4HHUA

Crystal structure of engineered protein. northeast structural genomics consortium target or280.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
170
structure length
170
Chain Sequence
MGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMGSGSGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMTGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Engineered Protein OR280.
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords OR280
total genus 49
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4hhuA02
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4hhuA01
5IWAJ 2KL8A 3D3BJ 1HR0J 4KY3A 4LF4J 1IBKJ 4DV1J 4JI8J 4LFCJ 2HHHJ 3R2DJ 1XMOJ 2UXDJ 4JI0J 4JI5J 1N34J 4LF6J 4JI1J 2MQ8A 4AQYJ 4X66J 1HNWJ 2ZM6J 4LF8J 3T1YJ 4JI2J 1XMQJ 2UUBJ 4JI3J 4K0KJ 1N33J 1XNRJ 4LF7J 4JV5J 4DV2J 4RJVA 4NXMJ 2UXBJ 2KVQE 4PWWA 4JI6J 2F4VJ 3IMQJ 3T1HJ 1N36J 1IBLJ 4V1Ak 4KYZA 3J7AN 4GKKJ 1FJGJ 4LF5J 4B3RJ 4DV5J 4LFAJ 5FLXU 4NEZA 4JYAJ 3D3CJ 4X64J 4X65J 3J81U 2UU9J 5LM7E 4KHPJ 4DR5J 4DUZJ 4JI4J 4DV6J 5AJ3J 4YY3J 4DR2J 5IT9U 1IBMJ 4YHHJ 4X62J 2VQFJ 1XNQJ 4DR6J 4NEYA 4GKJJ 1J5EJ 4B3MJ 1I94J 4JI7J 1HNZJ 2VQEJ 4DV3J 4DR7J 5A2QU 5LMUJ 1HNXJ 3W1YC 3OTOJ 4DV0J 4LF9J 2MEWA 3R2CJ 4B3TJ 4LFBJ 2UUCJ 1N32J 4DR1J 4DR3J 4B3SJ 2MTLA 2UXCJ 4DV7J 5BR8J 2E5LJ 2UUAJ 4DUYJ 4NXNJ 3J80U 4HHUA 3JAMU 4DV4J 4OX9J 4DR4J 5LMNJ
chains in the Genus database with same CATH superfamily
3KG0A 1O5JA 4WFXA 3WIVA 1LV5A 2VG7B 2H9ZA 3M6VA 5D4OA 4F26A 4J9VA 1TZ0A 4Y2AA 3NBPA 5D77A 2NUHA 1UEKA 1CJKA 3ZZRA 2GJ2A 3GLJA 4LIWA 1RWOB 2EFGA 2GO8A 1GTEA 1RAHB 2DNMA 1J2VA 3AAWB 1MLAA 4LSLA 3LO3A 2CAJA 3MEEB 5K5MA 4GVBB 1LW0B 2MQ8A 4IG0B 4D3GA 1UFLA 4MYUA 1E6YA 2ZBIA 3QT5A 1TAQA 3SBMA 4N56A 2W9CA 2R9LA 1KSPA 2HHHF 3RBZA 1M5HA 3HHEA 1NXIA 3TUJC 2J6UA 1N5QA 2DNQA 1TKZA 1SVDA 1N8RT 1J27A 3G86A 2VKZG 4FF3A 4A47A 3JSMB 2OMLA 2WONA 1S1UA 4IG3A 3DHXA 1WOSA 4JUZA 5KFIA 1EKSA 2Z56B 3ILLA 1CC7A 2FHMA 1SUQB 1PILA 3DYAB 3K8WA 2WSFC 3LAKA 2CJXB 4CLYA 3GJSB 1GMUA 4RW4B 1X8DA 1QAXA 1U6ZA 3ZTPA 3C16A 4YS2A 3BO4A 1NJXA 1L3TA 2ZD1A 2DR7A 3BH6B 4WFNQ 1S4EA 2WCXA 4NI2A 4ETZA 4F50A 3TZXA 2MLYA 1IKVA 3KLHB 1W25A 2HNYA 2Z2ZA 2FHKA 3M9NB 3EX7B 1AFJA 3GJTB 3R27A 1MU2B 3CDEA 5D0GA 4DR3F 3MEDB 2C2NA 2WB4A 4RW8A 1N54B 1UVJA 3AQPA 3K7RA 5FLXU 1RT3B 4I69A 3FEYB 1VS3A 4ZVHA 3QAEA 1WEZA 3G6ES 3M8ZA 4CH7A 2GNKA 4KV8B 3OXFA 4IFYA 2AYGA 5C25B 1DAXA 2XB2D 1JKHA 4DR5J 3I9ZA 3ZNJ1 1G7CB 3LQVA 2VD3A 3H40A 2ZUAA 2ZZTA 3TX0A 1HBMB 1RB0A 2HVZA 4DS4A 1HNIA 1RACB 1OIAA 2O5DA 3O8WA 3DLJA 4Z37A 1VHFA 2D3UA 2XTJP 4PAAA 3K5NA 5A8WB 3CMQA 1NPRA 1PSDA 2IJNA 4HTJA 4GKJJ 3CNQP 5JVGQ 2MKYA 1NK5A 3S6EA 1T9WA 2HGMA 3GV8B 3HD1A 2ZEJA 3K58A 8RUCA 2YX4A 1ZPWX 5F8JA 1TELA 1DQ8A 4CO4A 2W4PA 1TKTA 1RBAA 5B08A 2VQEF 5A6WA 1S97A 4EK2A 4JV1A 3KDNA 2YNIB 3BSNA 3FEXB 4HLBA 3MPYA 2OGUA 2FLLA 4P2MA 2HW3A 2W8LA 5DLGA 5AXMA 3C46A 5D8HB 3OSPA 3ETMA 3M2RB 2J7KA 2MTLA 3W2VB 4J9KA 2AQ4A 1HHQA 1NK6A 4CT8A 2MKIA 3IXQA 2UXBF 1OWXA 2KZMA 1WHXA 5GAGU 3CCJS 3ZXWA 3M8YA 2GMJA 1TL5A 1FNOA 3IM8A 4DPTA 2CQBA 3KK1A 2B6AB 5B0EA 4DEZA 1Q7YT 1IQZA 4ILMA 4C8ZA 2RRNA 3KHGA 1IKYA 4YB6A 1GTHA 2NSBA 3DOKB 1RWKB 3R7BB 1YG0A 2CQIA 3BGRB 3OR2B 4KH1B 4NLSA 3WIUA 4F25A 3FSYA 5A8KB 2W9BA 3DOLB 1ZS6A 2Y0BB 1RA6A 4NLTA 5C2CA 2X1AA 4DSFA 2HHHJ 2MJNA 3IBFB 2NUUG 1YBAA 1T03B 1FK9B 3JTPA 1Q86T 4OZJA 3LP2A 1VFJA 4L72B 4YB1P 3H4DA 3M32A 3PX0A 1U8SA 4U9RA 4X4TA 1ZTWA 2NREA 3ENAA 3IRXA 4PG7A 2HFVA 4JI1J 1WC4A 1S7IA 3R5JB 4Q0BB 1BXNA 2DO4A 3UW1A 3UD5A 1UJ5A 3CJRA 4YR3A 2CPZA 4Q2MA 5F0UA 4E98A 3G4SS 3A8KA 1SV5A 1WF0A 1ZM2A 2GCFA 1NZ8A 3JXOA 5I42A 1JLGB 3DHWC 1IUJA 3QBCA 2EI5A 2W1BA 4ZVEA 3MM8B 4TVAB 2VJVA 5KFGA 4LF8J 4DR6F 2KYXA 4WKRA 1B0VA 2YWKA 4ZCLA 4BLGA 4ATNA 3AXKA 3B82A 2NXCA 2VF3A 3C6TA 1M5OC 4LF7J 4P7VA 1I51B 3TANA 3KTQA 2GS8A 4RW6B 1EETB 2WZ1A 4KHRA 1FFWB 5AXLA 3RW7A 3R7SB 3H2UB 1YKWA 4Y0FA 2KH9A 4JI6J 1RI7A 1XR6A 3QGPA 4KGVB 2A6OA 4F02A 4DR4F 1YWXA 1MROB 2VC1A 2GIRA 4PWDA 5THWA 5H9EJ 2P9EA 2M8HA 1HHTP 4ZVFA 1MSWD 4OV6A 3M6XA 2BE9B 1H98A 3Q83A 5GADU 4DLEA 2QGFB 2EEYA 1WDTA 2BJDA 3KMSA 5EWGA 3LWMA 3L09A 4MKBA 3D68A 4ES1A 4NEZA 4LJMA 2VG6A 1KQFB 3BPDA 2G9OA 2V94A 4UW2A 4Y2MA 4A8KA 3CCMS 3R1HA 2DR5A 2XI2A 2RHSB 4PZVA 2KB2A 2HHXA 3VF0B 2HS4A 3B6BA 1N5SA 3PEHA 3QT7A 5D4LA 4C0OC 3GR0A 4PRFA 5J2QB 2QA1A 1P1TA 2C2OB 2GVZB 3PFEA 2FVCA 4DR2J 1LWEB 4B9SA 1S77D 1SL2A 4LBHA 4MIAA 4Z7YA 4HR2A 1GMWA 4KGZB 3WX4A 1RXOB 3QT8A 1SJRA 2AJQA 1RWWB 2M70A 1SBRA 3CD5A 1R7IA 3W5ZA 1Q8IA 2WRMA 1RT7A 2VICA 1TK5A 2QLJB 4F3OA 1YJTA 5KG2A 1Y00A 