4HHGA

Crystal structure of the pseudomonas aeruginosa azurin, ruh107no yoh109
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEEEHFFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 30
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhgA00
1QNIA 5B1KA 1HAUA 4YVUA 1GY1A 1YLBB 5PCYA 2UXGA 3S3DB 1IBYA 3V9EA 2WSDA 2DV6A 1MDAA 2JKWA 1XB8A 4HCIA 2VSMB 1GSKA 4Q89A 4AZUA 2EILB 1IUZA 1ASOA 3NSFA 4FA7B 3S8FB 3SBQA 1L9QA 2BO0A 2IWFA 2YARA 1BQRA 3QJRB 3FYIB 3NJKA 4JKNA 4NB7A 1CC3A 1WA0X 3TASA 1AIZA 1GS8A 1DZ0A 5B7EA 3NSCA 1ZV2A 2X88A 2VM3A 1NDTA 4DP5X 3PAUA 4YVNA 1PCSA 1KBWA 3EHBB 1PNDA 3OD3A 4GP5B 1E65A 1AACA 3PXLA 1SFHA 1VLXA 1CYXA 4DP9X 2BP8B 3ABKB 2YAFA 3BQVA 4AI7A 4F2EA 2J56A 3H4HA 1NIFA 5I6NA 3T9WA 4UANA 3X1EA 3GYRA 1KV7A 4JHVA 2AVFA 4DP0X 2DYSB 2OJ1A 3FSAA 3V9CA 4Q8BA 1A4CA 3T6XA 1CYWA 3QJSB 2BW4A 3AG1B 4CSPA 4UF7C 1PF3A 3C75A 1M9WA 2GSMB 2R7EA 4E9RA 1PLCA 4YSCA 1BYOA 1FFTB 5AKRA 3AG4B 4KOBA 1JZJA 3S3BB 3T6VA 4MFHA 4YSSA 3TBCA 1JZHA 4YL4A 5B1JC 4BDVA 4YSQA 2PP9A 4HAKA 1EZLA 1W6LA 4FAAB 4WTQA 1ZIBA 2IDSA 3AY2A 1ILSA 5I6MA 1JZIA 2QPEB 3CG8A 9PCYA 1OCOB 1NINA 2IH8A 3EH4B 2YAEA 2FTAA 3U25A 1AS7A 1KYAA 1WAEA 2PP8A 4UAHA 2XV0A 4GY4A 5I5JA 3NJIA 1HAWA 2EINB 4HIPA 3WKPA 4G7QB 1L9SA 4E9TA 2IWKA 3DTUB 2J5WA 2VSKB 2QT6A 1E67A 1L9PA 2JFCA 5B1JA 1OCRB 2PPFA 2PPAA 2CALA 2W88A 4KO6A 1URIA 2BP0B 3NSYA 4W9ZA 1AG0A 4DP8X 3CZUB 3AZUA 5I26A 3QQXA 3JT2A 3ABLB 2IH9A 3AG3B 2EIKB 3OM3B 4YSDA 1KGYE 3D12B 4X4KA 4P5SA 2HZHA 2WO3B 4F7KA 3WKQA 3DKHA 4QLWA 4ZK8A 2FJSA 2FQDA 3FS9A 4PAZA 2OCCB 3FSZA 1AZCA 2Y69B 2H47C 1A4BA 3IBOA 1JXGA 3N55A 1NWOA 3ASNB 1AZBA 1J9SA 4DP4X 2UX6A 2MRYA 1E30A 1MG3C 4KNTA 1IKOP 4N8UA 1L9RA 5B1AB 3NP4A 3ABGA 1ET8A 3ZBMA 4DPBX 2VW6A 4G70B 6PCYA 4HZ1A 2PCYA 2PLTA 3NJMA 1ILUA 2GC4C 2HLEB 3QJTB 5B1BB 1NPNA 4NAJA 2CAKA 1JXDA 2N0MA 2OV0A 1PAZA 1XB6A 1AS8A 1J5CA 4YSEA 1AR1B 1BAWA 3S3CB 3N2JA 3UGEA 3T6WA 6PAZA 1ET5A 3CVBA 3NT0A 2XLLA 2VM4A 4A68A 3PAZA 2FT7A 4KOCA 2XVBA 4TXVB 1BQKA 1AZRA 1UATA 1X9UA 2DWTA 4HCGA 5B3SB 4M3HA 3SBPA 2VW4A 2GIMA 2MTAA 2UXTA 4E9SA 4M4RB 3GXUB 2I85A 3SBRA 2PPDA 2FQFA 2WO2B 4AX3A 3X2QB 1M56B 5ANHA 3SQRA 1NPJA 4G7SB 1X9RA 2XWZA 1ZPUA 1AS6A 1OE2A 5I6OA 2FT8A 2YQBA 1T5KA 7PAZA 1L9TA 1JERA 5A7EA 2FWLB 4HHGA 2Q9OA 3S8GB 2H5UA 4BK5C 1ETJA 3IN0A 3PAVA 3TU6A 1SFDA 1NIEA 4DPCX 1OF0A 4NERA 3NJLA 2DWSA 3BVDB 4JHUA 1QLEB 2IDTA 1PZBA 4DPAX 1PMYA 3HB3B 4E9VA 3T6ZA 3OMNB 1NTDA 2BP8A 4WKXA 1AZUA 1J9TA 3HEIB 4E9XA 2PP7A 1GW0A 5B7FA 2BWDA 1TEFA 5F7BA 4HALA 2XV2A 2VN3A 2XXFA 2NRDA 1J9RA 2YAPA 3IN2A 4A2HA 3CVCA 4GXFA 4YSPA 4BXVA 3FSWA 2UXVA 2P80D 1OE3A 5TK2A 1OV8A 1N68A 3OQRA 1E5YA 2GI0A 1AG6A 3ZIYA 1WS7A 2BP0A 2BW5A 4G7RB 1PLBA 3DIVA 2H3XC 3NSDA 2YAOA 3CVDA 1OOWA 4YSAA 1A4AA 5D4IA 3UABA 3WI9A 1SNRA 4QKTA 2B3IA 2HX8A 3EF4A 1RCYA 1ASPA 4YSTA 3X1GA 1SF5A 4F2FA 3FPYA 5EHFA 1EHKB 1NIDA 1KCWA 2P80A 1FWXA 2B08A 4BXSV 1SJMA 5D4HA 3X1BA 2I7OA 4DP1X 1JVLA 2IDFA 2HRHA 4AKQA 3OMAB 2Q5BA 3UAEA 2UX7A 1RZQA 4N4YB 3IEAA 4P5RA 4BDVB 3FU8A 1WA1X 4EF3A 2CBPA 2EIMB 1HFUA 3RYMA 1NWPA 2TSBA 1JOIA 8PAZA 4A67A 2XYBA 3FT0A 1MZZA 1KDIA 3IE9A 1XB3A 1BXAA 4BWUA 2R7EB 3NYKA 1JZGA 1MG2C 3H56A 5TK4A 1AQ8A 2PCFA 4W1TA 2HX7A 2LLNA 1NICA 4GP4B 1NIBA 1A8ZA 2PPCA 3AG2B 4G72B 1AAJA 4YSUA 1V54B 1QHQA 2QDVA 3WG7B 5I6KA 5IY5B 1AOZA 1FA4A 4DP6X 3X1FA 3ASOB 1OE1A 4BWTA 1F56A 5I6PA 1PZAA 3ERXA 3QJQB 3UAAA 1CURA 4DP7X 2DY2A 2JXMA 1CUOA 4AKPA 1TU2A 3NJGA 2IAAC 3FPXA 4KO7A 1GR7A 2GC7C 2W8CA 2I7SA 1RZPA 1BYPA 5E9NA 3NJFA 1AZNA 3GDCA 4E9WA 2HXAA 2ZWNA 2ZOOA 1V10A 1JZEA 3ABMB 3WIAA 1R1CA 3G5WA 5AFAA 2YAQA 3FU7A 1JVOA 4KNSA 2IDUA 4A66A 5B7MA 1SHXA 5PAZA 1N70A 2GB2A 4A2EA 3NP3A 4PCYA 1B3IA 3QJUB 4HCFA 2FT6A 3NJNA 1BXVA 3NJJA 1BQ5A 1KCBA 2XX0A 3FQ2A 3ZDWA 3H4FA 1V55B 2CJ3A 3QPKA 4L0PB 2BZ7A 1WS8A 3TBBA 1I53A 5FC9A 4ENZA 1XMEB 2YXWA 1TKWA 1GY2A 2RACA 5F7AA 4KO5A 3FU9A 1SF3A 3NJHA 2A3TA 2Y1AA 3JTBA 1W8EA 1AANA 1ADWA 1WA2X 1PNCA 2BHFA 2QPDB 3UADA 2XV3A 4GYBA 1GS7A 1ZIAA 4DP2X 2CUAA 2HX9A 3EH3B 1SDDB 1OCZB 5AZUA 4KO9A 3WNJA 2YAHA 1BXUA 4A2FA 1GS6X 3OMIB 2AANA 3QJVB 3FU7B 2QDWA 2XXGA 4RH4A 4YSRA 2J57A 2VW7A 4AKOA 3PCYA 2XUWA 1M57B 2FQEA 3CDZA 3L45A 1GYCA 1ZDSA 4A2DA 1BEXA 2UXFA 4YSOA 4GP8B 3AW5A 2J55A 2TSAA 2VMJA 2IWEA 1TEGA 3TA4D 3WNIA 5I5IA 1JZFA 3ZX1A 1OCCB 2EIJB 3KW7A 1DYZA 3CDZB 1A3ZA 3FQ1A 1PY0A 1KDJA 2HRGA 2XU9A 1SHWA 3PPSA 4K9JA 3FSVA 3X1NA 1J9QA 3MBWB 4G71B 4A2GA 2BWIA 2XX1A 1ID2A 1W6WA 2E86A 1ZDQA 4E9YA 2GBAA 1SDDA 2BZCA 4E9QA 2AFNA 2ZXWB 5LDUA 2IDQA 2YXVA 4CSZA 5I28A 7PCYA 1A65A 3PLYA 1ET7A 2AZAA 1KBVA 1MZYA 3KW8A 2FNWA 1ASQA 1J5DA 2FQGA 5I6LA 2X87A 2CCWA 3MX0B 1PLAA 3UACA 3EH5B 1NZRA 1RKRA 1IC0A 4BWWA 3FYEB 1NIAA 1E5ZA 4KNUA 1PZCA 2YAMA 4HHWA 2DYRB 2ZONA 5I5MA 2AZUA 1L9OA 1JXFA 5D4JA 3T71A 3FQYA 2PPEA 1IBZA 2GHZA
chains in the Genus database with same CATH superfamily
