4HHGA

Crystal structure of the pseudomonas aeruginosa azurin, ruh107no yoh109
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEEEHFFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 30
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhgA00
3X1BA 2R7EB 2QPEB 1YLBB 2FQFA 1UATA 4YSEA 2UXGA 4YSSA 4P5SA 2B08A 3X1EA 4YSCA 5A7EA 3PCYA 3OM3B 1WA1X 3T6VA 4MFHA 1CC3A 1JXFA 1ASQA 1XB3A 4BK5C 2BW4A 2P80D 2IDUA 1R1CA 3AY2A 2J55A 2FT8A 2CAKA 3H4FA 4A68A 2J5WA 1GS8A 3EH3B 3NJIA 3RYMA 3DTUB 3S3CB 5I5JA 3FSAA 1PCSA 3UAEA 5I6KA 2IWFA 3SQRA 1KDIA 1MZYA 4L0PB 2UX7A 4EF3A 5B3SB 3KW8A 3S3DB 1GR7A 3S8FB 5D4HA 5I6NA 2MTAA 4AZUA 3FSVA 1AOZA 7PAZA 2HLEB 3UACA 3OD3A 3JT2A 3NJGA 2BP8B 2DWTA 5PCYA 4GP8B 3NP3A 1M9WA 4G70B 1RCYA 1FFTB 1V10A 2OCCB 5D4JA 1XMEB 3NSYA 4YSPA 3ZX1A 1FA4A 2GB2A 2BP8A 3ZDWA 4DP2X 5B1BB 1AG0A 3H56A 1ILSA 3SBRA 2ZOOA 2DV6A 1PF3A 4HCFA 2FNWA 4DP8X 1SFHA 1ET7A 2PPEA 1AS8A 3NYKA 1JZHA 2PPCA 3L45A 3WKQA 1JZJA 2GSMB 1BQRA 2FQDA 3TBBA 2VW4A 3FU7B 2JFCA 4JKNA 4M4RB 3WI9A 4G7SB 3NJJA 1IBYA 1OCCB 3NP4A 1J9SA 2PP8A 3IN2A 2N0MA 3WNIA 2A3TA 3AG1B 5F7BA 3CDZB 3TA4D 4KNUA 4F2EA 1GW0A 4DP0X 2UXVA 4E9WA 3FQ2A 2YXWA 1NPNA 1SDDA 2BW5A 1KYAA 2OJ1A 1NIAA 1JVLA 3FU8A 1ASPA 1BXVA 4RH4A 1SFDA 1PZCA 3FPXA 2XV2A 5FC9A 2VSKB 4N8UA 1ET5A 4G71B 2MRYA 1W6LA 4P5RA 4NAJA 4PCYA 3PPSA 1L9OA 3X1FA 4DPAX 4DPBX 3AG3B 3GXUB 1A4AA 1AQ8A 2IDQA 3GDCA 3X1GA 1M57B 4DPCX 1PLCA 4UANA 4YSTA 4UF7C 1E5YA 2GHZA 4KOBA 1BYOA 1HAUA 1SDDB 1MZZA 3ASNB 1GSKA 3QJVB 1WS7A 3V9EA 4E9RA 2YXVA 5I6MA 5I5IA 3CDZA 1XB6A 2YAQA 3V9CA 5B7FA 2OV0A 2PPFA 1OOWA 1J9RA 2XX1A 2XYBA 1KV7A 5I6LA 4F7KA 1JZGA 3UABA 1X9RA 1RKRA 1ZPUA 2DYRB 3FU7A 2NRDA 3BQVA 2DY2A 3NJLA 4A2EA 2DYSB 4E9SA 2CJ3A 1ZIAA 1AS7A 2XXFA 2W8CA 5I26A 3IBOA 1PLAA 1QNIA 4F2FA 3PAZA 1JOIA 1JZIA 4E9YA 1J5CA 3H4HA 2XV3A 1DZ0A 2XUWA 1PNDA 2IDTA 5B7MA 5B7EA 3T6WA 2IWEA 6PAZA 1N70A 2YAMA 4PAZA 3OMAB 1V54B 1NIBA 1PLBA 1TKWA 3S3BB 2UXFA 1BYPA 5D4IA 5AFAA 4BWUA 1E5ZA 1L9PA 4NB7A 1M56B 2LLNA 3CG8A 5AKRA 5IY5B 2YAPA 3X1NA 3CVBA 3NSFA 3IE9A 5I6PA 3QPKA 2IWKA 1AZUA 1JXGA 1RZQA 1RZPA 2HX9A 3PLYA 1FWXA 4TXVB 2HRHA 3UAAA 4KNSA 2BWDA 1T5KA 1TU2A 1HAWA 3ABKB 1BAWA 4YSDA 1SHXA 2FTAA 1IC0A 1ZDQA 3ASOB 1B3IA 1AR1B 1L9SA 1AZNA 1GS6X 2XVBA 3NJMA 3FPYA 4AKQA 4DP5X 4FAAB 4YSOA 3ERXA 2YAEA 1SF5A 1IUZA 1NWPA 1GS7A 1KBVA 2AVFA 5PAZA 1A8ZA 1KDJA 2FQGA 2HXAA 4KO5A 2FJSA 1KGYE 1TEFA 4GY4A 1ADWA 4BXSV 4HCIA 4HZ1A 2BO0A 4QKTA 5EHFA 2BP0B 2H3XC 3EH5B 2ZWNA 1E30A 2BZ7A 2YQBA 2UX6A 1NIDA 4HIPA 2RACA 3ABGA 2YARA 2GIMA 2EIMB 4HALA 2XX0A 4GP4B 4WKXA 3N55A 1MG2C 2XWZA 4DP9X 1ETJA 3OMIB 7PCYA 2H5UA 2I85A 2WO3B 2QDVA 4DP6X 4KO7A 1L9TA 5B1JC 2CUAA 5B1KA 2PP7A 4KO9A 1L9QA 4YL4A 2AZAA 4G72B 1WS8A 1HFUA 4BWWA 1PZBA 2YAFA 2BP0A 1GY1A 1NWOA 2CALA 3QQXA 4BXVA 1SHWA 1BQ5A 1ET8A 1OV8A 3KW7A 3MBWB 3NJHA 1ZDSA 4BDVA 1W6WA 1XB8A 2XXGA 1CUOA 2W88A 3AZUA 1JZEA 3MX0B 1KBWA 3TU6A 3PXLA 1MDAA 2HX7A 4Q89A 9PCYA 3NSCA 5B1AB 3DKHA 1J5DA 3X2QB 1SJMA 3EH4B 3FT0A 3IN0A 4AKPA 1AZRA 2IAAC 2TSAA 2GC4C 4K9JA 1MG3C 2GC7C 4YSAA 2JXMA 1ILUA 4KO6A 4E9VA 1GY2A 1A3ZA 2YAHA 2CCWA 3OQRA 4HHGA 3D12B 5I28A 2FWLB 1AZBA 1OE3A 1V55B 5TK2A 2PPAA 4KOCA 4E9TA 2IH9A 6PCYA 1BXUA 1KCBA 1URIA 3T71A 1BQKA 2PP9A 4YVUA 5LDUA 2BWIA 4BDVB 3DIVA 2IH8A 3BVDB 1J9QA 3QJSB 4QLWA 4AI7A 4N4YB 1GYCA 1SNRA 2VW6A 3EHBB 1EZLA 2P80A 1OE2A 1PNCA 1AACA 1F56A 3WKPA 2VM3A 2PCFA 3TASA 1NTDA 2UXTA 4G7RB 4W1TA 1OCRB 1L9RA 3SBPA 3UADA 4DP7X 1AANA 2AZUA 2HRGA 1A4CA 2JKWA 1BXAA 2PLTA 2H47C 4JHVA 5ANHA 4Q8BA 5AZUA 4ZK8A 1NDTA 1TEGA 4KNTA 2VM4A 2VN3A 1CYXA 4A2FA 5B1JA 4E9QA 1PY0A 1AAJA 2E86A 1NINA 4GP5B 1AZCA 1JXDA 4BWTA 2VSMB 1A4BA 4W9ZA 4DP1X 1AIZA 1WA0X 2I7OA 2EIJB 2AFNA 2FT7A 5TK4A 1DYZA 2EILB 3WNJA 4A67A 1AG6A 4A2HA 4YVNA 3T9WA 1NICA 3T6ZA 1ZIBA 4CSPA 2GBAA 2VW7A 4HAKA 1KCWA 3AG4B 2QPDB 4WTQA 2EINB 4NERA 1PAZA 2CBPA 2EIKB 1QLEB 1ZV2A 2QDWA 2I7SA 4GYBA 4YSRA 3IEAA 2PPDA 1OF0A 3FSZA 5I6OA 4CSZA 1IKOP 1X9UA 3PAUA 2ZXWB 3S8GB 3HB3B 2FT6A 3C75A 1CURA 1NIEA 3ZIYA 4E9XA 4DP4X 2WO2B 4YSQA 3QJTB 1JERA 2Y69B 3EF4A 2IDFA 3CVCA 1WAEA 3FU9A 4YSUA 3AG2B 2FQEA 5F7AA 2XV0A 5E9NA 1N68A 1QHQA 2PCYA 1E67A 1EHKB 3FSWA 3NT0A 2HZHA 3OMNB 1PMYA 1OCOB 2VMJA 4AKOA 4AX3A 3SBQA 4UAHA 2Y1AA 3ZBMA 2J56A 2Q9OA 4A66A 2YAOA 3N2JA 1PZAA 3NJKA 3FS9A 3PAVA 3QJQB 2HX8A 1E65A 2GI0A 3AW5A 3TBCA 3FQ1A 1OCZB 1NIFA 4M3HA 4A2DA 2IDSA 3FYIB 2BHFA 3G5WA 4HCGA 2AANA 1BEXA 1W8EA 2J57A 1OE1A 3WG7B 2TSBA 2X88A 4JHUA 2DWSA 2R7EA 3ABLB 3CVDA 3JTBA 1AS6A 1I53A 3FYEB 3HEIB 3NSDA 2BZCA 3UGEA 1IBZA 1ID2A 1CYWA 4A2GA 4X4KA 2B3IA 1NZRA 1WA2X 4G7QB 2X87A 1NPJA 2XLLA 4FA7B 3FQYA 3QJRB 1JZFA 8PAZA 1J9TA 1SF3A 3GYRA 2XU9A 4ENZA 3ABMB 3WIAA 2WSDA 3QJUB 2QT6A 4HHWA 2Q5BA 3NJFA 5I5MA 2ZONA 3NJNA 1JVOA 1VLXA 1A65A 3T6XA 3U25A 1ASOA 3CZUB 4GXFA
chains in the Genus database with same CATH superfamily