2BW7A 2CPJA 3AH6A 3CW2C 4IUFA 5D4PA 1XNQF 2YKMB 4FKXA 2CQDA 2WOMA 1G3OA 3NL0A 3CPWR 3MECA 4LR8A 2H5IB 5F3ZA 4UUWA 4FS2A 4ZVSB 4BBYA 2C22A 3UNGC 3W61A 3MR6A 1Y3JA 3CCLS 4DV0J 1KR4A 2I6WA 4IQXA 3G2XA 4LMZA 4NZ6A 4YDDB 1UVKA 2M2BA 4N77A 4ECYA 1OY8A 3H0PA 2X1FA 1QTMA 1WC5A 2J6SA 3W2VA 1NHUA 2V9KA 4JP8A 2FLPA 3HLUA 2IC3A 3KHHA 5CYMA 2H5EA 1U0HA 4KFBA 4PQUB 1GNKA 2B4UA 2A1BA 2J76E 3CO9A 3QIDA 4UT4A 2E5LJ 4OV1A 3RU0A 4LF7F 4NXNJ 4ED2A 4CO2A 3TUZC 1Q16B 3I56S 3BGLA 5DGAA 1EJ7L 2COLA 3DU6A 4OYMA 1R8AA 3TA2A 1HQEB 1NHVA 3D9BA 4ZN1A 3CT9A 4A8WA 1NBEB 2ZITA 2OD6A 4RBVA 4DV6F 1PG5B 4C2MA 2W25A 1E6VB 4KY3A 3HJFA 1MN7A 1RAJA 5KFPA 5KG7A 4FYXB 4DG1B 2Z8QA 2GJFA 1TFYA 3FRZA 1YJUA 3HULA 1SKRA 2XS7A 3H42A 1FDBA 1S1XB 3AOBA 2NLWA 2XGQA 1TL3B 4OX9F 1IBKF 2YVSA 4M5MA 2HFNA 4EFAC 3RW6A 3EVWA 2R8KA 1VK8A 4WFAQ 3PRDA 1N6QB 3QJPA 1I94F 2WVCA 2OSQA 2DEIA 3B4MA 5DRKA 4K4XA 4G3IA 2Q43A 2EK1A 3W66A 4X66J 1K1SA 2EKYA 3AOAA 1BQNA 5JVHQ 4U7CA 2JLEA 4DZDA 2KM8B 1FRMA 3W8GA 1H6KX 2XLIA 4EZ6A 4DS5A 3LP0B 1YDLA 3PR4A 1B7YB 1HARA 3DOMA 2FIUA 3FBCA 4EWTA 5CYQA 1IBMF 4EO6A 1K0VA 3PTWA 5K8PA 4M5JA 1GQEA 3CCSS 3QRRA 4JI3J 2XMKA 1PAEX 3PXGa 2E9RX 1N33J 5FJ4A 2IHR1 1URNA 3A13A 5BJRA 1S1WB 1F1BB 3CEDA 3TWZA 4B02A 2MKCA 4YB7A 5K14A 3V4MA 3PW4A 1KVIA 5KFAA 4K0KF 3UE2A 1JIHA 1LW0A 3U1MA 1MROA 4MYTA 3U27A 2DCLA 2M8DB 3NY0A 2M3DA 3GV7B 2R2UA 3T1HJ 1P27B 2AP6A 1KS2A 2DXFA 3AT1B 1R0BG 2QG9B 4V1Ak 3DFEA 1SJFA 3NGKA 2ZE2B 4OJ1A 4AL5A 3LA0A 3O44A 4CDIA 5CD4H 3JSMA 3RB0A 4MJKA 2FJVA 2GHWA 4OI1A 2YKNA 2K7KA 4I64A 4LIRA 1Q95G 1TUGB 5F3TA 2E5JA 2XHWA 3UN5A 3TZYA 2RILA 4JYAJ 4DL3A 4X62F 2WTFA 4RW4A 4Q44A 5GAEI 2OFHX 4NXNF 2DR6A 5DDQC 3IS9A 3HJVA 4IOCQ 4PUOA 2HQCA 2HGNA 4LRCA 5FDLA 1CJVB 1NK9A 3FGVA 1D1UA 3DRYA 2GA7A 2CPYA 4TLRA 4ANEA 5I3UA 4V19X 5IT9U 4DQQA 4K5RA 4TNOA 3MTJA 4B9LA 2UUBF 4ITSA 2Z2LA 1Z2ZA 2VJUA 2UVUA 1RT2A 2DGWA 2QA4G 1FNXH 1UAWA 4IYQA 2LYVA 4M95A 2BX6A 4TKTA 4JI4F 2CNNB 3IRWP 3GG1A 4BS2A 5C24A 3GP9A 5ETKA 1C1BA 4JI5F 3MR2A 2JHEA 1VQNS 2FJAB 4WU2A 4TY8B 3ZTSA 3OL7A 4R0EA 2LECA 5J2MA 2FY8A 2MQMA 3K0JA 3P8BB 3MMCA 2W9AA 4I7FA 1I6JA 4YB5A 1FXRA 2BEFA 4YQWA 5D3GB 1YQHA 3T6JA 3SIPB 1AT1B 1ZM9A 5FIIA 2FD2A 2UUCJ 1HNIB 4NPOA 1FTCA 3NCQA 1VC0A 2HAFA 5ETLA 2FVSA 3NLCA 1JLFA 1HW9A 3JSRA 3O5TB 3GILA 3PV8A 3AJ2A 3OV7A 2DNKA 2KFZA 3VQTA 2ZH5A 3CJKA 4NMLA 3TOQA 4CM2A 1Z1ZA 2FZGB 5EWEA 4NLWA 2J0XA 4IG0A 4KPCA 4J37A 3DLEB 1VK3A 2JSXA 4CH0S 2DVIA 2Y8WA 4B9VA 1WD6A 1SJ3P 3QJJA 1BY9A 1EB0A 5DQGA 3CCVS 3VAFA 1HQEA 4PQAA 3CXCR 2R7UA 3DDNA 3LPYA 3PR5B 2JEGA 5IQQA 4B9UA 3IFEA 2F1FA 1LWCB 2JH3A 2R3VA 1DLOA 2OJ3A 1TQLA 4OX8A 1AFIA 4LF5F 1V9OA 4LSNA 2G0JA 1F5CA 2L48A 1TL1A 4F3MA 1XMOJ 3ISND 2HQIA 2HEKA 2IMWP 3HHNB 2UXDJ 1WJ9A 3MAAB 4CTAB 1UWBA 2R4FA 5E3CA 4FPIA 3TA0A 1NHKL 1S6OA 2NZCA 3HT0A 4PYAA 3SXLA 1U1OA 3PM9A 5HROB 2PFDA 3WZ0A 3H59A 2K2PA 2YX7A 2B6AA 5B0FA 2IVMA 2C3PA 1YRXA 1Q79A 1HBNA 2V63A 4WKYA 4E0DA 5DJBA 4M8LA 1JWWA 2OTLS 3H90A 1RLDA 3DKDA 1PBAA 5BYSA 1Q5YA 2Z2MA 4NYOA 6AT1B 1ROFA 5ETSA 4TYAA 3SDEB 3T1YJ 3M8WA 3K2YA 3ZZOA 5DQIA 1RTJA 1U8WA 4X4UA 3AFGA 4PABA 4CH1A 2HK2A 4DR1F 1JLAA 1FK9A 1RTDB 2MQPA 1FVSA 1HBUB 4JV5J 1F9EB 2EG1A 4DCPB 2W2QP 2MQLA 1R0AA 3SQGB 2H1YA 1VI7A 1T9UA 3FMBA 5M2UA 2DHSA 2KVQE 2MKHA 2UXBJ 3DU5A 3J7YU 2K3IA 3TAMB 2ZH9A 4KAIA 2QLXA 1CS4A 3A3NB 1UA1A 1RYRA 2AEMA 2UVVA 2K1RA 3QSYB 5HMXA 2OEMA 1Q4RA 1REGX 5KOXA 4ECRA 1EQ0A 3AJ1A 1D09B 4DI6A 5ADZA 1VDHA 3UPFA 4R5PB 3CC2S 3AY0A 4QYZJ 3GWCA 2XSJA 4F7VA 2HIQA 2CG4A 2AWZA 2RJZA 2XNQA 1HWLA 1N5YB 1UPMB 4TU8A 1TK0A 1S79A 2UUWA 1EARA 3HMJG 2LCWA 4IH6A 3BO2A 1VBKA 2YWWA 1WEXA 1N0VC 5GADI 3J81U 1WOPA 4RL1A 2FPHX 2I9SA 4FYDA 3ETOA 1FO1A 1FRXA 2YQ0A 2HRTA 4ZVOB 4USKA 2HHQA 4NL5A 4R8UB 3UN2A 4KQZA 4ZP9A 1VRQC 4LRDA 3FKBA 5SUHA 3MCMA 4QPXA 1HQUB 5AE3A 5F8NA 2UUTA 1S0NA 4ES3A 1VCTA 2HWTA 5JJBA 2XO6A 2PSZA 4O0IA 2HHPA 3L7UA 1FX2A 2G0CA 1TKXB 4CP5A 1Q8LA 4F36A 1XERA 3PYFA 2BVZA 2KT3A 3QAUA 2M4MA 4WWSA 5C24B 1KVJA 5KFEA 2ZHBA 2VG6B 3KLEB 1I94J 4JI7J 2JEIA 2ERRA 2P6TA 4RBUA 2DEJA 3MXHP 4QCLA 2B3TB 2RF2B 2W7AA 5AE2A 2KZZA 5KFUA 1QTNB 4M5DB 2OEKA 4EMDA 2ZDOA 1TV6A 4GKJF 4YFUA 3LH2S 4CLZA 1J5EF 2PC6A 2MEWA 4KKOA 1X4FA 2MKSA 2MY8A 1KLMB 2JJ4D 4MH8A 1FRJA 1S0MA 2A2DA 4OYWA 4ERDA 3NCPA 2ALYB 2CKWA 3MF5A 4IFVB 1FRKA 1F5BA 4IO1A 2LMIA 1G2EA 2C3OA 1GMVA 1Q0NA 1Y10A 2P8IA 3I4HX 1LXNA 2HFUA 3QNWB 4M5KA 4GC7A 2IAJA 2VA2A 1CLFA 5F8LA 3HHLA 1D3WA 3HHDA 1XJWB 4WYWA 2WHOA 3RG6A 4KR0B 4LFAF 3M8RA 1K8AT 1M1KT 1RTIA 2HBYB 1U25A 4RU9A 2IA0A 1X9WA 1YZ7A 4M94A 2C2KB 2I5JB 5KG4A 5I3QA 3VHQA 3RR7A 