4HHGA

Crystal structure of the pseudomonas aeruginosa azurin, ruh107no yoh109
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEEEHFFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhgA00
1ILSA 3OD3A 7PCYA 1UATA 3T6ZA 3FYIB 4A67A 1JVOA 2UX7A 3ASOB 2Y1AA 3TU6A 4YSCA 1OE1A 4ENZA 1WA1X 1A8ZA 2BZCA 3FPXA 3NYKA 4F2FA 4FAAB 1JOIA 1CURA 3NSYA 1SDDA 2OJ1A 1GSKA 4A68A 1PLAA 4JHVA 1E67A 5D4HA 1PNDA 2GB2A 1BXUA 1N70A 1AZNA 1NTDA 4K9JA 2YAFA 2DV6A 4DP7X 4E9VA 1X9UA 1E5YA 4YSPA 5I6PA 1JZGA 3NJMA 2VSKB 4PAZA 3DKHA 3S3BB 1SF3A 1KGYE 1ILUA 2B3IA 1GY2A 3FQ2A 2HLEB 4FA7B 1AS8A 1L9RA 1A65A 1J5DA 1OCOB 5B1JC 4GP4B 5B1JA 4A2DA 2Q9OA 3FPYA 1NIEA 2XV3A 3S8GB 1ID2A 3NSFA 2X87A 2YQBA 3U25A 2IDSA 3SBQA 2J57A 2UXTA 4HHWA 6PAZA 1A4AA 1NIFA 5I6LA 1TKWA 1NIAA 5A7EA 1NIBA 3N2JA 4DP1X 3PPSA 5B7EA 1KBWA 3FSZA 1AZCA 2DWTA 2HRGA 2X88A 3IN2A 1HFUA 4NERA 1IUZA 2XX0A 2PLTA 5AZUA 5I5MA 1KCBA 2EILB 4NB7A 5B1BB 1PZCA 1GYCA 1YLBB 2GHZA 4YSAA 4YSSA 2HX7A 3OMAB 4NAJA 3RYMA 3AG2B 1PMYA 1V54B 1RKRA 1A3ZA 1NPNA 4YSOA 1NINA 4KOCA 1L9PA 3FU9A 2W88A 1A4CA 3T9WA 2A3TA 1BQ5A 1MDAA 1CUOA 4N4YB 4YSDA 4UAHA 2AFNA 4JHUA 4G70B 4YL4A 1MG3C 2CUAA 2I85A 2IWEA 3WIAA 8PAZA 3MX0B 1IBYA 2QDWA 1IC0A 2WO2B 3ABGA 4YSEA 1I53A 1SNRA 4G71B 1IKOP 2BW4A 2PCYA 4KNUA 2JKWA 1ASOA 2YAPA 4AKOA 1F56A 2XUWA 1FA4A 2TSAA 1WAEA 4HCGA 1CC3A 3ABMB 4AKPA 4E9TA 2IDTA 3EH3B 5TK2A 3EH5B 1AACA 2H5UA 1M57B 1ZIAA 2FTAA 4P5RA 2FQFA 1OE2A 2BWIA 3FT0A 5I6NA 3GYRA 2J55A 1NWPA 2XYBA 3QJRB 1JZJA 2E86A 1AZRA 1SDDB 3WNJA 2ZXWB 4AKQA 3C75A 3ZX1A 3JTBA 1BYPA 1B3IA 2YAOA 2GSMB 1AOZA 4G7QB 3WKPA 1E30A 3ABLB 5I6OA 4YSRA 1GS8A 1V55B 3IN0A 3KW7A 1KBVA 1W8EA 2EIMB 1ZV2A 4F2EA 4GY4A 2CAKA 4W9ZA 1N68A 4YSQA 3AW5A 3TBCA 3T71A 1GR7A 3DTUB 2PPFA 3X1EA 4DPAX 2NRDA 3S8FB 3BQVA 2FT8A 5I5JA 1TEGA 3KW8A 4HCIA 1PF3A 2YAQA 3PAUA 3UGEA 1L9TA 1DZ0A 1E65A 1PZAA 4A2HA 2YXVA 3H56A 3OMIB 3CG8A 4HZ1A 1PY0A 2UX6A 1NWOA 3DIVA 2CALA 4E9SA 2PPCA 2WO3B 3N55A 1XMEB 4A2EA 2HX9A 1ASQA 2FQEA 1V10A 2XU9A 3T6VA 5PCYA 1BXVA 4WKXA 3ERXA 1NIDA 1ZDQA 2BO0A 1CYWA 1WS7A 1AIZA 3X1BA 1M9WA 3QQXA 1T5KA 1OF0A 2HXAA 3NP4A 1W6WA 2PCFA 1QLEB 1QNIA 3QJTB 2GC7C 1XB8A 4P5SA 2YXWA 2AANA 2ZOOA 2UXGA 4KNSA 3TA4D 3UABA 1AS6A 2XV2A 5B1AB 1SHXA 5PAZA 3X1NA 3WG7B 4E9YA 2MRYA 3GXUB 4KO7A 1KCWA 1M56B 5LDUA 3IEAA 1J9TA 3UAEA 1AR1B 4GP8B 3TBBA 1RZPA 2OCCB 3IE9A 4E9QA 5AFAA 2QDVA 4BXVA 2IDQA 2QPDB 2GC4C 4YVUA 5B1KA 1R1CA 4KO6A 3ZDWA 2VM4A 2YAHA 4DP9X 2N0MA 1ZPUA 6PCYA 3FSVA 4BWWA 2YAMA 2W8CA 4GYBA 7PAZA 2FNWA 4G7SB 4RH4A 4CSZA 5I5IA 1KDIA 3PAVA 2XXFA 3ABKB 2QPEB 1OCCB 1MZYA 2P80D 3UAAA 2IDUA 4KOBA 3S3DB 4WTQA 2FT6A 1VLXA 4KNTA 3AG3B 3T6WA 1ET5A 1PZBA 2GBAA 4GXFA 5IY5B 1FWXA 2PP8A 3HB3B 2BP0B 4JKNA 3HEIB 5I6KA 2XV0A 4MFHA 5I28A 1QHQA 3IBOA 4BWUA 1DYZA 3MBWB 1EHKB 1CYXA 2JFCA 2HZHA 3PXLA 4G72B 4DPCX 3T6XA 3WNIA 2DYRB 3X2QB 5F7BA 1BEXA 2OV0A 3NSDA 3UACA 5EHFA 3NJNA 1IBZA 4BK5C 4YSUA 3FYEB 2FQDA 5D4IA 4AX3A 1OV8A 5D4JA 1JXGA 2EINB 3NJJA 1AQ8A 3CVCA 1MG2C 2BP0A 1WA0X 2UXFA 2CBPA 1SFDA 4N8UA 1OCZB 3S3CB 4DP6X 2ZWNA 5F7AA 1RCYA 4QKTA 1E5ZA 2JXMA 3NJIA 1XB3A 3NP3A 2IH8A 3UADA 1GW0A 2XXGA 1J9QA 2BP8B 3ZIYA 4L0PB 1NICA 1MZZA 4EF3A 3H4FA 4DPBX 2J56A 1L9QA 2DYSB 4M4RB 4Q8BA 5B7MA 1AZBA 4AZUA 5FC9A 4A66A 2FQGA 1JZHA 2VSMB 3FQ1A 1J5CA 1ASPA 1GS7A 2IH9A 5TK4A 1JXFA 1OCRB 2IDFA 2BWDA 3SBRA 1FFTB 2PPAA 1PLBA 1JZIA 2Q5BA 4HHGA 4DP4X 2CJ3A 1ET8A 1JXDA 1KV7A 1L9SA 5I26A 2BW5A 1PCSA 3FQYA 2XLLA 1NZRA 2IWKA 4E9XA 5I6MA 2XWZA 2BP8A 4KO9A 2EIJB 2H3XC 1GS6X 4KO5A 2GIMA 5B3SB 2VM3A 4X4KA 1AG6A 1URIA 2IWFA 4YSTA 4A2FA 1GY1A 1RZQA 3QJVB 2ZONA 3H4HA 2XX1A 4E9RA 3OQRA 4HALA 4GP5B 4DP8X 1XB6A 1OOWA 3AG1B 1JERA 1PAZA 3FU7B 2XVBA 3L45A 3D12B 3EHBB 2WSDA 1EZLA 1SF5A 3EF4A 1WS8A 2J5WA 4W1TA 5ANHA 2PPEA 1AAJA 2BZ7A 2B08A 1JZFA 2UXVA 3QPKA 2YARA 3NSCA 5AKRA 1X9RA 2H47C 2VW7A 1BQRA 1HAWA 4PCYA 2VW6A 4QLWA 3TASA 3CDZB 3NJLA 1PNCA 2BHFA 2LLNA 1ADWA 3ASNB 4A2GA 4DP2X 2HRHA 1AANA 1W6LA 3FSWA 1AZUA 2PP9A 3FU7A 9PCYA 3G5WA 1KYAA 1NDTA 4ZK8A 3NJHA 3CVDA 3X1FA 1WA2X 3OMNB 4E9WA 2FT7A 2R7EB 4DP5X 1L9OA 3AY2A 1ZDSA 1JVLA 4HIPA 4TXVB 3WI9A 3BVDB 1SHWA 3OM3B 3CDZA 3PAZA 2VN3A 1TEFA 4UF7C 2PP7A 4BDVB 2DY2A 1BXAA 5B7FA 3CVBA 1BQKA 2I7OA 2IAAC 2PPDA 3QJQB 2DWSA 3ZBMA 2GI0A 1BYOA 4CSPA 3QJSB 1BAWA 3FU8A 1ZIBA 2FWLB 3FSAA 3V9CA 3NJGA 1ET7A 2EIKB 1JZEA 2R7EA 4Q89A 3JT2A 2VW4A 3PCYA 3EH4B 3NT0A 2CCWA 4G7RB 2YAEA 5E9NA 1J9SA 1SJMA 4BDVA 4HAKA 2FJSA 4HCFA 1J9RA 2TSBA 3CZUB 4BXSV 1HAUA 2Y69B 3NJKA 1SFHA 2RACA 2MTAA 1ETJA 3PLYA 3X1GA 2AZUA 3AG4B 1TU2A 1OE3A 4YVNA 4AI7A 3SBPA 4DP0X 2AZAA 3NJFA 3QJUB 1AS7A 3SQRA 4M3HA 1NPJA 3AZUA 2AVFA 2I7SA 4UANA 4BWTA 2P80A 3WKQA 1AG0A 2QT6A 1PLCA 1KDJA 3GDCA 2VMJA 1A4BA 4F7KA 2HX8A 3FS9A 3V9EA
chains in the Genus database with same CATH superfamily
