC 1W0WA 4HCIA 1A14H 2VRAA 4NZUH 1CURA 1MVUB 2JJWA 3GHBL 5I15H 2XA8H 1X4ZA 1YMME 2XG5B 4L4VD 1JTTA 4NRZA 3ZZLA 3NEOA 4OZFB 3VD9A 5FYKH 1ZHKB 4NPJA 2ZF9A 2R9HC 4IMLB 2VZVA 1UVQA 4KPHH 4PH8A 4TYUA 2EYTA 3GJFK 4M8VA 4JAMA 1RK1B 2CJSA 4K23L 3QNXB 2WV3A 1GGBL 1U3YA 4FOMA 1J5HA 1N0XH 1VAHA 3SDXA 1ZXKA 2EVGA 1TSHA 1P6AB 1YJDL 5H37G 3SDDD 3TBSA 2Q7AA 5AFAA 3GSUB 2EE0A 2JIXD 4RX4A 5D7IE 2HP4A 2CHWA 4OZ4A 4U6YA 1FG2A 5TE4H 1F1AA 1KJ2A 1CICC 1FVEB 2HG5B 3BUDA 4U1JB 4M43H 1N8OE 1HL8A 4KJWD 1G9NL 2DBJA 2ZNXA 4TF4A 2CDEB 4GQ9H 1JGEB 4WEBH 4Y4HA 4BWTA 2FHBA 1M05B 1LP9A 1WISA 1S5HB 2QQLH 3TCLB 3AXIA 4FADA 3VFVB 5JTWA 3HS0A 3IFLH 3ESNA 4TVPL 2R15A 1GYCA 4ELMB 3C08H 5J1TC 2ZUQC 1LO0H 4IS6A 5IBUG 1Z9LA 3HHSB 5FIEA 1ZHLB 3RGVB 1XF4A 3LQMA 3WAJA 2QPUA 3OZKA 4Q6YA 3KYAA 2Z4QA 4H44C 4KJQC 4NZ8A 5L6YH 3KVQA 1CPUA 3QWRD 4ZXBC 3KGUA 3H53A 3L3IA 1J88A 3C6LC 5GRZA 2FX9H 3B43A 4KO7A 2GHWB 1MCWM 4OLUH 4R8WL 2MCPH 4GSUA 5DUBA 4MXVE 3QBTB 2LV4A 2VLLA 4PRAB 3I9AA 5DO8A 2XWDA 1BZ8A 4UWQB 3DETC 3NUKA 4XVSL 5DZNA 1FCGA 3RWCB 4ZFOL 4KQ4L 1JNLH 1IC4L 4PRBA 3S36L 1MCHA 1FWXA 4ALAH 1Z5HA 3JZ7A 4XH2B 1D5XB 3HB3C 4PWFA 5IR1A 2X42A 2BY1A 3VMPA 3O6ML 2XKSA 1I8LC 1X9RA 2QTEA 4EZMA 5F9OL 3W2DL 3L6FB 5TE6L 4X4XB 4AM0B 4QRPA 5JIDA 3PXHA 2Y7LA 3NJHA 3GZPA 1ZSDA 5B1JC 1MNUH 3FCTB 3OAZH 3FT1A 1GHFL 5BS0E 1R24A 1LO3L 2HJLA 5C09E 5EUKA 3AMLA 2XYBA 4EIZC 4JE4B 1USQA 2VDMB 5E2TH 3KVDD 3ULUF 3NQKA 3GSNL 3U2SB 5I1CL 2YAOA 4XNBA 3WNMA 4QYAA 5FLVA 1BCIA 3BE1H 4ZMYA 2BW5A 4GMSL 3WUWG 3PWLA 3TFKD 4FTVB 2FBOJ 4NUPA 2CDFB 1J9RA 1KC5H 3QFJE 4JKMA 3RZCB 1MW3A 3PJSB 1GGUA 1EHLL 2YBRA 3H54A 1CD1B 3QAZC 4AENA 4BYHA 4AYSA 1KYAA 2ESVB 4LPYA 1MF2H 4Q9QH 4CU6A 6FABL 1HHGA 2DMGA 2VLMD 4MAYB 6FABH 1VGKA 3EJZD 3HLAA 3M45A 2J71A 4M62H 1RUQL 4N4YB 4AWJC 2CUHA 2ZCLL 4G7SB 1W8NA 3HE7A 2G2RA 1JHKH 1PCXA 3OSVA 3QQ4A 4A6YH 5LNDA 1H3TA 4E9VA 3GMPB 1DJGA 1EDYA 1F13A 2ZX6A 4PWKA 4RGNC 1WFIA 2WKLA 3CCHB 4A04A 2P5EE 4MQ7A 4YK4B 4FLSA 5E1AB 2YRLA 4P9MH 5EC2B 2PTUA 4KFZC 3GBML 4YHML 3M8OL 5D5MA 4UNTA 2VXVL 3QDJB 5F0PB 1TVHB 1FZOA 3QPXL 3F01A 5B1BB 3QEQA 2ICWI 1NGQH 2O6EA 3OAUH 2K7QA 2D03L 1N59B 4AK2A 5BUAA 1EHNA 4ODVL 1JTPA 4YNY