3CO0P 2YKOA 2Z30B 4NOHA 2ZH7A 5IWAJ 5J1EB 5KFYA 4U95A 1RT4B 3IWXA 2B9XA 3Q2SC 5KT6A 3A3OB 3KG1A 1S6UA 4H4KC 3TP2A 1TMMA 3IR5B 4FPRA 1T02A 4G1QA 3VV2B 5HMZA 1LW2A 2DHGA 3PYGA 5HP1A 2EG2A 3CC4S 4ILRA 4NLOA 1VQLS 1Y0HA 4W98A 5IS2A 1UVIA 2ROGA 2I8EA 5KFWA 3CCQS 4WE1A 4WCEQ 2M0GB 2MZJA 3CCWA 4RKUC 3FMWA 2D9PA 2PMHA 2VPZB 3BEGB 4OZ1A 4DX6A 4LFCF 2GFFA 2ZH4A 1FRLA 4NLYA 3HPOA 1SQFA 2LP4A 1BUXA 3V4IA 2FHJD 3KXDA 4L73A 1AYEA 3C6UB 3DLGB 1UP1A 2KXFA 4ED1A 4ED5A 3EZUA 3UVJA 3RAXA 2L3MA 1RT5A 4O0NA 3VGUA 3M1VA 2L9DA 2ZM6F 4EUVA 3Q86A 2WBMA 2PMWA 1KOHA 2LXIA 2XEXA 1JXEA 3AJDA 3MAHA 2HK3A 4Q2LA 1LWFB 3SQGA 1NB2A 2E66A 1Y11A 3R5BA 3Q23A 4OZ5A 2XS5A 1X0PA 2IIHA 2W2PP 4A8SA 4WIIA 2XMUA 4MKVA 3CTRA 2B9WA 1FNMA 2ZKUA 3MI7X 4Q8EA 4JV2A 2ZD1B 4MIBA 4EBCA 1X5SA 2DT9A 1C1CA 2MSSA 1DTQB 1RT1A 4WZMA 2W4CA 3BZQA 1FA0A 3K59A 4F04B 4ZKAA 2MDAA 4B3TF 4GKKJ 4KTQA 1NH8A 4Q0BA 1MU2A 2M52A 3GJRB 2HS3A 2BM1A 3NGDA 1VQPS 1TVRA 1T9YA 1WSRA 3TR5A 1NH7A 5KFLA 2RNEA 4FNIA 2HVDA 3EUNA 3D0GE 1GXLA 4P9SA 1S6QB 2OD4A 3PHEA 4ZITA 2LXFA 2ROPA 3MECB 4G65A 2ZH6A 5C25A 3OPKA 3PYEA 1OSDA 5JXSA 3CB4A 2K06A 4FF2A 4RBTA 4KHPJ 1IQTA 3H5UA 4IFYB 3DRSB 4I68A 3VGSA 1H74A 1KHWA 1WEYA 4F3QA 2VG5A 4X64F 3CJSA 1OO0B 4HHJA 2V0NA 2ZOMA 4QIEA 1NCLA 3POTA 2EFOA 4P2FA 4EYIB 1XMQF 2HFSA 4O44A 3ZZTA 1ZZNA 2IC3B 2DNLA 2MLXA 5DG7A 3CSKA 5G0RA 1HFEL 4HTIA 1GEHA 2KXHA 3OTOF 1IM6A 2DNNA 1UTAA 3CDBA 1QSSA 4UUXA 4B3MJ 2VFRA 1VJQA 2F8HA 1HNXJ 2DGQA 1S7HA 4KH0B 4QWBA 2DPIA 1HW8A 1RHRB 1T95A 2D1CA 1VRTB 2DITA 2WB1D 2KT2A 3OL8A 2E5HA 2OPQB 4DHVA 2JLGA 4K4YA 1WF1A 1KLMA 4L3KA 4DPYA 3R2CJ 1RHMB 1WC6A 3HFZB 4IFVA 3WHIA 5BXIA 5KT3A 1NPPA 3FSIA 2O1PA 4DR1J 1IR2A 1OMSA 3VVUA 1LFWA 1U1QA 1RADB 2IAJB 3I55S 1S9EB 2BOPA 1UVNA 2B0GA 1B70B 4CLKA 3DGPB 5IWAF 2CNKB 2JFKA 2QO3A 3H5SA 1T11A 2LEPA 2F65A 3PJWA 4QIFA 3TX8A 2CPIA 1H2VZ 3H25A 4LRAA 4GC6A 4YY3F 3J80U 2K3KA 4WP3A 2CPXA 3JQMA 3VTIA 4DL0C 1NM2A 2JDJA 1WWHA 2ABYA 2IFXA 1SH0A 2DTJA 2OLWA 5FD1A 2W7PA 3M2VB 3DLHA 3GFZA 3OFFA 1PC5A 3D3BJ 3SI8A 1DBDA 1KFDA 2FUG9 2R2TA 2BJ7A 3VAHA 3R9LA 2OPRB 2VIHA 2D3ZA 4DV5F 3BKFA 2DBBA 4XAKA 3BREA 2BUNA 2ZOGA 2DNOA 1FE4A 4IH5A 5B7WA 3H8YA 1N48A 4KO0B 4C8KA 3QFHA 1JLFB 2D41A 3UDVA 4M5IA 9RUBA 2V4RA 1XR5A 1JJ4A 2A2CA 3UR3C 1RP5A 5L1KA 1XR7A 2I2YA 3FJ2A 3PW5A 2V68A 5BYRA 3I0SB 1SC4B 1DTTA 2AJ1A 5D0HA 4RLEA 1WG5A 1FJEB 3RR8A 5HSPA 2IRXA 5C5JA 4RW7B 3TQEA 1L3UA 3KUHA 1F2GA 2ZH3A 2EVZA 5I3UB 5DGBA 3EJMA 2DGTA 2CUYA 2U1AA 5CA5A 2ZM6J 1U47A 3NEKA 2VG7A 4JI2J 1C0TB 2PEBA 5KFZA 4K2XA 3BN7A 3JTOA 3OFGA 3EXYA 4JI7F 1KVKA 2OKQA 2DJWA 2HG4A 3VAGA 1NJIT 1Y5LB 1TL7B 1I1GA 3OTDA 3K5LA 5ETQA 2X3DA 3G8SA 1O6XA 2BMBA 3D0IE 1DQAA 3G8QA 1ZH5A 1BHNA 1WOOA 2W9CB 3PO5A 2M7SA 1NSKL 2CQCA 1KBRA 4N8NA 1CEZA 2B43A 1VRUB 2ZBCA 4ZVTB 3D1OA 3VALA 2HSEB 2Q6CA 4ECXA 4OZ3A 4KJIA 4KHMA 5J2NB 3UDLA 4F4ZA 2AJFE 2EC0A 1WG4A 4LFAJ 3Q8PB 3MD3A 9ATCB 2V8DA 1HYSA 1YHQS 2EK6A 4ICLB 3KLGA 2X1GA 1XMOF 1TK8A 2JX2A 4QOTA 2WAQD 2G13A 1YI2S 3KJQB 3OUYB 2NPFA 3OJSA 2XSFA 3DMJB 5ITHA 3FDSA 3ISZA 1MMLA 1FERA 4MK9A 4ZPAA 2ROEA 4B17A 4WTOB 4JYAF 3P5TL 1NDPA 3D7SB 3MEGB 5F41A 4X62J 2K8GA 4JI3F 5L1IA 8AT1B 1RT7B 4DV3F 3NG8A 3HK2A 2F8MA 4XPEA 2H51B 1U1NA 2UU9F 2V2QA 1WACA 3I5BA 2CXEA 3CDAA 2AYMA 2B8QA 2B56A 2DGXA 3E2EA 2WOMB 2APOA 1PC4A 2BJ8A 5J1NA 5BYQA 1PYTA 2XCAA 2Z57B 3NWGA 4PXCA 5GMEA 5KFOA 2LU1A 1DHMA 3W1YC 2RU3A 2XYPB 2Y0SD 3QLHB 1HNVB 1P9QC 2E7WA 2NS1B 2RMLA 1HD0A 3VAMA 1VLOA 1EX8A 3NNHA 3OXGA 5EDWA 1DLOB 3CUNA 4ZOSA 4ANCA 3DLBA 4UY8T 1U0HB 1T9VA 3NGTA 5A8WA 5KTQA 1TL1B 1N52B 3V6KA 3PCOB 2NCKL 5KFHA 1V6HA 4KFBB 3MAAA 4GMKA 4UQTA 1NK0A 3PEJA 3TVZA 3HVTA 4ED0A 5I4MA 1RT6B 2RKIB 4DQSA 2ALZA 3QIPA 5LL6d 4FBTA 1R6VA 4ZVQB 4AXIA 1HI0P 3QO9A 2RRBA 3EM1A 2CQ0A 4LR7A 3Q89A 3V6JA 8ATCB 2IPOB 2LKZA 2B4PA 3BF4A 1HWJA 4WP8A 2VH7A 4HACB 5CQGA 3KJFB 4OIXA 1T05A 2P9GA 3RRGA 1FX4A 1OYDA 4KSEB 3N79A 4KO0A 5ETTA 3G9CA 1ITPA 2B8PA 3UNYA 3V81B 4AXJA 2RS8A 2V2ZA 3EDQB 4QW9A 4DQRA 2V6AA 3LANA 2V9WA 3AD9C 5LMUF 4DV1F 3QATA 4WFZA 3GYNA 3OD2A 2HIYA 3CDUA 3DDKA 4ZHRB 4JI2F 2OIHA 3OTBA 3JYTA 4CLWA 2R7RA 4JI8F 1WKLA 2GIQA 2ACYA 1TFWA 5E3RA 1NKBA 2ATLA 2DNZA 2QMUB 1PJ5A 2CPDA 3T3FA 1FFGB 1S1TB 1S12A 1YZ6A 2DKOB 3DOLA 1U6FA 2V8HA 3D66A 3ZC4A 1YJNS 2V8VA 2GVDA 1IM4A 1S4FA 2NXNA 2DNYA 3A8IA 2J7WA 1SCJB 3L95X 1QUVA 4Y34A 4R25A 2Q1LA 4CLSA 2CQ1A 1RBOB 5K14B 2MQQA 2R7TA 2HZCA 3M32B 3TJ8A 4PYDA 1CSJA 2N4DA 3OBIA 4WXOA 4RWXA 5KFDA 3AB2B 4ZDNA 1IN0A 4NXMJ 5HLFB 3FQKA 1V5IB 5J1PA 1R6YA 3W9HA 3LW5C 4HH0A 1VHIA 5D78A 2KFNA 1SXLA 5LXYA 5D6GA 2D3OR 2V4JA 1RHJB 