4L1DA 4LNRB 2R9HD 2AJZB 2G9HA 3U1SH 3KGUA 2ITCB 1TZGH 5IK3A 4OTXL 4XCFL 5EZOL 3SN6N 2IANB 4V2BA 5E4OA 4LSDA 6FABL 3IDXL 2AC0A 4RGMB 3M1OA 1B0RA 2E56A 1X5IA 4Y1SA 5JHDD 3VFOA 1PLAA 4QIRA 5ID0A 3HG5A 1XVSA 3FUEA 2ZP8A 1YMME 4NLAA 2BMKB 4K5LA 3S34L 2M26A 1R3KB 1A3LL 4LESA 4E9VA 5C0AE 1HSBB 4OTXH 4XCFH 5DRNB 5FO8A 2XYCA 5EZOH 4H1LH 3EIFA 3BGFC 1UENA 1P7HL 4N0UE 4X6DB 5IKCB 2Y6TE 1ILUA 4FI6A 6FABH 3IDXH 1N0LB 2N56A 1BZ7A 1JPGB 1XGPA 3B34A 4K8RL 4PD4K 3GRWA 5L2KD 5B1JC 4FKHA 3WO4B 2VLJD 4TTGA 5JORB 1OB1A 4DFIA 1SJVA 4KKLC 1AKJB 2VXSL 3FU3A 3S34H 3ZE2E 3IB4A 2HFEA 5HVHC 3L6FB 4JG0L 1Q1JL 3MRPB 2VLKB 3QJFA 5IBUG 4AUYA 1I1YA 1O75A 4P9ML 4HGKC 4XZ4A 3RVUD 3VI4E 3AGVA 3P77A 1TKWA 2Z9TA 1DQLL 4ZSOA 4HK3J 5KN5B 1YC8A 2HJKA 4K8RH 4YBLC 4A7GA 4OLYL 4OV6F 2PLTA 2MTPA 1U33A 3HAEH 4LLAA 4M56A 5IHWA 3KBHE 4NB7A 5IHZB 1P4UA 4ZUWA 5B1BB 3TESA 3CBJB 5A2AA 3ZMRA 3O45A 4CILA 2VXSH 4YSSA 4HJGA 4XVSL 3DX0A 4DERA 4MAUL 4JG0H 1Q1JH 4PU2A 4P9MH 4O4YH 4OCSL 4ZAKC 4JFUA 1DQLH 1GIGL 3U4EB 4NQCD 1CUOA 3LH9A 1EFXB 1HN1A 1QWNA 3NBNA 3RB5A 4OLYH 4EIUA 5IB4A 3M7FB 3EBAA 3FO1A 4TNWK 5EZLA 1XGRA 1RZ8B 5CHNA 4L4VA 3ABGA 1C1EL 2Y2WA 2IAMD 4XVSH 4V11A 5HDBB 4YSEA 4G71B 5GRYA 5FHAL 2ZXGA 4MAUH 3VFGL 2JKWA 5EOCL 1BXXA 4JJOA 1FIEA 1USZA 1F97A 3ZUCA 1GIGH 4AKPA 4EQ3A 5HVWA 2WKLA 1FG2A 3BQUA 1ANUA 2CJTA 1N18A 2O61A 4WU5B 1E28A 2JCCA 4D7PA 5FKAB 3RPKA 4GG8A 5HD8D 1U3NA 1X4YA 3FRPA 4S1RL 2WBJD 4W81A 1E5AA 1HEZB 2XOTA 3OX8B 3U9UB 3GSRB 4P46B 3UG4A 3ML8A 1C1EH 5F6IC 3UDWC 3VFUA 5FHAH 3GEWB 3MX0A 4V2CB 3VFGH 5EOCH 1NSNL 1HKFA 4LCCC 4PCKA 2BXYA 5AYQA 3ZX1A 1UWXH 4YDVA 3EG9A 3MBEC 3SYQA 3NTCL 3TEZA 3ATAA 3KPRA 3PWNB 4QXGL 5JHLL 2OXHB 4QCIB 1MCPL 4QT5B 3S37H 4Z77B 4S1RH 2DPKA 4X5LA 3DUSB 3MC0A 1UXWA 3QO1B 2PPFA 2CK2A 4KY2A 4P3DA 5IEHA 5DMKA 4N86A 3CFKA 5C0IB 5CN2A 4APQC 4HPHA 1B9ZA 5F2FA 2FIKB 3MPCA 4IBQA 3ECWA 1NSNH 4MYPA 2UZPA 4UILL 1G6RA 4Y88A 1VEOA 5EUKB 2CLVA 3NSJA 5E03A 5F9AC 2J8OA 3NTCH 4AIXA 4QXGH 4BA8A 5HBBA 5JHLH 4WO4D 3GHPA 3P9LB 5KVGL 1XMEB 2HUHA 4HEME 1MCPH 3TXAA 3MDJA 1UM4L 2OSWA 2XA3A 1VKXA 2PXYB 3X13A 1BQLL 5E23A 1BYNA 1QP1A 4IBZA 2G4EA 2NY6C 4KVNL 4M4RA 4TULL 3EJPA 4CADB 1Z9MA 2OA9A 2WGNB 5JO5A 2NQCA 1FYTD 5DK2B 3G6AB 4UILH 3RZCD 3CFEA 2HXAA 3FN9A 1HI6B 3QO0A 2LVCA 4XN1A 3ULUC 3ZTEA 1YPZA 3QJTB 2YXWA 2ZYSA 3AROA 1NGZA 3H7LA 5KVGH 2V9UA 2FYYB 5HJGA 1UM4H 1NCCL 4UU9B 1JWSA 1IGTB 2C7UB 3L3JB 3RVWC 1J88A 4XNBA 4CGTA 3WS6A 4WTZG 4GQZA 3ZT5A 1BQLH 5KSBF 1KGIA 3TBBA 3IT8D 1JE6A 1JZDC 4KVNH 4TULH 5G5DB 3T65B 3QRGL 5AD0B 3IE9A 3FXIC 1MVFA 3QIUC 5DD6A 5KAQF 1H6UA 1FV1A 3VXTA 5T1LB 1MF2L 3V4PA 1XF1A 2ZXAA 1GGTA 4CJ1A 2VM4A 2R56L 3KM2A 1PJWA 4JFXA 4PRIA 1H5BA 2YD7A 3WO3B 1NCCH 2MQGA 3PL6C 3TFKD 1LP9E 2EEDA 2JJTC 4FP8L 5J5EA 3PQYE 4EXKA 1IGYB 2A6KA 3QRGH 3GLDA 2NY4D 2CSPA 3ABKB 3KWVA 3PAVA 4FXKB 1GSMA 3L8QA 5EN2A 3D09A 3L4VA 1ZVSB 4OAWA 3TBSB 3W9EA 4BQ8A 3U6RB 3WTWA 1MF2H 2P5WE 4G8GE 4ZNEA 3TLRA 1QD0A 2VLRE 4G9FB 1FWXA 2WTPA 4N0CD 2BP0B 2FO8A 3V0AC 1WC7A 3QZPA 4PJEF 1AQDB 1ZRUA 3VRJA 1S3KH 5I28A 4BQ6A 4X6CB 2JXMB 4FP8H 1DJZA 2A6IA 4R26L 5L0QB 4P4RB 1EHKB 2Z3FA 4LSQL 5J6HB 2GTZB 5F0LB 3FCSA 3TIEB 4G5AA 1EH9A 2V6HA 4EN3D 3TVMC 8FABA 4C56A 1IBZA 4YSUA 4Y16C 4S2SA 2C9PA 4JFPA 4BK5A 1NC2A 2D7NA 5F9WB 3T08A 2V37A 5D6DA 3EAKA 4TQHA 4IKJA 3WE1A 2D7MA 4U1SB 2H1LM 3JZYA 4L0ZA 5IVXE 2UXFA 4R26H 4YHYC 4ACPA 4JPKL 4LSQH 3SPVB 4G82A 1DJSA 1E27B 4KROB 5HPMB 1PSKL 4G6FB 1U0QA 5I6XC 4XN8A 1GHFL 5DJXB 1I8UA 1ZHNA 2ARWA 3IFPA 3QEHA 4I2XE 4Z0XB 2N4IA 3ECVA 3FT4B 4G8EA 4RAVB 1C8PA 5FFOA 1AGBA 4HIIA 3RFZC 4ELKB 2CKBA 4GKNB 4UUJA 1CD1B 5IQLA 3QXUA 3P73B 4OUOA 4JPKH 4L37B 1BX2B 5AYUL 1PSKH 3NIDB 3GM0A 4M7LT 1Y1DA 2DEWX 1GHFH 1F4AA 2NY3B 2OCFD 5DO8A 1OT4A 2OMZA 2G5BB 3KE0A 5FB8A 1IQWL 4Y5YA 3SDCC 1VHPA 2ADIA 2I25N 2Q76B 4TOYL 3FO9B 1FZOB 1UEMA 1WWCA 3AQZA 3HN8A 2WLYA 4PJGB 4N2EA 4JGJA 1R3JB 3KNBB 5IFJB 1DVZA 2Y24A 4HH9B 1Z7JA 3T3MF 2CLRA 3HS9A 3MRJB 4GBXC 3MYZA 2Y7MA 4DJMA 3BVUA 1JCVA 4EIBA 5J4MA 2KS0A 1EAPA 5DFVD 3GDBA 1B0IA 2ZIDA 4EJ1C 3LY6A 4MS6A 5AYUH 3N1PC 1NUFA 3BAXA 4PB0L 4YNYB 1KF9B 1FL6A 2KBGA 4U1MA 5F1NA 4U1IB 2MCG1 4F7MB 3KZ8A 1IQWH 5IJVB 1T1ZA 4TOYH 2ITDA 5GGRB 1JWMB 1BVNP 1KTBA 4XCNB 3TIDA 4PJAA 5CN3A 1KBPA 5IJBC 3ARDC 2CO6A 4M3KB 5EZJA 2I32A 1EV2E 5AKRA 2YEZA 3D39E 3KS0J 3QWRD 4HCRL 2G75B 2NOYA 5TDNA 1R5IB 3CU7A 4PB0H 1PNCA 3H0TA 4XMVA 2QSCL 2GTWB 4PBDA 1RURL 1ZA3A 1SOSA 4Y19E 5C0DB 3S36L 1X5GA 2XTJB 1OSZA 3D6GA 3CSGA 3RU8L 3EHBC 3QDGE 5LCVL 4AV0A 5AOIA 2Q6WB 4R0LB 3LKNA 1HTYA 3VVVA 2GKIA 3AXLA 1GJWA 1NANI 3BRDA 4S10A 3PGCA 1CTMA 4K3EL 4LP4A 4HCRH 4P2QE 3W3BA 4GAJL 1SVBA 2C1OB 5F9DC 2XFGB 1GCYA 1ES0B 2D31A 3BDYL 5K9KA 5KZCB 4YE0A 1J05B 1WAAE 4FTVE 5I73C 2QSCH 2OJEB 3BPCB 4OY9A 3UGXA 1RURH 1H3WM 4JFQA 4PJHA 3S36H 5MEOA 3RU8H 4P2AA 1B4RA 2VE6A 3BRFA 5LCVH 3UAJC 4FXGA 1M71B 2IBZY 3CVBA 4KXDA 1P4LB 1J0JA 3QJQB 5C71A 1C8QA 4MXQC 2J12B 1G1YA 1NCGA 4PLOB 3TBYB 3EGSB 4KHXL 4GAJH 3MFFB 3B5GA 5LUMA 5DLML 2R69L 3FSAA 2GHWB 3BDYH 3QEUA 4PJ9C 5CJBA 1WCQA 3AAZA 4HJ0D 4XNQB 5A43C 4MD0B 3ISYA 4UOW1 4XCCL 3MHZA 4Q2ZB 1QHPA 3CZNA 4FOMA 1W0YT 4WI5A 1MUJA 1VFBA 3DV4B 4A6YA 1PZSA 4PG2C 1FC2D 1T4WA 5DRZA 2BPBA 3FCBA 1GVIA 4ZXBD 5BW7C 5FK9B 4PGBA 3CQPA 3W11C 3QNXA 5IQ7L 5KYXA 2YJQA 1H3TA 