1OK0A 1AD9B 4NDMB 3L9YA 1KT2A 3DJSA 1HIMH 2ZYSA 2B08A 1E0OB 3EYUH 5E2VH 3TIDB 4CVXA 1ZHKA 3LH9A 4PVNA 1PKQB 1N8ZA 1N9PA 4E41A 1QLRA 3FH5A 5HGDB 2YPLA 4M00A 3V4PB 4GAAA 4Q6IA 4G1EB 3L4XA 5I1EL 4RMWA 3B7YA 2CCLA 3PL6B 4DESA 3OPZH 3O2DA 1J0KA 4WUUA 3MREA 5TQ2L 4YDVB 4KKZA 2CO6B 1DVYA 2IWFA 2DEYX 4JG5A 4M93C 3UTQA 2WGNB 4FQ1L 5EZOH 1NGWB 2V9QA 1KXTA 4A7TA 1J1OH 2AK1H 3N43B 5DXWA 3UO1H 2DLFL 1T21B 2EECA 4ICXA 4XXCC 2BVUA 1CFNB 1RIVL 3WN5C 2VLJA 1YMHA 1SXNA 3VWJA 3SKNA 4XNUH 4NKIH 4L3EE 4HOWA 3DHJA 4KU1A 1K4DB 5F6IB 1LHZA 5C86A 2B1HL 2HT2D 2W0KA 3L9RB 3RL1A 4RFEB 1AJ7H 5FCUH 5BUAA 1P4UA 4H20H 1T1XA 1RFDL 4LARL 3GJFB 1T66C 4MBOA 4MA7H 4XAWL 2RALA 2B4CC 4RA3A 1UHVA 1R3KA 2Q3XA 2Y1YA 3GS7A 2CM5A 2LR4A 2ISDA 3T0AA 4QYOA 2HTKC 5DHYA 2E75C 3VU2A 3VXUD 4PWKA 2VDQB 2R4SH 1S7UA 3FW6A 1P4BL 4PRBA 5GGVH 4AVHA 4HJUA 1SEBB 1SYSA 4KVNH 5DQDL 5C6TL 3TBBA 5FGCB 2OMYB 3KDMA 3FT3A 3O4LD 2ZCZA 1BCIA 1SOKA 1I3RB 4LRIA 4YXLL 4YEFA 4ILDA 4YXKH 3GMLB 4ZD3L 2IGLA 4XNAA 1J9SA 1Z9LA 2YPVL 1UURA 5F7BA 4HAFA 1E6OL 2EP6A 2FYYB 2OI9B 4XNQA 1AD0A 1QI3A 5AVQB 4PWIA 5I1LB 2YXWA 4H0HB 3CFKA 1MHCB 4XMKH 3FQRB 5T5NG 3U82B 2W38A 5DUPH 4ABVA 3MRBA 1K8DB 1SFDA 1G0DA 3FPXA 3D51A 5D7LE 2EUVA 3DVIA 3ZDXB 3AJ7A 1RPKA 3GMPA 5GRUL 4Z3JA 5DHXB 1J1XH 2DQDH 1FNSL 2IOOA 5C0ND 5LUMA 3TYGH 4L3AA 3BKML 1TJGH 5IBUG 4EBQH 1UWEL 2X09A 5FF6B 2VYRE 4FNTA 5FGCE 5ITBH 3VXMB 5BZDB 3GLEA 3NABH 1RJYB 2F7RA 2X42A 2H1XA 3CDYA 5CS7A 1LEGA 3QEQE 4TVSa 3P4OB 2HB0A 2V0AA 4JFPB 5HHXL 5MEND 5JXAH 1CL7H 2DTMH 2MCPH 3EO1A 2GK0A 2WXLA 3VXRA 3D4GA 1GSKA 3SPCA 3EBGA 4ZUUB 3MRDB 1IZJA 1FYTA 5T8IA 1HZHH 1GGUA 2DQCH 4N68A 3RDTA 1BIIA 1P5UC 4JRYA 1KIQB 1KJ2L 3IFOB 5CAYB 3BMVA 3F7RA 3ETBF 3CQPA 1IAKA 2Q87A 2ERJB 1V3KA 3CMGA 4M1CC 1XF5A 1BZ9B 1AZVA 3DA0A 5D7JC 3C6LA 2HTLC 3UYPA 3WIHH 1IGMH 4FLRA 3SDDC 3TPKA 3QNZB 5DDHB 4GQZA 4POZC 1FF5A 4HWEL 3EZ8A 4WHYG 3TT1H 3RPIA 4K3JL 1E40A 5TE7L 4ZMLA 3GPEA 2DYSB 4A2EA 4BRJA 1L6ZA 4OH2A 3QT2A 4ZFOB 1N4XL 2YO3A 3RNKA 4BKSC 1CI5A 1QNIA 3U36B 5FFGA 2NPLX 2WCGA 4MXWH 5C9KA 4TQEL 5F1SA 3Q2CA 3WNNA 5J56B 3H8NA 1QATA 3MRGA 4PIBA 2PETA 5H35A 3HN3A 4Q2ZA 3KLKA 3WYRA 4EN3D 1T6WA 3VXMD 5J1AA 4PGCB 4C83A 5HVFB 1WFUA 3U2JA 4JY6B 2Z1KA 2CIKA 4OD2B 1FL3A 5E4IA 4FN0A 4UM9B 5BVPL 4GAYB 4NB7A 3UMNA 5GS2H 1FVEB 3HW7A 3IKKA 1YUKB 4F37K 4FG6C 3CZEA 3HPLA 5ERWB 4XZUA 1JXGA 1V8HA 3RWCA 4F5CE 8CGTA 2LU7A 4TXVB 1OAYH 4QOKA 2EDQA 3QUYC 5D8JH 3GDBA 4UV7H 2NT1A 4L3EA 2XWRA 5BW7A 2PUQT 3FUHA 4TSCH 4OUUB 4MA1B 4NN5C 3QEGL 2IBZX 3VRJB 1O75A 4FAAB 3SGEH 1IUZA 5C2UB 4LOVA 1WZMA 3QG6B 4PD4J 3HR5A 5D2NB 1FRGL 3IF1A 4L37A 3R8QA 4MMXC 4B53A 4CVXB 3I6KB 2GBTA 3WOVA 5E2UH 5EIIA 3Q6FA 4YHML 2AEOA 2C7UB 5EHFA 1U8PA 3EH5B 5D7EA 5F8QC 4PQXA 3IVKB 3ZYZA 4L4VB 2HFGH 1BIHA 3GZKA 2VR9A 3HUJE 1HTYA 5IHLB 3EFDH 3OLDA 1NGYA 3N91A 1NFDE 3A4FA 3GT6A 2X28A 1HI6B 1W0VA 4ZTOH 5I71C 2JKRM 5AW8B 5JW4R 3AM8A 3FB8A 4G72B 4GXUN 3QIWB 5EEUA 1FFNB 4RZKA 4C56E 3RWGB 4UQ3B 2EH7L 1KTLA 5DA4A 1COBA 4LGPB 3D52A 5LO7A 1RUQL 1XX9C 4IBSA 5JHDB 4FXGA 1W6WA 4X5XB 5AL8A 5IVZA 5CM1A 3LQAL 5KJ7E 4PJFF 5H94A 1FN4B 4Q89A 2XY1A 4AYMC 1QLEH 2OZNA 4ZQKA 2UZPA 3RFZB 1GZQB 3CDGB 1F18A 4L1LA 4HWZA 5ADOH 5CLWA 2IANE 2NY4D 4GS7C 4NKIL 1FFNA 2X41A 3K8LA 1A6TA 3DTDA 4DAGL 1CFSA 2HH0H 4XMVA 4BINA 4YL9A 4XBEH 3JXAA 3FH8A 4TUKL 2VR4A 5K1JA 4XPAH 5ESAB 3EJPA 3FCTB 5E24E 2PR9A 3CLFH 5IUSA 4KRNA 1NFIA 3V10A 1F3DH 4HUVB 4RGOH 4HKXA 4OBSA 1CR9H 1X4YA 3H9SA 4OI7A 1N64L 2CG9X 3S9DB 2KZ1B 5TK2A 1E3XA 2FX7H 1FFQA 2ADFL 2OYMA 2VZOA 3LX9A 5DVLA 1N2RA 2ZD0A 2LTQC 1XMWA 3FB6A 4BELD 4OGAD 1CFSB 1BQKA 2QELA 1TVDA 3MJ8A 3S37H 1BVOA 2D7PA 1HXMB 1CL7I 1T2JA 2FIRT 3U0TA 2AKRB 3FSOA 4P9MH 2A74A 2FGWH 5D5ME 1QBMH 1N0LA 3OR7B 5FUCC 3HS0C 5HYQB 1ACXA 4GO8A 1EEYA 3HZVA 4J8RB 3BN3B 3BVDB 4PM1A 4WO0A 4BSWB 5JPNB 2WVUA 3LS4H 4MJID 4GLRH 2HJKA 3QDMB 1YEHH 4AYGA 3BN9D 2BERA 3C60A 3KWUA 5KYWB 43CAA 1A6WH 5AVSB 2NY7H 4AV0A 2PCFA 3WU1A 2VO5A 1IGYB 3O4LA 5GRZA 4YDJB 4ZT1A 4MDRA 2KS0A 3VW3L 3LZPA 2HLFC 3X14A 1RZ8B 3FONA 4TOYL 2J71A 3MRHB 2COQA 2P28B 3HC4L 1A4CA 3VGDA 2PW1A 4FI6A 3UTSE 2VM4A 3RLSA 3OWRA 5CIPB 4AUUA 1MRCH 3FRUA 2IH1B 4OLZH 4WUKH 3MXWL 4P46B 4J4PA 5A2KH 5JMRA 3MJGX 5I74B 3QH3B 2KL6A 5K33A 4LP5A 1I8MB 4M9PA 1I7UB 2H8PB 2HFTA 3EKCA 3HB3C 1DEEB 1NLDL 3F58L 4APQB 1IBBA 2J1XA 2R29H 5IIEA 4ZI8A 3QZLA 3CSPA 1F11A 2HTLD 4JM0A 4PW9A 5ACZB 3T6ZA 4G6MH 1FL6B 2FWOA 4EI5A 3NMEA 5L0QC 2N7SA 5D1ZC 3BDBA 5CGYC 1NC4D 4X7DC 2X1XR 3KPPA 1RK0B 1U0QA 3OXRA 1PW3A 3VFTB 3K91A 3BGMA 1NGXB 5AKTA 3M8OH 4JFUA 4R8WH 3BUQA 2NY0D 5T1DL 5A7BA 1QFPA 2Q2EB 4M4RA 4YFLF 1HHIA 4N0YH 3HPLB 5DHMC 3QCTL 3EYSL 3HB3B 3NCFB 3C75A 3P30H 1J0IA 4HFUL 2NCEA 5FKAA 3DTXB 3DX7A 3VM5A 2J8OA 3IFOA 3PS6A 1B4TA 4U6VH 1IAIL 3K8MA 1Y6KR 3L2NA 4G8IA 1ZANH 2DAVA 5IW6A 2GPZA 3H1ZA 1KF9B 2V6HA 3DROB 4GBXD 2X0VA 2EACA 3ALXA 1J8RA 2O30A 4F1SA 2CK0L 2BVPA 4WW1A 3RWIA 1VACA 2F74A 4B3VA 4HC1L 1Q38A 1QW9A 2YQ2A 3DX2A 3U48A 1MF2H 2X1QA 5GS0C 5KS9F 1C5DA 4ZUVA 4F27A 2I9TA 4MXVF 1MWAL 1CXLA 1XGPA 2XKNA 5ESQA 5FKAB 4E5XA 2ZYRA 2FJGB 5DMGC 1OCZB 1WZAA 3LKQB 2YKKA 4ZUSB 5K9KB 3M7OA 3G5WA 2QTEA 1JZDC 2WOYA 3ULUL 4MWFA 4RQQB 3LXCA 3OKOB 4MX7A 1U8IB 1PFCA 2QQKL 1ZVSA 2Y7QA 5GISH 2VQ4A 2YZ1A 