1FVDB 1MWAB 3O8XB 3MBED 4PY7A 1JPST 3G9AB 2QSVA 3B9DA 3ZO0A 3HRZC 4BQ9A 1L7IH 2EUVA 5AW6B 1G7IA 2X3CA 2BNQE 3C5ZC 4ANXA 4YZWA 2F6AA 5ISZA 5K9JL 3QYNA 5ICZA 4AJYV 4H1LG 1R3HA 1DQQA 3V6FA 1IUZA 4A6YA 3NSFA 2PUQT 5LB1A 4CUCA 1G43A 1R3LB 3TCLB 4DAGH 3DX6A 1P7KB 3BAYA 4XBPA 3AU0A 4S1RL 4ZUVB 4ZTPH 2Y6TE 1RZJC 1RK1A 4YO0B 2O6DA 4PUBH 5DO2C 4JDVA 1ZHLA 2EDDA 4KY2A 2RCSL 3L1OH 5D7LD 3EO9H 4DP5X 3BP5B 2H41A 3P9LA 4ZQTA 3GSUA 1SMAA 4HD5A 1UM5H 1FGNL 1DJIA 1HIMH 4UM8B 3BVNA 3CZEA 2EH7H 4AJWA 3QNFA 4JRLA 4GIAA 3VFWA 1GC1H 4AI7A 1XEUA 5IGXL 3GO1L 2AAVA 3GBLA 5IEHA 4B27A 3DSNB 4HJGB 2VDML 1MCKA 4LCWE 4MJJA 4NQDB 3ZTNL 4PJ7E 2VLJA 1W0VA 4ACTA 3UH8A 3NZSA 4G8GA 2RD0A 1JNHB 1PZDA 4XZ4A 2AVGA 1IC7L 1AD9A 3IAPA 4DVBB 1AI1H 4O02L 5KVMC 1OP5H 5GGTH 1CDCA 4RX4D 3HG2A 5DJXB 43C9B 3BO8B 3LN5B 3LRSB 3IF1A 5LG6A 1HVXA 4YSSA 1QLFA 2WUBH 3BP6A 2IBZY 3TBCA 4YEFA 4LKXA 4QXTB 3HS0B 3KJ4B 3PYCA 4RDQG 3RQ3A 5FFOA 5C70A 3WTSA 3KLHD 5FB8B 5IJVB 4M3JA 2FUQA 2IADB 4PS7A 1LK3L 1CICD 3VFOA 4AK1A 3W38A 2DB8A 25C8L 4JFPB 3S3JA 2VDKB 4OI8A 3DUUB 4ELMA 4N6RB 2EUWA 5C0RH 1LO2H 2B4CL 3SJVD 3LQAH 3UTZB 3BKMH 4OJDH 2IXQB 2IPKB 1T0OA 1P6FA 2PP8A 3QRLA 3ZDYE 1KPRA 1J0HA 2GJ6B 2VGLM 4QRRB 2NY6C 1GOHA 3CSPA 4R0LB 5M7QA 3QG7H 5GGVL 3WIHA 1EO5A 1XWVA 3RX5A 3PS6A 3KBHE 4YLBA 4BRJA 1E67A 1U3HC 4M6NL 2V37A 3D52A 2WBJB 4Y5XB 4WEMB 5JPNB 1QQDB 5I9QB 3DBXB 1F97A 5GSVB 3MV9B 4DP8X 2H9GA 2DWDB 2H7WA 4OZGF 4B0MM 2NUPB 2IH9A 3BVUA 5EZJB 4K94H 5MEOB 1HZHL 1E0OB 1XV8A 3QORA 3U30B 1N6QL 1WK0A 2VITA 3TTSA 1D5IH 1CWVA 2AEQH 2CBMA 3RI5K 3DKHA 3P2DA 3SQBA 5IVXA 3ES6A 1CL7I 4JO2H 3K80A 2AERT 3ARQA 4M1CD 1WYJA 3SKOA 5AAMA 1N67A 2H47C 2CLRB 2E46A 3ABZA 2WXIA 1UHVA 3QO0A 2H6OA 4IBTA 1S8DA 1U8OA 2VH5H 2QFRA 4NZRH 1CO1A 3MLWL 4KNTA 2Y23A 1INQA 1DBML 2MNUA 3NP4A 1MQKH 3ZDZB 4J1UA 4ZX6A 1W72B 3HE7B 2DLTA 3EYOB 4L9DA 1YYCA 2NQ3A 1U0QA 3EH1A 3Q1SL 2C8NA 3OAYH 1ZWIA 4U6VL 3GGWB 4XPGL 5DUBB 2P3YA 2VR4A 3T1WA 1EQWA 3CDGA 5I1KH 1FL5A 2ZKMX 4YR6A 1EBPA 1P1ZA 1PAZA 2MCG1 4HIXH 4FQLH 1NFAA 2XIIA 4HKXB 1Q72L 3VD5A 3F01A 5JMOC 4YHOL 1IKNC 3IDIA 3EXJA 3IFNH 3ZDZE 3V5KB 3QFJA 5AOIA 3HMXH 2X42A 5FIEA 1XH0A 1A02N 4M6OH 4PHXA 3RJOA 2X2YA 2FT7A 3DVGA 4XMZA 3P69A 3SGKA 2E4FA 1K6QL 2GSGB 2AEPL 2DKUA 2WQXA 1G9NC 1C5CL 4JHAH 2FUTA 2GIMA 2UXTA 5EU6D 2MCPL 4S1QH 1FN4B 5DD5H 4HZLA 2PPDA 4R4FL 2BSBA 4LE8A 2X2JA 3A24A 5E00B 5IJKC 1UB6B 5FYKL 3KPSA 4GXVH 3BPOC 1T5KA 5CJQH 3IJHA 3QJHA 3SE3C 3SY0B 5C0AD 3BZFA 5LNGA 3X13A 4HUKB 1LXMA 2CKBL 2NQCA 4WUUD 5DRWA 2GABA 3O45B 4M8QA 3UTTA 4XBEL 5T5NF 2P44B 3ZHDA 3P54A 5CP3H 1QBLH 1VB9A 1OF0A 2BOCA 1W8NA 3AXLB 2XOTA 4NERA 1K5NA 2Y06H 1SN0A 5DYOA 2FSDA 3OKNB 4ZO9A 5KYYB 3GJEA 3HC2A 1XGQA 5A2KH 3LD8B 3RTQA 1A9BA 4WKXA 3FN0H 4JAMA 1MI5D 3GXNA 4OIFA 2QV4A 3D3VB 3RDTA 5KSBB 1T66C 3O4LE 1TEFA 2H26A 4ZYKA 3CSYB 2X1XR 1OAXL 2CLVA 5DI8A 5DZAA 1BECA 4HMCA 5E8OB 3IU3B 1PYWB 5D2LF 3DV4B 3MUHL 2VDOB 1FZOA 4J3OH 3HKFA 1JXKA 5KVDE 3G6AB 1KBGL 4D0BB 4G6ML 4XOAA 3T5WA 3S7GA 1XGYL 3QE5A 2H3XC 3FTWA 2HUEA 4F1SA 4N5ED 3UABA 3BKYH 3RHWF 2HX8A 1T1YA 2WZ6A 4MMZB 4N0YH 4ZUTA 3UAJA 2WAQA 3E2HC 3MNDA 3PV6A 3BUYA 4EDWH 1IGFL 4JRXE 2N3JA 5JORA 4AUYA 1KIQB 1WEJH 2D9QB 4ZPVB 3TBTA 4OQTA 4L4VE 4LIQH 1JVLA 2J25A 3C60A 2XKUA 3TN0D 1AQKH 1GGTA 4P4RA 4UT6L 1TJMA 2LT9A 3EBHA 3N06B 2UZIL 5EZIH 2WD0A 4PY8J 2UWEB 2ZXDA 5F70A 4GSDH 1UA6L 4PJFA 4GQPH 4IK7A 1EZUA 1UWXK 5SWQB 1HFUA 2NY4D 3FO1A 4Z3TA 2W60A 5CFHA 4LSUH 3UYPB 5FO9B 2EEXA 4GG8A 1SN2A 1HILB 3DVIA 4JREB 8PAZA 1EJOL 4YPGB 3JVFC 2DLFL 3PWUA 2F5AL 5TK4A 2EIZB 3MRGA 4U1KB 2EEFA 1X3DA 3DIFB 3TURA 1EHXA 1NCIA 4YBQD 4DEWA 4EIZC 2WLZA 1X5XA 3S3SA 2Y36H 4HBQA 4F3FB 2ED6A 1E4WL 1KG0B 2NDGA 4XI5D 3QQ3B 4GW5B 2W1NA 4PWEA 4TVUA 2A5UA 1WIOA 1FBIL 5DC0A 3B5TA 3I85A 5B3NA 4GAGH 4G9FA 3KEHA 4Z3IA 2HVBA 2QJDA 3DGDA 1AO7A 1VFAA 1RUML 3GXIA 3P77B 3RDTC 1TZIB 1A47A 3BSHA 1T21A 4ZSOE 3T09A 3FB8B 3W0WD 1KYDA 1OW0A 4UBDC 2EXYD 4H8HA 3ARFC 3EYFB 2AJXH 4UZGA 2YKLH 2DI7A 3ALPA 4WU7B 5D5MA 5IQ7H 3WIAA 1ZLEA 5E5LA 5DGQA 2F7OA 1MFBL 4KAQL 1FO0A 1FJ1B 3GXTA 3KPTA 4FX5A 1TCRB 4H4NA 3TIEA 3U7YH 3ZTNH 2YD2A 4XBMA 1EEZB 4FLQA 1KXTB 4RMSA 4O58H 4X8XA 5TPWH 4KKZA 2R0WH 1T0PB 1PG7L 3U83A 5HYJA 1TFHA 4ZUUA 2NYYC 5HYIA 3V95A 5IBLD 1CVSC 2IPUG 4WW2B 2ICWB 1TNMA 4KI5C 4WY7H 1TKWB 1W0WA 3CZSA 3KXFA 4LCVA 4QRRD 3CVHB 5D96C 1GCFA 3FQNB 3KAAA 4AY0A 1R4XA 2MOGA 4G8IA 2O61A 3TWCH 5I75C 3MRBB 4GBXC 5BJTB 2ADFH 2ZYSA 1MWAL 1T1WA 1HL4A 1PX3A 3VXSD 5EN2B 3OHXB 3HBGA 1PX8A 5KZCD 1YSOA 3TBVB 1HESA 1OP9A 3NPSC 2XZQH 4LSPH 4AGLA 1ZIAA 3QEHA 3KCWA 2J20A 2DD8L 1U8QB 5D7SH 4PBVC 4NSKA 3Q05A 1EANA 3QJXA 3FU7B 4AZ8B 1M6OA 1HTYA 4YHIB 5FGBC 5TDPB 4FI8A 3V4PL 4GS7C 3JBG7 2V9TA 3POCA 2YD9A 3L4YA 4JPIB 4X9BA 2P28B 1I1RA 3T3ME 3L4TA 4KTDH 2DI8A 1BCIA 1NFDE 2UXFA 3CN4A 3P73A 4RGNB 2BIOA 1JGEB 3O6FC 2DM4A 1TVHB 3MPCA 1NCTA 1G1YA 2OL3A 3W39B 4IKIA 3WY2A 5I1LA 1NL0L 1S4IA 5ESQA 1TU2B 3W81A 2ZPKH 3FCSB 1KDJA 4QXGL 3L5HA 1TQBC 4PRBB 1SHWA 4PJGB 3VRIB 4F7MB 3NCMA 1Z9SA 4WQOA 1NGZB 5E1GA 4J4PD 4B9GA 5A2BA 2XX1A 4ZFGL 1AGEB 3W9DB 5F71A 4FEIA 3MGTA 3ZE0F 1XF4A 3PXHA 4Y16C 4IEFB 5B22A 4GW4B 3LNDA 4HUXB 3IDYC 4P0DA 4PG2A 3SCMB 5I16B 1X7SA 1P2CB 2VM9A 1EUUA 4XX1G 2MKWA 3O9WB 2GJZB 4YHPA 