3DETD 4K55A 2Z65C 4JB9L 4H5SA 5T3XE 4FADA 4IU2B 3AITA 4KHXH 3FNKA 1DUZB 3PWPA 5DLMH 2R69H 4AIZB 4Y4KD 4I87A 3MR9A 1M7XA 3KCPA 5IBUB 4B50A 4XCCH 5JMRA 4AI7A 4ELMA 3LNDA 2AZAA 3MRLA 3TN0D 2J6WA 1RSFA 4N1HB 1Q0YL 1CQYA 2OMUA 4KXCA 1EZVX 1NCNA 2AEIT 3AZUA 4P2RD 5IQ7H 4DKEL 1TSRA 2NY2D 4JB9H 1I3UA 5KS9A 1DSFL 2X2JA 1OZTG 5MENA 2HX8A 1I4FB 1U2HA 3V9EA 1MPAL 1ILSA 4LCIL 4R8WL 3IDIB 5DRXA 1B3JA 4IOSA 1DQJB 1ZXKA 1COBA 4HGWB 3BO8A 4J3VA 1HHHA 4WWID 3RWCA 1Q0YH 3UZVB 5IMLA 4R4NC 1H3XA 3O3EA 3BFWA 1B2WL 2ED7A 3IBEA 2EJ1A 4K4KA 1ETZA 1NA8A 4DKEH 2EVHA 1WHPA 2NR6A 4MJ6B 4A68A 1U8MA 4BCXA 2FR4B 2F08A 4RNRB 1DSFH 4QNPE 1XF3A 5L8KB 1BJ1H 1MPAH 3PWPE 5EU6E 4R8WH 4LCIH 1EUTA 5TE7L 2DV6A 4POZC 2BNRD 3QPQD 5I6PA 1RJLB 3CFQA 2APWA 5B22A 3ZGIA 4IRSC 4JY5L 4OJAA 3TO4D 1B2WH 1CDYA 1CWVA 5J0BA 3MJ9L 2RQEA 5C0GB 4NQVB 5KS9E 2RH0A 4U05A 5JIHA 3U30C 4M03A 4W6WB 3OKOA 1T22A 1CZ8L 1TQSA 2IOIA 1TOXA 1W9XA 3NSFA 5TE7H 4NSKB 2AEWA 3QG6B 1OGAB 3BEVA 3L7EA 3GUFA 2TRYA 4JY5H 5C0EA 4G6AC 4WK4B 4MD4A 2DQFA 2DMGA 4M61A 4AYDC 2QEJA 4DP1X 4L3EA 1UWXK 5C8JB 2BY2A 1Z3RA 3DYOA 2OAAA 4QRAA 4LL9A 2VB5A 5D7KD 1ZT1B 1IC7L 3MJ9H 5FCSH 1RVFL 1LO2L 2XX0A 3B2XA 3VXUA 2RFXB 4K9EC 2C4XA 4OZHE 1YEWA 4V1DD 1CZ8H 2R9HC 2Q7NA 3SYOA 1U3HA 2CDGB 5FYJL 4JANA 1U36A 4PJCA 3VWJB 1V54B 4WEBL 5EOCJ 1F41A 2BSTA 2X4SA 2KH2B 4CVZA 2LTQC 4IS6A 4OIBA 5FF6B 2QKIB 1RZIB 3JV4A 5FDWA 1F3DH 3HG1E 4HUKB 1IC7H 3QT2A 1RVFH 1LO2H 2XN9B 5EFIB 4G2AA 4YFDB 2KKQA 2RJMA 1A3QA 4YL4A 1MG3C 1TVHA 1WFMA 4JFWA 2YRZA 4O51B 4X9HA 5JIKA 3K0WA 4X6FB 3R4RA 4CC4C 4F20A 3CPLA 4UTAA 2BCMA 5F7EL 5FYJH 4FFVD 4LCUA 5CD5D 5DJ8A 4TQIA 4AQAB 3BT0A 4WEBH 4JGNA 1H8OA 4PGCA 1ZE3C 4BE6A 4FQXD 5FA3A 2VLLA 4ICWA 4QRRD 4KX7A 3OF6A 4XPHL 5TK2A 5JA9A 1S9WB 3N6YA 2FTAA 5AOKA 4LF3A 1T1YB 3D18A 2FQFA 3KPMB 1G7QB 4NEHB 1DVTA 3FT0A 5E8EB 2Q1EA 5K9OB 2NXYB 1KLFA 2WB1A 5CU5A 5F7EH 4N6RA 3EW3B 4DK6A 3NCMA 5KBDA 1FSKC 2UWEF 2E86A 4N0FB 2W94A 1ZPLA 4OCNC 3RE0A 3FHEA 4YXHL 4AKQA 4B7IA 1BYPA 5AG8A 2ESVE 2B9AA 2F8OA 3ABLB 2ZXQA 3LCYA 3VG0L 4AW7A 4XPHH 2GIXA 4D9RD 2BVUA 3ET9F 3TT1L 4PJ7A 4S1DC 4WFFE 1HC1A 4TF4A 5C0CE 4MS8C 1TMCB 4GXUN 2DIBA 2K70A 3S8FB 4HPYL 2J20A 4JG5A 4ONHA 2VC2L 1FNEA 2E74C 2VM9A 4MD5B 4I48A 4YXHH 3KLQA 4J27A 1CIUA 1W0VB 2OQJA 1JMZA 2WO3B 3BX7C 3CZJA 3VG0H 5DZVA 4U6HA 2HX9A 5JDSB 3VSQA 3TT1H 1CU4L 5D1XE 1FNAA 2IAMC 3SE4A 3V5KA 2NX5D 4JJ5B 4KV5F 1MAML 4MCZA 5IEKA 4AG4H 4HPYH 2BVQA 4WI9A 4DPRA 5HDQL 1MHCB 5ESQA 2VC2H 1M9WA 4LCYB 1QSFA 2Z91A 4Y4HB 1BVLB 3VB9A 1OAKL 4OD1L 5IFAL 3G5ZB 4O5LL 4N8VA 2VQ1A 5DWPA 4OVVA 2H32A 1QLEB 3HMXL 3AB0B 2WBJC 4IMLB 1RFDL 4JM2D 3QS3A 1K9TA 2B7DT 2Q3XA 1CU4H 4HMEA 1JWUB 1FFPB 2JB6B 4PLJD 3V8OA 1MAMH 5ICYB 2C3GA 3IU3A 4YLBA 4YS4A 3F7VB 3GIVB 5HDQH 2NY5C 2ZQKA 3KPLA 5IFAH 5IW1B 1OAKH 4OD1H 4O5LH 4PSRA 4JE0A 4NN6B 5F6HI 3T77B 4J6RL 4MNQB 3GFUA 5E0FA 4WKZA 2D4FA 5HHQA 3HMXH 3QI9D 4YUEL 3ARGD 3MTXA 1RFDH 1K5NB 3CN3A 3NEOA 3OR6B 3ESVF 3SKUD 6PCYA 1WQVT 3VH8A 3VD3A 5DDHB 4LASL 2J71A 2XBDA 1S7UB 1XF5A 2J6EA 1M7UA 4FULA 3D4ZA 4AM0Q 1AFVL 1QSFE 2A6DA 3ARBB 4F8TA 2X41A 4J6RH 4J4PC 1ESOA 5AAMC 4TQPA 5MI0C 3VD2A 1E2ZA 4JRYA 4BUGA 4YUEH 2YGOA 1H8NA 1VSCA 4PP2A 3VMOA 3WD5L 1K3ZA 1ND0A 2PP8A 3QQ9D 5ADOL 5IUSA 2W07B 4LL1A 4GFXA 2Q10A 4L8SB 1JPFB 1JGLL 4LASH 3RIAF 5EZPA 3CSYB 3QISA 3I6KB 3N0AA 4JZJA 4Z5RA 2VDPL 2EDLA 5F88A 3RZCC 2C9XA 5ISZB 4DPCX 1VGKA 2AJYL 1QA9B 3T6XA 1AFVH 4YHPA 2DYRB 5D1QB 3RX9A 3IRPX 1H0DB 4IQHA 2CO3A 1FZKA 2BHUA 2NZ9C 3GF8A 4KKNA 1EAOA 1NPUA 4AX3A 3WD5H 2C5DC 3FOMB 3S4SA 2KHAA 5ADOH 1HXYA 3B3IA 4YE4L 1CXKA 1KIPA 4YC2C 4A1RA 4BELD 1AQ8A 1MFBL 4UT6A 2ODHA 2X4NA 1TTGA 1JGLH 2Z4QA 3LRSB 4LSSL 3UTSB 3D85A 4PVNA 2VDPH 1A25A 3W37A 4MMXC 1SJEA 3BUIA 2AJYH 1V05A 5F1IB 3SQOL 3US1A 5I0VA 2IAND 3K6SA 1E4XL 1SLVA 4HEPA 5JXAL 3V0VA 2BP8B 3T4YA 2CMRL 1VGEL 3TFKC 3UPRB 4JDZA 5I15L 3UP1A 3H85A 2P7TB 4YE4H 2X6CA 4JFYB 1KPRB 1XGQA 4UDTB 1MFBH 5LDSA 4N2HA 2UUDH 3ZUNC 2GK0B 3O4LA 4JHZA 3LD8B 4LSSH 4AE0A 3P3YA 1MCFA 1GS7A 4J8RA 2BIHA 3BP5B 5FGSA 1IARB 3RNKA 3MLRL 5IQOA 3BHBA 3SQOH 3D87B 1EDQA 3TT3L 2P5EB 1E4XH 1ZY9A 4YDLC 1WWWX 3NCFB 4KZDL 5EWIL 5JXAH 2CMRH 3VI3E 1G87A 2JTDA 3VFNB 4IEFB 2XLLA 3O3BA 2OX5A 5I15H 1H3PL 4KO5A 1NFDB 5EC2A 3ECQA 4NZFA 2WHVA 1AKJD 1MRFL 1R5VB 4GW4A 4UAOC 4CSSA 2CO7A 4RGNC 3MGOB 3QJVB 3P4OB 5CLWA 1E4HA 1A6UL 1RZJL 2VLKD 3MLRH 4ZDHB 4GB9A 2E7LC 2BM3A 2XKSA 5LBSA 3TT3H 1JYWA 3OAYH 4B7LA 1T2JA 4HKBA 4KZDH 5HGDB 5EWIH 1SXAA 4HIXL 4Z18A 3BDXA 3DECA 4X7TA 5CEZE 4ZNCD 5C0JA 1H3PH 1SZNA 4ZUUA 4P07A 1VIWA 3VFPB 2A4ZA 4NO2A 4CW1A 3RY4A 1MRFH 3BPLB 2BZ7A 2B08A 3O4LE 1QTYT 3DVGB 2DLTA 3T8MA 5E5MB 4X4YB 1A6UH 1RZJH 2ERJB 4FHKA 4MRCA 5ITBL 4HWEL 2I9LB 5EEYA 2A73A 2JJVA 5BOPA 3WY4A 3EO1A 3TJEL 5SX4I 4HIXH 5BMFL 1G7PB 1UJ3A 1EFXD 5FUCC 3ZK0A 2AXFB 1HU8A 1S9XB 2Z8RA 2ZX6A 4XOAA 1JZ3A 3SDAB 4BH8A 4DKTA 1HZLA 1ONQB 3N40P 5HTSA 3LDBB 4J3OC 1IKFL 1NDTA 2HG5A 5BPPA 5AVWB 3CMOL 1Q9KB 1J86A 3RJOA 3P02A 1KYDA 4AIOA 3TWYA 3E8UL 1LEKB 5ITBH 4HWEH 1UQSB 3TJEH 5DJCB 3SDDB 2MNUA 3C5ZA 4F33B 