2IFFH 2OMNA 1JL8A 1JIBA 5ALBH 2F08A 3DECA 4NBZB 4NKOB 5K9QG 2O61B 1QFWL 3GKWH 3OR6A 1IBZA 4R90L 5A2AA 1ZLVK 3RP1A 1GZHC 4PJGE 4M9OA 3DVGA 5IBUB 1OGTB 2DQJH 5I1HL 1RXLA 1NPJA 3BKJH 5BS0A 1CB4A 3GSOA 3KBHE 3VFRA 5DK2B 3MO1A 1U92B 1Q0EA 1NC2B 5KW9H 5EEVA 3WIAA 3CPUA 1ANUA 1CD1B 1GZPA 4G7YL 2WXMA 3QARA 4P5TA 5T1LB 2IXQA 1TJMA 2DMBA 5B39G 5K5YA 3L3OB 3Q3GB 3ZTDC 3WIIH 1YLBB 3IETB 5GS1C 2G75B 1F8TL 4G9DB 3HN5A 1EJ8A 4GEIA 4YSCA 2G5RA 4POZD 2Q76B 5KVEH 2VXTL 4TULH 1FHGA 4GRMA 4X7TA 3VFOB 1MPAL 5IESL 3ZYOA 2FB4L 1ZPLA 2FUQA 5FUOL 2G9HB 1U8NB 5IG7B 3HG3A 4AH2A 4YHNB 1R1CA 3DBXA 5IW1B 1QLEL 2EEXA 3B2XA 3AU1A 4JPIB 2VLKD 1IEBA 4S0TD 4WNJA 1UWYA 2LW3A 1OGTA 2APWA 1FVDB 1ACCA 2A2QT 1RZJC 3AY4C 1F3JB 1ZVNA 3GBNH 3BWAA 2NSMA 4QHLB 2VLRE 3WDHA 4LHUG 4ELDA 5IWLC 3JVFC 1I9IH 3KXFD 1IU1A 4XBEL 1B90A 1UZ8B 3L4CA 1UGNA 3TWCL 1P4BH 3C5JB 1GHFH 4FG0A 2OMTB 2JKLA 5EU7C 5AB0A 4EZKA 2G0LA 2WMPA 3EDDA 3ILPB 4YUEL 4GQQA 5A40E 1E28B 2X6AA 2QQNH 1P1ZA 5EO0A 2VITA 4LSDA 1IAIM 1NMAL 1EDQA 1QEWA 4HHAB 1UD3A 2GB2A 1A1OB 4YWGL 3V4VH 3BEWA 3I3DA 3QYCA 2VR3A 3DXAA 4K0OA 4EZMA 1WWAX 3HI5H 3E6FB 3OJ2C 4RSYA 2EH7H 4OCXL 1D9KA 1KXVA 4X7SL 1A7NL 4XHQA 4Z23A 1KEMH 2R27A 1MIMH 4GKSB 4ZW8A 3WI9A 1PY4A 3W9EB 1IT9L 3LN5B 1S7TA 2NUTB 4IHOA 3JTSB 3LY6A 1BWMA 1Q0YH 1FO0B 2VLJB 4P2QA 2N0MA 1BM3H 3MA9H 4CJ0A 5LQBH 1TPXC 2N7BA 1WAPA 3KYMA 2XFXB 5E1AA 1ESOA 2BSED 3CXDH 3LPFA 3L7EA 1HEZA 1GW0A 4DP0X 2UXVA 1A0QL 2WVVA 3CLEH 4LLDB 3ULUD 4O9HH 2GQHA 1GH7A 4DOHB 2CSPA 4H5SA 3QFJD 3FU8A 4RH4A 3KPNA 4A7UA 3ULVH 4HJJL 1LO2L 3C08L 4Z95L 5AUMA 3UJTL 2IPKA 5AEAA 2AABH 3BPOC 3RGBA 3IGUA 1I7ZB 2B39A 2X4QB 3PPSA 4JKPL 3VG9B 5IB4A 3FCBA 2Z35B 5E9DB 1OALA 5DVNA 4KROB 1H6FA 1I1AB 2HFEB 8FABA 5FCSH 1NBQA 5CZRA 4OLWH 4CMHB 1SRDA 2NTSP 2EDFA 1DQVA 1MCWM 4IMKC 4LASL 2ESVB 5DD0H 1FFPA 2IV8A 3ULVC 3QA3B 3MJ9H 2PWDA 3PABB 2BHYA 2PXYB 4UM8B 2CO7B 4D9QE 2A9NL 1TCRB 5CINL 3MCLH 3FQXB 2MPVA 1CQYA 1FNHA 3ARYA 3CZFA 3QCVH 2NY7L 1TQCC 3RNQB 3VTMA 4AMWA 4G42A 4OJEH 4PTUB 3OMZA 2IIJA 1U8KB 5DMYA 5I66A 1KIRB 1U6AL 2DOCA 25C8H 5I18L 3L95B 4BFEA 4IOIB 2V2XA 4ZS7H 1KB5L 5IQNA 4DGUA 1Y1UA 3HAEA 3RZCC 1Z3GL 4Y16D 4IDJL 5GHWL 3K4DA 3H4HA 1YEIL 3MX0A 1WF5A 1ZHNB 1YPZF 3I6GA 4PRAB 1K6QL 2YOCA 3D9AH 3DDFA 2IWEA 1OSPL 1R19A 1G7HB 3NJXA 5EBMB 1JWSB 1XSKA 5FA4A 1R24A 1DQDL 4RMUA 2CMRH 1P5UA 1KCRL 2NT0A 1ITBB 4XN2A 5D4IA 2OYLA 1EZVX 3ZT7A 1N5AA 4HEPG 4KK5D 3H53A 4PS8A 4FYQA 5C0GA 2XN9E 1TTGA 4IKNA 4JREC 2VCOA 1FFRA 3NSFA 4Y16A 5BRZA 2DLHA 2IWKA 4JANA 2HKFL 2GTZA 3ZKSD 3FH7A 3MLUL 1PZDA 1EBPA 2BWDA 2OJZL 2NXYB 5CUSH 4Y19B 1INDL 2DEXX 2IPTL 3O41A 4KXZH 3DO4A 4NZJA 4WFHD 4JFDE 4Z8FH 5T1KB 1KJVA 2F15A 1GGIL 4ELME 1OQOA 3F83A 1Q9OA 4I77L 2ALAA 3KS0J 1FG2B 3FPYA 3HNSL 1V27A 5J6GA 4MJ2A 2M26A 5CWSB 2VUYA 5J5EA 4U1IA 4LB8A 1DFXA 3N41F 1NAKL 5CEXB 3B2VH 4O2FB 5EO1A 5ESVB 2X1PA 4Q2ZB 4NCC2 3S97C 2A9DA 5C0AB 3HG1A 4WO4B 3D85A 3N85H 4ZFZA 4CC4C 3DIFB 3MNVB 1QNZH 3Q5YA 4FQHA 4NRZA 3ES6B 5CZVH 1J8KA 4HOXA 3QWOA 1CFMA 3UYRH 4DZBA 1MHHB 3TJPA 1JGVL 4JZOB 1UVQA 2BOBB 5JNYA 3M46A 3FQTB 5I9QC 1KFAL 5LNGA 1C1EL 3FTGB 1F42A 3NEXA 1YQVL 1F1DA 3QQDB 4EZJA 3D39B 3EF7A 3GGWB 3QUMB 4X8XA 3V52H 3RIFF 5I0VA 1JPSL 4GG6F 5JPMB 2EIDA 1GAFL 2WYHA 1EFXB 2IPUK 4L4VE 4QIRA 1CLOH 3NCWA 1QD0A 1YNTF 2FNBA 1BW8A 2YEZA 1QPXA 3QWOB 1OF2A 2X5PA 4L37B 4KDVA 2HAZA 5LCVH 1U21A 3AITA 5C0FB 1MEXL 4FXTA 1FE8H 3NH7H 4WO4A 2YC1A 4JM4L 2JWYA 4H2CA 1RSYA 3RTQD 1YRKA 3S34L 1I9RL 3GBLA 3IDUA 4KXCA 4OIFA 3RX5A 4JPVH 4JRXD 3WHXA 1J5DA 4W68A 1N64H 3SPVA 5FUOH 4PLOB 1ZT1B 1AGDB 3RVTD 2WQWA 3INUH 4OLWL 4JN1L 2YGNA 2V17L 3CWGA 4KI1A 3H7LA 2I24N 5EU4A 4ONGL 4Y5VA 4E36A 2Q7NA 4O4YH 2HLAA 2JXMA 3JV4B 5T33L 3QZWG 1A3ZA 2OXGA 1OP5H 3T0VA 4WVRA 4X99B 3RTQA 2WZ5A 3UAJA 1ZSDA 2UYLB 1NCHA 5DR5L 15C8L 1B2WH 2W1NA 3OTTA 4CW1A 2JQZA 2E7BA 2AQTA 3QUXB 4JM2F 3VGAB 2AV1B 1EPFA 4E9TA 3Q8EA 4JFZH 5E8NA 2HVKA 4PLKC 4X4ME 3HS9A 3NIGF 4OR1A 5BV7B 5LQBL 2WV3A 4IU2A 3KNBB 5HVWA 1D5BA 4G6AC 1XF3A 3TBYA 3D08A 2DWEB 1P7BA 4TTDC 4UT6A 3AT9A 4F7TB 3DGCR 3BD4A 4YE4L 5F7DB 3QQ3B 4QRSB 2D9CA 4WEBL 3ZTCC 4GXVH 3VJ6A 3SDYL 1J9QA 5IHUH 3IDNA 1DJXA 3KL0A 2PO6D 4ZX6A 1SNRA 4HMEA 3QULB 4XT1C 4BHUI 3NTCH 4TLSA 2J88H 3V5DB 3UTOA 2V5YA 2BNUB 3ARDB 2DH2A 4OCXH 3PPEA 5DD6A 4FL4B 1F58L 4JY5H 5CP7A 1T7VA 2JTDA 5AKSA 3MRLA 4NJAH 5T3XL 5FYJL 3BP7B 4WJG3 1ETZB 1OCRB 2NTFA 3UADA 1IE4A 3FBQA 1SUJA 1YYLH 4KV5E 5D2NC 4NWTH 4YBLB 2CO7A 3SCMD 2AXJA 2GT9A 5CJQL 5SX5H 1EAPB 3ZRFC 2XHNA 3QHTC 5FM5M 1NBZA 1AFVL 5SWZA 2WXNA 3M45A 4QT5A 2MCAA 5BOJA 2ZXGA 1JXDA 2QZQA 4W81A 4PY8I 1RZFL 1J1PH 1XBRA 1PFOA 3UZVB 2XZAL 2PTVA 3CSYA 1WA0X 1E2VA 3SZ6A 5DZVA 4WY7H 2VLRB 3G04A 5ICUA 4OCSH 3QUZD 3Q43A 4F58H 3L5IA 2ZJSL 3QEQB 4AENA 3HZ3A 4C54A 1MQKL 3QQNA 2NZ9C 1FGNH 4A04A 3C12A 3BVUA 4U2ZA 3IDNB 3BGFB 1FIGL 4FC3E 4H8HA 5KBDA 1L7IH 3APMA 1QKZH 3HFML 4IYKA 3HG0A 5E6IA 2DIAA 2FE0A 3NIDB 5C3IA 3DK2A 3ME0A 3GSNL 3K6SA 1JUFA 2QDWA 3WN5B 5DJ8A 1JP5A 4HWUA 5DD5L 5LBSH 4OQTH 1MH5A 1XCQB 4ZMYA 2VN7A 1X7SA 3VGAC 3ARQA 5HYIA 4TULL 5IJVA 