4JHWL 2JB5H 1A7RL 1T1XA 1F45A 1YNLH 2X4OB 3KM2A 5IM7B 1ZGLB 2LW3A 2BY3A 4PQXA 3QC6X 1E4XI 4L8DA 4GEJA 2VZSA 2ADYA 1XMWA 4GLRH 4KK5D 3N1QC 2Z93A 2ZSWB 1SYVA 1ZS8A 1NCNA 1PPIA 2A9AA 5KN5B 3N40F 3LXUX 2DQFA 4XCYA 4PGCB 2BPBA 3CSGA 3D39B 4U1HB 4Z6AT 4OD3H 4PJBE 3V9EA 4PJ5D 2OP4L 3GRBA 2JKWA 4ZAKD 1TTBA 4AW7A 5KVEE 2D3VA 3OKDA 3BGMA 2Y7LA 1KGUA 1JF1A 4OQTH 5E5MB 3WNPA 3UTSA 1EBAA 2K7QA 2DH2A 2F18A 3K5RA 5ESVA 2WTPA 5GRJL 5DHVB 4OUUA 4XPBL 2NY1B 4BSWA 4P57B 2YO3A 4YL9A 4Z7QF 1SVZA 3WIFA 2R0KH 3DK0A 3NSCA 4EZLA 3ZYIA 2DMCA 3IXTA 4MMXC 3FUIA 1SM3L 2X89A 1S9WA 1QSEB 2E75C 1QTYT 3NG5A 2NY0B 5DRNA 2H2SD 5EDXA 2A6DB 1AQMA 2C3WA 4XTRD 5HI5C 5ECJE 1MRDL 2BNRB 3O41A 4S2SA 2YAFA 5F7EL 1JNJA 4KV5F 3V6OA 5FDWB 4LMQE 3OXRB 3QDGE 2ADIB 4XX5A 1UOWA 2IWGA 1Z9MA 1FVCA 1UXWA 2XTJE 4JHVA 2E3VA 4NO0A 2RCSH 3WJJA 4BSVA 3SGJA 4AQ8A 3QUHA 1RUQL 1Z6JT 4HUNB 3MBEA 2FZ3A 1YEDB 5D1QE 4H8UA 4UF7C 1MCOL 4ORGA 3OG6B 5DD3H 5GISH 1TZOA 3J27A 3CVHL 4TUJA 3KPPB 3BSZL 1QSZA 3MYJA 3ILQC 3QIBC 3UPAA 1LDPH 2P8PB 2ALWA 4OLYH 1DVYA 3VD0A 1KNOA 4MDJA 2YPVL 4UT9A 4A2MA 1MFMA 4DO4A 4FKEA 1MCEA 2ENJA 3UPRB 4QXWA 1XEDA 3D2UD 1IE4A 4TRPL 2XTLA 1L5GB 3P0VH 1H8OA 1LK2B 1Z66A 5FFLA 2F5BL 1CICC 3RX8A 5IQOA 1CPUA 3V0VB 4TNFA 5HJ3B 5HGAA 4WWNA 1M2OA 3E6FA 4NS0A 3HI1B 1IQDA 4WJ5A 5F7DB 3V9FA 5B3JF 2X4SA 3DX4A 3VWJC 1C5DA 5GGRA 2Z34A 4QRPA 4KZCA 1Y07A 4IRJD 2VN5A 2VQTA 3OZ9L 4L8SC 2F7QA 2XN9D 4UB0H 4NIYE 1ZT7B 5DD0L 1MIEH 3CFUA 2NXYC 5FK9A 1WAPA 2EQDA 3TO4B 2FO8A 1MHEA 3AXHA 4XCNA 1OHQA 5BUAA 1S7QB 5AVWB 3GBDA 1UKSA 1QZ1A 4X0KB 2EVHA 4YSDA 4GUQA 5ICYA 1UXLA 3MKGA 1AGBA 4YGVA 1PKOA 4ZMOA 2FBJH 3UO1L 2C9AA 3B2PA 1IC4L 5J56B 4ODHL 1ZLUK 1CR9H 3FTYA 4N2FA 1EWHA 3PJSB 5E9DD 3V7MA 4PLJC 5E1QA 5I5RA 2Z7YA 2B2XH 4FNSA 1J1PH 3FT2A 1ZXQA 3F62A 2G9KA 2APBA 2BOBA 4BZ1H 4FL4C 5D9SB 3SDXE 3MCYA 1SXAA 3FU6A 3FTGA 3NIGF 3C5ZD 5I1IL 1CQYA 3MRFA 5KTEH 3Q9QA 2VXQA 2EYRA 2Z64C 3HBZA 4GRWF 3QHZL 1FZMA 5I1HH 3L95B 5BW7A 5JHDD 2QADB 3L9RA 5TQ2L 2ZG3A 3RAJL 4HK0B 1EEQA 1CXLA 2R27A 1PTZA 4WW1B 1XF2B 2V3EA 3DO7B 2FJFA 3QJTB 2NXZC 2NY7L 3QG6B 1A3LH 5JHLL 5KAQF 2MQCA 2BS9A 2NNXA 4OGAD 2A4EA 5TE6H 5I19H 2YUZA 3QUKA 1J5CA 1B4JL 1E8YA 4HIIB 1RPKA 4S1SH 4YDJA 3R8BB 3HC0B 2R39A 3WFCL 3OXSA 3MRDA 3N43B 4WGWB 3TOPA 6PAZA 1RZFL 1P7QB 3NT0A 4LDEB 4K3HA 3GXDA 4AMWA 4KDTC 4L4TA 5FLUA 4ZMTA 5DK2A 2V7HB 4A68A 5JYLA 5KVEL 4LB8A 5D6CA 4GMSH 4HWBH 5CEYA 1KJ3L 3HN5A 3MV7E 1T83C 3X17A 2FO1A 3VG9B 4PWKA 4M56A 3ZKSD 5G4NA 3TO2A 4XBEH 1T2JA 3ROOB 2CGRH 5TPWL 2ESVB 4Q6IC 3S4SG 3PGFH 5HBBA 4JZNB 5DJAA 1MDTA 4WWKA 5C0CB 2B9AA 4OZHB 2OSYA 4OLZL 4MB4A 3SOBL 5DS1A 2JB5L 2E9IA 1Z5LA 4GKNB 1CFTA 5DZVA 3T0XA 3VD3A 3VFSA 4CW1B 3IDXL 3CVIH 3AFLA 3FDWA 3NIFB 2FWLB 2Z0BA 4K3GA 3KLKA 2EH7L 5D55A 3K46A 3NGBC 3MXVH 3D3VE 3IN0A 4HV8B 4PJBA 3WEXB 1RZJH 2IQAB 4ZQKA 3QJFA 2CRYA 2VIRB 3RNKB 2C1OA 4HSQA 3PL6D 3SEPA 1OT1A 2VLMD 2BSCA 4H1LH 5JHLA 5KBNC 1L6ZA 3VXUE 1WFTA 2R0LH 3KPLB 4L2YA 1AYRA 2O30A 4DKFL 2YA1A 4U4BA 1MH5A 2EDJA 4IS6A 5CEXA 3DXAB 1EJ8A 1TFPA 4NQCB 3ISRA 3B2UC 3MRLA 3BUPA 3IDMA 4HHAA 4PJIE 1U58B 3CIAA 4PBXA 5ACZB 1OGTB 4PJ7A 1DN0A 3IN2A 4JFEB 4A7GF 1BREA 1QR1B 2BS71 2XRAH 4M5ZH 1I1CA 1DSFH 2CHXA 3QEQA 4HIQA 5E8EB 2A6KA 2GI0A 2VL5A 2V9RA 2X0VA 2ZJSL 1GYWA 4TKWA 3OF6D 3MI6A 1FH5L 5FUZH 5FYLD 3UTQA 1CE6B 5JIKA 1MAJA 1A4AA 3MNMA 5D7IE 2E74C 2OMZB 2Y6SD 1QBAA 5DDHB 2DTMH 3DPBA 5HHOB 3DTDA 3X1GA 4L3EB 3DMMA 3FPYA 1ZVHA 3H3BC 5EHFA 4OD1H 3O4OB 4OIIH 1OP4A 2VLRD 4NNYB 5DS2A 5MENB 3LX9A 2Q1EA 2N1KA 5EO9B 1XIWA 5FO7B 4HUVA 3O3EA 1QSFD 3JWDL 3NTCL 5K9QG 1BFTA 5D7IB 3V8CA 3KMDA 4P9HH 2F74B 4GUOA 4E5XA 3R7RA 1UZ8A 4OIAA 1HNYA 3MX0A 4OLUH 4Z77A 1WLHA 4XVSH 5KOVC 3QWOA 1OP3H 3GRWL 1WC7A 1Z1WA 3MCKB 3IGKA 1MJJA 4Z0XB 1OM3H 3RRQA 1LE9A 1SJEB 2D7OA 1NEPA 3NIGB 1FUNA 2XXCB 3EO0A 4X7EC 1S9YB 5JR1H 4KUCF 4BWUA 3U36B 1E42A 1YC8A 3Q44A 4IIQC 1HSBB 4GP4B 1MCCA 3DHMA 3QYCA 4Z3EA 5CZXC 3LOWA 1U8CB 5EUOA 2WXOA 5J6HA 3UMTA 3CFBB 2VH5L 4KZ0A 5IG7A 1YY8A 1ITBB 4DQAA 4UZUA 1VZGA 3D8MA 4WKZB 2WQAA 3KYKH 5CXPA 4M7ZB 5IQ7L 1CUOA 2Z31C 1XF1A 2VDOL 3B9EA 3HE7D 4Y19A 4KO7A 2WV3A 4N2GA 4CU8A 5ABDE 1CXEA 1I1AA 2ATPA 5D1QC 2V9UA 3S96B 2JJSA 3VCLA 2M1KA 4MYPA 4ES9A 2R0WL 2P5ED 5IHHA 1BVNT 4L9LC 2K4WA 3ECBB 5GRVL 2D7PA 2VB5A 2QQQA 2Y07L 4NN6C 2B2XL 1IGJA 3H42H 3KYMB 3AM8A 4NN7B 1S3KL 4HS8H 2XWDA 2L7JA 1KT2B 3H8NA 5F7EH 2XBTA 3O3AA 2XACC 3IFPA 5B7MA 1GC1C 1VKXB 2HSIA 3HHSA 4FD0A 4LBEB 5AZEH 4EZMA 1N70A 3AABA 3MLVH 4PCTA 5BZDB 3QJUB 1BGXL 3HN3A 4GEIA 4R97B 4XNAA 4BA0A 2ARWA 1E8XA 1KCBA 1T5XB 3KYOB 4L8BA 1I85A 2Y7QB 5EIIB 1GYUA 3FQ2A 4KMTL 3MLTA 1G6RH 2HTKC 2NMSA 5E1AA 3VXTB 2HH0H 2JQMA 1WWBX 1T0MB 3GS7A 4L0PB 3MO1A 3I3BA 3FCGA 4FABL 2WYHA 5AVQB 1CYGA 3G7TA 4W9IC 5BRZA 3MJ9A 2F0CA 1T0MA 5TQ0L 1B4JH 4QO1A 4L4TE 2OR9H 1XH1A 3MLTB 4TNVF 3GMLB 4O58L 2Y7QA 4ZFZA 4L8BB 4W9KC 5DVLA 2C7FA 4Y4HB 3UEQA 1PNCA 1T3FB 2BHFA 2QPDB 2A83A 3EOYG 3UO8B 4UNVA 2Z35B 1NCWH 2EDLA 3HHSB 1VKXA 1N0XH 1FG9C 3IB4A 4K5PA 5I9QC 1IZKA 3O3AB 1GS6X 2XN9E 2AANA 1U2CA 3FHEA 1HH9A 1KT2A 2JLLA 