5D8JL 1T89A 3DBXA 2HUEA 5ACZA 1KT2A 1BV8A 5I8KL 1MW0A 4P46D 3SGDH 4AC2A 4LBAA 2R1XB 1IKFH 2Z31A 2IO5A 5JIMA 1TQWA 1YMMB 2IAAC 3ILPB 4ZOAA 1J8HA 3CMOH 3MUGB 4TUUA 4HKJB 3UJIL 3T0WA 5JW5A 4S0TD 4MCYB 4MNHA 3E8UH 3SY6A 1OF2A 3JWNG 2Z7YA 4AH2A 4J23A 3QUYB 1XAKA 4ZYKA 4U7MA 2D4DA 4CDHA 1A6ZA 3P2BA 2VW4A 1IMHC 5D7LB 5D8JH 3VFSA 2L7UA 3RWHB 2DOCA 5I8KH 4IIQB 1U3YA 2XN1A 1RD6A 2YD9A 3MN8A 4JFEE 3HBGA 4NJ9L 2Z7ZA 1R3LB 4LVHC 3RGBA 5CU9A 3S35L 2G9HB 4RDBA 3QZLA 1PZ2A 2WZ5A 5IK3B 5HHOE 1BJ1J 3VMNA 3DHPA 4QUOA 3VI4B 4QRFA 4CN6A 4NNXA 1FORL 4GW1A 4HSAC 3ZDZF 1GJIA 2E3VA 3BAKA 5HYQA 1B0RB 2PXYD 3VFOB 1G9EA 4XPTL 5T1KA 5ID0B 2VKWA 1UUSA 5SWSA 2Y5TA 5ECJE 1ZVHA 3EXLA 4NJ9H 4OGZA 4LFHD 1QZNA 4NN7C 2VMJA 2WLJA 3MQIA 3S35H 1BQSA 3Q01A 2P8MA 4BFOA 2R51A 4FTDA 4RZKA 5FO8B 4QMEA 5GGVL 1ZGLM 4F1ZA 1FORH 3HI1A 2ZZUT 1CDIA 4P48A 4F37K 5L2JA 5D96B 5FGCE 5L6YL 5JPNC 4MB3A 1XGPB 4QI3A 1F1AA 2K3TA 3QA3A 2MH4A 1A8ZA 3HUJA 4XPTH 3FPXA 4WEUD 1Z2KA 1OB1B 5F0JB 2X2HA 2VDKB 3OZ9L 2AJSL 3ESOA 4IBUA 4MJ2A 2OMVA 5LG6A 1Q9OA 2KERA 2HFEB 3UZQA 4HJ0C 1BXUA 5T1LD 4F92B 1L0PA 1IV8A 1CE6A 2IQAA 4H44C 3QJFB 4L4TE 5GGVH 1I1YB 1N5AB 4KU1A 3OVUB 3P77B 1TKWB 4ZSOB 1DVXA 2HPTA 1E5YA 3MRRA 5FGBA 5L6YH 2VL4A 2MFNA 3GJFH 2HJKB 3ZMNA 4AQOA 3B4NA 1D2PA 2B3IA 3DETC 4DESA 3JWDC 5CIPA 3K4DA 4ZUWB 1F3DJ 1OCOB 3O45B 3OZ9H 3QP3A 2EIDA 4HJGB 5B1JA 1UEYA 1G7LA 1NEZA 3CN1A 3TN0C 4MAYA 4XXDA 6CGTA 4G9FD 2J57A 4UWQB 4GAAA 5BVJA 4KTDL 1JK8A 1CDBA 4TNGA 1MCKA 3GZPA 1YNTF 2EDKA 3MJ6A 5IB4B 2NY2C 1H3VA 2HRGA 5EZLB 1MNNA 2ZUUA 5FX3A 1XGRB 4FJZA 5CHNB 4L4VB 4Z1PA 2YKLL 3HG0A 2VLME 3MKKA 3ZKQD 4M29A 4ZFOL 5D72L 2HT4D 4JO1L 3TZVB 4NP4L 2G2RA 2HMID 4FDWA 3RKDC 2HT3C 5IG7A 1U8NA 4KTDH 1DEEB 1E28B 2B9BA 2JCCB 2W88A 1CI3M 3VFWA 3ZTCC 2HTKD 4GG8B 4U6VL 5IB5A 3FRPB 1LDSA 1MDAA 5BV7B 1T3FA 2QZ5A 3GBDA 4ZPVA 1OP9A 2YKLH 4KROD 2K8QA 1W80A 2VWEE 4ABUA 4GUPA 2AEQL 3VFUB 4G6FD 5D72H 3EH2A 3MX0B 3E6HA 1SDAB 4JO1H 1AXSA 3W39A 1XTMA 1XD0A 1HWHB 4YLCA 3IKKA 3EG9B 2FWUA 5LQBL 3KPRB 3S5YA 3CN2A 3ULVD 1FA4A 2X1PA 4HCGA 1GA2A 2EO1A 4U6VH 3LRKA 2HJFA 1VA9A 2JMRA 3BYYA 5F93C 1WUZA 5LNGA 3SYPA 3TWCH 1AACA 4P3DB 1WPCA 3NIFB 5I71C 5DMKB 3CFKB 1B4JL 2DL2A 3NN8A 3D48R 4GQ9L 2AEQH 2A0LD 3NA4A 4YK4C 5K69A 2NY3D 3CNKA 3VA6A 3UDWA 3S3SA 2CLVB 2AGJL 3H8NA 4UQ2A 5FKPA 3P3TA 2V8MA 5LQBH 2BH0A 5AB2A 1CDGA 4JFDA 4LCCA 1EXUA 3WKPA 3C2AL 1R0AL 3MBEA 1V55B 5GHWL 1OPGL 3X13B 4IRJD 4OZGF 1BZQK 1YDPB 4GY4A 2CAKA 2FECL 3PQYB 1B4JH 3CDGA 1G1CA 4GQ9H 2X0WA 4BFIB 4X5XA 5JO5B 4AYID 1GMIA 4NZUL 4APQA 4UDUA 1WFTA 2AGJH 2HT2C 3QO0B 1ZT4A 2JTYA 4GIAA 1JGUL 1YPZB 3H56A 2GY7B 5F7FA 1NGZB 4HIQA 5B3NA 1KCRH 2WWMD 2D3VA 3C2AH 3O9WD 1R0AH 5D2LA 1JWSB 5GHWH 1OPGH 1YEEL 3NEEA 3QNYA 2JIXA 1TSHA 2GCYA 3QORA 2DWDA 5KWYC 5PCYA 1F02I 2EDWA 3MUY1 2LV4A 3L2NA 1YQVL 5DC0A 3LMJL 3A67L 5DD6B 4NZUH 1OOAA 1FV1B 4FQXC 3VXTB 5FYLD 3V4PB 3FQTA 1IAIL 4DEPB 1JGUH 3H42L 3NCXA 2A9ML 1ZA6B 2EUZA 4JFXB 4PRIB 1NDGA 1H5BB 1BAFL 5KJ7E 1QNIA 2EDHA 3KLDA 1YEEH 3KEDA 4HX1A 2O1AA 1T1WA 3AQYA 4DGYL 1BIHA 1N19A 2LU3A 2A4EA 2R0WL 3ALWA 2A6KB 3BGAA 3CN4A 4KKBC 4MB1A 3CQQA 4Z7NB 5C9KA 5KZCD 5EN2B 1YQVH 1WZAA 35C8L 3LMJH 4OAWB 3A67H 3W9EB 2WZ6A 2ADFL 4BIKA 3M46A 4NXSA 5KBMA 1IAIH 1ZLWK 3H42H 1EFQA 2A9MH 1JD9A 3QIUA 2V5MA 3U2SA 4F58L 1BLNA 1WC7B 4TNVK 3PGDA 5JPMA 3VRJB 2WYHA 1OGTB 1ZPUA 1KTJA 4DGYH 2R0WH 2YAMA 3PL6A 2BCKA 3ABZA 3S0PA 4CKVX 2FNWA 1TZ8A 2COQA 3FCSB 35C8H 5BO0D 4Z3EA 3KLLA 2JJTA 2ADFH 4GMTL 8FABB 3RWIA 4N8VG 1KB5L 1WD8A 5D2NC 1OCCB 3D25A 4S2SB 4JFPB 1T80A 1NC2B 1FBIL 3P3UA 3TH2T 4RVBA 5FEBA 2NCMA 4PJXA 4F58H 3WNOA 1FF5A 1F2XK 4JCMA 1AZZC 3HKZA 4OIFA 5I2IA 5IUCA 2I27N 4M6OL 1WBYA 1A6WL 2I9TA 4FGMA 4WENB 4HIHA 2VISA 3K2KA 5G55A 4YHNA 5F7MC 3JXAA 4KZ0A 4GMTH 3HJEA 4G72B 3VXPA 1NGYA 1KB5H 1ZHNB 4NKQB 3IFPB 3QEHB 1AMXA 3DLQR 4IDLA 4I89A 4HVBA 1FBIH 4G8EB 1V5JA 3B7UX 3UACA 4C59B 5C1MB 1AGBB 3OAYK 4HIIB 4JM2C 4MQSB 3TVMA 3VDAA 3F00A 2CKBB 4UUJB 1G7MA 3ALPA 1PX8A 4FNUA 4M6OH 1W15A 1A6WH 4LAQL 5I66A 5IVZA 5SWZA 3FAXA 4UV7L 3D2TA 1WA0X 4GXVL 2CBPA 4R4BB 5KSAC 2AF2A 4LCWA 5J13C 4M5TA 1DQQA 1FHNA 4PJFF 1AJ7L 2OMZB 2XVLA 1KB3A 1UGKA 3RTLA 5FB8B 2BY0A 4Y5YB 4Y19B 2ADIB 4YHOL 5FIEA 3HE7A 1JHTA 3GD1C 2KMWA 1MEXL 4PPTA 4PJXE 4BFRA 3S5LA 1A47A 3QDGB 2HKFL 4GRWF 4PFEA 4PV8B 5DHVA 4LSTL 4PJBA 1X5HA 2QJDA 3LZOA 4ZQKA 5JDJA 1BD2A 4LAQH 4N25A 2GEEA 5F89A 1JXJA 4UV7H 4C57C 3HE6A 1QFWL 3N50A 2IXQA 1BREA 4GXVH 3BD3A 4N3TA 3WU1A 2OMBA 1JRHL 4U1MB 1M4KA 3HLAB 5F1NB 1AD0A 4IJ3C 5JLZA 4YHOH 3QWQB 1E9QA 2ITDB 3SPIA 4HHGA 1MEXH 4JPWL 1XEUA 1HCVA 1ET8A 1YYLL 1KV7A 4Q4IA 3QQ9C 5I26A 3S4SG 2HKFH 4QTIL 4PJAB 3TIDB 1TCRB 4LSTH 3ZZLA 3KMDA 3SDCA 4MQ7A 4PCSA 2IIJA 5EZJB 4LEEA 2GIMA 3BOVA 3BDBA 2YEZB 2IWFA 3I84A 5EUOE 1QFWH 5EU3A 1P6WA 5ACMA 2MKWA 5KVEE 1NCDL 5E6RB 5TDNB 1OGAD 3GLEA 4CDGC 4GBXA 4F5CE 1JRHH 3ARVA 1HH6A 3H0TB 4NKMA 2Y23A 3TCTA 1N0XL 1ZA3B 4DP8X 1CDJA 2APXA 1OSZB 2ENPA 4JPWH 4Z3JA 5JMOC 1YYLH 4FQLL 1UB5A 4QTIH 1JN6A 1DE4B 3APFA 3NAAL 2AERT 4PJBE 3LKNB 4GLRI 3N40F 