4ZTPL 3HN8A 1UQSA 2OTWB 4JKPH 3DUSB 3W37A 3PF2A 2VLKA 2UWEE 3MUJA 4MQ7B 3V4LA 1CURA 2PW2B 5LGHL 3US9A 3QXAA 1AR1D 5BMFH 3PFQA 1DBMH 1WWWX 5E99L 4YIQA 4U1SA 1WAEA 2YSSA 4Y8DC 1S7RA 4YSUA 3QGVA 4J7RA 1XIWB 4XMKL 4DUVA 1I85C 2CD0A 1A7QH 3FU6A 1OW0A 2AEWA 5E9NA 2L8AA 2VDRH 4JAMA 3FSWA 2FAUA 4G6KH 5FX3A 4B9IA 1YO4A 2W07A 4I3SH 1CXKA 1S9VA 2ERJC 3C5SA 4MCMA 4PGZA 5I1JH 2JIXD 5FXCH 1TR7A 2EO9A 1DDHA 4M6NL 3GTNA 4WI8A 3VXNB 2ZP0T 1E65A 1RZIB 3AW5A 2Q1EA 4MJ4A 4TSAH 1KTCA 3TBCA 3QORB 4CRPA 2R8SL 5A2FA 1DBBH 4B5EA 5BXFA 3IPFA 1OE1A 4IKKA 4QAWA 1TTCA 1KXQE 2R4SL 4CA4A 1RK1A 4U7MA 2WUBH 1MI5B 3JQOB 4LSQL 2CRYA 5MEOB 3P2BA 2CDEB 5D1ZA 4BFNA 3EGSB 4XCYB 1JV5A 4X4KA 3IJEA 3KPTA 2X87A 4PJBA 3W2DL 4FA7B 3VI4E 1NGZA 1DLFH 3EYQD 1U8OB 4HGWA 5T5FL 2XBZA 4FZEH 4FQIH 2WSDA 2X2JA 1G94A 1P9MC 1JVOA 3E9UA 1VLXA 3MRDA 1WIOA 2NY4B 3CH1A 3K2KA 5E1GA 2MQ3A 1HZKA 4ABUA 3MYZA 1OL0A 3BEVB 3T0XA 4BZ1H 2B14A 3UCQA 2B16A 2VSCA 1SY6L 1XF5B 4MB3A 5BQ7A 3KXFB 4O2CA 3TFBA 5C0BB 5E4EC 4XP4H 5LBVA 3TVMB 2KZKA 3TH4T 5ISZA 5BS0B 5FO9B 5IEHA 1YEGH 3OKLA 3NPZB 4PJ8C 1AGCB 5E08H 4Y9BA 1QBLH 3MV7D 1QTYT 2NCMA 5AOIA 4G82A 2CAKA 2QKIB 1MKFA 4A68A 3IETA 3WO4C 2R39A 4P9HC 1QRNE 4I0PA 4RGNE 3RDJA 3N06B 4TRPH 1JXKA 2WNXA 3JWOH 3QJHB 3GSOB 4I4WB 4WWNA 1PZ5A 2P8MB 1OO2A 3VUAA 5KVGH 3F12B 4PJCB 3VFNA 3ZVVA 4L8CB 2DQDL 3L1OH 2VO8A 5DSCB 4ONGH 3WSQL 3BLBA 4Z78A 2YD9A 2JCWA 4HS6A 3RWFA 2EUZA 2R2EB 4D8PB 4L9LA 2P9RA 5IQOA 1MHPL 5IHBA 3BRDA 3RUGA 2ZCKH 3IGAB 2YN5A 1QW8A 3HKFA 5LWYL 3VSVA 3TTYA 1AQKL 1ORQA 1FGVL 1RPQA 4A7GA 1XMEB 4NJ9L 5BQ7B 1ID5I 5B1BB 3H42H 3EYVB 2D31B 5GJSL 4GKOA 5EU5A 3N44B 3M17A 3UZQA 5C3LD 4IK6A 1AGCA 3HJ0A 4ODHH 1YMHB 2VDNH 1UZ6E 3SDAD 3UERA 3AXLA 1U3HD 3AU0A 1VSCA 3L45A 3NYKA 1NAMB 2PCXA 5HTSA 3REVB 4MQTB 3ZKMC 2VMCA 3IGAA 1B0RB 4FQ1H 1MW0A 4OF6A 4ZXBC 5TPWH 1LK3H 4LP8A 4K9EC 5AVVB 3GRWA 2YPLE 3SE4A 2AERT 1XAKA 2XJKA 3D85D 3WY3A 1XEDA 2BY2A 2XTJE 2CE6A 3W0WB 5F9OH 5IMLA 5IQ9A 3GSVB 4BUHA 2GAZA 5GSVB 3FFCA 3TZVC 4OAWA 5D6DC 3P4MB 1NPNA 1IGIH 2HA1A 3LN4A 5FAAA 3K46A 1RK0A 5EUOA 1E4WH 2OJ1A 2WUCH 4EPSA 5IIEB 1NM9A 4HEME 3WUZA 4X7EC 1AGFA 2YA2A 2RD0A 4K5PA 1ET5A 4Y9FA 3VRIA 2I9LB 2OJEB 5GRUH 3BAIA 1MLCB 5JW5B 4WY7L 1PD0A 1EGJL 1MRFL 4S2SB 4DT2A 2JSFA 4P04A 4K4KA 1ZS8B 3L5WB 2G0KA 3U4KA 2WN2A 3CSGA 3B2UC 4Q6IB 3U2IA 3Q44A 1RMFL 2F5BL 3VFWB 2HJLB 4MMZB 5DK0B 3LSOB 4QY8A 1N10A 4GQPH 5F1OB 3PP3H 7FABH 1HAUA 4JO1L 1HHKB 1MUJB 3VYPA 4AVIA 4NIYE 2NY6B 2XIBA 3IS1X 1P7KB 5BQDA 2YJLA 3SHSA 5D7KD 3ZKMD 1FJ1A 3APFA 4OKVA 1OWWA 2R2HB 2D3VA 4NRYB 2N1TE 5LCVL 5SX4I 4XPBH 2Z8WC 4X6CB 5I1IL 4YHOH 2CDGA 5JZ7C 3ZKXC 4XPTL 1FPTL 1F58H 1CGYA 4K5MA 1T66D 4R0LC 2X2YA 4NQSA 4YE0A 5E8PB 1JMZA 1M42A 1AP2A 1NFDA 2ICCA 4MXQD 2UY6A 1S9WB 1RZFH 4S0SD 5GGQL 3ARGB 5IBTL 3FU7A 1OWRM 1H0DA 2OTUB 2FVNA 2KBGA 2VXSH 4ODXB 4BEIA 1UH2A 4QOKD 1XGZA 3APCA 4LSTH 4TL4A 2WKLA 1IGTA 5DRXA 5A43C 4MA7L 5EIQA 2EIZB 4HULB 5LVEA 5E6RB 3NDZE 4ZFOL 2Z31C 1PNDA 4LFHG 5FDWB 3A6BH 4N0FB 1D5MA 3SGDI 6PAZA 3U2SA 5DRWA 5TQ0H 5JHDD 2PYEE 4HIJA 1OAQH 1KB9K 2ZOUA 4YGVA 5D1ZB 2K70A 5KSAD 1BYPA 3MRPA 3H7BB 5D2NE 4ZX3A 2J7LA 5EO9A 3CG8A 2E3VA 4WHYH 5TFSL 3WAKA 1QSEB 1YEFH 3UL4A 4BSWA 5JPNA 3B56A 5I6PA 2XDHA 2EDKA 1JXJA 3QJZA 4TLTA 5CSZA 4LVNC 4B5ZA 1I3GH 4PW3A 3P54A 4K3DL 4U1SB 4QHPA 5JZ7D 4ZX4A 1FZKB 5AZ2L 3F8UB 2COVD 5C0CB 2ZCLH 2ZCHL 4FADA 4AM0A 3IXTB 3LEVH 3RIFK 2FWSA 2HG0A 5B38G 3IAGC 2LVCA 3ASOB 2Q20A 5CP7B 3VA2C 3B6SB 3MV9E 4OVUA 4ES9A 1MHEA 3FKUS 3MQIA 4WI0B 2CHDA 4ZODA 2IAMB 1SF5A 1CG9A 1NWPA 1WG3A 3MTXA 1KBVA 4GINA 4MQXD 2ZSVB 3GSRB 4XPAL 2W80C 4TVPE 3A67L 2ZICA 2FJSA 4L8BA 3VFUB 3SB3A 2V3EA 3BUYA 3ELQA 4WW2C 4I13B 1NFDF 4Y19D 5T1DH 2AJUL 5DEGA 4WJKB 5EB9A 2UX6A 3SGEI 4GBXC 3TV3L 1BEYH 3L3HA 4P2CG 2I9TB 1A9VA 4XBPB 2UWEB 1DANU 4L8CA 1XGYH 7PCYA 4HMCA 3U4BH 2DBLH 1T22B 1MN4A 3NIGE 5JORB 4OB5L 1AO7E 2A9ML 5AW4B 1L9TA 1FBIH 4HS8H 5F9DC 1JK9B 2F8VA 2Y2YA 4G11A 2VNCA 4ZUWA 2X4SA 5DS2A 4CSSA 2JJWA 3WTYA 1PZ2A 4MKMA 3ULSA 2P8PA 1EAJA 1HFUA 1BVNP 4LHUA 1BF5A 3P73B 1RIHL 3I84A 3I9GL 2BZDA 4F9LA 5JOEA 2YQ3A 1KPVB 4A6YL 1NWOA 3TEUA 1AMYA 4LSVH 3QDGD 2Y6SC 2BMKB 3QQXA 1U2CA 1E50A 2J4WH 4H26B 2YEQA 1ET8A 1O9VA 3I9PA 3KPQA 2DLGA 3NJHA 3GSRA 2WBJD 1NOFA 5BZXA 1JZEA 5TH2B 4PJ5A 1BJ8A 3UPRB 1BJ1J 3EFFB 4M6OL 2CBTA 5DJYA 4F7EA 4FG6D 2WSKA 3MRJA 3WNOA 4DZBB 5E23A 3ZMEA 1PZSA 2BNQE 3MOAL 3VG0H 1GVIA 4XN8A 5MEQA 5JPMA 4QNPE 4O02B 3BP6B 4N2LA 3QIBA 4EDXB 5EBLA 3PHOB 3S96A 2J12B 5BNXD 5ERWA 3R4DA 3JSSA 3RWCB 2ZX7A 2L3BA 3QDME 5KVGL 2ICEA 3MGTA 4ZW3A 1DLHA 1FC2D 2QV4A 2Y36H 5CGTA 3TA3B 4GAGH 2J3SA 3FTSA 2IF7A 1ZT1A 4DCQA 5F7KC 1AZBA 3VM7A 1V55B 4DERA 1AIFA 2WKGA 2BSTB 4GMSL 3FHAA 5CILL 3OV6A 2OW7A 5MHSD 4XPFH 3SBWA 1EJ6A 2H2SD 4HISA 4HUKB 3ZL4H 1MVUB 5C0EA 2HG5B 5I19H 5F1IB 1J5HA 2J8UB 2MQCA 3DIVA 1RHHB 1UACL 1KUMA 5E94A 4OJYA 5EEXA 3S96B 2FHFA 4YHPA 5L4IA 1P4IL 3H3PH 4KITB 4DNLA 1AXTH 2AF2A 3A21A 3DETC 3BJLA 4GI6A 5ANMA 4N6QA 3LOWA 3RI5F 4PWGA 3AT0A 4LRNH 2Q86B 3WJLA 3GM0A 4DAGH 1DVSA 3GB7B 5I1CL 1JZ6A 4M1DH 