2GGPB 2BZ2A 5I42B 2ASJA 3C6UA 5LSOA 2HWHA 5KT7A 1QE1B 2AEJA 3MM8A 3DM2B 3IN5A 1U48A 1QM9A 5KFVA 2QFJA 2HVIA 3I32A 1RT5B 4HDHA 1X4GA 5IFMA 3C66A 5GMDA 2VB6A 4PXEA 3RRHA 2BE7D 3S7RA 2CPFA 3GCWP 2MGZA 2VZ9A 2DB1A 4MFBA 4DXLA 2OPPA 4GVLA 1TUWA 1HPZB 4RNMA 3DMJA 3SMZA 4FF1A 2XQCA 1TKTB 4YMEA 3E3XA 1FHTA 1IWAA 2FJBB 3Q8VA 3W62A 1PCAA 4C8OA 1RHKB 1O51A 1RAGB 1FEEA 2MZQA 1H7XA 3HVWA 4C3MA 2BQ3A 2O01C 1UEUA 1S48A 2KN4A 1XNQJ 1H72C 2XMTA 3UCGA 2B51A 4URGA 3KUEA 3KHLA 5CZVA 5B09A 2IMOA 4ECSA 3IO1A 3GU0A 3F56A 1X5TA 2RUSA 3PJXA 2DO0A 2C3YA 1QUPA 1C0UB 1B0PA 2F9JA 2WVFA 3G87A 2RB7A 5T7LB 1NDCA 1S6QA 2DGUA 2HNZB 4ZA1A 5ETPA 1W2BR 3G71S 5HANA 4B3SF 4FYYB 1AUDA 4ZIVA 1P9YA 2XZDB 3CJ0A 2EFVA 3K5MA 1Y5NB 1FF2A 3FBBA 4BWJA 1VISA 3BQ1A 3J81Y 1JLCB 3FCWA 4OYBA 2ZJPQ 2RQKA 3I4PA 4N41A 1RWVB 4KB7A 4USUA 2YNFB 1K0TA 1QY7A 4DX7A 2OFGX 3POTB 3WDOA 2E5LF 4I1TA 1UJ4A 2IBOA 4DUYF 4L75A 1AA1B 4P73A 4DR3J 4FVCA 1MN9A 2Y1LB 2YKQA 2ZWPA 4NA1A 3HP6A 1QAIA 3TRGA 5E41A 2XMWA 4NLPA 1VQ7S 3RAMA 2AYBA 2LQ9A 5IM0B 1D9FA 2IM2A 2GIFA 1RAAB 2YKMA 4FXVA 1YBTA 5HBMA 3Q22A 4LFBF 2EFNA 2ASLA 2HZAA 5C42A 3FZ2A 2LVWA 3K89A 1R8PA 4DPWA 3K5PA 3MCSA 4DV4J 3MMBA 3PIPQ 2A10A 4LVOP 1KWMA 2UUAF 3HKWA 4HACA 2IBKA 2MY7A 5K8OA 4IR1A 1LWCA 2QIFA 3SYZA 4I56A 5CZXA 3BBCA 2V8GA 3WBZA 1IBKJ 2QLWA 4LF4J 2Q3PA 5HJYA 4JI8J 4WFYA 3CGIA 1RWXB 1U1RA 1UFKA 1F60B 1YGYA 3GJQB 3R5AA 4O4RA 3T41A 5CYMB 4LSNB 5KOWA 3D0HE 2B9EA 3P3DA 5E3QA 4M5NA 3T9ZA 2J0QD 4RNHA 1WG1A 3JB9k 1UWBB 2Y1RI 1P6TA 2HHVA 2YWEA 3IBCB 2H4YB 1ZOTA 5HROA 1HNWJ 1NU4A 1DTQA 1RT1B 2UV8A 4ZVUB 2PO4A 4PKDB 3ZZZA 4ED6A 3RB6A 1QAYA 2KRBA 5IV3A 2KJVA 3VR1A 4YP3A 3DXSX 1NKEA 2OPRA 4C97A 1ZAXA 1UKUA 2P9CA 1T0TV 2HS0A 3CD7A 4G6VB 4OLPA 4OX6A 2QX0A 2ZUGA 1FKOB 4AL6A 2XZTB 5D0EA 4MMOA 5KFTA 2XYHB 1NLKL 2Q79A 2I1RA 2EBEA 1FJ7A 3V5RA 2IVFB 4F8RA 3W60A 4LQ3A 1SUQA 3DYAA 1SB6A 3KFWX 1FD2A 3CJQA 4A8FA 1RHUB 1RUSA 4LVNP 2KHCA 2XMMA 1FDDA 2B9YA 2KKHA 2V4JB 1X4AA 3L7PA 4N8OA 4XK8C 3TAMA 1PO6A 3DRXA 5DG9A 1N36J 1MW7A 1YLXA 2VFSA 3GE9A 2RDJA 4KPYA 3P49B 2CWXA 3DM2A 3M2UB 4YDXA 1LNQA 2IDLA 4WZQA 4HEA9 2AMCB 2DISA 3BR8A 2EW9A 2GQCA 4NZ0A 1JMTA 2DY9A 2HAIA 2LDYA 2KG0A 4FXDA 1H7WA 2E29A 4MKAA 1MMDA 1NSQA 1S1WA 1C4AA 2OAUA 1AB8A 4G1PA 1Y3KA 2ZOFA 5HN0A 2ZFHA 2OHDA 2OPPB 4X65J 3GIMA 2W4DA 2BACA 3PRBA 1UZHA 4WIQA 2V67A 3AXMA 3NS5A 4WK1A 3RRKA 2DRDA 2POKA 4R8UA 4U7UD 2QTWA 1M5PC 3DC2A 1UVLA 5KFQA 4JI4J 2FTRA 4Y6IA 4HDGA 1R89A 2CNLB 2RQMA 1J5OA 4XTTA 3CD6S 2CG8A 1X0FA 1WKJA 2LLZA 4ZK7M 3OSNA 2BJ9A 4TYBA 4FF4A 1EAYC 1X4HA 1HBMA 1JK9B 1TKXA 3AODA 2YWFA 4NLGA 3J7A1 3HKZD 2BE2B 3D5MA 1H38A 3Q2TC 5AJ3F 5H9FK 3NRBA 3HX9A 4J9PA 3KLEA 1FKPB 1U02A 2ACMA 4OYOA 5K20B 4CLFA 1ZZFA 1NDKA 3EPGA 3IA0A 4A8XA 4X4SA 3F0NA 4NE9C 2ADBA 1K47A 3MGJA 1OPZA 4FS1A 4OL8A 1W2IA 2YY3A 5FLXY 3GQCA 2W2NP 5DLFA 3OTOJ 3RAQA 1JLCA 1CJVA 3SZ2A 2R7VA 2E44A 2JEJA 2DH9A 4USTA 5EN1A 2DD8S 4LFBJ 3ZFVA 4KKOB 3PZPA 4CO3A 3X1LB 4X4QA 4UZCA 2QRRA 4I6YA 3T1YF 3MM9B 4I2QB 4OI0A 3OR1B 3HVAA 1S1VB 3M6WA 3OL9A 4AD6A 2OPSA 4DV7J 2IYIA 4OYAA 5KFKA 3EPIA 1QJHA 2LEBA 3RGIA 4Y2IA 2UUAJ 1RTZA 4EO8A 5B0AA 3ULHA 1U49A 1Y5IB 2R7SA 1REVB 2ZNZA 1RTIB 2GMLA 3R3TA 4XPCA 4DF4A 4J9LA 4C48A 2BXJA 3KK2A 2V2VA 3A8EA 3KK1B 2J0SD 3QLHA 4RWWA 3T1AA 2X7IA 4PWUA 4Y2CA 1SL0A 3DOMB 1IKYB 5L39A 1CJUB 3BKTA 3C15B 4HHHA 5CYQB 2ZJRQ 4M5LA 1U1PA 2VOOA 2R7XA 1H2UX 2YPZA 2RQ4A 2C2EA 2Y9HA 2LDIA 4URQU 3OT9A 1S76D 3R2DJ 2ZH1A 5DG8A 3KKFA 4ILLA 3MFIA 1H3DA 5CHCB 4OHWA 1U1LA 2KU7A 3GB0A 3W3SA 2JC1A 3D2WA 2I38A 2MJUA 4GO5X 3Q8UA 2LQBA 4DLGA 4LF6J 4K4SA 4B9MA 2YNGA 1XC9A 3QWUA 2CJQA 2DNPA 2GQ2A 4LBIA 4CO1A 3V4IB 5EX0A 1VQ6S 2FJWA 2VBXA 3CCTA 4QIVA 1UMJA 2C2ZB 3ITHB 1XNRF 3I6PA 4ALZA 2LQJA 2ZE2A 3DCAA 2CQ3A 4LR9A 5J2PA 2RE1A 3PHTA 3QRQA 1CC8A 1JLGA 1QDUB 5DQHA 3ZO7A 4JI1F 3Q24A 3EGNA 4NLDA 4D3HA 3GZ7A 3V6DA 3TYTA 2RRAA 1LKZA 4DSJA 4C4WA 4Q8FA 1GXTA 2U2FA 4DV2J 1LFPA 1WC0A 5H9EK 2VBWA 3KYLA 4U96A 3Q0AA 3MMAB 4K4WA 3GFHA 1IXKA 1YJRA 1NRKA 4PWWA 4RPFA 5HO4A 3OUYA 4TXSA 5DDRC 3KLIA 1C1CB 3I31A 5FDLB 4A8MP 4MK7A 4O3SA 4QZVB 2AF6A 2LXUA 1FTRA 1BE4A 1R8HA 3NKYA 4K8RA 3CJ3A 4C8NA 2AJ4A 1HBNB 1UW9A 3KLVA 3M05A 2MB0B 3MCNA 2MYFA 3MD1A 2GZOA 1PYOB 1UVMA 3K17A 4JI0F 4FDFA 1D0EA 3EDRB 4LBPA 2YQ3A 1KONA 3IGNA 1C1BB 3THTA 1YIJS 3PIOQ 1IR0A 2WVDA 1X5PA 5HLFA 4DMZA 2AEFA 1VMBA 2WW8A 1N0UA 2RU9A 3RBXA 3EMTA 4W92B 1Q8BA 5L1LA 1KKHA 1NZAA 4DPXA 4YY3J 4RU2A 1K44A 2Q6BA 3RJMB 2ZWOA 5EWFA 3PX6A 1SJ4P 1B64A 5EUHA 5KG5A 4J9RA 1SL1A 2YQ1A 2N3OA 5D15A 1JJHA 1MG7A 1FKPA 5DS7A 3VGVA 2E1AA 1J5EJ 4YR0A 2DPJA 2W7OA 3CJKB 