1H3UA 3EF4A 4P2YA 3AXLB 2EXWC 1S78D 3QW9A 4MA1B 4QF1A 2NSXA 2ADGA 3PGCB 3RRQA 3OR7A 3MO1B 3F5WA 3GSNL 3HNVL 4LKXB 4L18A 5I0DA 3VWJD 1NCDH 5K9KB 2V7HA 4YO0A 1W72L 4XMXA 3RILA 1K8IA 4RGMC 5C08D 3UFIA 1WIOA 4CVWA 1N0XH 4PJHB 4JFQB 5ALCL 5F1KC 3SODB 2NNRA 3IFNL 5MEOB 2A9BA 3E9TA 5GJSL 2VE6B 4FQLH 2XN9D 3ESUF 2GUOA 3ZHLA 3EJYC 5TF1H 1AANA 1F4XL 4UYPA 3ULVL 4UMGA 1JF5A 3G5WA 4XNXL 3NEXA 3GSNH 1YG9A 2EO9A 3HNVH 4ERSL 3T1WA 2JQZA 5B38G 3QEUB 4LIQE 3IXAA 3AAZB 1NCHA 1W72H 3GQFA 3B6SA 4O9HL 2DAVA 3AY2A 4JM2F 5ALCH 1MUJB 1VFBB 4A6YB 3IFNH 3WO4C 4KFMA 3WCYA 3SYCA 2CU9A 2R29L 3E1F1 5GJSH 4EUPA 5DRZB 4PJIF 1DANU 5FA4A 3QNXB 5BO1L 1SOXA 5KYXB 1F4XH 5BQ7A 1VESA 3ULVH 3RVTC 5H8DA 4H5SB 1N64L 4MWFB 2NW3A 1WGOA 2NXYD 4IOFD 3UAJA 1F45A 4JCWA 5FM8A 4XNXH 5HYEA 4ERSH 5I1LA 3PWPB 2EQDA 3HS8A 4AGLA 4M7LL 2HVJA 1YC7A 3MR9B 1PY9A 3QCTL 3KCPB 4D8OA 4O9HH 4O02A 3H6JA 4ELMB 2COVD 3KPSA 4FG2A 4UMSA 2AXJA 2OMUB 4FLOA 4PJ9A 2R29H 2R7EA 3RIFF 4PN6A 4Z78A 4ZFFB 3F3HA 1NBYA 5BO1H 1LEGA 2OULB 2VMFA 4NHUA 3P40A 3UJJL 5LLIC 3N42F 1NBQA 4PG2A 3GJFK 5KS9B 2FHBA 1N64H 2E0PA 4O2EB 2YAEA 2GI7A 3B56A 1YYCA 4ZMPA 5MENB 2YQ2A 3K1DA 4NZTL 3R8QA 2IGFL 4G59C 3VU2A 5BS0D 3SQBA 1VPOL 4HAKA 4ZPTB 5DRXB 3S2AA 3QCTH 1UYWL 4PH8A 1O9ZA 1OGPA 3PHOA 3BO8B 3RWCB 5IMLB 2OSXA 4NWTH 1TNNA 4EZLA 1XSJA 1ETZB 3BLPX 2PWDA 3LX9A 4X4ZA 5CILL 2B3RA 1WV7T 1U8MB 3UJJH 3UYRL 3RVXC 3WFZA 4AGPA 4OZHB 1TJGL 2EH7L 1QEXA 3NACL 4NZTH 4Z7WF 2IGFH 2QT6A 3MJ7A 1VZGA 1PVHA 1PJ9A 1VPOH 5A2IH 2CPUA 4Y4HD 3FUNA 4Z3HA 1ITBB 4EXPX 2X7LB 1XIWA 2EVGA 4NRYA 3A21A 3ZZQA 1IC4L 5KVDE 3KPSE 1XCXA 5EBLB 5FYLH 1ZV9A 5A3IC 2WO4A 3NSXA 4P46C 4PJ8D 4QAMB 5CILH 3UYRH 5I1GL 3NYKA 1TJGH 4FAAB 1FQ9C 2EH7H 5EIVA 2W0LA 3OKOB 1T22B 3NACH 1JIBA 4PGDA 4LHUA 2W5PA 1L3WA 3CPUA 5T5NF 1KCVL 4IKKA 1E67A 4YPJA 2P5PA 2J21A 4WGWB 1X6NA 4M02A 4MNQD 1G5GA 3BEVB 4N5ED 1DBJL 1IC4H 2ICES 3L7EB 4K9JA 5C0EB 3NRPA 4MD4B 2DQFB 4L0YA 1SYSA 4YSPA 2FJHA 4L3EB 3N41B 3Q8FA 4LSVL 3DKHA 4IRSA 1KGYE 5DURB 2ARJA 3MRKA 5I1GH 4DNLA 4DN4L 5DEZA 3CN0A 3GMPA 2BNQA 5CEZL 4M4PA 2QGCA 1K85A 1U3HB 4JANB 2Y0SA 1KCVH 4MX7A 4PJCB 3T2LA 3KBPA 4ATWA 1DBJH 5D7IE 2BSTB 2X4SB 4TL4A 4XT1C 5AG9A 4CVZB 1KTDA 4IS6B 5IMMA 2PXYC 3JV4B 1I1AC 1DSWA 4LSVH 2OFQA 3MV7A 1HNGA 3PPSA 4AQ1A 5JHAA 2AJUL 3F01A 3PGFL 2DWTA 3IN2A 4DN4H 1HFUA 2KC0A 3MNVA 5ISZD 1MHPL 5CEZH 1NKGA 3DSNA 5I5MA 5JYLA 5EC1A 4LCUB 4RETB 5LXGL 5D1QD 2DLHA 1G7JA 4ETYA 4PGCB 1MAJA 2A83A 3L2LA 5FA3B 4XNZC 2VLLB 1DQML 2V3EA 2F54D 4X7FC 3L1GA 3WDJA 4MKMA 1O7VA 3UMTA 4M1GL 4LF3B 2XI9A 3D18B 2AJUH 3PGFH 1UCBL 5TGBB 5IQMA 1MHPH 1UD8A 1KLFB 1RUQL 2AFNA 3HBQA 4UAHA 1BHGA 1NEZG 4N6RB 5LXGH 2IWEA 1O7DC 3LN9A 3RX8A 5ABZA 1RK0A 1M7IB 3H9SA 4R96A 1YJDL 2V4LA 4ENED 1BLIA 2WNXA 2IMNA 2IOOA 4CC4A 3OKKA 5JW4Q 2OYMA 4NO0A 1KNOA 1DQMH 1ASOA 2Y25A 4CSTA 3SE6A 3QQNA 1J0IA 5HDBF 3LNGA 4M1GH 4WFEE 3DIDA 1CFSA 1MHEA 3QS2A 5E1QA 1UCBH 2IEPA 5CWSA 3CVHL 1L0YA 1RUQH 5ESAA 2ZWLT 4F8PA 1TQUA 3GTTA 2P5ED 4ONHB 4YZFE 5I6NA 1FNEB 3QUXC 5DTFA 4I48B 1YJDH 4ODVL 1I9IL 3UBXA 2B39A 1Z3GL 1T83C 3HS0C 3CSTA 1TETL 1Z0MA 2DS4A 1WD9A 2OQJB 3KL5A 2JKIS 3T3PE 4G42A 2YA1A 3ZTJG 5KAQG 2YAOA 2D3NA 4U6HB 3FQNA 5J57B 2X4RA 3CVHH 1GMEA 4K8RC 3FTGA 4MCZB 5IEKB 4NCC1 2BVQB 5ESQB 4Z7VB 1QSFB 2Z91B 3ZOAA 1CFBA 2IF7A 4ODVH 1QUPA 2ZX8A 4N8VB 1FHGA 2VQ1B 1XL6A 5F9WC 3TJHC 4CKQA 3OWRA 5IHBA 1Z3GH 3DUUA 4M6NL 2H32B 4A2HA 2DM2A 1KLUA 4JFOA 4HZ1A 5CF3A 2YXMA 4G6KL 4NNYA 5IROA 5BRZE 1NKRA 5CFAA 2PWHA 5HYJD 4KRNA 2GBTA 4XH2A 4XVJL 2CHDA 3U46A 3WHE1 4HZLA 3IU3B 5I30L 2RHEA 1OP4A 1RH8A 4JGMA 3KPLB 1QFUL 2FECI 3EYQC 4JFFE 4PJ5A 4WKXA 4ZW3A 4U1NA 3NRQA 3SKJL 4M6NH 4WKZB 4AT6A 2H8PA 4ODUA 5HHQB 3SDAD 1LDPL 1CFQA 4YR6A 2AMUA 2PTUA 4IU3B 4G6KH 3OKNA 4O58L 3V4VA 5KSVA 2R15A 1QBLH 3VH8B 1NUGA 2CNZA 1PTZA 4DK5A 4XVJH 2O5YL 5HGAA 5LGHL 1XF5B 1UZ6E 5I30H 2XTSA 3RB7A 2BLFA 5LDUA 2A6DB 3ZQ9A 5CP3H 1PKQA 2JH2A 3SDDD 3SKJH 4QXUL 4J3XA 4LLUA 4TLUA 1ZLSH 4I77L 4JRYB 5EU7E 5JOEA 4XBEL 4ZX5A 3D06A 1PDKB 4PP2B 1LDPH 4UNUA 4BXVA 4PRBA 1ND0B 4O58H 1RERA 3D0LA 4WI2A 4QO1A 3P3RA 5LGHH 5HDRA 2O5YH 4XAKD 4MRBA 3JUZA 4CVXA 3JTSA 1M53A 4JZJB 4F57L 2DEYX 4WI0A 4Z5RB 4NIYE 5F88B 3TNMA 2VN5A 3ZHDA 3CIQA 4YHPB 1EHXA 5IQ9A 2G3NA 4QXUH 1WH0A 1AGDA 3STLA 2FX7L 3VQ1C 1QLFA 5D7LD 2PYEA 4I77H 5B21A 1FZKB 4ODWA 4JRXE 1AC6A 4XBEH 3DJZA 5D5ME 2DJSA 3S4SB 3TA3C 1HXYB 4J4PA 3WJLC 3B3IB 2APVA 1KIPB 4LGRB 3B5TA 1PZBA 2GBAA 2X4NB 3IFOA 2Z4QB 3QJOA 3OG4B 4GKSA 4J12A 4A38A 1F6FB 1A7QL 1IE4A 3CC5B 3D85B 4DOHE 4F57H 1SJEB 3H2WA 3SKOA 3WMQA 3I2CL 1CXHA 3GMQA 4R7VA 2H0FA 1HDMA 5IOPA 4F8QA 1PKQE 3K6SB 2XTJC 3S36X 5J12C 3N1MC 3Q3GB 2XG4A 2DQTL 2FX7H 3RY6A 3V0VB 3T4YB 2H1XA 1D5BA 4X6CF 3AUWB 3QDJE 4LRNL 3GSOA 3QYCA 5MEQA 1RLWA 4JDZB 3K2MC 5GJTL 5E9DA 1XGQB 2HVBA 3LPPA 3R1GL 3VW3L 4QRSA 5D4JA 1KJVA 3O4LB 3ZR5A 4UM9B 1A7QH 4J8RB 3TPUA 2P46B 2E6PA 4QJ3B 1U8JA 4ZX4A 3RNKB 3FU5A 3I2CH 4XNMA 4PV1C 1ZJAA 1FGNL 4FC3E 1TJMA 4KTYA 1OCZB 2XNAA 1TUPA 2DQTH 3TBVA 4RRPM 1L0XA 2PYEE 4JS7A 3WY1A 3OXRA 3NP3A 4LRNH 