3BFQG 3S7GA 5SWSE 1PNCA 3C6LB 3UYPB 1AACA 3ZIMA 4EXKA 1LWJA 3VRLF 1RPUA 1W72A 2VITB 2BIQA 4TSAL 3VH8G 4NZTL 5JQIB 2R23B 2R8SH 2Q76A 4P46C 4QJ3B 1UD4A 3SBPA 3VGFA 3GTTA 1NANH 5AZUA 2JKWA 2VMFA 4YHZL 1A25A 2BINA 1UXWB 4D9RD 3HC4H 2D7OA 3HC0A 1OVZA 3WEOA 4L29A 4ZFOA 2YPKA 2ICWJ 2X89A 3P3SA 1FAKT 3VXUA 2C26A 2E86A 3NGBB 5DS1A 4YLCA 4R96A 2H6PB 2QQKH 4N2BA 3O4LB 1TQBB 2EIJB 5DMIH 4PJ5D 2X6VA 1WHOA 3NGBC 2GJ6A 3QJHA 4I4WA 2VKWA 3QIUC 4FQJL 4PJIF 1R33A 4XO3A 4Y4HD 3KPSD 3LYRA 5DJ2A 1ZIBA 1S7SB 2G2RB 2I9LA 4L3ED 4MCNA 2FYYA 4Z7UF 4AC4A 1E5BA 2YKLL 3OVUB 4BFFA 4D0BA 3L17A 1LO4L 2H2PD 1DBKL 2RH0A 2VC2L 5FF6A 3D0AA 3LD8B 1TFPA 2F6AA 1JWSA 1DQLH 4LHUD 2X9ZA 3DETD 5GRVK 3FOLA 1I7UA 3ZGHA 4Z7WE 3FSZA 1ZLUH 2D3NA 4BM7A 3RUGB 3KAAA 4GKNB 1FO0L 3ALPA 1YYMH 4H1LA 2XPYA 4GUQA 3DMMB 2JELL 2OR7A 2ZXWB 3SDAC 4PRID 3SPIA 4JKKA 2XTJC 1M6UA 5MENB 3UBXB 3D50A 1FNEA 1IQDB 4OZHA 2WO2B 5FHBL 3UJTH 3F65A 3P4NB 5HJ3B 3WNPA 4XP6H 4U1LB 2Y69B 5IMKA 3O4LE 5CMAA 1DJSA 3CFDA 2BJML 4ZQTA 4F91B 1CT8A 4G8GD 2H1PL 3FRPA 4KRLB 3RVXD 4ZMAT 1SYSB 4YDIL 1AHWB 2YUXA 4X4XA 5GGVY 3ZR6A 3U0WH 3SBQA 4JY4B 1BD2B 2B1AL 1PG7W 1HC1A 4M7JL 1N5YL 4LCWD 3C6LD 1LL1A 1QSFE 2Q7YA 2Q0ZX 2GI0A 3B43A 5HVHB 2BNQB 3VD2A 1OCWL 3BH8A 1NIFA 5J12B 1AGBA 1J7VR 5DJ6B 3K0YA 5SV4A 5IBTH 1KPUA 3WG7B 5KZCB 2EICA 4Y0GA 4JDZB 1CBVL 4LZKA 1YG9A 2XZQH 1NCWH 1YEDA 3LMJL 1A6UL 2CNZA 1JYWA 1CGSH 3RWGA 4O02L 3BESR 4KUZH 4ALAL 1JZ2A 4YO0A 5CJBA 4LL9A 3IBEA 3IU3A 4UTBA 3RB7A 5J13C 4U6XA 5A2IH 1A1MA 1K3ZA 5FIEA 3NZHL 5E5UB 2X3CA 3ARXA 3J07A 3LXBA 3L4WA 1O5PA 1TXKA 4OD1L 5FO7B 1CJYA 2Q5BA 4EEEA 3GLZA 3IJYA 1P2CA 3NJNA 1QG3A 3PNWB 3QI9A 4HWZB 1MPAH 2IOIA 2VDQH 2FX8H 5FGSA 3FUIA 4LKCA 5AVYB 3BPCB 4U33A 5F7NC 5K69A 2Q2LA 3EYQC 2XC8A 1S78D 3BP4A 3HC3H 5ILTH 5CZKA 5AL0A 5E6ZA 2F18A 3L4VA 4NN7B 3PWJB 5IFHL 5D2LF 3IFLH 2D3JA 1TJHL 1YNTA 2OKMA 2W60B 2WKOA 1CDCA 3MJ9L 3MLVL 4NO3B 4PYHA 2V5SA 1TIUA 5IB5B 1CC3A 1DSFL 3FFOA 5KYYB 5CLZA 3QC5X 1T7WA 4AEFA 2A9CA 3MFGB 2J55A 3EOAB 2J5WA 3CFJA 2ZOKA 3CSTA 4PJFA 3WY4A 2A1WH 2B3RA 3BP5A 2DQJL 2BVOB 4K94H 4MA8L 2JCCA 2HKFH 1WWCA 4NZRH 1HHGA 1DBAH 3VXME 3PP4L 1HIML 1B2YA 4RZCA 1UENA 3KPOB 1WLHA 4DVRL 1IKNA 3RGHA 3VA6A 5FLVA 3FQ4A 2HT4C 1TZAA 3GKZA 2B59B 3RWEB 4P2OC 4QRUA 1UT2A 3DBXB 2BP3A 3C60D 3VG0L 4JY6A 1GCFA 4H8VA 3SJVD 4N3TA 1WITA 5L7XL 4KI5E 3SYQA 2CA3A 4ODSH 1FDLH 4I2XE 1JGLH 2YLHA 4LCIL 1GYWA 3V0HA 4N24A 4K5OA 3GO1L 4O51A 2B5IB 5J1TC 1AG0A 2NLJA 3PL6C 4X6EA 1LO3H 2ZOOA 2F1EA 3D18A 2AJZA 2VDLH 4HCFA 4HIHA 3VI3E 3BVNA 1A1OA 2PPEA 4OGYL 2DWXA 4F2MB 3Q1SH 4PS4H 4HU2A 1N8OE 5DJXB 2FQDA 1HXYA 4R0LA 1AXTL 3T4YA 5AAPA 2JFCA 1P1ZB 2VZ1A 1GJUA 3G6DL 5J9PB 5H94B 4FABH 4Z7IA 3A6CL 1UACH 3IDGB 4E41D 4PBVC 4M1GL 4PRPA 4Q9RH 3WNIA 5JMOC 4I77H 4FG4A 3AG1B 3BZ4B 3MNWB 3V4PH 4W9EC 3Q8FA 2WZ6A 5JXAL 4ONFL 2F5BH 3WFCH 1ITCA 3FQ2A 1BP3B 4X6CE 3VX1A 4ZNEE 4XNUL 2C4XA 2WYZA 4W9KC 3FUEA 5AALA 3BQUC 5GRJL 4RGNB 2XQYK 3V7MA 5A2CA 1G9MC 1G9NH 2NNAB 1YN7B 5CCJA 1R3HB 4ORGA 1ZJAA 3F2LA 4G6FB 4GSDL 1DQDH 3VXPB 4P9HL 4TM9A 1EZUA 4F7PB 2Q3AA 3B83A 5KBKA 2VABA 4WI9A 2KC0A 4LL1A 2ZKWA 1PD6A 3O8XC 2NNCA 4R26L 5FUZL 1S5IH 4QRQB 5B3JE 3SQBA 1B4JH 1RLWA 5BV7C 1BM3L 4FA6A 1VZIA 4RFEA 3L1GA 3FU3A 5TD4A 3NQKA 2IAND 4TTDD 5EPMB 4DVBA 4HS3B 1F97A 4OIIH 2A83B 2C9AA 4LPTA 4OI9A 1LNUA 2CKBH 3MV7A 4MJ6B 5I6LA 2DQHH 4UQ2A 2BSSA 3MLYH 2VQTA 1JV2A 2VABB 3SCMB 3OAYH 4XOEA 3KS0H 1RZJL 4J2QA 2M2DA 5AW5B 4UV4L 3APNA 2EQDA 3ZDXF 3C8KB 4X9HA 1B0IA 2PWFA 4JPKH 3A47A 3N9GL 1LVEA 3V9FA 1AS7A 1ONQB 1DQJA 3T77B 2X3BA 3PAZA 1JZIA 3BI9X 1RJZA 1Z5LA 1CDHA 2YAMA 2YMOA 1WICA 1BAFH 1HNFA 5F6IC 1QBAA 4QXUL 5I1LA 4XXDA 4CN1A 4NAMA 4UAOB 4EI5B 5HYFA 4V33A 5F88A 5CEYA 2NUPA 4LDCA 2EH8L 1U93A 3WS3B 3CVBA 3BSGA 3IE9A 4AL8H 5EA0L 1EGJA 2CR3A 2HX9A 2WZPD 2EVIA 5CJXC 5KBMA 4JG0L 2HRHA 5DURD 3F62A 3BRGC 3PGCA 2FK9A 3QW9A 4XCNB 5FO7A 1DDTA 3HHRB 4P2OB 1T0NA 4J3WA 2K6WA 3SYOA 3GSNH 3UTSD 4X9FA 1L9SA 2F19H 3O8XA 3NIFF 4KTGA 4BFIA 1WIPA 4DP5X 1ZAGA 1FGNL 2YXMA 2BRRH 2JLLA 4YHKH 2C9UA 1A8ZA 1YNTB 1KDJA 2V9TA 5T33H 5JOFA 2RHEA 3T2QA 3GRWL 2XQ0A 2ZXDA 3MRCB 3TZVD 1AXSA 3G9AB 2BP0B 2F7QA 4Z3HA 1J5OL 1JK8B 4AUJA 3QAZB 4RMRA 5F9WB 1SYVA 1IMHC 3QWNA 2B9BA 1DQLL 2E6PA 3B1TA 3MA7B 4AGPA 4LAQL 2YD7A 2YGPA 1NKGA 4PD4K 2CM6A 4GNKB 4MAUH 2DQ6A 2I07A 2CUAA 5FYLH 1JUFB 1SM3L 1BZ8A 1B9KA 1JF1A 3WIHA 1X9LA 4UUJA 3QPQC 3RZCD 1CQKA 4MQSB 4UMGA 3KYOA 1IFRA 3K80A 5DZAA 5E6ID 3QVAA 3S98A 4JKWA 4CILA 1GGCL 3FHQA 2WIIB 4MQ7A 5AW2B 5D7IA 5F89A 1NAKH 3GZOA 4FXGC 4PJIB 4J3VA 1NEPA 4GPVA 4WUKL 2JH2A 5F7HA 4KVCH 5I0YA 4ZUWB 3LKRB 3QUZA 2VXVL 2DW5A 3HUJB 3QQ9D 4PJEA 1T4KA 1L0YA 1QRNB 2B1AH 4XO8A 5CP3A 2WLKA 1UWGL 3BZDA 1H8LA 1TZHB 3DV6B 3HCVA 2WTRB 3CGTA 4LAJH 4F2MA 3MV8D 3ISWA 2WXIA 3TXAA 4FQLH 4NC1E 1GZQA 3CDGA 3HHMA 1KPVA 4W9HC 2DJSA 4IGBD 4N2AA 5AVUB 1DJHA 4FTVE 4NWUL 5ID1B 1A64A 2GC7C 4NX0A 2ZXBA 3AUWB 1KNOA 5CLXA 1FNLA 3BMWA 3DO7A 5CR8A 2JIXA 3THML 5JXEC 1LE9B 1VPOH 2XWTB 3D12B 3FAWA 4L3FA 4H40A 4JBSA 1EX0A 4Z76A 1DE4B 1FZJA 4Y7OC 4DGVL 1XH2A 1CFNA 