3LAFA 3TZVC 4YJZL 2K6WA 5DCCA 2CO3A 4LSQH 5I8EB 2OZ4A 1IGJB 3KYMA 4H8VA 4NNXA 3VRLF 1DL7H 2C9SA 2WW8A 5E9DB 5C0JB 2YMXL 3ECBA 3Q7JA 1SHSA 2WBWB 1MF2H 4I18C 3HMXA 2EE9A 1KWKA 1J1OH 1FZKA 1CLVA 2X6CA 3CFKB 1OCCB 4RMTA 3M1CA 1I3GL 2LGNA 1DYZA 2YWZA 2HT2C 4YZFF 5F6IB 1IC4H 4K5OA 3C9NB 3DDGA 5DJ2A 3SYPA 4LASL 3U7WH 4RIRB 1QD0A 4PRHA 4WKZA 5CJ5A 1NUGA 3UZQA 5IG7B 3CFBA 4QIRA 4BFFA 5ID1A 2GTWB 3Q01A 4LOUD 2J8UF 2JV6A 3PV7A 1QA9A 1U3HA 4GO9A 2X4RB 1NFDA 4XI5C 3U36A 7FABL 3MXWH 1YDPB 4YZFE 4BQBA 2NY3C 4FQIH 3UBXI 5KBKA 4YH6A 3RU8L 1N8ZB 1WC7B 3MCKA 1AGFA 1UOKA 3RVUC 3ATBA 4P46A 3KPOB 3MX0B 4ZFOB 1PVHA 3WEOA 4KNUA 2F74A 3RWIA 1WVZA 4U33A 5C0BB 5D7IA 2ESVD 1V3LA 3JVGA 5C0EB 4HUVB 2O5XH 5JXAH 4C56E 4L3AA 4MSWA 4PJ8D 4XMPH 3MLSH 1L6XA 1UEYA 4H2AA 1VERA 3DGCR 2EDQA 3GSNB 5B1CA 1JPTL 3DMMB 4PJFE 3PHSA 1HCZA 5T3ZE 4OD1L 3TJPA 1OAYH 1IBYA 5KOMC 1CLOH 5DDHA 3TP4A 4J3TA 4JFEE 4OGQC 3D50A 4V1DE 4QOKA 2BK8A 4KMQA 2AQNA 1CE6A 2ICWI 3TYFB 1ASOA 1WTLA 2VKWA 3CZLA 4CGTA 2A6KB 3GKZA 4D9QD 4LBAA 4FYQA 2DIAA 3WUZA 4FDWA 2X4TB 2BNRE 4G5ZL 3TASA 7CGTA 1DN0B 4JY6B 1OGTA 4PJ7B 3LEYL 4N87A 3UJTL 1TNNA 2X7LB 3IDMB 3L6FA 2CUIA 1ZRUA 3MRLB 4X7SL 1F4YL 3VACA 1KBWA 3AC0A 4NQCA 4QAWA 1G5GA 5T5FH 3OR6A 4IS6B 5DWUH 4LSRL 1DVTA 1RUPL 3CTTA 3LD8C 3ABKB 3KPLA 1KBBA 2J56A 3OC5A 3V8OA 3KS0J 3IRCA 4Q7DA 5KSBF 3K3QA 2FEEI 5AKVA 2OJ1A 1L0PA 3SN6N 4NAQA 5FAAA 3RNKA 3A6CL 4ZQKB 3SY6A 4JE4B 4X6DB 3WEXA 4HV8A 3VX0A 1TLKA 2R9HD 3C5ZA 3C75A 3ETTA 1BZOA 3EFDL 2JSFA 1E2VA 5AVRB 2HCZX 4YPJA 4YDLB 3BZ4A 4XMPL 3OKLB 4CW1A 4TMPA 2NPLX 3VFSB 2X6MA 3ZTDC 3VW3H 4QJ3B 4AV4A 1CFTB 3LN9A 1KPVA 3BLPX 3DBSA 3N91A 5I73B 3L8QA 4OZHA 1XZ0A 3WFBL 4WWKB 5DFVC 5DJAB 4JZNA 5C0CA 1ZT1A 4H0GA 4WTQA 1LWRA 3N85L 4N90E 3WY4A 4FAAB 2NY6D 5J6GB 5GGRY 2VXUL 1QSFB 4PB9L 2P8LA 3V0AC 3ROOA 1WT5C 3TFKD 1CLYH 1KACB 4N9OB 3HE6C 1AS7A 1QEXA 1UD2A 1WAEA 1HOCA 2XV0A 4GOSA 4TL4A 2AMGA 2WZ0A 2YRZA 2XSKA 4HIXL 4UUJB 1MHPH 5D6CB 4KKBD 1BJ1J 5F97E 1OAUH 5BV7H 2V7HA 4YHOH 4LSVH 5G2NA 2QT6A 1L9PA 2YEVB 4YK4B 3MRDB 3UPCA 1F0LA 1URIA 3SYQA 1Y1UA 4PIBA 1T89A 4YDJB 4HIIA 2PYEE 3M45A 4HGWA 4JW3A 4Z95L 3HS9A 1TMCB 3TBWA 5KANG 2EIKB 3LB6C 1KIRB 2FJFB 5AB9A 3OKOB 4N2IA 4LKCB 1XF2A 1YYLH 4WW1A 5EOTB 2HZHA 2RJMA 2AEWA 4QXGH 5IFHL 4JKMA 1AC6A 4QCIA 1FZMB 1GYVA 2EYRB 3T3MB 3MRFB 3WD5H 5CILH 3EFDH 1NC2A 1FQ9C 3FTGB 2R2BB 4WW2F 3N3EA 5D9SA 1CTNA 1YUKB 4OFYD 4CNIB 4X5PA 5AG8A 3VXQA 3PREA 3K72A 4YHNA 1MG3C 2E7BA 1JYXA 4H26B 1U42A 3ARED 4HH9A 2WZAA 5EORL 4XCFL 1N5AA 1SLWA 4HQQH 2AK1L 3ZY7A 4BUHA 1AGBB 1OSEA 5ICYB 4FFVC 3VWKD 4X0KA 1S7QA 4NAJA 1MHEB 1RY7B 4XCNB 1JXDA 3KL5A 2OV0A 5FK9B 3SPIA 4IU2B 1FSKB 1ZTXH 2PWGA 1UH4A 1ZT7A 2OQJA 3MLYH 3P3TA 3R18A 4LIQE 2EDHA 5LUMA 1Q0EA 1WO2A 4OCYL 3HI1A 1F2QA 3E6FB 1KFAL 3HA0A 5HGAB 3D39D 3IMTA 3ULUF 5HJ3A 3EO1B 3V0VA 1BQKA 3KE0A 4C4KO 4NRXB 4W9FC 3S6CA 5EA0H 1LK2A 1L5GA 5AD0A 3DX9A 3BVXA 4YBHA 3ROLB 1OPGL 3UPRA 4TNWF 3EUDA 5T3XD 5EU4B 1KJ2A 5FA3B 3AMLA 4G7SB 4MDJB 4OM1L 2ZP0T 2G2NA 4XAWH 4XZUA 5GS3A 1FCCA 2QTEA 4W4OC 3NIDB 2YQBA 4XNBA 3TX4A 1E5AA 1RUKH 5LDSA 2A6JB 3MYJB 4RAUA 1I3UA 2Q10A 1XXDC 5ALBL 4O2EB 3KPPA 4U4IA 4PG9B 4TUJB 3CQQA 1ZAGA 4H8WC 4LL4A 2OMBA 2Q9OA 1C1EL 3FU0A 4NZRL 3HNTL 4ORGB 4DKEL 4J2XA 4PD4K 4PRIB 1NIEA 1YEDA 1GL4B 1LO3L 1N2RA 4G6AD 4KZDH 4ICXA 2ZXQA 1MXGA 2N56A 5DR5L 4BSVB 1UXWB 3GJFH 2MJWA 1PZBA 2K9FB 5LBSH 3O6KL 3OJDA 3WFZA 3ARTA 1JJUA 3ZYZA 3O41B 2BNRA 5DEJA 4M9PA 4Y1AD 1GW6A 5KW9L 1NGPH 2YJLA 2AQ1A 1CN4A 1DJYA 1QG3A 1KYFA 4DKAA 5C2BH 1QSEA 3SO3B 1PLGH 2W9LA 2NRDA 4KWUA 2JQAA 4EUPH 2JWYA 3EJRA 4CU6A 3C2AL 5E6ZA 1AHWB 5CD3B 1ANUA 1ZE3C 4RISL 5IW3A 3LHPL 4P57A 4Y89A 5AW5B 1J1OL 2X5PA 4Q9RL 2I60H 5DHVA 3LH9A 5DZJA 3AMKA 4IJ3B 5ESVB 2V8MA 5BVPL 1KB9K 3UTSB 3NSDA 2Q3AA 1JF1B 3BGMB 3P0VL 4PI2A 3DJTA 1HDMA 2G5UA 3SODB 2IAMD 3MRNA 4QKTA 2B3IA 3HFFA 1ASPA 3NA9L 4U1HA 4YSTA 2WMPA 2DQFB 4XCYB 4OD3L 5J1SC 3Q8EA 3QYMA 4F8OA 1HT6A 1SYSA 1CTMA 2DM2A 1YHPA 4V33A 5C86A 4R0LC 1MCRA 1C12A 2IFFH 1WAAE 4JFHE 4IW4C 3IPEA 1ZGLA 3H3PH 2R8SL 1YEGL 1F1AA 4YDVB 5TFSL 2XTJB 3ATFA 4PHZA 4X5XB 4YHPB 5JXEA 2WBJC 3F6IA 4Y5XC 4JDTL 4JFFA 4MKTA 1LO0H 1ZV5A 4XP9H 4URKA 4LVHB 3HHMA 1KCLA 3SCMA 4HUXA 1MZZA 4HCRA 3N40P 1XF4B 4BCXA 1LL1A 3WN6A 2NNFA 3UJJL 4KHXH 4YX2H 3VFVA 1NBCA 4TSAH 5I1GL 2FWSA 4UDTB 4DPRA 4DUWA 2IBBA 1A9VA 1C8QA 1NGZA 2BFVH 1Z9SB 4F7MA 3UTTE 1HS6A 1JV2B 1R5WA 1NKGA 4PJGA 4PRBA 4N68A 5FCSH 2ZUXA 3FCSA 5DU7A 2BDNH 6FABL 5F8QC 1TU2A 5CZXD 3TT3L 2FSEA 3UOAB 3WS3B 1OPOA 4UBDD 1NOFA 3CN1A 4GT0A 3U1SH 1XAUA 3S48A 2OL3B 3W39A 2QTVA 1J11A 1JF5A 1JGEA 1YEKH 4BFKA 4MNGE 3HE7C 2YZ1A 2N01B 4JZJB 3EHBD 1UUSA 1OK8A 1INEL 3UZEA 4QRQB 2VZVA 4QT5B 4A7VA 4YHIA 3EUUA 2V6HA 3FO0L 2Z6FA 1M6OB 2Y5QA 4UTBA 3FU7A 4AZ8A 4KNSA 2K3HA 4EBQH 5E6YA 1P5UA 4NSKB 4KI5D 2O4EA 5F7NC 1A0QH 1NLDH 1NMBH 1YNTF 3ZT7A 4EQ3A 4XVOA 4JQIL 2OZ4L 1V3KA 5CIPA 1KGCD 2W92A 4PI0A 1UD4A 3L3HA 3L4WA 2VDRB 5EN2A 3RVXD 3FFCA 1T1WB 1MW2A 1CZ8L 1J0YA 3H4FA 3P3SA 4ONGH 1KZQA 5FYJE 5LN4A 3DHUA 5GIRB 5L9DL 2F8XC 1AH1A 3MRBA 