2XZCL 1MFVA 4YQXL 1E4KC 2AV1A 2OX5B 3O3BB 4ZMVA 5GJTH 5EC2B 3ZRSA 3R1GH 4W70A 3VW3H 4AY0A 4GW4B 4Q8BA 1YY9C 4NQUA 2CO7B 3L4CA 3LEXA 1EZSA 2CBMA 3FF7A 3VGAB 1Y0LA 2CO4A 4O2CB 4FZ8L 4KDVA 3FULA 2GITA 1WRFA 1FGNH 4KFZC 4ONOA 3ULVF 4KRPC 1BIIA 2ZCHL 4QHPA 4HKBB 4BJLA 1JI1A 2QVMA 4QHKI 5E1AA 3FFCA 2WKOF 1NGPL 3N1QC 1NUNB 2XZCH 2OSLA 4X7TB 4YQXH 4KKCD 3FK3A 5AUMA 4BQBA 5C0JB 4PJDE 2J25A 4WEEA 4ZUUB 3OJ2C 3QDME 5LAPA 1TZHB 3UEQA 1SY6L 4NO2B 4CW1B 1O9WA 3NIDF 1JS4A 3C5JA 4PY7A 3KLHD 4C83A 1TIUA 5EIIA 2VITA 1E4WL 4FZ8H 4OBSA 3AQXA 3N44B 1A6AB 4U0RB 2A73B 2A1WL 3LQAL 4JPSA 1OT1A 2ZCHH 4PJGF 3EO1B 2FSDA 3WN5A 1RAMA 4E9RA 1QYGL 1UJ3B 1NGPH 3BEWA 3K8LA 3K6OA 2X5PA 3S5LG 1LJMA 1OOWA 2BDNL 5DMGD 7FABL 4R6UA 5T5FL 2XVBA 1SY6H 4L4VD 4R7DA 2WXNA 5AWNL 2HG5B 5AVRB 4HIEA 4NQXA 2YPKA 1E4WH 1J0ZA 4JL2A 2Q3ZA 4PRNA 2A1WH 3LQAH 4Q6YA 1X9RA 3V5HA 1BQRA 3BQUD 3I6GA 1QYGH 3KM1A 3C5ZB 4WVRA 3DBXB 3QUGA 5ACZB 2EUWA 3W5MA 2BDNH 1KT2B 2DDQL 3DIFA 7FABH 1HH9A 5T5FH 1OTSC 1I8IB 2IGTA 4M7KL 4BFGA 2Z31B 5AWNH 3FRUA 3D3VA 2K0RA 1J8HB 3FU7A 3SGJC 2NNCA 5JW5B 1KYAA 3CFNA 4MNHB 3SGKC 4RWHA 2ZP0T 4AH2B 3X1FA 4GSXA 3VM7A 2YQ3A 4ZYKB 1JK9A 1A6ZB 1OSYA 3KPRD 1WGVA 1NCOA 4OV5B 4XXCA 5JZ7C 3PJSA 1TO5A 2DDQH 3ARZA 1FVEA 1AGFA 2X6MA 3BVDB 1FL3A 2RR3A 4UF7C 3TEUA 2WCSA 2WD0A 3SOTA 1BQKA 1K8DA 3AS2A 4A55A 5F71A 4AGNA 4NNXB 4GW1B 4WI7A 3V9CA 4OZFA 3VXMA 5HYQB 3LHPL 1QRNA 4XR8C 4AK2A 1DLHA 1HQRA 5T1KB 3W2DL 3ZL1A 1IGJB 4Z7UA 5SWSB 5JHBA 2Y5TB 5B39A 3GMOA 2ZWKA 3QFJE 3QHFL 2IVFC 2M8XA 3VWJC 4XVUD 2P8MB 4N24A 5DHMC 1UA7A 1KMGA 3FUIA 4Y4FC 3H3KA 2FJSA 4B9FA 1A1OA 4RMUA 4W6XB 3HI1B 4DFHA 2NUPA 2W91A 4R5TA 5L2JB 3VGEA 1ZCRA 2PABA 2MTAA 3LHPH 4XN4A 2BVOA 3QA3B 3ZO9A 4JW3A 3HUJB 4WNQA 3W2DH 4NP9A 2CR3A 4KI5C 3MBXL 5C07A 2XFXA 2IALA 3QHFH 3OV6A 2OMVB 4LARL 3UZQB 2NY0C 3NCCB 4BCYA 2HJLA 1F3JA 4Z8FL 2IQAB 1CE6B 4AL8L 1S9VA 3FTUA 2BHYA 4OM1L 2VDNL 4P04A 2HYMA 3MRRB 4PRID 1RJYA 4QOKE 5CEYA 2UZIL 1UURA 2EIZA 4JRLA 1SLUA 4ONGL 4JJHA 2E75C 4Z7UE 5H35A 5CIPB 4IOFC 5JPNA 3MBXH 2MCPL 4ENZA 2QGEA 3DX9A 3E3QE 1KV3A 1DBBL 5JW3L 4LARH 5GGVY 2ENQA 4P23D 3WIIL 1E90A 1G7LB 1NEZB 1RIVL 2OJ1A 2Y7LA 2WCGA 4OI8A 4AL8H 4ORZC 2W60A 4JHVA 5CZXD 3C8HA 4MAYB 4OM1H 1GCFA 1DO5A 1QI5A 4WAFA 5T1DL 2WXFA 2VDNH 1N70A 4J3WA 4OU3A 5TF0A 2UZIH 5BVJB 3OTTA 1JK8B 1NKOA 5AW0B 4ONGH 1IVLA 2CGYA 3FUDA 5IHLB 2VMCA 3RWGB 2MCPH 3U0TA 2RAMA 1QSEE 3ZLQC 1ZGLA 4YBLB 3PE9A 1DBBH 4J8QA 5JW3H 3WIIH 2DRUA 5A6MA 3SDXE 1RIVH 3G9AB 3I3BA 4FLQA 4IM8A 1U58A 4PQXA 4C56D 5EEVA 4FHBD 2G2RB 4ZS6D 1NC2D 5T1DH 1XGZA 1MJ8L 5IG7B 4ETQA 5EF3A 3D2UA 1U8NB 3VFWB 1ECZA 2ZWSA 5IB5B 1UKSA 5SX5H 4LNVA 1D6EB 4QHMA 4TVPD 3QZBA 2CWRA 2WQXA 2KZ1B 1Q8MA 1GGBL 1T3FB 5L8LB 4ZPVB 3BPNB 2VDRL 3A6CL 3FH7A 4LHUG 1LD9A 4GUPB 4NQDA 2YEQA 4Y4HC 3E6HB 1RUAL 1AXSB 1YUKB 2F0CA 3TO2A 3W39B 2P8LB 3UTQA 1KY7A 3RBSA 1PZCA 4KKZA 1LM8V 1MJ8H 4JUTA 4JHAL 4NAJA 4UNIA 3FT9A 3LJ3A 1PAMA 1DVYA 4N85A 3WBDA 4P4KC 2AK4A 2HJFB 2JKXA 3G5VA 3LKPA 1L9PA 4G8FA 1L6XA 1GGBH 4LAJH 2VDRH 1P7BA 3A6CH 3NN8B 5TPWH 1GZPA 3A4DA 2HSIA 3MLPA 1RUAH 4N5EC 2XQYK 2CUAA 2I85A 1UTDA 3LH8A 2QSTA 2VDLL 4NIKB 5FKPB 3BD5A 4GSUA 4JHAH 2A9NL 4JFDB 4DEUA 2OL3A 4JE4B 4LCCB 1EXUB 1PIFA 4QRPE 1F56A 3MBEB 5E6UB 1HZKA 4J6IA 1C5DA 4AJ0A 4XHJD 1U95A 3VTAA 1WFNA 4AGMA 1OO2A 2IDTA 3CDGB 4JQIL 3EH3B 3ARBC 5E4AA 3OBAA 4AITA 4P5RA 3VVWA 2H45A 4UDUB 3S9DB 5GRXG 1ZT4B 2EYSA 1MXGA 2VDLH 4PRDA 2UY6A 2C9UA 2A9NH 5CBAA 2XYBA 5SWQA 5JUEL 3ZKMD 1IEHA 1DN0A 1F18A 1EQWA 5D2LB 2HLFD 4PR5A 2EKJA 4G7VL 2W1NA 3F6IA 3M17A 3QNYB 3GMRA 2JIXB 1IBBA 3QORB 5GRJL 2DWDB 3IN0A 5IV2A 1D7BA 3UTZA 1BWWA 5GZNC 3DTUB 4HU2A 3FQTB 3UO1L 2P44B 4HS6B 3GK8L 4DPAX 3D0AA 1XDTT 3TPKA 1DANT 1GKEA 2OYLA 4WHTA 1NDGB 4EO5A 5JUEH 3FFOA 1E65A 1OY3B 1PZAA 5T3ZE 3J2PA 3LKQA 4G7VH 3BP4A 2J88L 5KVDL 1M1SA 2XKNA 4LPWA 5GRJH 4KGJA 3N55A 2KQMA 5HI3C 3N3EA 1JYNA 5I0XA 1HJCA 2OXGA 2XU9A 3HZ3A 2R0ZL 5HHME 1VERA 3RDTC 1MFUA 3T6VA 4ENEC 3UO1H 3UBXG 3GK8H 1IKNA 2ATAA 4RWYH 4JQVC 3HHMA 1AIZA 5H37H 2D9CA 3QQXA 1FLTX 3U2SB 1BLNB 3L5IA 2FWSA 1HK6A 3LD8C 3PGDB 1QFOA 4A39A 4PVBA 2J88H 5JPMB 4O00A 5KVDH 1I3RA 2LT9A 3REWA 5FV2A 3SJVE 4HF5L 1VACA 1ZSDA 3PL6B 3U82B 2BCKB 3DC0A 3MRCB 5E2WL 4QAWA 2R0ZH 4X9GA 3QJXA 3BZ4A 3RWIB 1G6RL 5KG9A 2GVYA 3D25B 5HI5C 2NYYD 4HK3N 3B83A 2QHLA 4PJXB 4DW2L 4OVUA 3L4YA 2E46A 4ZQTA 4WNJA 1SHSA 3EYVA 3OZLA 3K80A 4R4FL 4DZ8A 3KYNA 4K94L 3DOHA 1S7XA 4ATTA 1GYUA 5I2IB 1WBYB 3HPJA 3V0FA 2I9TB 1KIRA 4HF5H 2FO4A 4HIHB 2DLFL 2VISB 5E2WH 1CBJA 3FQXA 4YHNB 2NLJA 2CA4A 4OLWL 2KPWA 3VXPB 4RGOL 1NGYB 1G6RH 1YVLA 1SJXA 4K7PL 3VXRE 4AK1A 2WV3A 2XXFA 4F15C 3TVMB 4NKDA 4KK8D 5I82A 3GI9L 4DW2H 4XP5L 1JZ8A 5E1GA 2IDUA 5CMAB 4R4FH 4M9OA 2WINA 1G7MB 4TMPA 3VXNA 4K94H 3WNPA 4HBQA 3P4MA 2E7BA 5MEND 2BY3A 3CHOA 4H25A 5I66B 2E7DA 2VMEA 5IVZB 2ERJC 4S11A 2DLFH 5IY5B 4MJ5A 3TL5A 1L6PA 4ZMAT 3L3DB 4IOSD 4B9PA 5AVTB 4OLWH 2ED9A 4LCWB 4MFHA 2H26A 1DQQB 2BP3A 2Z0UA 3IBOA 4RGOH 1X5MA 3FT3A 3G7TA 1UVQA 2CE6A 2DW5A 1CYXA 2GJZA 4K7PH 3SDAC 2X05A 5GGSA 