3KMQA 4NRUA 1WUUA 1HNZJ 3QIPB 2MGZB 3BM7A 4CZCA 5IC4B 3VQSA 4C6AA 1ZAVA 1VQ4S 3VAKA 4URSA 2HNDA 2H65B 4K59A 5H1SV 1DY3A 4BWMA 4LF9J 3VVTA 2WVBA 2XWXA 3IG1A 5A6PA 1HQUA 2XNRA 1X7VA 3M8SA 5A8RB 2XC9A 2WW4A 3BJYA 2RUGA 4KIAA 1T05B 3P4UB 1S99A 2OMOA 1U0SA 4C98A 3CDWA 4XO0A 3R8YA 1S9EA 2LA4A 5HVFA 2R8GA 2NSCA 3GONA 2QL7B 4ZHRA 2HZVA 2O3DA 5LSLA 1Q1KA 3QGIA 2JEFA 3KWMA 4ZLLA 3OW2R 5E5NA 3QYYA 1WTFA 2GHVC 2ZVIA 1GXUA 2YNHA 5KFXA 1T3NA 5L9XA 2MZSA 2BOAA 4XIUA 2XY5A 2F63A 1N34F 1Q78A 2KL8A 3S1TA 1PAUB 1VR6A 1QAJA 2HQDA 1AROP 4ID5A 5KG3A 4LFCJ 4F4KA 3R5GA 4EGLA 3DNCA 1LOUA 2CDRB 1L3VA 2MZRA 4HI2A 1JLAB 3VCDA 4ES2A 2KTQA 2CJ9A 4PXDA 2KDOA 1R0AB 4ELTA 4JI0J 3MEEA 1TL3A 4H4MA 1R8BA 5IM0A 2QJ3A 1V3RA 4L76A 1CULB 1T8EA 1T7PA 4NCAA 3UDCA 2GHPA 1N6QA 3S8SA 2HQFA 1M1HA 3ITHA 4RUAA 2VV5A 5G4DA 2UVRA 4C9DA 1VJWA 2HFZA 3DI6A 2BABA 1JLQB 1UW4A 3G8TA 4ZJLA 4EBDA 2Y1JA 4C11A 3TZZA 5AXKA 1VC6A 4IKAA 3TQ1A 3CCZA 2HVEA 4N7TA 3C14B 4B3OA 5B0DA 1VQ5S 1GFWB 2BA9A 2DH8A 3RBDA 3HSJA 3MTKA 4KE5A 3US5A 2K7JA 3MPDA 4USMA 2V4QA 4EEYA 4I67A 1DRZA 2J9CA 3DXBA 3MPVA 3W9IA 4K5SA 3MR3A 4CT9A 3GIJA 2FLOA 7FD1A 3A4TA 3GIIA 1LK5A 3W2WA 1Z4UA 3IGVA 1N33F 3L3CA 4DBQA 3OVBA 2KVIA 1NK4A 2VOPA 1M0SA 3RTVA 2N82B 3BDPA 1ZA1B 4X2BA 4OX9J 2HNYB 3BS9A 3U7JA 5K8MA 4KGKA 1KEKA 1DZ5A 3QJLA 5K9FA 3P45B 2DNHA 2QEXS 2XHCA 1RAIB 1PBUA 2QL5B 3N01A 3N5FA 2SXLA 5HK4A 1UCNA 2F5GA 4NMXA 3PY8A 3EWGA 3FC9A 2J8SA 4WBFA 3UI3A 3MR5A 4B3RJ 4IOBA 3M1VB 1MMNA 1ZPVA 1LXJA 3SCKE 4C3KA 3EGWB 4LF1A 4X64J 1YTYA 2FY1A 3D6HB 5DO2A 3VAJA 4RO0A 3M8PA 1JKHB 4W4MA 4QU6A 4R0JA 1X4CA 2ZDPA 3PG9A 4DUZJ 2VL1A 1TV6B 4OMFG 3FFIA 4QBUA 2OP5A 1RSCA 3MAQA 2BBEA 3MEGA 1KDNA 2CPHA 2LA6A 1B99A 4PPDA 3M30B 5HJXA 3K5OA 4KRWA 5CH7B 2L41A 5F8GA 3PW2A 1NK8A 2R7QA 3ZTOA 4AUKA 3M8QB 4QJVA 5KFNA 2GQQA 2XO7A 4MKYA 1F9FA 2D9OA 1OS5A 1PIEA 1U2RA 3KUGA 1F2HA 3MM5A 4NEYA 1RT2B 3A12A 4QR2A 1HIYA 5HMWA 1FXLA 2V8PA 1OYEA 4O4GA 4USWA 5A2QU 4YEAA 1F6TA 4PG8A 1U2CA 1YJ9S 1TUVA 1A7GE 3BBFA 3G82B 3P96A 2MXYA 2PA3A 4F4WA 2BR0A 2OTJS 4A8YA 2W8KA 4TY8A 3B4DA 2P5VA 5C2GA 5J2MB 1VQ9S 4FP9A 3DRSA 5C7PA 2RVJA 2HHSA 4RZRA 1X5OA 1UWAA 1DARA 4I7FB 3JS9A 1S9GB 5GMKa 2PN6A 4G1QB 1K73T 1WC3A 4XDCA 1LW2B 2AHOB 2A6MA 2HMIA 1Z2LA 2JLFA 3IR6B 3AHPA 4Y28C 4N5SA 2BE2A 3MUMP 1KQSR 4WJBA 4B3SJ 3BGFA 3UD4P 4FYWB 1ACMB 5G0RB 2NYIA 1BMQB 4P72A 4ZVPB 3LP1A 4F67A 2MKKA 2GC8A 3H5XA 1XK8A 3BB5A 4O3QA 4PQUA 3FQLA 4K4UA 4CLLA 1RT6A 1WDDA 2CJYB 3BSAA 3QO9B 1N5VA 3JAMU 2VPYB 4Q45A 4K4ZA 2OELA 5E7OB 3LOUA 4PXBA 1I5OB 2E7XA 5H9FJ 2UXCF 2RD5C 1WI8A 1X4EA 2Q66A 1O0PA 5JUMA 5ETOA 3CVKA 1URRA 3SFGA 1HHSA 4NCGB 4IH7A 5DETA 4DSLA 4J7CA 4ZIWA 3GYGA 5DDOC 2KO1A 2FYXA 1IJEB 4DL4A 3DGPA 1NDLA 2VFVA 2OPSB 4QYRA 1OQ6A 1RCXB 3LF0A 3IR7B 3LPEA 3IWNC 3JYTB 1FWKA 1TP7A 2MQOA 4CNYA 2DGOA 1JXLA 1KFSA 4F2SA 4FXWA 1IVZA 1YX2A 1PJ7A 2QV6A 3H2VE 1RDRA 2D3O1 3NS6A 4EU0A 3HSZA 2UXDF 1H2TZ 4DL7A 2XZWA 3UCUP 3LUYA 4ED7A 4ZPVR 1RJJA 3M2VA 2CZVC 2D74B 3R97A 1U6BA 1FD8A 3T5HA 3KNGA 2FDNA 3W5XA 3H5YA 2KXNB 4B3OB 2HQ3A 1S10A 4PPZA 1OSCA 5SZTA 4KGXB 1S1TA 5KFSA 2F3JA 1TVRB 2VQEJ 1TR0A 4ZP6A 2J9DA 1FVQA 1OY9A 3GIRA 4AE5A 4K4TA 1GX6A 1JLBA 2J6TA 4DV7F 2LFVA 1WC1A 4IDKB 4FYVB 1OQ3A 1HWUA 2FGOA 2MMYA 2AV5A 3I0RB 4P10A 4ZPCA 3KNAA 1U09A 1ZBTA 5LMNF 5KFMA 1HQ2A 2KYZA 2VG5B 1J5OB 4EBEA 1ZTTA 1KC8T 3N6LA 2QA4S 3J7AN 4NLXA 1RWMB 4O44B 1F5AA 3M7VA 4LF5J 1FJGJ 1X9MA 3MM7A 1IBLF 1ICEB 4A4JA 2XSJB 1S1UB 4IG3B 1TU0B 2VFTA 4ED3A 2F4VF 1RBLA 5EX3A 2W2OP 1X9SA 1N5YA 4A48A 2VBYA 2B4OA 2E5IA 2EKNA 3D3CJ 4RW9A 4YUDA 2CNOB 1SQGA 3MPUB 2DGVA 2N7YA 4M63A 3FRYA 2MZ1A 5CAAA 3MMAA 2W2MP 2HQGA 4ED4A 4CLUA 3RZAA 2ASDA 1JXVA 1HPZA 2R8HA 3FFIB 4WYLA 1AZSA 5E2QA 3K57A 3DRRB 3EZ5A 4ZMMA 1HKAA 4J91A 5HATA 3KK3A 2FQQB 2FC8A 2BQRA 2OSRA 5L8RC 3G96A 3CCES 3CE8A 3W64A 4YHHJ 2LQ5A 3G6VA 3TO8A 2VHGA 5KG1A 3LAMA 4RNFA 5F9NA 4RX6A 4K2JA 2WSCC 1S1VA 6FDRA 3BGUA 3B8HA 3ZTQA 2XI3A 1Y9OA 2CDQA 1FKAF 2W01A 1C0UA 1UZDA 5T7LA 3SCJE 2ATCB 5IV4A 1V3SA 1EP4B 2J7UA 2YPYA 2XM3A 1L3SA 1X4DA 3KJNB 1QLNA 1CPZA 1YK9A 2HRUA 4DPUA 5LMUJ 3FZBA 3G6YA 3N4WA 1FI4A 3TNVA 1RAFB 2E1MC 2HNZA 3UDEA 4CWBA 2Y1IA 2L08A 4QWEA 3CMES 3UFCX 2HHTA 2IY5B 1NB7A 2FLNA 2A0FB 4M5DA 2HPUA 2YNFA 2OH2A 1DQ9A 3W7BA 3UD3P 3C15A 1HWIA 1RHQB 3VGTA 4NA3A 3Q8SB 2G4BA 2MKJA 4FVMA 5DZ6A 1N56A 1MNEA 4QR0A 3C8YA 4OYIA 2MQNA 4HT5A 4DL2A 2KT5A 3SSQA 2PEHA 1WSVA 5CYJA 2GAGC 2N4CA 1N32F 1BLUA 1Q7LB 2FVPA 5C42B 1DTTB 2YNGB 1D9AA 1S57A 2HURA 4OQJA 1E6YB 4O23A 4OJGA 3EZOA 4RW7A 3IC1A 4WPAA 5KT5A 2JL9A 1GK8A 3D1HA 3IP0A 1RU1A 3NNCA 4JB8B 2RSQA 