1X5ZA 2Y07H 3FB7A 2EXYD 4PJ6A 5G2NA 4F3FB 1KCBA 2MOVA 5D8JL 2K7PA 2V4LA 1MEXH 1NM4A 4KQ3H 2BWIA 3VSTA 2OW6A 2R9HC 5LAPA 2XICA 2QGEA 1SY6H 4HOZA 1D7BA 1FUNA 4I9WD 2CGRL 2Y5EA 3LTVA 4M5ZL 4X9YA 3AMLA 4DHLA 2R51A 3WFEL 5D70L 2WXOA 1YNLL 4G8GB 2IALA 3PGDA 3MRMB 2CO1A 3EHBB 4G3YL 4MCZA 4OT1H 1QEXA 2P80A 1U8KA 3VNYA 4LVHC 4GQ9L 3TASA 3SYAA 1NTDA 4IJTA 1TFHA 1XGRB 2A9AA 3AS0A 1C12A 1KTLB 1QA9A 3TBYB 1W80A 1T1ZA 4PEEA 4WFED 3HNVH 4HIIB 1GJWA 2G9KA 3DGDA 1A7PH 3NACH 4KJPD 3HBZA 3SD2A 3SY0A 4NZUL 1MAJA 2VH5H 1XIWD 3MSPA 2EYTB 2ENSA 4XAKE 3DPBA 2HFGL 5L9DH 1CGSL 4GP5B 2BVYA 3A6OA 5H4ZA 4PJHB 1VERA 3D8MA 3W9EA 3ARGA 5E9AA 1KENH 3LZOA 3RTQC 5MP6L 1BGXL 1EEZB 1V3LA 3WAJA 5TK4A 3HHSB 1AG6A 2EXYC 4GAFB 2Z6FA 3MBEB 4AYSA 1TEYA 1BVNT 1GGYA 1NDMB 4ZXBD 1KCWA 3AG4B 3EFDL 1ICTA 3ARVA 4NERA 3GMRA 1FYTB 1UZGA 4IMKA 1WUNT 4UOJA 3ZL2A 2FX7L 1SBSL 4MCYB 5IUCA 4DKEH 3A4AA 4GYBA 1ZTXE 2PPDA 1UEYA 1YMMD 5MEPA 1WP6A 4R2GB 4JFPA 2YN3A 2X12A 1BZ9A 4JG1H 1C5BH 3B4NA 3LEXA 3NCJH 3PAUA 3S8GB 4NHUA 2A6KA 4QJ5B 4CAGA 2F1BA 5CWSA 1TUPA 2QGBA 1VKXA 3T09A 4PG9B 4Y5VC 3QJTB 5EDSA 5I73C 5GIRB 2XZAH 2L4OA 3JBG7 1HZLA 1XCWA 2FQEA 1LD9A 3HNTH 4OLVH 4ONHB 5F7AA 3WFBH 2XV0A 4N85A 3F01A 2PCYA 4DGYL 1EHKB 2XQBH 1E3ZA 5D7HA 5FK9A 5EU6D 1PEZA 4PJ9A 1OCOB 3L5HA 4P07A 5HYSG 2JB5L 2FO1A 4FRWA 1BX2B 1IQDA 3HFMH 4OZHB 5C0RH 3BDYH 3JYCA 1SMOA 1FZMA 4E68A 2Z64C 4AYDC 3FB5A 1E9QB 3NCBB 4KKPA 5DJZA 5ETUA 4L4TD 3T6QC 1RY7B 2AXFB 1EJFA 4MXVE 1EHAA 4DW2L 1MJJA 3SSGA 2E7HA 1T89A 2QSCL 2IANA 2P46B 4BZYA 4W93A 1YECH 3RIAF 2R7EA 2EDEA 1VGKB 3CVDA 4PJHE 2H2SC 5E8DL 2JK5A 5DWPA 3FTZA 2X3AA 4NO0A 4WFGE 2CRMA 5I73B 3FYEB 2XN1A 3BVTA 3SKUD 4KTDH 4CC4A 2F1AA 2PXYC 1EUTA 4A2GA 4U1KA 32C2A 4Y2LA 2ZUUA 3MFFB 4N8VG 1MIEL 4ZMZA 4G43A 1G7HA 3KYAA 5EBMA 4NO2A 3BSZH 1DSYA 1SXZA 3VW3H 3ARFC 1WUZA 1MRDH 2BHUA 2JB6A 3NJFA 4OV6F 1TITA 5KANG 3VXTA 4QRTA 3GQFA 4WTZA 1A2YB 5BRZB 1A3RH 5DQ9A 5AOMA 1OTTD 3EJZD 1T89C 4WJ5A 3VI4F 1JCKA 1LK2A 3T2PA 4XVJH 3K2UL 4Q9BA 4BZ1L 3N1PC 3SPGA 1H19A 4X8GA 3PV6B 4NZDA 2N59A 3P11H 3QUML 3JYBA 5F9AC 2QFRA 4URKA 3RNQA 3W0WD 4CU8A 3JWOL 1WA1X 4MJ6A 4NO2B 4O58L 4O9HL 5DMKB 3BUDA 2OQJB 3VB9A 4OJDH 2FD6L 2J6EH 5DJDA 3BAEH 1OIOA 2DIEA 3PWVA 5I8EA 1RMFH 1UWGH 4R7NA 4G5ZL 4KTYA 4Q6YA 5I1GL 1RZGB 4HKJA 5C07E 1A9EA 1EXUB 1UASA 1JPFB 2CJSA 4HK3J 1KDIA 3QZBA 3RGVD 4BFOA 2FO4B 5FYKH 2QBWA 4QXWA 4ZO6A 2GUOB 4BFJA 5EUOF 5LNDA 4GW1A 2BSRA 2EC9T 2XN9D 4JKMA 2VDKH 3N1GC 4E0RB 4WDIA 4QHKJ 2HLEB 1QFHA 2EDOA 4OUOA 4CKQA 5C9JB 1RV6X 5FA3B 1W2KT 2I32A 1WC7B 3WKML 4AGQA 4MD0B 3VWKA 3L4ZA 5IHHA 1T7YA 4FQXD 1JWUA 3RRQA 2OCCB 3RZCA 4ALAC 3VAEA 3ZDYF 4M1GH 1BVZA 2BP8A 3H56A 3GNMH 43C9A 1FIEA 3I74A 2HVJA 2Y72A 2A4EA 1DO6A 1EZVY 2B59A 2HCZX 3DI2B 3II2A 1AVAA 5DZ9A 3RWEA 1CXHA 1IC5H 3AABA 2X53A 4HSQA 5DQJA 2QTVA 4V11A 3H9SE 1MCQA 1M71B 4PLJC 4YHOL 4NUJA 2QKIC 3DHPA 2WNGA 5AAWA 4XP5H 3RZCB 1KT2B 3TT3L 1HWHB 2PP8A 3CAFA 3GSQA 4HIXH 2A3TA 3KGSA 3BVNB 4PJAF 4TF4A 4HKXB 3P69A 1EJOL 1UJTA 3TVMC 2NLJB 1TTAA 4KNUA 2ZCKL 5DRNA 1H3VA 1Y1DA 4MD5B 2K3TA 3BVXA 3LIZA 5SV3A 5IGXL 4UZSA 1NGQH 3KPRB 2BIMA 3BIKA 3AWGA 2OS7A 2ITDA 3A3YB 4MNGE 4NQCB 3QDHA 4PRPE 5GS1B 2R69L 3I9AA 2ICWB 3OXSB 3GIZH 3LZNA 3KYKH 4LEOA 4FQXC 1FYTE 1TQUA 5SX5K 1BGXH 4OJAA 1SQMA 2EEFA 4OU3A 5L4MA 3ARPA 2QADC 1QWUA 4K15A 3X1GA 4ACTA 4AJYV 2XNAB 1LDPL 4DPCX 1I9JH 4FQCL 4HLZH 2A73B 3T3PB 4WF7A 4G7YH 1K6QH 1QBLL 4J27A 3SOBL 4RAVB 2ZF9A 1SJVA 3ZZLA 3BIKB 1XGRA 3SPJA 2RJMA 2EDDA 5LAXB 2DICA 2VLME 1WT5C 3EW3B 2C3GA 4K5LA 1NGPL 4JRXE 3OAYK 5D5MA 3V9EA 1GC1H 1NBVL 2ATPA 5I5IA 1JSYA 3TPUB 3V9CA 3IMVA 4P2AA 4XBMA 4HWEH 1TG8A 2P5EB 4HWNA 5HI4C 3SE9L 3CBJB 4PTTA 1SVBA 2XBTA 4JJ5A 1P7HL 1MCIA 3DWTA 3EOTH 3QIBB 4EDXA 2X40A 2E4FA 4UIMA 4LSSH 3T0EC 3GXMA 5L4JA 3E6HB 2TRHA 4XP9H 5BZWA 1MFDH 3GZQA 1J8HA 4CBPA 3U4AA 3T4AB 5IFAL 2H7WA 2DQUH 3SDCA 4AMKL 1XR9B 2I69A 3L7FA 2N1KA 3POHA 4QO1B 3TN0D 4F2FA 2D31A 2L7UA 1J5CA 1WD8A 2WLIB 2XV3A 2X4UB 5F96L 2GJZB 3ARUA 4Z3EA 2IDTA 2P7TA 2VLRA 3CFKB 3VMPA 3T0DA 3N41B 3MJ9A 1V54B 4XGZB 3TWCH 4BKLB 1MW2A 4I0KA 4ATWA 1CPUA 1NJ9B 1TTBA 3Q2WA 5KYUB 3QFJB 3FTXA 4P2QE 3PWUA 3IGKA 1XCXA 3BEVA 3OC5A 4KQ4H 2GSGA 4QCIB 4F8NA 1B0WA 3RQ3A 1IGTB 4YHKL 1RSFA 2VDML 5DRXB 5J8OA 2C1OA 1RH8A 3WL9B 3PLYA 3TLRA 2CO2A 4UT9A 3WJJC 4UAOC 3MNMA 1A7RL 2ITCB 3QUGA 3BWUC 3TCLA 5D1XC 4OZIB 1SHXA 2FTAA 3BGFC 4LCUA 1E8YA 1OP3K 4HSCX 1ND0B 4YS4A 3KPSA 4PP2B 2IOMA 5E2JA 4DGYH 5JR1H 1L5GB 1W91A 4BV1A 1NUFA 3MLUH 4HLEA 4UU9A 5F72S 1FL3B 2NQDA 2R1YA 5DJCB 2OR9L 3MRFB 1GS7A 2Y2WA 4JZJB 5E2VL 4R4FL 4UDTB 3TYGL 3ZTJH 3QBTB 4B96A 1E6JL 5CBEB 3OKOA 4BXSV 4KJWD 5IJBC 2EXWD 4HCIA 1EMTL 3F5WA 1EK3A 3GEFA 1VFMA 1KLGB 2MSPA 4PJIE 1WHPA 4NCDA 2R2EA 1OSPH 2D0FA 2VT0A 3RVXC 1OGAA 1WAAE 4LXFA 4U49A 5CHNB 1JTTA 3ZE0F 3TZVA 1HQRB 1JPGB 4MXQC 2WYTA 5AWNH 1Z3GH 3V0JA 4ZZFA 1ETJA 4IRJA 4JFED 3CIQA 3MV9B 5F3FA 2VXVH 2WO3B 4HT1H 1VCBC 2XETA 4KO7A 4QTHA 3GBDA 4HXBH 3QYMA 4QR7A 4G8FB 4QWWC 4K3JH 4YLBA 4WU5A 2JXMB 4KO9A 1L9QA 1HOCB 4PJDF 1G7PB 3O8XD 5D1XD 1UXLA 