3HE7B 1JHTB 2LAAA 5ABAA 3DX1A 3GI9H 3LDBC 4XP5H 3S5LB 2NR6D 2F15A 3IDMA 1OXYA 5DHVB 4PJBB 5FOJA 3AVEA 2VKXA 4YDIL 1R4XA 4XWGL 4N2BA 4ZQKB 1D9KA 3MLSL 1BD2B 5F89B 3HE6B 4LP5A 3Q8BA 3HB3C 4O2FB 4UQIM 4PYGA 5AW6B 1AD0B 2K3HA 5JLZB 4ZO8A 5KSAA 1E9QB 1ODUA 2L7EA 3K91A 5DFTA 1S7VA 2WNGA 4OGAC 3UADA 5GGTL 1GOFA 2A9DA 2EP6A 2FL5A 2F7QA 3SDCB 4MQ7B 4B9GA 5JIIA 1J9QA 4AVJA 4YDIH 3PP3H 4XWGH 3BSZA 3MLSH 4J7RA 3WELA 3CFCL 2J56A 1L9QA 5EU3B 3QUYC 4FI8A 1I82A 5FC9A 3SZKC 1D5XA 3QEQA 4GBXB 2YGQA 4B9ZA 4B9CA 4NKMB 4FE9A 2FUTA 2BSRB 2X9WA 2XA8L 2E27L 4IIQC 4L3ED 2Y36L 4PUBL 5ADPL 1UB5B 3BCFA 5GGTH 3OAUL 1JN6B 3H3PL 4GRMA 4L9LC 5DURD 3VXUD 3WV0A 3NZ8A 4Z6AT 1YEGH 2YPVL 2AW2A 3S35X 4QF1B 3CFCH 2ADGB 1MFEL 4LQFL 3OR7B 1U3HD 3F5WB 1S9YA 2V3FA 4HT1L 3WLWD 5DA4A 1CL7I 2WNKA 4WLCA 2V7HB 5JIQA 4QTHA 3CAFA 4ZI8A 5GRVL 1K8IB 2XA8H 1NFDF 3M1BA 4MXWL 3WS3A 2E27H 5FO9B 2Y36H 4PUBH 4EAEA 5ADPH 1YYML 4FN0A 3OAUH 3H3PH 2GUOB 2B0SL 3AG1B 2ZG2A 2R2HA 5AVZB 4LQFH 1MFEH 2WVTA 3EHBB 1Z9OA 2A6JA 4HT1H 1Q90A 2GJPA 3GS7A 2AK1L 3IXAB 3RPBA 1KN4L 4QRUA 2UXVA 3FU0A 3B6SB 3QZWA 3VACA 1RPQA 5DF0A 4MXWH 1ADQA 1FJ1A 1OKEA 2DQJL 3E8VA 3OF6D 3GGWA 2J2ZA 3BKCL 4EUPB 2PMZA 5E94A 2X10A 2EVJA 1YYMH 2VW6A 4HUUA 4HFWA 2B0SH 5FA4B 3L9EA 5BQ7B 4H8QA 5CZVL 2NW3B 3A3YB 1FCCA 3FB5A 3UTOA 3HPLA 4H8WL 5I1LB 5EIIG 4R3SA 2AK1H 4CAGA 3KLKA 4HJJL 4ALAL 4ZW5A 2HVJB 1KN4H 2HKHL 3US0A 4HS3A 3BFOA 4O02B 1ZK5A 2DQJH 3KPSB 1Q1PA 5FW7A 3BKCH 4X6DA 4LOFA 5IKCA 2AXWA 2FT7A 2R7EB 3AQDA 5AB0A 4Z78B 3SBWA 1NBYB 3CXHK 1LEGB 4NBXB 5EORL 2Y3AA 4NHUB 4HDIA 1NH6A 1ACYL 5DFWH 3CDZA 3PAZA 4FMFA 4H8WH 3SQBB 1UB6A 3FCGA 3FAWA 4HJJH 4ALAH 1NGXA 2YHGA 3PHOB 4HQQL 2ALAA 3MNWA 4CC1A 4U3XA 3QNFA 1G1OA 1BAWA 5DMGC 3CXHJ 5D70L 2ZPKL 1D5RA 1KYOJ 4OFIA 5L8JB 3GSUA 5EORH 4OH2A 5IREA 1ACYH 1YEIL 1YEHL 4PJEA 4HUXA 4FYSA 4Z0BL 2QPSA 3TZVC 4B9YA 5DYOA 5KSBE 2C9AA 4J3OG 5E9NA 2KLTA 4OQTA 1XIWB 4NRYB 4HQQH 5MP6L 5GGRY 3IMSA 2VDMB 5F3HA 1P5UB 1BWMA 1REIA 5D70H 2ZPKH 5BV7C 3KDMA 2R1YA 4OFKA 5DR5L 2FJFA 4ZFGL 1YEIH 3LPFA 1YEHH 4R5XA 2EICA 1ACCA 1RZ8A 2PTTA 4PW9A 1E40A 4Z0BH 1XGYL 4LHUB 4PGDB 1MVUA 2I7SA 5D4QA 3RPIA 3B5HA 1BM7A 4IJTA 5AVXB 3MU3A 2JKJA 3KJ4B 5MP6H 3MV8A 2FEJA 3DWTA 4OZFG 2XRAH 5DUPL 1SYSB 1SYVA 5DR5H 3UC2A 2XTLA 2OW7A 4IRSB 5B39G 1AZVA 1WIUA 2ARJB 3MRKB 4ZFGH 4PJEE 3APMA 4E41E 2CDEB 3VXSA 1ZLVH 4FQIL 3GMPB 1E3ZA 2BOCA 1XGYH 3QUKA 4M00A 3L9BA 4UZUA 4XODA 1R9FA 1OTUD 2R2BA 2V7NA 4MX7B 1WE5A 2VDOB 2AEOA 3U30B 1AE6L 2B14A 3P11L 3SEPA 4J3SA 3NCEB 3U0PB 4JRYD 3C12A 3MV9A 1DVFA 2UVEA 2BFVL 1KTDB 4QXTA 4XMKL 5IMMB 5DUPH 3QAQA 1TEYA 2XACC 1BFTA 4FYQA 2D7PA 2ZOWA 3F58L 3QC5X 2BZDA 2WW8A 1DJGA 4KI1A 3MV7B 3VXOA 2APBA 1MY5A 4AQ1B 3QO1A 4PAZA 4FQIH 3MNVB 4BFFA 2BS9A 3DSNB 2HLEB 5EC1B 4JHBA 4GSDL 1WEJL 3JSSA 3L3OC 2ITFA 4A7GF 1AE6H 1G7JB 3P11H 2A83B 1LO3L 3L2MA 3MV8E 2BFVH 4XMKH 1IQDA 3MZTA 3MA9L 4FFYA 1LEIA 3LIUA 3CSFA 4P59L 1LWJA 5F3BB 2IDSA 3F58H 4K71B 4BZ1A 3EO9L 3ZE1B 2WWKO 2LTQB 4A7VA 2VR9A 3D85D 1I1AA 4U7KA 2YD8A 1T0NA 3TJPA 5B7EA 2ZX7A 4G1MA 1I7TA 4GSDH 1WEJH 1RK0B 3ZW3A 3H9SB 5FDYA 1IIKA 5DK2A 2YSTA 5HYIA 1LO3H 4CN1A 1H5BC 2WSPA 1U4FA 1KNOB 1J12A 3MA9H 1AQMA 4YSAA 1L9MA 1MFMA 2VXTL 4P59H 3AG2B 1PMYA 3OB0H 1RKRA 3EO9H 1A14L 1EBPA 1V3JA 3LOWA 1CFSB 3EJZC 3O4LD 1MHEB 2VYRE 2AVGA 2VUYA 3QWNA 5CWSB 4WSGA 3T3ME 2C4FU 5ESAB 3GPEA 2TRHA 4E5XA 5ICZA 2JCCF 5AD0A 2ATKA 1SM3L 5DTFB 3UTTE 3FONA 2QQQA 4JHUA 2X12A 1A4KA 3UBXB 3CFUA 2EIEA 4JFSA 4BSVA 1FSKB 3WEOA 5GS0L 3VTTA 4G42B 2H3KA 2WB7A 2VXTH 2K8MA 2BW4A 4FKKA 1O6VA 3QBTB 1A14H 1KYFA 1T66D 2AQSA 3FQNB 2X4RB 3ARFB 1R6VA 4HG4K 2EADA 2FHFA 1E8XA 1WAEA 2B5IB 3FTGB 4GINA 3PWUA 4H1LA 4UNVA 2F8XC 4N90E 4Q4EA 3EH5B 4N2LA 1RUML 1SM3H 1BW8A 3KLSA 4ZW8A 1OE2A 3WENA 4K7FA 4NQEA 1KWGA 1EGJL 2N59A 1KLUB 3K8KA 3NIFF 3QUXA 5GS0H 1N8OE 4LVOC 4YZWA 2N01B 4NNYB 5AB9A 4PBXA 4MJIA 1T83A 3HS0A 3UP6A 1OZUA 2ZXWB 4A2MA 2DL9A 4HAFA 3U46B 2GJ6A 1DJXA 4HZLB 4NAQA 4BCZA 3U6XA 2FNBA 2F1BA 1BVNT 4HV8B 1RUMH 2YPLA 5GS1A 2ZWYA 4XMUA 4PJ5B 4U1NB 5DGQA 2NT0A 1FO0L 3HAEA 3T5WA 3KH4A 5MHSE 5T33L 3QAZB 4UQ9A 4AT6B 2H8PB 4ODUB 4DCQA 1EGJH 3COOA 1YMHA 1CFQB 4YR6B 3C6EA 1VFUA 3TEYA 2I24N 3OKNB 3QQ4A 1DZ0A 5CCHE 3DXAA 1IGFL 3MAWA 3V4VB 5KSVB 5F0PB 5E0QA 2Y6SC 1U8IA 1GGYA 5HGAB 1IBFA 1YPZF 5A16A 3FW6A 3N9GL 2CQVA 2X4TA 4A2EA 4DH2A 1RZGA 3LPGA 4Y5YC 1PKQB 5FM4A 1FO0H 2Q2LA 4LLUB 5F3FA 5T33H 5DJXA 3VRIB 2AMGA 5HYFA 4MZ3A 4JKPL 3HG4A 4PRBB 5FYKD 2Z31D 3IXTA 4H8PA 1IGFH 3DVFA 3WY3A 1J8HD 4QO1B 1K72A 4N26A 1A02N 2X9XA 4CVXB 3JTSB 4C4UA 3GXDA 5DZLA 4WI0B 5BZDA 3N9GH 4QYAA 1BX2A 1TJHL 2XIIA 1TZIA 5IQ9B 1UXMA 2AQNA 1FNGA 4NT6A 4KAQH 1AGDB 2H6PA 3HZKA 1XFPA 4XMZA 1MCHA 3STLB 1QLFB 2PYEB 4GIOA 4D9QE 3IEAA 2Q76A 3FO9A 1A9VA 4JKPH 4Z7NF 5KSUA 4UT9L 3NCWA 3WNMA 5I0YA 3OSVA 5MI0B 2YLHA 3KNBA 4MA7L 2EIBA 2DLIA 5CM1A 1OARL 3GKZA 2Y2TA 4GKSB 1D5MA 4QYOA 4ANWA 1EO7A 2AQ2A 1WCBA 3SKOB 4ZUTA 4XO8A 1KACB 3GMQB 1TJHH 3JVFC 4H0GA 5IOPB 2MEJB 4NUJA 1V8HA 4KRLB 2XG4B 3EZ8A 3L1OL 4U33A 1QLRA 2ATPA 2WXPA 1D5BB 