3AD7C 3MDFA 1SIZA 3JSBA 4UOFA 4N47A 5LMNJ 3QGGA 3HZEA 5L38A 5HQLA 4B08A 3OL6A 1JNZB 2G2YA 5B0BA 1WTBA 3PNIA 2CJKA 4WP9A 1RWUA 4J9QA 3T5JA 1NUEA 1T94A 2NQPA 1P8GA 3EGZA 4P71A 2CA9A 2MZTA 4DX5A 4X66F 4OZ0A 2DNRA 4ZP8A 5HAOA 5HP1B 3D1QA 2J9EA 5MLCV 2AJ0A 2FC9A 4MIWA 5GVQA 4U6PA 2RQCA 1QSLA 2VPWB 4OHVA 3PVXA 1MWZA 4WFBQ 3Q8RB 4NLQA 4P52A 3TEHB 2BJ3A 4AQYJ 3RB3A 4USVA 3EVMA 4CYUB 2QYGA 3VWSA 3M9MB 4XDDA 5JMNA 3EE3A 4ZS6A 3RYLA 2VFUA 4DF8A 1FWPA 2VQFF 3J80Y 2PIIA 5L9NA 4NCBA 1HL6A 2LU2A 2ZVSA 4I6AA 3W8PA 5F8HA 3RB4A 3TVYA 1HLWA 4BCAA 1G4CA 2XCPA 4OHXA 2G1DA 1XNRJ 3ELHA 2CQGA 1T03A 3OTCA 2W24A 2ZBQA 4GO7X 1ZAWA 3LP2B 2FZKB 2AGQA 2VONA 5T14A 4ANDA 3DRPB 1VQYA 1RWPB 1GMWD 2G2OA 1S59A 1TL4A 4DL5A 2GO9A 1SIWB 2BW2A 1U24A 2BANA 3N6NA 1VC5A 1L3KA 1YRTA 3ONQA 1LK7A 4FKYA 3IMQJ 2FB0A 4ECQA 2AGPA 1IBLJ 2CZ4A 3E01B 4E8UA 1SV5B 2H4WB 2ZC4A 4OFZA 1JX4A 2IRYA 1RTDA 4W90B 1YJ7A 3M2UA 3D6FB 3F41A 3HF5A 2AZ3A 3R5DA 5T41A 1NPKA 3D54A 2BM0A 4M5HA 4DV5J 4IRKA 2BV3A 1NJZA 2VDIA 3QWPA 2VKRA 4MT1A 2QMXA 3DDIA 3J81j 2QA2A 2JC0A 3PDNA 1W26A 2QZ8A 2CYYA 1HMVB 4Y65A 5AT1B 4QR1A 3D4JA 4DCJB 5IT0A 2XGPA 3KJVB 1DJ0A 3EXCX 3BGOP 5LOQA 2EFPA 3TAPA 3WX8A 5LM7E 3DRRA 3FUYA 4ZVGA 1VLYA 4ECVA 1HNVA 2RS2A 1S0VA 4QU7A 3QGHA 1ZA2B 5CXTA 2ILYA 2YX1A 2B4VA 1S9FA 1VQSA 1L5UA 4DCOB 4UOGA 3THPA 3HD2A 1W7WA 4UOHA 3FCVA 3I87A 4KHPF 4DV2F 1RAEB 4C8LA 1KN6A 3D6MB 3GR1A 2PE8A 3HVTB 1T9TA 1X4BA 1KD1T 1Q8KA 1TTHB 4AFFA 3C2PA 1R3NA 1UETA 3UR0A 3QPIA 2BJEA 3CULA 4IRDA 1DURA 2B5JB 1UEVA 3DGVA 1KQGB 2UUCF 2AKWB 3HXMA 3PKMA 4CLPA 2CFXA 4I0WA 4X4OA 4N76A 3TAQA 3RUBL 1IKWA 2L9WA 1B0TA 3MM6A 3EICA 5E0OA 3UWTA 4ENOA 5AE1A 2IA6A 4ZPTR 2IM0A 2KM8C 1VQOS 2IM1A 3EGVA 3M30A 1AXQA 4I2QA 2AIRB 2EBGA 4ZLNA 4CO0A 5E33A 2QSWA 2C42A 5GAEU 4LRFA 3OR1A 2LEAA 4BHQA 3PKYA 1WORA 3HZGA 5HL7Q 4DFJA 4H4MB 2R2SA 1RGVA 5U47A 3FBEA 5KFBA 3PO4A 2VUGA 1NNDA 4LF2A 2C3UA 3LWLA 2P6SA 3HDSA 3NOGA 5HQ8A 4Q5VA 4LF4F 1FJCA 1QVFR 3P5BP 4LRBA 2P2CB 3I5AA 1VQKS 3OLBA 1FESA 3OLAA 1OJ4A 1R8CA 2UP1A 3PW7A 2C28A 2CQ4A 2E5GA 2ZKTA 3C14A 3CC7S 3DLKB 1BQXA 1WHYA 2QC3A 3CIMA 1JJCB 5IT4A 2FHOB 2KI2A 4RNOA 4CIOA 2QE5A 5CCLA 3P6YC 2J8AA 2R8JA 2YTCA 3GSDA 3KLFA 1NEEA 1KOOA 1BD6A 1HNXF 1N34J 1EETA 3CIZA 3W2WB 4NA2A 2YWGA 2F40A 3NGRA 4OI3A 4A46A 4EYHB 3VZHA 2HWIA 2M88A 3BN4A 3GYXB 1H73A 3I0SA 2NPIA 1KHVA 3TUIC 4NZ7A 1N5TA 2DXEA 3D67A 5L1JA 3MMBB 4ZP7A 4MK8A 4OI4A 4NWBA 3CD0A 3BV8A 2HLTA 4USJC 4DN0A 5IZHA 4DQPA 1JLEA 2X1BA 2WONB 1RKJA 3ILIA 3L9ZA 4NCGA 4OYXA 4I4BA 5LJ3Y 1OY6A 3KG4A 5J2NA 2ZBPA 2ZHOA 3NS7B 1LWXA 1RKIA 1WHWA 4HT7A 3TARA 1U45A 1QVGR 2DGSA 4OJHA 1F3VA 1SC3B 2RDDA 3A3PB 3DRPA 2H54B 4ZVRB 2ZH2A 2VA3A 4MFBB 2HFOA 3BSOA 1GH8A 2BANB 1RAOA 5IT9Y 4WU3A 4O3OA 3HSDA 3ILOA 2DY1A 1M5KC 3BR9A 3C16B 3T5KA 1IKVB 3NGSA 5KFCA 3MWBA 5J2QA 4Y3CA 1UJ6A 3MHYA 1MWYA 3SV4A 4NI2B 4MAKA 4WK3A 3N9UC 1FWLA 2DH7A 4FNHA 4KYZA 3M9OB 3TZWA 2J9DE 4DOZA 3OXLA 5LT5A 2UZAA 5M2PA 3S01A 2HRYA 5ETNA 4ECZA 1CQNA 2CVIA 1FKOA 4ZPDA 1U1MA 1XMBA 1RTHA 1RE1B 3GPAA 3NMAA 2QN6B 2F7VA 1NJWA 1HYSB 2CRLA 2YXLA 1RT3A 4HH1A 4QYZK 2MSTA 2XLKA 1RK8A 4B3RF 1VIOA 3NCRA 4DV4F 4P2SA 4X4NA 4DFPA 5D0RA 4FN5A 4GRSA 2DHXA 4DN9A 1C2PA 5AJ3J 4PEOA 3UN3A 2DRAA 3AOCA 4F4YA 5F8IA 4JV0A 3CMAS 4DSEA 3T5LA 2HMIB 3ENQA 1WHVA 4DSKA 2PMZD 1KTQA 1GAOA 3W65A 4HI1A 2BRKA 2F4FA 4OZLA 4P74A 2YKNB 4ZCIA 6FD1A 3J7YI 3F73A 3LP1B 1CBKA 5ETMA 3UQSA 1U26A 5GAGI 4DV3J 2XULA 2RF2A 4JI6F 4TLQA 2HNDB 1RU2A 3TVKA 2E9ZA 2HHWA 4P75A 4OZNA 2CPEA 4DPOA 2AW0A 3E8OA 1IKWB 1IR1A 5HVHA 4J9MA 3W9JA 3U02A 5IXUA 4EZ9A 4ZCKA 4ZJQA 4YOEA 3N6MA 5A8RA 1K1QA 3KK3B 4WXWA 2Z58B 1RZMA 3O6QA 4DQIA 4CCHA 1RABB 3DN9A 4ZJOA 1JB0C 2XMJA 3QMQA 4AT1B 4AYBD 1S1XA 3OHBA 3M2RA 4JBCA 2PI5A 5L46A 3NAIA 3MPWA 5LXRA 2IRUA 2D69A 4USHA 3LALA 1EP4A 4OYPA 3QQCD 2DR8A 4IR9A 2WK4A 2ZZNA 5IOLA 1F0XA 2RKIA 3LGNA 4HHUA 3FBFA 1YITS 4X84A 2O66A 2X51A 4F0KA 1Q81T 4F2RA 2HBZB 4UY85 4JOUA 1FT8A 5IC6B 4ZLJA 3I82A 2CQPA 5J1EA 4DR2F 2AX1A 4C8MA 2ASYA 1RT4A 2BKPA 4LF6F 3QRPA 4I2PB 2M9KA 5D3GA 1NSAA 2AX0A 2EWHA 3DOKA 3DLKA 1RCOB 1V3ZA 3SCIE 2XBPA 5KT4A 3J7Z5 4DFKA 1A9NB 2CVEA 5E3PA 1NJYA 7AT1B 3CCRS 3TUPA 2C2RA 1VYAA 4KT0C 1KQKA 2JRSA 2DHAA 4FZVA 4WE1B 1HR0F 5AXNA 4IDKA 3IAM9 4NLVA 5KG0A 4RNNA 2DCUB 4ECTA 3GG0A 3IRXB 1BC6A 3MZIA 3HT3A 2GMHA 1REVA 3NWRA 1HA1A 2NXEA 3MMJA 3A1YG 3MOZA 4J90A 3T19A 4RUCA 1G1XA 2B7BB 3H98A 3KK2B 4PG6A 1R31A 4DR5F 3FCHA 3R1LA 2E1RA 2DIVA 4C11B 2BDPA 1YJVA 4OYZA 3DI6B 3JAMY 3HSGA 1CJUA 3H4BA 3UVJB 2AYEA 4OX7A 3BQ0A 2JVOA 2PT0A 2NYHA 1XMQJ 3H20A 3N0VA 4ZN3A 4CLTA 2EPIA 5I3PA 