1HHJB 2OFQA 4AYFA 5EBMA 4G8IB 2O61B 2NY2C 2WZ5A 3FQNA 2JELH 3CVHA 3R8QA 2G4EA 1XMEB 1W0WB 1TKWA 3KXFB 3Q6GL 4XP4L 1B2WL 3I6SA 2DMGA 3FU9A 4KO5A 3O2WH 1RUAH 1SLXA 4E41E 2ICWA 3BPOB 4JPVH 1MLCB 3JTBA 25C8H 4L8CA 1OGAD 1AANA 5DMYA 5HYJB 4V2CB 2D4FA 5EUKA 3PFQA 5JHMA 1EEZA 4UNUA 5BRQA 2BRRH 4HC1H 4TLUA 4P2QA 4UV7H 4E0RA 4FFZA 1KGWA 4F33A 2ISDA 3DOSB 4A2FA 1FJ1A 4Y2DA 1FO0B 5BOPA 3T8MA 2WINB 1D6EA 3TO4C 5L2JA 3M86A 4YXHL 2QVKA 3EYFA 2K4AA 3V0EA 5I1HL 3KGRA 2XUWA 4AEFA 3QZOA 4JG5A 2XY1A 3TZVD 1T21B 4RA0C 4F58L 1FLRH 1NBYA 2CCVA 3VFUA 1S7XB 1TZIA 4HUWA 1W15A 4OLVL 3VI4A 3P77A 4EBQL 3ARPA 3S5YA 1TEGA 4L0ZA 1EEUA 2NR6C 1AO7B 3PQYE 3F6LA 1JGIA 3GZPA 3DPDA 4LRIC 2XJKA 1T2XA 3B2VL 4G9FB 4M62L 3RWDA 2HRGA 2AC0A 4N8PA 3RY4A 4CMMA 1WZMA 4ODWA 3GKWH 4GW5A 3QQ3A 3R4RA 2R56H 3MBWB 4DN4L 2H3KA 1UD6A 1WD9A 3MGAA 4PJCE 4F3FA 3K0WA 1FAIH 3QA3A 5HJBA 4AG4H 1FNSH 1L3WA 3VSVA 4E9YA 1NCDL 5SWZA 3DIFA 4LPYA 2EIZA 3MRGB 4U1KA 2VSDA 2EDWA 5F96L 1SXCA 1B4TA 1B2WH 3PWUB 2YLHA 1HILA 1LMIA 4GG8B 3KWTA 2M26A 3PLYA 4JB9H 3NCFB 2ZXAA 3UYPA 2A9DA 3FO1B 2VZOA 4FQJL 5SWQA 4ZMWA 1S7UA 5E1IA 4OI9A 2EEDA 4PJFB 1FNLA 4X98B 5CN2A 5CZKA 4R84A 5KYXB 5GSRA 4CBZA 5I5MA 2PKDA 5FM5M 3U6XS 1UOVA 1FNAA 1EX0A 2GHZA 3C87A 5D7JA 2ZG2A 2HMIC 1KIQA 4TVPH 5JORB 1SY6L 3BUYB 1YLBB 3V4VH 5IHLB 5FW8A 4OFIA 1O7DE 3T0ED 5DD1H 4MMZA 4Q6IB 1T1YB 3LDBB 3WTVA 4L1DA 1UM5L 1XGUB 1CVRA 3S8FB 4EN3B 2DQTH 2J8UE 1JNNH 2ZCHH 1CC3A 4JO3H 4PWJA 4S1DC 4D0BA 3RWCA 3G6AA 2MCAA 5EO1B 3QEGL 2D0GA 1IFRA 1RV6X 2ZCZA 3DV4A 3HZKA 3NGBB 3P2TA 4O4YH 5C71A 3VVVA 1XSOA 5E99L 4OZGA 1UD5A 1THCA 2C9XA 3Q48A 5E8OA 4OT1L 5LWYL 4M8RA 2CLVB 3CSYA 1FZJB 5D1XE 4ZYKB 1AACA 3RDTB 1PG7W 1BW8A 3OKKA 5EEXA 3SDCA 4JAMB 3UJJH 1F4XH 1FC1A 4F2EA 3MOQA 3RTQB 1U36A 5I24A 3FRPA 1XGQB 3GJEB 2YFNA 3T9WA 4DT2A 5KYYA 2FEEL 1GSMA 5DYOB 4BUGA 2AVFA 4R8WH 1DBAH 4HP5A 1JGVH 3INOA 4FG2A 4QKXB 3AXLA 2BOCB 1A7RH 3WAJA 1V8HA 2J8HA 1JFQL 3V4UL 4NFBA 1N59A 2R7EA 5DZNA 3O45A 4ODTH 1J1PL 5DRWB 3IS1X 4XNMA 3X13B 3AG4B 2WXPA 2WTOA 4IBQA 4UYPA 2PYFA 3IJHB 4L29A 1UB6A 1MCLA 5E00A 1P4LB 3BQUC 1O9ZA 4WHCA 2EYTB 3DROB 5F0JB 2F8IA 3OL2A 5IQ9A 2IDSA 2EDOA 5I17A 3S37H 2FX7H 4ETQB 2AQTA 3ESNA 3FUHA 5CD5C 4I1RA 1OB0A 3LKRA 1FN4A 4PWHA 5F2FA 3RIFF 1OL0A 2OMWA 2YAEA 5DLMH 1S7TA 3T1FB 2CDEB 2HRPH 3VFRB 4GY4A 4QWWD 2EDNA 2ATAA 4JFYB 3DVGB 3RIAF 3TV3H 3GMOB 3K4DA 1D5IL 3TEXA 4JFHD 4NNPH 2EH8L 5KJ7E 3E8UH 3P0YL 4E9LA 2PPFA 4ZZKA 3V5KA 1A5FL 1RVFL 1HXYA 3IDIB 4TVPD 5DURB 5FYJH 3VXSB 4B5EA 4NKIH 2YPLE 2GITB 1XAKA 1T2QH 3ZPDA 1P84K 2DRUA 2FX8L 2EAEA 1FL5B 3EJYD 3KDPB 4YR6B 5AVUB 1KJVB 3GGWA 1LWJA 1ZWIB 3SDAC 4N8CH 4MNGA 2QLVB 4J1UB 2WXMA 1KB5H 1LEKA 3QI9B 1U8PB 4MAYC 3FSZA 4X6CB 1U8OB 3C8KB 1GIGH 5FM8A 3MC0A 1JXGA 3N55A 3N44B 4Q6YA 4D2NA 1DQLL 5C0IB 4MA1B 1E30A 5DJZB 4ZI8A 5E0FA 4LF3A 4LHUG 2ICWJ 2AEQL 3ES6B 5IVXB 1SHMA 2MOQA 3LSOA 1NCCL 6PCYA 3MODH 5SWSE 5HYJE 4PIRF 3IJ7A 1TT6A 4IMLA 5ETUB 1YJDL 1TPXB 4QHLA 2HLEB 3QORB 4XOCA 5D71H 1RMFH 4OF0A 5EZJA 4Y5VC 3QNZB 3SCMC 1DANT 4R90L 3T2PA 2DWDA 2H9GB 1CDGA 5GSVA 1I9RL 1F3RB 1O6VA 5FDYA 5JPNA 3LQZA 4Y5XA 2WBJA 2ZCKH 3PDGA 3WOVA 1KEGH 4E41A 2O5YH 3CVBA 4JM4H 3WUWG 4GQ9H 2WLHA 4U6TA 1BP3B 3ZRCC 4R0LA 4QRRA 2GJ6A 4PV1C 5KEZA 4QRTA 1SRDA 4A63A 1KPRB 3VGAB 3NVQA 2IPKA 1A6VH 5GZNA 1QWNA 1JWMA 4I0CC 3MLYL 3VSTA 3LZPA 3UYOD 3GXUB 4ONFH 2FRGP 3GNMH 4N6RA 5I1EL 3QDJE 4JFPA 4NZDA 3VFOB 2VLRE 2IADA 4KQ3H 2Q7YB 2N7BA 5I18L 3HS0A 1MFDH 1H3XA 3ORJA 4QXTA 5L9DH 1ZOXA 3V7AE 4NUPA 1QLFB 1O7DC 3BP6B 5DVPA 2GW5A 3V79C 3IF1B 1RZIB 3LRSA 5A7EA 2Y5EA 3TBSB 3M46A 4UI2A 5G5DB 2FO4B 5AW1B 3US1A 4H8QA 4TM9A 4DVBA 1KLFA 1AD9B 4ELKB 3PAVA 4WO4C 3RLSA 3HHRB 1JNHA 4G6KH 1IARB 4JRYA 1W0VB 2VDLL 2L3BA 3BVDB 1T66D 2BP3A 2VE6B 5IEHB 4Z7OF 1TQUA 4XXDA 4WFFE 2X1PA 4U2ZA 4M5SA 4AE1A 2ZUYA 4MJ5A 1DCEA 1JMZA 5BVPH 3DA0A 3SYCA 3C6LC 4F57H 4ZUSA 2A9NH 2DIEA 2OMNA 3P9LB 3TA3B 5ABZA 5HHNB 2R69H 4MZIA 2JJUA 4L23A 1ZHLB 4JDVB 3A22A 1HZLA 2Y6SC 4N2DA 2UXVA 1RK1B 4YO0A 2YOCA 1OE3A 3ULUC 2Y1YA 4PRPD 4DGYH 4ZUVA 1P7KA 3MKKA 3DX6B 3GD1C 1QFWI 3TCLA 3C60D 1NH6A 2EDXA 4WHYH 1QPPA 4JKPL 1DQQB 3JZ7A 4CVXA 4HF5H 1X7TA 4WVRA 2R51A 5ISZB 2IV9A 4QHKI 4JDTH 1G7IB 2E7DA 4TLKA 2QHRL 4GKLA 1BAFH 1QSEE 1QPXA 3WFEH 4PY7B 1L0QA 3O8XA 4KU1A 1FVDA 5DHYB 3TH2T 5DFAA 4B7IA 1XCTA 5JYMA 4R7NA 3WMSA 2XQYG 1HKFA 2UX7A 4JB9L 5I82A 3CBKB 1ZHKB 1IAKB 4PGEB 2NX5D 5DZLA 1YZZA 4P9ML 4FFVD 4EI6A 4N0YL 1TVBB 3EFFB 1HL9A 3AADB 3HLKA 5J8OA 4NPYA 2Z8WC 4TSCL 1SQ2N 2F54E 4MNHA 2R0LL 4N1HB 3VMOA 3VTTA 4JZOB 4LLDB 2V2XA 3IE9A 3LNHA 4LGPB 1QBML 5D1XA 4QRUA 2NYKA 2HP4A 5IMKA 3WKYA 2DQIH 3Q6FB 1WWAX 4F57L 1YAZA 1NICA 1FA4A 4D9LH 5B38A 2LHAA 5HI4D 2IJ0C 3CFEB 4HT1L 1BZEA 2XA8L 3IMWA 3ASOB 3CSFA 1LD9A 3WNOA 5DMGC 3S36X 4L0YA 3GJFK 2ADJB 5C97A 2PF6A 2CKBA 1DSFL 3RWJB 2VLKA 1E28A 4J3BA 4MJ4A 1N0LA 1TJIL 4OCXL 3R1GH 4APXB 3DARA 4YHKH 1TZAA 4TLSA 1OCWH 3FB7A 1RZPA 1MCPL 4J27A 3L3JB 4M1DH 4YWGL 4HOXA 3L7EA 3DJ9A 3KPSD 3TCXA 3QXUA 1AZNA 1KCKA 1H5BC 1WFMA 3GDCA 4MB5A 5HYSG 5B8CC 3U0PB 1JYWA 1SBSH 