1INQA 2YPLB 2BP0A 1IV8A 3SPHA 2ZOWA 3PWPD 1XZWA 3QCVL 3HS0B 1OB1A 3DUSA 3IXAA 2ITFA 1VB9A 3UTPE 1AFVH 1GGBL 1O6TA 5FO2A 1OV8A 2BOCA 1JG9A 4WWPA 1CUOA 3LPGA 3CMOL 1UKSA 2FSEB 4JDVB 3DSNA 1CE6B 5C0FA 1KYUA 5FHAL 4KRPD 4PS7A 4Y4KC 5HD8D 1IGYA 9PCYA 3NSCA 4NBYB 1A47A 1JNJA 4Z7OB 1ZLSL 2G2PA 4NGHH 2V3DA 3HPJA 2E56A 2EXTA 1SLUA 3WHXB 4FQCH 4OFKA 4EUPH 4I89A 2W07B 1QASA 2GITB 3QAZC 2ATAA 4K9JA 1N7MH 3O6KL 4HQQH 2ED6A 2DLFH 4TSBL 4YDJA 3CSFA 5KVDL 4OLXL 3MUZ1 3QB7C 3B2VL 1GY2A 4S1SH 3RX9A 3WFHB 2HN7B 1NOLA 2X70B 3BQUA 3C2SA 3M1CA 3QNFA 3DI3B 3EJTA 5SWQB 4CVZB 4D9LL 5I19L 1JGDA 2EYRA 3QO1B 2MH4A 1G7PA 2ILLA 4HU8A 3RKPA 4HIEA 1CI3M 4S1QH 4X5PA 1M05B 2VDRB 4P2RA 5EOCL 3FMGH 3K72B 3KR3H 5BJTA 1H3PL 2XJLA 3LPWA 5EC2A 1FNGB 4ZS6D 3WNMA 3K2MC 1DQKA 3CBRA 1F00I 3LSOA 4QY8B 3BP6A 3KM2A 1IAOB 3ARFD 1AGEB 4OCRH 4DEPC 3DYPA 2AK4E 3S5LA 2BSTA 2LU5A 2Z92A 2E9GA 4HUUB 1VGEL 5EBWB 1KNOB 4OCLC 2DKUA 2ZJSH 3HMXL 2DKSA 4IJ3B 3GLAA 4GXUM 3TA3A 3WJMA 4D3CL 4NRZB 1IO4C 1U6AH 5KWYC 3M17B 5ICXA 3P40A 2BFGA 2WLNA 2ZUXA 2AAVA 3ZZQA 3PJSA 4MSWA 4YAQA 4QRQA 1JI2A 4KY1H 3K6IA 1UB5A 3G6JA 5F2FA 3KL3A 4ZFFB 1AANA 1I82A 2AZUA 1XGYL 4JFOB 1R5WB 2R4RH 2Z8SA 1WCBA 1MCPH 3NG5A 4GRLD 4XOBA 2VR8A 5B1JA 5ELIA 4F8LA 5AVTB 4G9FB 4TLKA 5FYJH 1UA7A 2WUBL 2CHWA 4LSQH 4GEJA 1NINA 3AXHA 3OF6A 3T5WA 2AV7A 1B0RA 3U9UA 2LLLA 5IT2H 2C9SA 4MJJA 3Q0HA 2I7OA 3JZ7A 3PJSB 1BZ7A 2VWEC 4AV4A 1PZ5B 2P8MA 4DFIA 3MRIB 4NQVB 4OD3L 1OCWH 1YN6A 5CJ8A 5EO9B 1NSNH 3G5VA 4H88H 2FATH 2EVHA 4G8GA 1ERNA 5DUBB 3EUUA 4YDMA 3MNWA 2NXYC 1S8DA 2A1WL 1KGXA 1J0HA 2X4PA 1KPRB 1V5JA 3TO4D 5C0CA 4LPWA 4G6KL 1ZK9A 2C9XA 5DT1L 3JWNC 4Z0XB 1B0GB 2CGYA 5DU7A 3DOSB 1L7IL 4OZFH 4PTUA 1X9UA 2C1OB 4F92B 3IDMA 2R0KH 3BT0A 3F85A 4PJFE 4B9PA 5T3ZL 1QSVA 3VVVA 3TCLB 3O0LA 4WNQB 4JFQA 4PP1C 3SIKA 2C7FA 1K8IB 5DJXA 1KY6A 3QP3A 3Q2LA 4RMQA 3P02A 2BNUA 4NQDE 2GJ6D 1YAZA 4HBCH 4WGVB 1BMGA 5HHNB 5FGBA 3ZUNC 1FSKB 4P5MA 4HJEA 3IFPB 3MR9A 4N0RA 3VXQA 2Q9OA 4A66A 1LO4H 2AGJH 2YAOA 4N6RA 4BQCA 2O6PA 1SN2A 2BSBA 2V7HA 3TT3H 2CRZA 2HX8A 5I76A 3V5HB 1HCFX 1MQKH 3GKWL 3CFBB 4M3HA 4A2DA 3HMXA 4IBTA 1MHPH 4MD4B 5TF1H 4FGMA 1OP3H 4I0PC 5H37A 3MRCA 5BS0E 3C9NB 4BQBA 3B1UA 1CLOL 5BXFB 1AC6A 4X6BA 5AD0B 4C4KT 4GS7B 1ZVYA 2DQHL 3KPRA 3NAAH 1NAMH 3OAZK 4K7FA 5E4OA 4BYHA 4MBRA 4Z7WB 3JTBA 4JO2L 4R4BA 1YEWA 5F7EL 4JZNB 1UWXH 3GNML 4P5MB 5CSBA 1CTOA 4APXB 1ONQA 1HNGA 5F9JA 3EBAA 5JIHA 3SDAB 1WA2X 1ZT7B 3BCDA 3LV3A 4LCIH 1I8AA 1NOAA 2BC4B 2YA1A 2EVJA 1K8IA 1MCRA 4KROC 1KJMB 2BP5M 1SLVA 3G6JF 2D7QA 5DGQA 1EHNA 5HGGS 2A73A 5BW7C 1A4KA 1HL4A 1CLZH 1J10A 5E08L 2C9PA 3OAUL 4LPYA 1L7TH 2VZUA 3MODL 1R3LB 4M7LL 2JJUA 2JV6A 3CZUB 1L9NA 1JN6B 5LAXA 4N90D 2NUPB 2VISA 1ZLEA 5I71B 3LS4L 1P2CB 1CFVH 3DSNB 1F4YH 3GSWA 3NCCB 1KEGH 3QXDA 1LP9F 2WNWA 2XPGB 4OZGB 5FYKL 2F7PA 3KLQA 4P2RD 2IWGA 3HG1B 4MD4A 4YDLC 3CHQA 3D1MC 3F3HA 4K94L 1T83C 2CHZA 3B8SA 1JXFA 1F86A 5ITFA 1XB3A 2X2UA 2OTPA 1B9ZA 1P4LA 5EU5B 4WO4C 2GIYA 2G3XA 2EYSA 1MCSA 3CFNA 3GGWA 3X12B 1GOGA 1W0YT 4X4YB 2FEEL 1PCSA 4FJYA 3KDPB 2AQPA 3SDAA 4OF8A 4Z3GA 3CVHH 3U83A 2A6DA 1BJ1H 5TPWL 1IC4L 1UUSA 3LQMA 1H6EA 4LCWA 2J72A 4OZFG 5JIDA 3SKOB 4XCFH 4WHTB 4EF3A 1DZBA 2CZNA 3MRNA 5CCHE 4EE2A 3KW8A 2FJGA 1Q9WA 3C6LC 2MTAA 5BJTB 2FECL 1DL7H 3MBXL 1AOZA 3AGWA 2F5AH 4R7NB 4EIUA 4RAHA 4L1BA 5F88B 2F0CA 3UACA 3JT2A 3HI5L 2VDLL 2SEBB 4M8QA 2EKSA 1UXSB 1S5HB 2E5EA 2P5ED 5E5MB 2EE9A 4OFYD 4W4NA 1RCYA 2AQ3A 2JJVA 5C92A 4HPYL 3HLAB 1JGLL 3ECQA 1BQLH 3NSYA 1BVKA 1U8LB 4CC0A 2YWYA 4PG2A 4PRHD 1X6LA 5C08A 2VDLB 3EYVA 1JRHH 2PN5A 1Q9KA 2J8UE 1SLXA 2B15A 2NXZD 3MLYL 3BAKA 4N3UA 1N0XH 4JFFB 4ANVA 4AG4L 3PP4H 2VIRB 3T3MF 3OZKA 1OCCB 5JXEA 4FQPA 3OL2A 4TUUA 3DOHA 5HVHC 4YJZL 2A6IA 3T3ME 1G87A 4L8SB 1SEQL 3P0YL 1XH3A 4UILL 4HC1H 4P5TB 3DLQR 2CXGA 4UT6L 2DQIH 3CHPA 3GMNB 4NQEB 4K2UH 1AY1H 4C8XA 3BKYL 1T1WB 1MFEL 3MUHL 2FB4H 4N25A 3ZZSA 3M88A 3FRPG 3O9WC 1UFUA 1TQWA 4IGBC 2W9LA 1JVLA 1BXVA 5LHDA 4MQXC 2R2BB 3FT3B 3LZQA 3HC3L 2GHWB 1GC1C 1YN6B 1AO7B 1KIUB 5DS8B 5CEZE 1JZ3A 2QPFA 3QCTH 2CR0A 1UCTA 1KLUA 1LYQA 3WY1A 5T3ZE 2O5YL 4XB8A 2FJFB 5IQ7L 5JXED 2B5IC 3Q8BA 1KBGL 1MCLA 1PLCA 4IK7A 5GGRA 3VWJD 5SX4H 2GCYB 3AREB 4Y5XA 1VADA 5HPMA 4GSRA 1RK7A 3ARZA 1IL1B 2C9VA 2C9RA 1HWWA 4C4KO 5LN8A 3L3IB 3E80A 5HDOA 2G4EA 4OSUH 3D4CA 3CFUA 3TEZA 3TO4C 4Q14A 4E9RA 4F57L 5I6MA 1TZIA 4LBEB 4PG9A 3TO4A 5C0CD 5E9DE 3GUFA 1FL6A 4UV4H 1UM6H 3WEXB 3FRUB 3II1A 1EWHA 5JQ6L 3VB8A 1T20B 2B7DT 1KC5L 2XWBA 1MY5A 1KCUL 1TMQA 1N59B 5DTFB 2N56A 3F7QA 1CWVA 4Y19A 2ZWKA 2DYRB 3MODH 4GKSA 1HHJB 2XZCL 2OI9C 2Y6SD 2EEAA 2LV4A 3RPKA 3NJLA 4YPJA 4C56A 1XTMA 5KZCD 1WTLA 2W8CA 4MAUL 4W9GC 1PLAA 4FG2A 4X6EB 3T0ED 5LWYH 1J12A 3DV4B 3QDGB 1KCKA 2WO4A 4NQXB 1AZZC 4Z7WA 4GQ9H 4P2RB 2FBJL 2XOTA 3OMAB 4K9EH 5IBLD 3B2MA 3PU7A 4XMLL 3N5AA 5DFVC 5TE6L 3KJ4C 3LIZL 4R4BB 4UB0L 4NM8L 1IARB 2ZAHA 5AKRA 1FO0A 4KFZC 4R4FH 3QUMA 2PWEA 3EG9B 4HUWA 4J8RA 5D7LB 3VCLB 1RZPA 4ZOEA 5ACMA 1Z6JT 1G9MH 1G9NC 2NSXA 3VWKD 1SQ2N 3GFUA 4LLWB 5JW4M 1BWWA 3QYNA 3UJIL 4H25B 