4HVZA 1S6PA 1M5SA 3C6TB 4DU7A 1LWFA 4A8OA 3HVRA 1M5VC 2FZCB 2GW8A 4RJVA 2Z4PA 1X31C 1EZZB 3M6UA 4P7TA 3TJ9A 2FVRA 4TU9A 3IS9B 4PUOB 3B78A 1S72S 4IQMA 2R7OA 4PWDB 2J0WA 1S5ZA 5HMYA 3BQ2A 2BKNA 4X4VA 3I9V9 2V69A 3ICLA 3B54A 3CWJA 4C0BA 3AQOA 4Q43A 3MUTP 1SH3A 2GGPA 2J5AA 4HKQA 2A18A 3FK4A 1VBYA 1VQMS 1TKDA 1QE1A 3F44A 2LQ8A 4C0HA 2AT1B 4J5OA 5LJ5Y 1RTHB 1RYSA 1FEHA 3PRVA 3SEOA 2PI4A 3OFEA 1A6LA 3ISNC 4M1KA 2HBRB 4DFMA 2XWYA 3HFKA 3BO3A 1U1KA 4LSZB 3AB4B 1B3TA 1AUSL 2CZ9A 1XTZA 4L3NA 3DLLQ 2BJ1A 2FJDB 3ZNUA 5HI7A 4MTPA 5IQ6A 2RAQA 3O1LA 2YBVA 3ENWA 3GFYA 2MLZA 3MOJB 1WF2A 4CM0A 3KLHA 3E01A 1HBOA 1SPBP 1XQIA 1FE0A 4QIGA 2KG1A 3ET6A 3HFVA 1IKXA 3OVAA 1IBMJ 1JNRB 1LWEA 3TA1A 2VQFJ 3MEDA 2IM3A 5D4NA 3MM9A 3UCZP 3OQ2A 3KHRA 1RQ0A 3QFWA 5F8MA 3M8QA 3ADAC 1NO8A 1H0HB 1HI8A 1UFWA 3HHLD 4CI0B 3NAHA 3WC0A 1BQMA 1RISA 4LF9F 1HMVA 2XLJA 3G82A 3W5YA 1VRTA 4UQGA 5F9LA 4YHHF 4TU7A 3M4XA 1HI1A 4NLRA 3SCLE 5K8NA 1WELA 3G6XA 2FGCA 1M1GA 1SC1B 4H4OA 3BSCA 2VU5A 1SH2A 4U7UK 4NYZA 3X3UA 1IJFB 1IBCB 2AGOA 2PA8D 4DR7F 4YN3B 3WQPA 3PFOA 3AD8C 3V6HA 4J9UE 2IJFA 5GAHI 5ETRA 5CD4A 5KG6A 2KJWA 4NX9A 2PFFB 4OJ3A 2I0XA 4ZPWR 1VQ8S 2B7CB 1X60A 1RWNB 4OLOA 4CRJA 2Z2YB 3CF5Q 2AU0A 2ILZA 1MWQA 2M5YA 1VIXA 4ELUA 1D8ZA 1WNEA 1U4BA 1F3FA 2E9TA 2C1EB 3OFHA 3JSYA 3CJ8A 3HCXA 2RIJA 4LSLB 4C3LA 4DUYJ 4UTGA 4GVBA 4G1IA 5HBMB 3BPSP 4YR2A 1EKRA 2RT3A 2XMAA 2BKOA 2H3EB 1NSPA 1SKSA 2CJAA 4DR4J 5KT2A 5J2PB 1EHWA 3R5CA 1WI6A 3MFHA 2YNIA 4L74A 3ZZUA 1R43A 3OJUA 5CCMA 1HR0J 3SDEA 2BYCA 1E6VA 2VDHA 2WSEC 3OHAA 1JJ2R 1RTJB 3V6DB 2H5JB 4DG1A 2EFQA 1AW0A 4OI6A 4J9SA 4BDPA 1KP6A 4QW8A 4ZPBA 1B4SA 4WF9Q 2CQHA 4JI5J 4ID8A 4CO5A 1Y7PA 1Q82T 4LF8F 3CJTA 4BC9A 3KLIB 3QZ7A 4OI2A 1HWKA 2XG8A 3MR7A 3N5BA 1XN9A 2R2RA 2K1RB 1BQNB 4KC5A 1YRUA 3I96A 2DXDA 4AQYF 2QL9B 2Y8YA 3OR2A 3BGRA 4R5PA 1C0TA 2W9BB 1BWVA 1YVFA 4LUBA 3CCUS 3ZZ0A 4DU8A 4ID5B 1FCAA 2OEJA 4PG4A 2ZC3A 5ETVA 4F4AA 1T9XA 3QSIA 4RW8B 4J9NA 2N3LA 1HD1A 1P1LA 1JLBB 1BGXT 1ELOA 1SJ1A 3ZZPA 3KJVA 3C3LA 1NMEB 2VASA 5CABA 2AZ1A 3IWLA 2YKPA 2ADCA 1CULA 3H7HB 4Y00A 4C7QA 5HQMA 1PGZA 3GIKA 4RUHA 4TQRA 4P6QA 1KTVA 2AJ2A 2NXUA 4L6V3 2E1CA 3QZ8A 1M90T 1VRUA 5GAHU 1JLQA 1SJQA 1A0OB 2GJIA 3TW0A 2IDEA 3DLGA 3VZIA 2VC0A 1OPIA 3LGHA 1N36F 5RUBA 1ZYQA 1PKUA 3LGMA 3VAIA 1B7FA 2V50A 2R7WA 4RW9B 4X4RA 3KLGB 4UZBA 5F0WA 4EI2A 4DUZF 3T6BA 4IRCA 4RW6A 4DDFA 1CVJA 1C4CA 1AZSB 2XYGB 3BYPA 1V5VA 3JTNA 2OUGA 3SSSA 2FJEB 2UU9J 1FFSB 3WC2A 4QQBA 3R6GB 1HBOB 3UO0A 3TI0A 3IG1B 2CIMA 4QIWD 1IKXB 4TN2A 1XWLA 4TY9A 4Z7CA 3NMRA 1XBWA 2DYAA 2PD1A 5A76A 4X65F 3OTEA 1PJ6A 2VPXB 2QYCA 2GX8A 3OVSA 4HYKA 3GMGA 2WVEA 4IO9Q 4U8YA 3HHLB 1Q5VA 1TMJA 2H48B 5A0YA 1BQMB 4F0HA 4UOCA 4ELVA 4OZ2A 4LREA 3R7NB 4DX8H 3GTYX 2VBZA 4LQ9A 1NK7A 4DR7J 4OHZA 2XY7A 4C8YA 4DUTA 4K7QA 3D28A 5LSRA 2YNHB 1YBUA 2I5JA 4H4OB 4QWCA 3MMCB 4F4XA 3HO1A 4ZCMA 3K8VA 2XS2A 4CQ1A 4U67Q 1APSA 1D9DA 2FVQA 2CADA 3V2UC 4ZLPA 3JQJA 1SC6A 3SFUA 3MCOA 1F9HA 2BRLA 5KFRA 5A8KA 5DZ7A 2OI2A 2JZ5A 3D6TB 3Q8YA 4QWDA 4ECWA 4H54A 2YH0A 1SKWA 4O3NA 2UXCJ 2NXJA 2BQUA 1VGYA 3NOCA 4DJBA 3KDOA 2XY6A 2ZZMA 4RUBA 1I3OB 3KLFB 2MPUA 5EGYA 4QPTA 5BR8J 4NASA 5B0GA 2HYIB 2ZNYA 4FBUA 5EHHA 4DWIA 4O4GB 1T3OA 4QWAA 4HL9A 2ZHAA 5B0CA 4CNZA 5KFFA 2G0IA 2RDIA 3FVYA 2HHUA 1G6BA 3L4BC 2OO4A 3DLEA 3L7OA 1TAUA 4KBIA 2R8IA 2GV1A 2OPQA 2CWKA 2DRBA 1CJTA 2MHNA 2JVRA 1YSJA 2O67A 3BBBA 4F0MA 5DDPC 1N88A 3T1HF 2YH1A 3TJAA 2ZJQQ 1JLEB 2C2MB 3PYDA 2MHEA 1CG2A 2UVWA 1S9GA 4P2XA 3SQOP 5DM6Q 4DV1J 3V81A 1ZETA 4WTYA 2DNGA 1KLNA 1R27B 3W63A 2QLBB 3NBPB 3E51A 3IAS9 3ILJA 1Q53A 4CTAA 1CJKB 2ZBRA 3NGUA 1R0CB 3AA8A 5HVGA 2ZH8A 2UV8G 4Q7AA 2CJBA 3GV5B 1YJWS 4TQSA 1PYSB 3EYZA 2QMWA 1UA0A 1HNZF 2G1HA 3MEKA 4RR5A 2R42A 3U1NA 2NZ4A 2RHQB 1VBXA 4CYUA 1FDAA 1UL3A 1VBZA 4UF4A 3PW0A 4NXMF 3QT6A 2V2KA 3C19A 4I2PA 4ED8A 1KNZA 4V19J 1ZM3A 1TKZB 3NXZA 2GVDB 2C2DA 3BKUA 3SV3A 2UUBJ 4K0KJ 1LEOA 4A8QA 1QSYA 2V34A 3PACA 4NRTA 1NAQA 4ER8A 3BH7B 1HBUA 4NYPA 1O8BA 1FJGF 1ULRA 3HHLC 3M8PB 2NR0A 4IOAQ 2JWNA 3CJ5A 1FXDA 4DV0F 1CQMA 2A3JA 4BC7A 2F4VJ 2JNJA 4OHYA 1SI9A 3PX4A 2QLFB 2JOQA 1CS4B 1GX5A 2E1PA 2GVZA 2WBRA 3CJ4A 3NNAA 3R6LB 3LP0A 2EC2A 2DK2A 2DHHA 3MM5B 4I6WA 5M2RA 2HKEA 4H4KA 1S6PB 4J9OA 2PDAA 4NLUA 3Q8QB 3GFXA 4B9NA 3CJ2A 1RA7A 2C3MA 3ENVA 3HHKA 4ETXA 2IJRA 5KAKA 3LTOA 2X3GA 3BYRA 1TL7A 3FEZA 1VOMA 2E7VA 3I0RA 3FSXA 2Y3YA 4KV8A 2FHJA 4Z2XA 1SKUB 4DV6J 4O3PA 3FNNA 3GSIA 3T9NA 1K9MT 3RBEA 2FJXA 3THVA 1NKCA 4DL6A 2RH3A 4O3RA 1DFDA 3TEGA 2HGLA 1ZM4A 1JQGA 2HBQB 3N28A 4S0MA 4X4PA 2QFIA 3MURP 2KFYA 2PGCA 2DIUA 2YKAA 