5T1MA 3MJWA 5FHBL 5E6IC 2FJUB 5E8PB 5LWYH 3ULUE 3ULVL 1F8TH 1I8MB 2W9EL 1KTRL 1KN4H 2DLEA 2VAAA 1R1CA 2QADD 5GJTL 4HPYL 4FFZL 4JCWA 4J3OC 5GGSY 1WBZA 3M07A 2P5WE 1JWUA 3BUDA 3E80A 2C34A 4LVNB 4B3VA 4PY8I 4P59H 1BZDA 2GB2A 3RUGA 4HCFA 4JPVL 2I9LB 3B7RL 1GMEA 2FJGA 1VDGA 2WP3T 2DYPD 4O51B 1OM3L 2F1AA 5CJXC 5GRYA 1XXFC 1FNHA 5DQDH 2WK2A 2G2PA 4DVRL 5A40E 4WWKC 3HE6A 2DD8H 1IT9L 1DLFH 3DYOA 4XMWA 3KJ6H 4WV1A 1L6PA 1JPGA 2BLFA 2E9BA 1CDYA 2HVJB 1EHNA 4ENZA 1CT8B 2XWRA 4NT6A 3ZYJA 2XFXB 3V4VB 5FF6A 2ARJA 5EBLA 1RQ5A 1DJSA 3WXVH 2FHBA 4P2OB 2A3TA 2XWJA 4I1NB 2LVCA 3GMPB 2WQRA 4NO3B 3DI3B 1WA2X 2PR4L 1Q0YH 1OT2A 1F4WL 1EH9A 3U46B 5I8OL 4XC1L 1N6VA 2R69A 1F6LL 2CUAA 5A3IC 3MV9E 3VXOA 4YK4C 2O72A 4NBXB 2QKSA 4JFDA 3ZQXA 5FOJA 1XCQA 3GSRB 2G5RA 2L7EA 1Q9KB 5F1KC 3TV3L 4BZ2L 3NDZE 4KKCC 4RH4A 3MLWH 3VFTB 5E4OA 3D07A 5I1DA 1Z9NA 1JGDA 3EGDB 4Y8AA 3MJ8A 2GJ6D 4P2CG 1PSKL 4HJTA 4N22A 5H35B 1GYCA 4DN4H 1ZDSA 4NHCH 4U6YA 1VESA 1XR8B 4UQCA 3RL1A 1DBBL 4FFZH 3MROA 5IT2H 4HJUA 5TF0A 4Y9CA 3SDXA 4ZPTA 2X3BA 1LE5A 4P49A 4ANVA 2C3XA 3VQMA 2J72A 5DEZA 5IBTL 3VFMB 4HFUH 3S4SB 1A1MB 4LOUC 1NC2D 1PY0A 3ECUA 2COQA 3IM1A 3ATEA 1G5AA 3MJ7B 3G5YA 2JB6A 4PJ5B 3CPUA 3MRQB 4ONHA 4PTTA 3RB7A 1HQ4B 5IR1B 5A2JH 4N9GB 4X6CE 1G0YR 1CL7H 3P4LA 4X8JB 1WAAF 2PYEA 5LJYH 2AFNA 1TJGH 2R1YB 3OKMA 3T8VA 5D6DC 3UDWA 1A3QA 3T6QC 3BCFA 3HFMH 3UBXB 4IBLT 3H3PL 1FSKC 1RIHH 1MVYA 3ZDXF 2X87A 2R56L 3UGUA 3WY1A 2CCWA 4AYEC 4L8SA 5F1IA 1KTBA 1CTOA 1FO0H 2AABH 4AIXA 1Y6KR 3RI5F 4KXDA 3VWJA 2Z1KA 1A6AA 1PD1A 4ZDHB 3MJ9L 1FVEA 5D2NB 1EJOH 1P4BL 2AJZB 1T04B 4LESA 3NDYE 4RFEB 1FFPA 1GZHC 1QMUA 3FQYA 1A22B 5BZWA 1JZ7A 4F7TA 2MSPA 2ZCKL 5C09B 3V0JA 2FB4H 5K33A 3VE0B 1F3JA 3TT1L 2DQUH 4RMWA 3HCVB 3ZL1A 2IG2H 1CDIA 3IE4A 1T0NA 2C4FU 3BN9C 4MHHG 4HCIA 4POZC 3A4FA 4AZUA 5AW8B 1TETL 3PNRB 4N0CD 3PFUA 4BUQA 1X4ZA 2YARA 5JMRA 4AJ0A 1X5JA 3VXNB 4NB7A 4NQVA 3TL5A 3RY5A 4HJJH 4QI3A 4WIQA 2H2SC 1BFVH 1DZ0A 1YN6B 3ULVD 2Z31B 4APQA 2YPVA 2BIQA 3VD2A 3FB6A 3WFHB 1WHOA 2F8VA 4Z7VE 3K6SB 2FIKB 4HKJA 1K4CA 4V1DA 1RD6A 5K59F 4ZFOL 4LFHD 5T1LA 4ODUA 2C1PA 3LPPA 2JJVA 4U0QB 4L9LB 4AQAB 3EFOB 4PJIA 4PJGE 1WTGT 4NN6B 5I76A 2HWZL 1MCJA 1V5JA 4JFVA 4FQXD 3OWEA 3WKNA 3QFDB 4CC1A 3L9BA 4JS7A 4FYTA 4K8RC 2VDPH 4LLUB 3VX1A 4ABUA 1XR9A 5K59E 4NC0B 5HGDA 1PLCA 3EKCA 3VDCA 2A74B 1DEEA 1E5UI 1MW0A 2ITCB 1ETA1 3VGDA 3S3BB 1T20A 4PRPE 3GSQA 3LKNA 5CBAA 2VR6A 5D8JL 1X4YA 1GJWA 5DUML 5KZCB 3L3OA 3HG1D 1MI5B 3EBAA 1YMMA 5EOQH 4C8XA 2ZX5A 5CP7B 4YL4A 4XVJL 2DQUL 3MRKB 5BZXA 4XP6H 1JK8B 3NMEA 1TZHB 5I6MA 1JZIA 2QPEB 4GRMB 3OKEA 3ARGC 1NINA 2W38A 4HGMA 2JMRA 3U6RB 4S0SD 1S7VA 3T08A 1U3YA 2NX5B 3BQUD 1J0ZA 5DJ8A 5CJXA 4MQXD 1G9NH 1DUYA 2CCLA 2M2DA 4HGKC 4H0IA 2AP2A 4XNUH 2XJLA 2R59A 2DJSA 3M8OH 2NZIA 3QO1B 1S5HB 4QXUH 1WBXA 3WKPA 4F24A 4HIJB 4U3SB 4IOFC 3JV6B 2UZYB 3PDOA 4N2KA 1R34A 3APMA 4I2XA 1N8OE 4G6JH 5I15L 3TZVB 3FAXA 1JPSH 3GI9L 4BKTC 1HE7A 3U2JA 1H15A 3LIZL 1DQKA 3SD5A 3VFGL 1DE4A 2WN2A 5IB2B 5LNDA 1E4HA 2OSLB 1HEJC 3REWB 2GPZA 3FT3B 2PW2A 4HEME 1AC0A 2Y5TA 5EF0A 4PP2A 1MIMH 4A7TA 5JHAA 2L7QA 4N20A 4QJ4B 2ZKYA 1K72A 2W80C 2XN1A 4RAVA 3T3PE 4UQIM 4PLNC 5CEZL 4MBRA 4AYBA 4S11A 5TQ2H 4PJCF 1ZSHA 1IIKA 1VFBB 4KUZH 3FRUA 3NCYP 2HN7B 3SDAD 4P2RE 3C6SB 4YHLH 2IVFC 2WVTA 1TYEB 4PJEE 5D71L 2NY7H 1H3VA 2FHFA 1J8HB 4M1GH 4MD0A 3RIAK 5C6WH 1AZBA 4HT1H 3IKCB 4M6MH 1GGYA 4CU7A 4OGXH 4MAYD 2CXKA 3MLUL 3VWKC 2QFPA 4UM9D 5AW9B 2VR9A 3QCUH 4WI0A 5BRZD 3UO1H 4AV0A 4MMXA 1VCAA 3F7QA 2YC1A 4NKDA 4PJAB 3MNVB 2JKNA 1CS6A 1LGVA 5DR5H 1RERA 3F58H 1ADQH 3KH4A 4K2UH 1SJHA 4KJQD 1A2YA 4NJAL 4Y1AE 2CHZA 5C92A 2XN9B 5KVDL 3DUSB 4PEEA 2XIBA 1HKLL 1P4IH 2XG5B 2I24N 2BP5M 1J0KA 2Q6WB 5F3BB 4GUPA 3GLDA 4LSVL 4M6NH 4PVMA 4Z7IA 1BX2B 2GAZB 3PGCA 5L8JB 1BF2A 1NGYB 3CIQA 3DOHA 4LLVB 3WGUB 5IWLC 4YE4L 2EVIA 5D7JC 5F93C 4ZXBD 3C09B 3FUNA 5IB3B 5FFGA 3UROR 1HZHH 5TE6L 4BBWA 1UCBL 4EOWH 4F1ZA 2J21A 5M94B 4UDUA 1T6VN 3WS6C 5C9KA 1V05A 1NC4D 4QHKJ 2GJJA 4AQ1B 1U91A 4RFOL 4LLQB 3IGAB 2PO6D 4UM9B 3W57A 1YYMH 2P5PA 2KDGA 3EYVB 1S7RB 1NSNH 4EDWL 1IFGA 1QWUA 4X6DF 1QABA 3PWNA 3ZVVA 2WSPA 4JQIA 4G80A 1I4FB 2WLLA 3ZE0E 5B8CA 1NKRA 4I77H 5MEQB 5IFAH 4GMTL 1DLHB 1WIPA 2OL3H 4HX1A 4MS8D 3Q43A 4ZFFA 4AIZA 5C8JB 2VT0A 2ZKXA 2ZKHH 1F58H 3ZGIA 1QLEB 5E95B 3C6LA 1AQDB 5IV2A 2JI2A 4BYHA 2IFGA 2VTFA 3PP3K 4MXWH 4N1EA 1Q9WB 1FFOA 4YDKH 4L1LA 4EIBA 1EAOA 2CA4A 4I48B 4C56B 1FNFA 2CJUH 1IJ9A 1I1FB 1UYWL 3PHQA 4YX2L 4X4YB 2J1YA 3O6FA 1QNZL 1SOQA 3ZTEA 2X6VA 2ALAA 4K9EC 3REVA 1ML0A 2BHUA 1FRGL 2V5MA 3FOMB 1F11A 4Y7MA 3CVCA 4ZOAA 2BVOB 1A1NA 1DFBL 3N04A 3NSXA 3KL0A 3HI5L 3V0IA 1HXMB 4DKFH 3JV5A 3ZIYA 4Y2DC 3DIVA 4LCUA 2CK0L 3PP4H 2C4XA 1BV8A 4LNRB 4QY8B 1P5VB 3D18A 1GPOL 1IEAB 4XE0A 1A6TB 4I3GA 3POHA 1NIDA 1XSJA 2K9UA 3L9YA 1D7BA 1KCWA 1I8LC 3BUTA 3N6YA 5TE4H 3GHBL 2ICES 4BK4A 2OK0H 5CU5A 1WE5A 3EJSA 4DP1X 3M17B 3FO0H 4RRPM 1IE5A 4TNVK 2AKRA 2YR3A 1BPVA 3NZ8A 4HF5L 1MXDA 3P11L 5D8JH 4RNRA 4NO5A 4HISA 5BV7B 5T1KD 4O02A 4GH7B 5E0QA 2RQEA 4WI5A 1WITA 3HAEA 