4RH4A 5DUBA 5MEQB 1PG7L 5IBTL 4MA1C 4PBVC 4UT9H 5SWSD 2YFOA 2QPEB 5E9DB 2MOQA 3Q6FA 4KBPA 3MRMA 4MA7H 5EDSA 3BMVA 4QRSB 4F3FA 2VNCA 1OARH 3AS1A 4OF3A 1YA5A 4PY8J 3TA3A 3TPUB 3CHXA 4OJCA 4LLVA 3BUPA 4YC2B 1WVZA 4LOUD 1INQA 4R7NA 5JHLA 4JKNA 3GB7A 1A9EA 3L1OH 3W0WA 2WN3A 5AQ0A 3TBVB 3K71B 3QIBC 3OXRB 1W8NA 1BGXL 5BXFA 4WWNA 1PG7H 3T0EE 3PXLA 2AV1B 5IBTH 1WTGT 2P52A 2QELA 1S7RA 3KD4A 3LEXB 1CDHA 1JXGA 2GITB 2P4AB 1JSYA 1BIIB 2PCPA 4TVSa 4M48L 3VNZA 5CD3A 1X5FA 5E1AB 4BE5A 2BSBA 3FFCB 3CV5A 1YY8A 1MFAL 4LXFA 1BGXH 1R19A 2OSLB 5GRVK 5AOMA 5AUMB 2FUQA 4YDLB 4HIJA 2CR0A 1UACL 2IH8A 3C5SA 2CCLA 1GW0A 3C5JB 4PY7B 4C83B 2L8AA 3IJSA 1E4KA 4M5YL 2C3HA 1P4IL 2Z35A 4JFHE 5DMIL 3V7AE 2YA0A 1LK3L 3KDPB 5EIIB 2VITB 4KKLD 3KYOA 3RGVA 5B7MA 4JR9L 4MAYD 1E7UA 4WUKL 1U3ZA 4UAOB 1P0SE 4RGNB 4M48H 4XNQA 5JOPD 3WN5B 5AKSA 4Q2ZA 3BEWB 3ARTA 4KK8C 4YGVA 1MFAH 4RMWA 4RA3A 3ZHKA 3DGDA 4R7DB 5DVKA 2AP2A 1SOKA 4M5YH 5IZ7A 1RQ5A 5CSBA 2CJ3A 4HIEB 1P4IH 4BYHA 3VX1A 2DZEA 5DMIH 4NQXB 4RRPA 1FFQA 4G1EA 1LK3H 5F7WC 1ZLEA 2YPKB 4JR9H 1QEWA 2O6DA 3LHAA 1Q0XL 3QQDA 4PRNB 4WUKH 4QGYA 4PJAF 3V5HB 4QPEA 4GT0A 3I6GB 1LHZA 4WUUA 3SYAA 2H6OA 1JVKA 3DBSA 5GS3A 5FW8A 5EF2A 5I75C 5A2JH 3KPTA 3GUTA 3TV3L 3OQRA 1HH9B 1A6VL 4GP5B 1H6TA 1SLWA 3E6FB 1JERA 3FRUB 3D3VB 4UT6H 3FU7B 1TF4A 3D12B 1SF5A 3L13A 1B0WA 1Q0XH 2DKSA 3RTQC 2FIRT 3QH3A 1HCZA 2E76C 3IDIA 4XVOA 1JK9B 2CCVA 4W1TA 1DQJA 4MBOA 5F7UA 5A6LA 1KXQA 3K7UA 1UWGL 4KX8A 3U7WL 2SEBA 3U0WL 3FCTA 3TV3H 1FVEB 1AGFB 1A6VH 3TASA 1FL3B 4B3VA 2GBUA 3RURA 5HYSA 3CIAA 2V33A 2FR4A 1ZWIA 3MYJA 2YGVA 4PJHF 5I16A 1CFTA 3GEFA 3UBXI 5BUAA 3NZUA 3CZEA 1K8DB 4ZFQA 2DYPB 2X1XR 2X2YA 5DVLA 4XNYL 3SGJA 3OGCB 4PW4A 4JFDD 4GPVA 3SGKA 5KYNA 3NJHA 3WFEL 1UWGH 4OZFB 5CZRA 3VXMB 3MBED 1QRNB 4RAHA 3AWGA 3U0WH 2ZTBA 1UZ8A 1DLHB 1HQRB 4Z7UB 4BUHA 5B39B 4X9BA 3AWFA 3GMOB 1U3HC 2MCAA 4XNDA 3QUZA 3FUMA 4W6YB 1OANA 5DQ9A 4KV5E 2WQUA 1DJYA 3JV6A 4H2CA 4APQD 4TNFA 1JZ2A 4BD4A 3T1FA 3ZDYB 1A1OB 2X28A 4FNQA 2DIAA 3LRHA 3LN4B 4XNYH 2NUPB 2YRPA 2IH1A 3WFEH 2PPDA 4NLHA 3LZNA 2BVOB 4HLZG 1BYOA 4XNUL 5CSGA 3U36B 4WNQB 1F5WA 2Y4SA 1BQHA 2JIXD 3QORD 5C07B 5CCKL 2XFXB 4J2QA 4B60A 4YXLL 2IALB 2FATL 4FG6D 4D9LL 3T2QA 4ELMF 3INUL 1J11A 2WZPD 4DN3L 2HJLB 1UD3A 1F3JB 4IKNA 1S5IL 3LEVL 4R9HA 4NN7B 1S9VB 5I8OL 1KULA 1HILA 2NYKA 2ENJA 1KGJA 1RJYB 5C0FA 5CEYB 4Y4FA 5KS9F 3O2WL 4BXSV 3CZUB 4KJPC 5JHDE 3ULUD 5D1XC 2EIZB 3FOLA 4XNUH 1RZIA 4LU5L 4UI2A 2CDFA 5H35B 1LQBC 2CR6A 4OGQC 4LE8A 5CCKH 3DX9B 4YXLH 5FYKL 2FATH 4D9LH 2UZYA 1V27A 3INUH 4DN3H 2PN5A 5GRWA 2WLHA 4B5EA 1UA6L 2D3LA 3CFBA 3KBEA 3KVQA 4U6YA 1S5IH 3LEVH 5I8OH 3UERA 4MJHA 2EDQA 1CD9B 2QVIA 4AQAA 2NNFA 1PLCA 3QIUD 4F7KA 5L2KE 3M8OL 3O2WH 3NZHL 4L23A 2KT6A 5KUKA 2VLJE 4UQAA 4LU5H 4DKFL 4HCRA 1JF1A 4XRCA 4N5UA 1BAGA 3U0TB 2EDJA 3PL6D 5FYKH 1C5BL 5ANMA 3BFQG 3IWVA 3FH5A 3BN9C 3QHZL 1XQ4A 3SZ6A 2K9FB 1U58B 2MOVA 1MELA 2F7PA 3NVQA 4F2FA 2GUYA 1JTOA 5LCVA 5E2TL 4N0FA 4PRHA 2D7QA 3B8SA 3TOPA 1RHFA 3X17A 4CU7A 4ETQB 1XD1A 3D2UB 3M8OH 2NW2A 1U91A 3NZHH 5CKGA 5D4HA 4F91B 2F1EA 1GW6A 2E47A 4DKFH 5D7JB 1MCDA 1NTDA 4QHMB 3RDJA 4U1GC 1TTAA 1R24A 5TTRA 3VWKA 4OZIA 1IZJA 1C5BH 2EDXA 3D0VA 3QHZH 1LD9B 4NQDB 2ZT9C 2DTML 3VYPA 3G6JA 1SF3A 3OC8A 2AXHA 3P3SA 3TO2B 1RUKL 2EUVA 1L9RA 3N41F 5E2TH 1J5DA 4NQCE 4Z95H 3TVMD 3MNZB 1A1MA 4OKDA 2JF1A 2WXGA 1OD9A 2N1KA 4MCMA 3LKPB 4G8FB 4MNGE 4PJCF 5KYYA 2R69A 3K4ZA 5SWZD 3OLGA 4PS8A 1RJCA 5CEXA 5C6PB 2UXTA 5ANME 1KGXA 5E5LA 1GZPB 2X6VA 1R47A 4EI5A 2DTMH 3DO4A 4LCWD 4MXVF 2IPUK 2YN5A 2DMCA 3TEWA 1RUKH 5EBWA 1ZKAA 1BVLA 1X3DA 5AZUA 1CTNA 1KEML 3HE7D 2JLLA 5KJRL 4GG6A 2OL3B 3G5XA 5C0BA 3QUMB 1T03L 1EJOL 5JORA 1MFCL 1TITA 3FUHA 4ESKA 4NZRL 1BD2D 5IR1A 1QNZH 1NPNA 3BH9A 3JT0A 1O6TA 3HE6D 4Z3GA 1XO8A 2FE0A 4GQQA 4P4KA 3PUUA 2NZ1A 3FU9A 5LN8A 1S7SA 3EDEA 1ROWA 2A3TA 3U83A 1DQKA 1XSKA 5FM5M 1JV2A 2H41A 2EYSB 3IS1X 1KEMH 3C9NA 4PRDB 4YK4B 2UY6B 5KJRH 3MLYL 5D1ZA 1JF6A 5SWQB 3AGWA 1T03H 1EJOH 3B2MA 1DN0B 3SDCD 3GI8L 2BVYA 1MFCH 3V6FA 4DVBA 4PR5B 1CS6A 4JZJC 1FZMA 4AXWA 3M17B 3GMRB 2Y7QA 5AKTA 1FVCA 3V95A 4AGQA 4ZUSA 4GUCA 1NCJA 5DDHA 5IV2B 3UTZB 2BIIA 3DMMC 3MRQA 4GBXD 4OFDA 3UC0L 3QE5A 4E36A 3TURA 3LB6C 4UZGA 3VD4A 5HY9A 2OK0L 3ARBA 2Y2YA 3MLYH 4PJ7F 1KSRA 4BINA 4Y7MA 5C0BE 4PRPA 2OCJA 4RQQA 3DGGB 3LKQB 3OL2A 3BP4B 4RESB 4AENA 2XKNB 4LDOB 2WXQA 2W07A 2WAHA 1IBHA 4OGYL 5CZKA 3KPPA 5CGMA 1UH3A 2OXGB 1P1VA 5CINL 3UC0H 1JPSL 4XE5B 4LKCA 5J1SC 4OFYA 4KH9A 4AC4A 2OK0H 4WY7L 3MJ9A 1X4ZA 1DP0A 4X8GA 4RZCA 3L9RA 2VDQB 3BQVA 1XH3A 3AC0A 5IBLC 1LL1A 3Q13A 3EHBD 1X6LA 4Z7VF 1I3RB 2NSQA 1WUNT 3REWB 2CXKA 1JZ4A 4F8OA 2XIBA 4OGYH 1WT5C 4H1LG 1PY0A 1T04A 1ZSDB 4OB5L 4N2FA 3ORJA 4E9SA 3UTSA 3S88L 5CINH 1JPSH 3BZ4B 5KYWA 2BINA 1LXMA 5KG9B 3QR1A 4LRIC 4WY7H 4WW2C 3KLAA 4U3HA 3RDTA 3H53A 3CFJA 4PRPE 1AGEA 1BF5A 2H9GB 4ZMNA 3EYVB 4DZ8B 3KYNB 1KBBA 3C08L 2WWNA 3C09C 3UAJD 2J43A 3HPJB 3IWUA 1F1DA 5DJ6A 1KIRB 1ZANL 4LSPL 2FO4B 4OB5H 4K0OA 3BVNA 2VN6A 1A7NL 3FQXB 4MXQD 2E9WA 2BSCA 2NLJB 2ZUXA 3NGB