3ULVF 3TH3T 2UZIH 3BH4A 1TTUA 4N8VA 4NFDA 4QHNA 3UZEA 5F0LB 2C34A 2VWEE 2B8OT 2VZTA 3MLTB 3S35H 1UA3A 2PCFB 4MASA 1QYGL 4XTRC 5GSRB 2EUWA 3CJJA 2XN9A 4PVLA 5DRZA 3EOAA 5D71H 3NJMA 1RLBA 4V1DB 3PP3K 3PWVB 3GSUB 5HJDA 4KTEH 3IJ8A 3MVSA 2ADGA 3V95A 3BO8A 1CFQB 4I9XA 3EFOA 3PABA 2JKNA 3ROLB 4H26A 2JCCF 3CFEB 4PJ5E 5DC9B 3BHBB 1G7QB 5J11B 2OL3L 4GFXA 4L1SA 1MAMH 1H9VA 4KHTL 3KPSE 3BZ5A 4QTFA 4WI4A 4LLMA 2NR6C 2VR5A 2BZ7A 1R75A 3OAUH 2A77L 3DX0A 1IGJA 4ZW6A 1HVXA 2ICEC 1OP9A 3MKKA 4HGMA 5D6CA 5FFLA 3GK8H 4DGIL 3L48A 4YX2H 1XGUA 2WKOF 3S88H 1MG2C 2UYLA 1EANA 2VXQA 4N1EA 5DFVD 2I85A 2FO4A 3CMOH 5EOTA 3HNVL 1TQTA 3T65B 4JFDB 4R90H 4ZS7L 1EBAA 3EDFA 4JB9H 2RFXA 3KWWA 3L13A 3OKMB 1A1MB 5AW7B 3WKYA 5KSVB 3D4YA 4AGNA 4GUOA 3G6AB 4KV5F 4PGBA 4PRIE 4XHJC 3U7YH 3TGXA 5HGAB 2HMIC 1WS8A 2HYMA 2A7BA 1SJEA 2GJPA 4YO0B 4QHKI 1PZBA 2BS8A 2G9HA 4P99A 1GY1A 5GJTH 4R83A 4FFWC 3Q2VA 3FQUA 4OFDA 3TNNA 2X6MA 4P4RB 1NCCH 4G8GE 1SHWA 4M5ZH 4Y2DC 4UQ9A 1DUYA 2WXKA 3WLWD 5TQ2H 4RMTA 3VG9C 5HYSB 1QABA 3MX0B 5ABDE 4BSVB 5HI4D 2VLJD 3OB8A 4U7KA 1MNNA 2BCKA 2QLYA 2ZXQA 3QG7L 4PGDA 1A1NA 4UQ3A 3RVTC 3FT0A 4GJTB 3OSKA 2F5AL 2K8QA 4IRJC 1HYSC 3CFTA 4TNFA 4I0PD 3QIWA 2NDFA 2IAAC 5IVXA 1MAKA 2F53B 2XRAH 1TPXB 3ESOA 4GRWH 3HE7A 3FZUC 3TBTA 3RAJL 3TN0C 3DGGB 4XMTA 1U8JA 2X7LA 4KQ3L 5I28A 3T2NL 3JWDH 1YYML 5E2WL 4WU7B 2WQAA 1N19A 2MOQA 4NQDA 2QHRH 3DO7B 4TNEA 4BSJA 2EDNA 4HG4J 2HMID 5JYLA 5GXBB 5DYFA 4XVUC 1E6OH 1CDJA 2UZXB 4G9FE 4IDJH 5ALCH 3V4UH 5IF0A 2W9EH 2YXFA 4G6AD 4K07A 4JFHD 2GITA 3ZHDA 1MNUH 1EH9A 3FFDA 4YXKL 5ESVA 4YHYC 5H8DA 3ZE2E 2ZNWA 4Q58C 5DI8B 2CXKA 4N0UB 3TL5A 3BRFA 1F6LL 3NRPA 1MIML 4ZS6C 3W5MA 1ZSDB 2WBJB 3ARSA 3ML8A 4OTXH 3KHOA 4RLDA 3B9KC 5FYJU 2DH3A 2ZSWA 3TIEB 1JNLH 5E8OB 1LEKB 3D39A 2ZZUT 1AI1H 2VDKB 1JD9A 4IMLA 4QRRB 5DHDA 3S5LG 1XCTB 3IJHA 2WVVB 2YJQA 5GGRY 3U0TB 1IL1A 5HPOA 2D03H 3SE4C 5GRVL 4DP7X 1M7DB 1KFAH 3U6RA 3LZRA 3TPUA 3WIFB 4GSQA 5K1VA 5JIMA 3IDXH 3MUGB 1MCCA 3TEYA 2XG4A 3X17A 4APQC 3L2LA 2DQGH 3LKOB 5EOQL 4XH2A 3KCWA 4JR9L 3V6OE 4R7DA 1FLTX 4I48B 3E1ZA 2CIKB 4OD2A 4UM9A 2OZ4H 3GD1C 1X5AA 1KBGH 1HHJA 4LSUL 1GSMA 3JUYA 4L9DA 5DQJB 3NEOA 5D1QB 4JGJA 2WYIA 3FFCD 2ZXCA 3ZDZE 2WWKO 3DBSA 1OW0C 1T04A 3F05A 1MLCA 3QS3A 1ZJBA 3NBNA 4RX4A 3FQNB 3ULVL 3QEUA 3CQFA 5HGBA 4FFVC 2DBLL 4U1NA 3SJVE 2WXQA 4M7JH 3U9PH 4TNGA 2Y0SA 3O3UN 3CU1A 5LNEA 3SEPA 5I1GH 3O81A 4J1UB 1QLEB 3IJSB 3LZFH 3BD3A 4OLYL 3DX9A 5C2BL 4JX0A 1F3RB 1E28A 5I66B 1JHTA 3W3BA 1U42A 2Y7MA 2DL2A 3VTTA 4IM8A 4K7PY 2CJTA 2KMWA 1ZWIA 4XP5L 1CCZA 3C8DA 4GRLA 3A67H 3MUGA 4WZ9A 2YBGA 4XVJL 3FT2B 3HKZA 4HS3A 3QJFA 5TE6H 5C09A 3CVCA 1TSRA 3BPOB 3RFRA 2C8NA 5L2KB 1ND0A 1EVTC 1ZXKA 3C60C 3WN6A 1GGIH 2WSPA 1N68A 3RHWF 1NGYB 3OJVC 4TVPH 1PS3A 2UZIL 4IRSD 4XE0A 3ROOB 4JM4H 2R0ZH 1PYWB 5HJBA 3KPMA 2KH2B 5CIPH 4J3OD 2A6KB 2NY2B 2A6IB 4JQVC 4C4BA 2FH8A 3FYIB 1WZKA 3SCMA 1R6VA 4WI7A 1QSZA 5C0DB 3D6GA 3ZSTA 2AQSA 1FYHB 2X88A 3CN3A 1E9QA 3L2MA 4MHHI 1MCOH 4PV8B 5BZDA 4X7FC 3UX9B 3UBXG 1AYOA 4HX1A 4F37F 1BG1A 1OGAD 3QUYA 5BZWB 5HHMD 3GWJA 2Q8BH 1RERA 4NIKB 5EU3A 1C16A 4JN2A 1HINH 2NR6D 2FL5A 1UC6A 2ROYA 3OKDB 4UM8A 3VD9A 5DJ2B 2K6YA 4GOSA 4G7QB 4AQEB 4PJXF 1AOHA 5IFAH 2BY1A 3MZGB 3FTWA 4HOMA 2EEBA 4YX2L 5I6XC 3APDA 4NZTH 1JZ7A 3CZFB 4LL4A 1SVZA 2NY0C 2MNJB 5E5LA 5HHXH 4X9GA 1TQSA 4HC1A 2X4RA 2C9QA 5DR5H 3VFGL 6FABL 4XP4L 2JK5B 3U25A 1NCBH 2IGTA 4GXFA 5JHLH 3QA3A 3MPCA 2KDGA 2I5YH 2YK1L 4LBEA 4Y8AA 1DBAL 1R5VA 2NW3A 1QHPA 3X1EA 3OHXC 1KJ2H 5DFAA 5T3XD 2BIOA 2HH0L 3CFEA 3UAJC 4H0GA 5KG9A 5JOFB 2Z9TA 3HVDA 4K8RH 4Y2DD 1L0PA 3EJYD 43CAB 4BK5C 5I6XB 2BW4A 2CLRA 1F6AA 2AJZB 1A4KB 4G83A 1X7QB 2FBOJ 5SWZD 3EH3B 4E41B 4JAMB 1TJHH 3MLVH 2ZWSA 3PXJA 3QC6X 2MFNA 2P8LA 3FO2A 1CBJA 3QUXD 3EYOB 4FJZA 4GRWB 5EOTB 3KH3A 3TIDA 2GBVA 4MJIB 4EO5A 4FABL 4KZEL 3KYKL 1HEHC 4FFYH 1OAXH 3FT1A 3MV8A 4XX1G 2VERA 2I60H 3UP1A 4IRSA 4FL4C 3CQQA 4G8EB 3O3EA 1Y07A 5EIVA 4XRCB 2FBJH 2OZ4L 2JKTM 1VAHA 2CLRB 4Q4EA 1HCYA 3D0VB 4FQQB 2K1MA 1AKPA 1CFTA 2ICES 4DWHA 4ISVA 3MREB 1D7FA 3HR5B 5D2NA 3O2DL 4Q9RL 3ZX1A 1DVFB 4MD0A 1KPUB 1CDIA 5F3BA 4FTDA 5LN4A 3OKNB 2DD8L 1XFPA 1LK3L 4XCEA 5D7SL 1BLNA 4DQAA 2ADIA 3RB5A 5FOBB 1AQMA 4EI0A 4OUUA 3LS5L 3F7LA 2V37A 3HMWL 1NUGA 4PGDB 4YZFE 1MFMA 2PPCA 1JZHA 1IC5L 1DVUA 2PTTB 1O6SA 3IJYB 2NMSA 3STLA 3WHE0 5EO0B 5A3IC 3LNDA 2Q8AL 2P49B 2VMDA 3S3SA 4U2YA 3RY6A 5BMFL 3ULUH 4NBXB 3L1OL 3U4EA 4Q56A 1XH1A 2P8LB 1U8LA 5E8PA 4HH8A 2FGWL 1OAKL 4ES8A 3FU0A 2W0FA 4LVOB 3X13A 4JDEB 4LRIC 1U8MA 2FBRA 2CDGB 4KRMB 4MNQB 1LILA 4DVBB 3L4TA 3DXAB 5DUBA 2MKWA 3WKMH 4XPGL 5K9OA 3QNYB 4E9WA 2VC2B 2G4GA 1Y0LA 3FO1B 3UXFA 3O6LH 3WUWA 4J4PC 4FS0A 1NIAA 2HRPH 4JG0H 4MLIA 3OAZH 4JFXB 4NO5B 4Z0XA 2QV2A 1ML0A 4KQ4L 2ENQA 4PMFA 5BVPH 2G2NA 4RAUB 4J1UA 4PWHA 4MJ5A 3VJ6B 3INOA 1IFHL 5J11C 2FX8L 3AG3B 3IDMB 3GDCA 1EAPA 1WBYA 3WLWC 5D71L 3HC0B 4MX7B 4UF7C 3BSHA 4IBYA 4I5BA 1B0GA 4OD1H 3HG1E 2APXA 4WWOA 3U1SL 4M8VA 2V3FA 2FLBT 2DQMA 4U05A 3DURA 1T1WA 3E8VA 2APBA 3D05A 1T6VN 1ADQA 3L3JB 2A74C 1NFIB 1J05B 4JHAH