3K8LA 1U33A 2PCPA 4JFOA 1I9JH 4QOKD 5CUSH 2XYBA 4JR9H 3CX5J 3FT0A 3OQ3B 1BXAA 2EDKA 4F20A 1MG2C 3LDBC 3PL6A 2QHLA 1U3ZA 5H94A 2PPCA 2PXYA 3CSTA 3G5ZB 3RG1C 3NACH 4YWGH 4CC4A 1AOZA 1QFPA 2FB4L 1EZSA 5FGRA 2ZX7A 2NOYA 1OE1A 1NGXA 4XMKL 1X5ZA 1PZAA 1R3JB 3K71B 3VH8G 4G82A 1CURA 4DP7X 3K1KC 4BA8A 4Q9RH 1PZ5A 2Q87A 4L3ED 5HJDA 1M7UA 2F54B 2YLKA 2FR4A 2XWEA 5T3XL 1D5RA 3GDBA 3RWEB 3FTVA 2G2RB 4L48A 2G3NA 2ZYHA 3FO9B 3EHBC 5CGBA 2NY5H 4PCKA 2B5IB 4OFQA 3ML9A 3OAUL 1H0DB 5LNEA 4GKOA 3B3IA 1D5XB 3N50A 5K1NA 1CFQA 1IGMH 3D85A 3MLVL 2N4IA 2CO6B 1T7XA 1MHHB 1BF8A 3SDAA 2ZWNA 3FONB 1J1XL 1SY6A 4LU5H 4NC2B 2QPFA 3FQWA 4UOW1 4BFIB 3FCUB 5FX3A 1O6SB 3BC9A 4HWNA 1SEQL 4FQHB 1OARL 2YAQA 4OLVH 3GIVB 4TUOB 3BPCB 4U6HB 1DVSA 2HTKD 3Q9PA 5PAZA 5AYTA 1JRHI 3U2SA 5ID0B 1K4DA 4WI4A 4AYID 3ZW3A 3A6CH 1WWWX 3DX8A 2EKSB 4XN2A 4NUJA 3O2DH 4XRCB 4K4KA 2ZG1A 1DBJH 1W16A 2CU9A 3UJIH 1V55B 4U6VH 2P5EE 4J23A 5LXVA 4RMBA 3OR7A 2F58H 3OHMB 1VA9A 3TBBA 1I53A 2HVKA 3O4LB 1NCDH 5DUPH 2WLMA 1WFUA 3T77B 3ZUNC 5FUOL 3A6BL 1K3ZA 3CHSA 4KFZC 2ARJQ 3BRGC 4KRPB 5EC1A 2WOYA 3NJHA 3CN0A 1MRCL 1PKQA 4LVOB 1KJMA 4MVBC 1I1YA 1RSYA 2FD6L 4ZS6C 3SSGA 1LP9F 5CZVL 5IT2L 4HLZH 3MACL 4W9HC 1QAWA 4P2RA 3KJ6L 4N2AA 5DS8B 4KTEL 1IKNA 1BG1A 1WH0A 3KXFE 1J05B 5TJWK 4RVBA 5AYQA 4FKHA 4JPSA 1L9NA 3UEZA 3LIZA 5HYEA 5E7BA 1DQML 3WHXA 2VLRA 5L2KB 4MJHA 3DX7A 4LPTA 3TTYA 3RGVC 2WVVB 3V6OC 4H25A 1F90L 1P4UA 2WCGA 4S0TD 4UT9L 1SEQH 4WDIA 1ZHNB 3RPIB 2CD0A 2VMJA 3U0TA 2VC2B 1JDCA 4MAYB 4ZMPA 3RPIA 4Y19E 4WDIB 4NM8L 4V2BA 3X3FL 4FTVE 4DGUA 4OI7A 3WDIA 4H25B 1SJVA 3V5DB 2WVVA 2C7UB 4JRYE 1M1XB 5HVGB 3DX7B 4TUKH 4P8QA 1FFNA 2VLRB 5L2KA 2OTPA 4OM0L 3RZCA 4DJMA 1IGCH 3WD5L 1K8IB 5CSGA 1KY6A 3GS4A 3UP6A 2BWIA 1J05A 3ZDZF 2P47B 3AUVA 1NPUA 1G1CA 4P2RB 3TEYA 1HQRA 1H8LA 1SMOA 3MV8A 4HAFA 4J12A 1D6VH 2DN7A 4A1RA 3BEWA 4I2XE 1KJMB 1PKQB 2YA2A 2J44A 2BNQD 2ZXBA 4M7LH 4PJHB 1IBFA 1MRCH 3T2NH 1XBDA 5IJKA 1J8RA 1X5KA 3A4DA 3LVEA 4LSPL 4NZTH 5HVHB 1ETB1 4O2FB 4ZAKA 1ADQL 3G5VA 3G3LA 1IJNA 1U6AL 4K2UL 4CVZA 2FYVA 4BSJA 4LHQB 2YMTA 2HVKB 4OKVB 5CSZB 4AVIA 2XWCA 3O3BA 5KSAD 1N5YH 2DM7A 4Z7WE 3ETBF 4XRCA 4NUJB 2VJXA 5E2TL 1IZJA 2Q20A 3DX8B 3T3PB 4DGVL 1K4DB 1RZJL 1E40A 2WLIB 1Z9OA 4LVHC 3V0GA 5EEYA 1XFPA 3U2SB 5F1NB 2RB8A 1F90H 3CH8A 1H6TA 3UG4A 1RU9L 2WUCH 1PBYA 5JHDE 4U6HA 4Y16A 5B4MD 3N0AA 2DV6A 4LGRB 2WB7A 4Q4IA 1BD2D 3WL9A 2CRIA 2VSMB 3MNZA 5L4MA 4Q89A 3X3FH 5DXWA 2MTPA 2XZCL 3PJNA 1O6SA 3CZKA 2YGOA 3GUFA 4U0RB 3FONA 3P11H 4M3KB 4M48H 1Q0XL 3HPLA 2GG1A 1MCPH 3QULB 4M1DL 3F7KA 4POZD 1O5DT 4Z0BH 3NUKA 3D85B 1RZKH 3FNKA 3RILA 1D5XA 4WO4B 3B3IB 1N7MH 1H0DA 4B9JA 1ID5I 3E9TA 2YQGA 2GTZB 2PW1B 2FLBT 3FTUA 2G2RA 3H9ZA 4EI5D 1VLXA 3RWEA 2QV2A 2ZJSH 4NZUH 3NFSL 3HS8A 3UG5A 5IEKB 3AS0A 4QUOA 4V1DD 1BF5A 4DNLA 2LR4A 1R3JA 4WAFA 4LPWA 2WLJA 4ZRGA 4POYA 4K23H 4HLEA 4WNSA 1RP8A 3EDFA 4JO4H 2PXYB 1KBPA 5CCJA 1F4YH 4YDKL 1B6DA 3PL6B 4KKCD 4X7FC 5GGQL 3FN0L 1MVFA 5K39A 3OBAA 3TLRA 5AKRA 2R0ZH 2ZWLT 4JFOB 5CINH 4MFHA 2J3SA 1HU8A 2C9VA 4ZUWA 4XO4A 2MWCA 1J5HA 1NFDF 3D25B 1A64A 1JHTA 5ANMA 4O02B 1Y7VA 3PWLA 5IHUH 3STBA 4APQD 5I1IH 1GMIA 4UCFA 1OZUA 2W07A 4RNRB 2CH8A 3VYOA 4LP4A 3GMNB 3NZ8B 4GBXA 4XNYH 4NI6A 3QUML 4UYQA 4F7EA 3M17A 1AI1L 4O02H 2X4PB 4M4RA 2F19H 3L2LA 4TS6A 3M7FB 4YXKL 1A0QL 1WT5A 3OTTA 1NAML 1IEAA 1TJHL 5GS2H 4JFFE 1MCFA 2H0JA 2RMNA 1L9SA 3D18B 3RNQB 4KQ4H 4QY8A 2D73A 4LNRA 1ZSDA 2ZUTA 4RQQA 3QQNA 3UGXA 1KIUA 3L13A 4YHZH 3MAWA 1BEYH 3BDYL 3HVDA 4ANUA 3VXMB 1HXMA 3BWSA 4DF9A 2HFTA 4LHUA 1KCVL 1MFCH 1LDSA 4QOKE 4FQ1L 3RGBA 1A1NB 1HWGB 1XQ4A 2JELL 4X80L 4ELME 5HYQB 3L48A 4FQQB 4R2GC 5CJ8A 2BVTA 1F11B 3FOMA 4Z3HA 3D12B 1EGJL 1OAKL 3P4MA 4LRIA 4ONFL 1QFWM 1K8DB 3OAWA 4LCCB 1M71A 3O6FB 4GQRA 5HHNA 4LASH 1WWCA 3INUL 1KLUB 2HKHH 3F7RA 3PHQB 1I1FA 3Q8AA 4LCWA 4MCZB 3BXNB 3JZYA 4OFVA 4WCYH 3AGWA 4JX0A 1FFOB 4HYTB 5HHPA 3D2UA 3ZR6A 2K45A 4ODSH 5IV2B 3GMMB 4JY5H 3ZKMD 1BAGA 1AQDA 5AZEL 4KZEL 1DN2A 2VXQL 1IKFL 4AIZB 1E6OL 5C8JA 4ZFFB 5GRWA 1BQLL 4IBVA 2ID5A 3ZHNA 43CAB 5MEQA 3I6KB 1NAKL 4IRSD 4XWOC 5B8CB 1FLRL 2WLLB 4PJXA 1I4FA 3VFNA 3PWNB 2NW3A 5IUSA 2X9ZA 1WJ3A 4FHJA 2DIBA 2OR7A 3IDYB 4FI7A 3ULVC 3CWGA 2KS0A 1S7WB 1AS8A 3CMGA 4WSJA 4DQOL 4OGXL 4UM9A 3IGAA 4LLQA 1U91B 3ATDA 2ADGB 3WAKA 2P45B 2HLAB 4FHKA 4LU5L 2GI7A 4MA3A 4OM1H 4OZHE 4XAWL 3T3PF 5C9JB 1Q0YL 4UDUB 5J3HC 2FDBP 3QQ4A 1USQA 1A8JH 3GHPA 1ODAA 2Y4SA 4ETYA 5EDSA 2D3JA 2P8MB 5JOEA 3F12A 4M3HA 5AVSB 4LLVA 1NMBL 3PNWB 4JFTA 1NGYA 2K6ZA 2EIBA 4G9FE 1CGSL 5CLWA 4U1LA 1PG7H 4GUPB 3HI6H 3CU7A 3I75A 5DYFA 4P46C 4LL9A 1P5UC 2Q6WA 3OJ2C 3VSQA 4ZW5A 4X5LA 3UJIL 1AS6A 3D2TA 4Z7VF 7PAZA 4P2OC 4EN3C 4ZG1A 5I8KH 3EG9B 1C9SA 2EO7A 3DO3A 4BZ1L 4Z7UA 1QLEL 4WUKH 1A2YB 2QSTA 1DQLH 1SJHB 3I9GH 1X5HA 4N2NA 3MNVA 4PJAA 1H3PL 2Z4QA 3P2BA 3R4DA 3TU6A 4MMXB 3FF8A 4Y5YC 4WI0B 3LQAC 4JE0A 4M43L 4IBZA 1JGUL 1F3DH 4FRWA 1YYML 4JHUA 3IKCA 1M53A 5JTWA 1J8HA 2VN6A 3D4GA 4OB5H 4DPAX 1DTUA 4W9JC 4WK0B 2XQYK 3OMNB 3QPQC 2EUXA 3QUYB 3R06A 1PDKB 2P4AB 3QUXB 3R0MA 5D93C 2K8MA 1ZK9A 5ITFA 2BWDA 3HNTH 3LQMA 4PMFA 3RFRA 4DKEH 3SKJH 1QP1A 4JM2F 4X9YA 1CIUA 1OXYA 1QFUL 4L4TD 4RAVB 1A66A 5K93A 1QRNA 1DSWA 1QZNA 2EE0A 4ABQA 2VO8A 5INDB 2PW2B 4MNQE 2Y24A 4KK6C 1Z9LA 1U8KA 1RZKC 1XCXA 4RESB 1N68A 3OQRA 4QYAA 2G5BB 5C0RL 2XFGB 2H0EA 4AJVA 1IQWL 3QIBB 4PB0L 3VD7A 2VMFA 4I2XB 2E76C 3CVDA 5GZND 2ZUQB 5EZIL 4WI7A 3JV6A 3ZTJG 3IXAA 5CN3A 1BM3L 3QO1A 3O2DA 4KKRA 4WFHD 1SF5A 1TZ8A 1NEZA 1PQZA 1EHKB 2VABB 1DUYB 2FVNA 3N43F 4XMUA 1CLOL 2NX5A 2W9EH 3NIGE 4P4KA 4BFJA 3GSWB 5SX4H 3CPLA 3QSKB 3U6RA 2I7OA 5DD3L 1UZGA 2DLHA 1T5WA 2IDFA 3HB3D 3F5WA 3ISYA 1TZHA 3UTSE 3QUYD 4NZJA 1EHAA 1EO7A 3BUIA 5TF1H 1QFWH 1WA1X 5CP7A 2CBPA 3VDBA 1NBVL 4MZRA 3C08H 3L3OB 4MCNA 4PD4J 3LH2H 3LKNB 5CBAB 2YBRA 1NWPA 4D7BA 1DEEB 3QIWA 3QUMH 3Q5TA 4XN8A 4BFEA 3TH3T 3NYKA 5FW6A 4JANA 4LLUA 4XAKD 3UYRL 3SPJA 2B9BA 2HX7A 1UH2A 2QDVA 3GO1H 4N0UA 5EN3A 5I76B 4R5XA 3G08A 4ZXBC 1F56A 2X40A 4AQAA 4ZMAT 2J73A 1CK0H 4FJZA 5GS0C 4MZ3A 2YN3A 4FNLL 5AVYB 5DK0A 1JZ2A 2DJMA 5T1LB 4IKLA 2EC9T 1LTXA 5ABAA 2D7TH 3HZMB 4ZX3A 4V1DB 3NJGA 1YEHH 4PB0H 1K4CB 2IGTA 4K3DL 2ZX9A 4PR5B 2FIKA 1MY7A 3K74B 1IEBA 2X70B 3WFHA 4ZS7L 4ZMXA 2P49B 2QADC 4N86A 2W59A 2Z31A 5E2WL 1AQHA 1MCHA 1YN6A 3CFCL 1KMGA 4H8WL 1L0YA 1KEMH 4NCC1 2W0KA 2KERA 4NQVB 3VXNA 2NXZB 4KDVA 2H1LM 2DKMA 2DQGH 3MA9L 3V0HA 3NIFE 1T22A 2E7LC 3NSJA 4KX9A 4QDGA 4PN6A 3RVXC 1ZTMA 2ZAGA 1KTKE 3HCVA 5DHXB 1E2WA 3U79A 4ZNEE 2ADFL 1F3JB 2MCPH 5H37G 2DH3A 3W0WA 3HG1A 5C09A 2LV4A 4F7TB 3RA7H 4RFOH 5BZWB 1UZ6E 3U9UB 3ZKNC 4KH2A 2BVYA 2EYSA 3VGAC 3CFTA 1F3DJ 1T04A 1MJ7L 4K5MA 2ZP8A 2AJZA 5L88H 4GB9A 2GTQA 1AMYA 3AT8A 1AO7D 3KPQA 5D2NA 1YECH 4OU3A 4ZDHA 1SOXA 4KH9A 1FLTX 2BRQA 5LQBH 5F7AA 2LLGA 2V9QA 3WTUA 3BJ91 3OG4B 1IAIH 3EJUA 5CCKL 4UT6A 4Z7VB 3VGGA 3OSVA 5CM1A 3TC9A 3OKMB 4TL5A 2AEIT 2PYEB 2NDFA 3BH8B 3GSXA 4Z8FL 2HRPL 5FYLE 4FXGB 1HQ4A 3NRFA 4MVBD 3MRQA 1BBJB 5J6SA 4QTIH 3B2VH 4PJ5A 1A7OH 3C5SA 4FADA 4FA6A 5BUGA 3VG0L 1RUAL 3MJ7A 2DQHL 4LPUA 4JPWH 5KYUA 3S4SA 4OM0H 1YJDC 5EORH 5CF3A 1YRKA 3MRJB 4UTAL 2ILLA 4QRBA 3T2LA 4Y4KD 2H1XA 2Q2LA 4P3CH 1LE5B 2WXJA 1WZ1L 5LGHH 4ZPTB 4F80A 2TSAA 5SV3A 1QSFE 5D7SL 4N25A 3IDXH 3IMSA 3MROB 1XR8A 3RL1B 4CGUB 3TA3C 2IH3B 2GY7B 2XZAL 5H35A 4JFUA 4LCYA 4D3CH 4EJ1C 4RBPK 3BAEL 3BJLA 5HHQA 1WCQA 3FQ1A 3MJ8B 3EGDA 4MJIB 2D3LA 1JGDB 1KB5L 1CR9L 1DQDH 5I1DB 3VFTA 3S98A 3INUH 2QPUA 3WN5A 3ZO9A 2HT4C 5CEZD 1PG7X 1TF4A 1Q9KA 2WWMC 3JWOH 1JWSA 3LZQA 4RDBA 1ZDQA 4WU5A 4BK5A 4WI2A 1VCBC 2PYED 3VXOB 4GAFB 5I28A 3L3KA 3WXVL 3PRZA 3GMPA 1A65A 2XWJB 4P2OA 3FU3A 3IDGA 4H5SA 2IDCA 4F7CB 5EBLB 2ARJB 1AR1C 1CFSB 5FF6B 5HHMD 5I6LA 1OHZA 5CGTA 4F93B 3H7LA 1YJDH 1YAIA 3SYAA 3FYEB 1NIAA 2HVJA 4W81A 4Z8FH 1ZLSH 4PTUB 4WV1B 2VXSL 1U92A 4HMEA 2CR0A 2F5AH 5F96H 5D4JA 1FF5A 3ARFD 4O51A 4TQEH 4LMQI 3UBXG 2PPEA 3BAIA 4XPBH 5BO0D 3PHAA 1U41A 2FJGB 3TFBA 3RUGB 4KY1L 3IAGC 2DQEL 6CGTA 3T0WA 3TYGL 2CPUA 3DYPA 2V3FA 3H2WA 4IKNA 3KH3A 3PDDA 3K6FA 1WP6A 4P23A 4EKJA 1GSKA 1EPFA 1W8OA 4FA7B 2FGWL 1H9VA 3E38A 3NTCH 2AK4E 4WTWA 4OQ1A 5E8PA 4L5FL 1I8MA 2WXQA 3NCYS 1OAXH 3IWUA 4DZBB 1UWGH 4WI8A 3BMVA 2XN0A 1MVUA 2L7UA 4NENA 1PGRB 5I8KL 5J13B 2DQDL 3DX3A 2AJXL 3FB7B 15C8H 2IOOA 1CFBA 2ZTBA 5C0AB 2BSTB 2Z9TA 1E65A 4OZIB 4JG9A 4LPXA 1NUFA 2V5YA 2VLKB 4I18A 4DP9X 5CINL 2CKBB 3ZT5A 3LZNA 1AP2A 2ADJA 4QRSA 4KI1A 4X42A 3H9SB 1EXUB 4HDIB 3U4BH 3CBJB 3GC3A 2AI0L 5JLZA 2R0KL 5T3XE 2CIKA 4NP4H 5B38B 2VMDA 5FKAA 3Q6FA 3KLHC 3AU1B 5D1XB 3TWYA 1DDTA 4XC3L 3CUPA 4LIQL 2HPTA 2V2XB 4FS0A 2AJ3A 3MFFB 4JZOA 4LLDA 2IFFL 4FNUA 2EUZA 3RJDA 1JZJA 1QX1A 1YEGH 4R97C 4BCZA 3EFFA 3RVTD 1TVBA 3WU1A 4EI6B 2ZOKB 5LBSA 2VDQB 3KL3A 3FXIC 1IAKA 3LZOA 1OAYL 3JVGC 2PP9A 1GGUA 2YXFA 4TYUA 2R2EB 5LLIC 4OH2A 1U8HB 3QPXL 1I9JL 4P5MB 4HD9A 3EJJX 4WFHE 1ETZB 4AVJA 4EXKA 1DVUA 3F58L 5FUZL 3QZWG 1KYAA 3LZFL 5DHYA 3TF7C 1OSZA 2R0ZL 4MXVF 2DQCL 8FABB 5A7BA 2OYLA 5E9DE 1Q72H 1LDPL 3WIHL 1N6UA 2VUOA 3IJEA 3LPFA 3IFNL 2ZOTA 2JFCA 2B1OA 3AJ7A 4KDWA 5EB9A 4Z7UF 4CVXB 3GZKA 1OKEA 3NIDE 5D7LE 1FL6B 4OCNC 1F1GA 4B0MB 4F2MA 1M9SA 3S2CA 3AG3B 2BJMH 1LILA 3L08A 4LEBA 1Y18B 4M1CC 1KGYE 4OGYH 1YUHA 2UWEE 3TA3A 3S34H 3KPRB 4TSCH 1BFOA 4PAZA 2OCCB 2OXGB 3G6DL 4NJ9L 2HFFB 2VO5A 4ZUSB 1AZCA 3GSOA 4MJ5B 3TONA 2ZWZA 2Y69B 1CJYA 2XTSA 1ZS2A 3IBOA 1JV5B 4XXDB 3WNKA 4XVTL 1Q94B 2VE6A 2DL2A 3BDXA 2MRYA 2H8PB 1ZEAH 5HDBB 4JRYB 4Y88A 4Z78A 5ESAB 4XWGL 1PZSA 4ELKA 1KLFB 2QZ5A 1Q38A 2YRBA 4G70B 2FO4A 1B4RA 5G5DA 4PM1A 4ZOBA 4J4PA 4Z5RA 2ZWSA 3TBSA 1E6JH 1RZIA 1EFXA 5D72H 2NY3B 2NT1A 1LNUA 3QCTL 3QIWC 2CHDA 1I3GH 1P0SE 5T1DH 4D3CL 2Q7YA 5FWQA 1CGSH 5L2KE 2I9TA 4G1EA 5KVFE 2ROXA 2Y22A 3C8HA 3NQIA 4NZ8A 5IVNA 3HI6L 3CXDL 3BDBA 4BELD 2QQNL 3DNKA 1JWMB 3QUZC 5D2NC 5I15H 4OBRA 5FYJU 2FWUA 4FNQA 1FPTH 3FUFA 5C0BE 3LPGA 4QRTB 3HI5H 3VMPA 3D3VD 1X9UA 3X3GL 4MD5A 1UADC 1AO7E 3PQYB 1UWYA 1F6FB 4FQIL 3DMMC 3H53A 1BJ1H 4Z9KB 4E41B 1AJ7H 2N7AA 4OZFH 3SPVB 3LQZB 2QGEA 3QRGL 1VAHA 4LRNL 2O5YL 2CO7A 4AL8L 1X9RA 3BYTA 1TZGL 4DVRH 2VXVH 4GQ9L 1ORSA 2MQ0A 3BKCL 4MS8C 1YECL 3QNZA 2Q76A