3MM7B 2N7CA 3EVOA 5A0YB 2GAHC 3H2LA 1S0OA 4DR6J 4LT6A 1XIQA 2Z0GA 4PR6A 4K50A 2JFDA 5MAOA 2EXUA 3IM9A 2VODA 4ICLA 1IWGA 2KRRA 4Y2KA 1U2FA 1Y4ZB 2HLUA 4U8VA 1S49A 1FRHA 3SSRA 4K4VA 4AL7A 3U1LA 3I5CA 1KRPA 3HM9A 2DR9A 1FDNA 1GT8A 3O3LA 3BDEA 2AD9A 2B5JA 3IBWA 7FDRA 4M5GA 4DSIA 3GCXP 1EQMA 1UPPA 2IVYA 2QT7A 5E3AA 4KGMA 5KFJA 1HNWF 4B3TJ 4GKKF 3HI9A 2F8EX 3MM6B 3ZTRA 4B3MF 3ET6B 3O2IA 2XMVA 5BR8F 1U7LA 2G2ZA 4PCQA 4PG5A 3MUVP 1N32J 2YWHA 5DM7Q 1RLCL 4E2FB 3AA9A 3A8JA 2KHDA 4ECUA 2L9NA 1BWEA 1SQEA 4USIA 2IYGA 4JV5F 2V5HG 2HVHA 4B9TA 3NP5A 3ZZYA 2QSFA 1D8YA 3J7ZT 1LQ9A 3JQKA 1XEZA 2F9DA 4DZ6A 1CJTB 1EIYB 1N4LA 3PJ9A 2CQ2A 1QD1A 1WKKA 2D7SA 3KOAA 1FRIA 5A2QY
chains in the Genus database with same CATH topology
5IWAJ 2KL8A 3D3BJ 1HR0J 4KY3A 4LF4J 1IBKJ 4DV1J 4JI8J 4LFCJ 2HHHJ 3R2DJ 1XMOJ 2UXDJ 4JI0J 4JI5J 1N34J 4LF6J 4JI1J 2MQ8A 4AQYJ 4X66J 1HNWJ 2ZM6J 4LF8J 3T1YJ 4JI2J 1XMQJ 2UUBJ 4JI3J 4K0KJ 1N33J 1XNRJ 4LF7J 4JV5J 4DV2J 4RJVA 4NXMJ 2UXBJ 2KVQE 4PWWA 4JI6J 2F4VJ 3IMQJ 3T1HJ 1N36J 1IBLJ 4V1Ak 4KYZA 3J7AN 4GKKJ 1FJGJ 4LF5J 4B3RJ 4DV5J 4LFAJ 5FLXU 4NEZA 4JYAJ 3D3CJ 4X64J 4X65J 3J81U 2UU9J 5LM7E 4KHPJ 4DR5J 4DUZJ 4JI4J 4DV6J 5AJ3J 4YY3J 4DR2J 5IT9U 1IBMJ 4YHHJ 4X62J 2VQFJ 1XNQJ 4DR6J 4NEYA 4GKJJ 1J5EJ 4B3MJ 1I94J 4JI7J 1HNZJ 2VQEJ 4DV3J 4DR7J 5A2QU 5LMUJ 1HNXJ 3W1YC 3OTOJ 4DV0J 4LF9J 2MEWA 3R2CJ 4B3TJ 4LFBJ 2UUCJ 1N32J 4DR1J 4DR3J 4B3SJ 2MTLA 2UXCJ 4DV7J 5BR8J 2E5LJ 2UUAJ 4DUYJ 4NXNJ 3J80U 4HHUA 3JAMU 4DV4J 4OX9J 4DR4J 5LMNJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA J;  2KL8 A;  3D3B J;  1HR0 J;  4KY3 A;  4LF4 J;  1IBK J;  4DV1 J;  4JI8 J;  4LFC J;  2HHH J;  3R2D J;  1XMO J;  2UXD J;  4JI0 J;  4JI5 J;  1N34 J;  4LF6 J;  4JI1 J;  2MQ8 A;  4AQY J;  4X66 J;  1HNW J;  2ZM6 J;  4LF8 J;  3T1Y J;  4JI2 J;  1XMQ J;  2UUB J;  4JI3 J;  4K0K J;  1N33 J;  1XNR J;  4LF7 J;  4JV5 J;  4DV2 J;  4RJV A;  4NXM J;  2UXB J;  2KVQ E;  4PWW A;  4JI6 J;  2F4V J;  3IMQ J;  3T1H J;  1N36 J;  1IBL J;  4V1A k;  4KYZ A;  3J7A N;  4GKK J;  1FJG J;  4LF5 J;  4B3R J;  4DV5 J;  4LFA J;  5FLX U;  4NEZ A;  4JYA J;  3D3C J;  4X64 J;  4X65 J;  3J81 U;  2UU9 J;  5LM7 E;  4KHP J;  4DR5 J;  4DUZ J;  4JI4 J;  4DV6 J;  5AJ3 J;  4YY3 J;  4DR2 J;  5IT9 U;  1IBM J;  4YHH J;  4X62 J;  2VQF J;  1XNQ J;  4DR6 J;  4NEY A;  4GKJ J;  1J5E J;  4B3M J;  1I94 J;  4JI7 J;  1HNZ J;  2VQE J;  4DV3 J;  4DR7 J;  5A2Q U;  5LMU J;  1HNX J;  3W1Y C;  3OTO J;  4DV0 J;  4LF9 J;  2MEW A;  3R2C J;  4B3T J;  4LFB J;  2UUC J;  1N32 J;  4DR1 J;  4DR3 J;  4B3S J;  2MTL A;  2UXC J;  4DV7 J;  5BR8 J;  2E5L J;  2UUA J;  4DUY J;  4NXN J;  3J80 U;  4HHU A;  3JAM U;  4DV4 J;  4OX9 J;  4DR4 J;  5LMN J; 
#chains in the Genus database with same CATH topology
 3KG0 A;  1O5J A;  4WFX A;  3WIV A;  1LV5 A;  2VG7 B;  2H9Z A;  3M6V A;  5D4O A;  4F26 A;  4J9V A;  1TZ0 A;  4Y2A A;  3NBP A;  5D77 A;  2NUH A;  1UEK A;  1CJK A;  3ZZR A;  2GJ2 A;  3GLJ A;  4LIW A;  1RWO B;  2EFG A;  2GO8 A;  1GTE A;  1RAH B;  2DNM A;  1J2V A;  3AAW B;  1MLA A;  4LSL A;  3LO3 A;  2CAJ A;  3MEE B;  5K5M A;  4GVB B;  1LW0 B;  2MQ8 A;  4IG0 B;  4D3G A;  1UFL A;  4MYU A;  1E6Y A;  2ZBI A;  3QT5 A;  1TAQ A;  3SBM A;  4N56 A;  2W9C A;  2R9L A;  1KSP A;  2HHH F;  3RBZ A;  1M5H A;  3HHE A;  1NXI A;  3TUJ C;  2J6U A;  1N5Q A;  2DNQ A;  1TKZ A;  1SVD A;  1N8R T;  1J27 A;  3G86 A;  2VKZ G;  4FF3 A;  4A47 A;  3JSM B;  2OML A;  2WON A;  1S1U A;  4IG3 A;  3DHX A;  1WOS A;  4JUZ A;  5KFI A;  1EKS A;  2Z56 B;  3ILL A;  1CC7 A;  2FHM A;  1SUQ B;  1PIL A;  3DYA B;  3K8W A;  2WSF C;  3LAK A;  2CJX B;  4CLY A;  3GJS B;  1GMU A;  4RW4 B;  1X8D A;  1QAX A;  1U6Z A;  3ZTP A;  3C16 A;  4YS2 A;  3BO4 A;  1NJX A;  1L3T A;  2ZD1 A;  2DR7 A;  3BH6 B;  4WFN Q;  1S4E A;  2WCX A;  4NI2 A;  4ETZ A;  4F50 A;  3TZX A;  2MLY A;  1IKV A;  3KLH B;  1W25 A;  2HNY A;  2Z2Z A;  2FHK A;  3M9N B;  3EX7 B;  1AFJ A;  3GJT B;  3R27 A;  1MU2 B;  3CDE A;  5D0G A;  4DR3 F;  3MED B;  2C2N A;  2WB4 A;  4RW8 A;  1N54 B;  1UVJ A;  3AQP A;  3K7R A;  5FLX U;  1RT3 B;  4I69 A;  3FEY B;  1VS3 A;  4ZVH A;  3QAE A;  1WEZ A;  3G6E S;  3M8Z A;  4CH7 A;  2GNK A;  4KV8 B;  3OXF A;  4IFY A;  2AYG A;  5C25 B;  1DAX A;  2XB2 D;  1JKH A;  4DR5 J;  3I9Z A;  3ZNJ 1;  1G7C B;  3LQV A;  2VD3 A;  3H40 A;  2ZUA A;  2ZZT A;  3TX0 A;  1HBM B;  1RB0 A;  2HVZ A;  4DS4 A;  1HNI A;  1RAC B;  1OIA A;  2O5D A;  3O8W A;  3DLJ A;  4Z37 A;  1VHF A;  2D3U A;  2XTJ P;  4PAA A;  3K5N A;  5A8W B;  3CMQ A;  1NPR A;  1PSD A;  2IJN A;  4HTJ A;  4GKJ J;  3CNQ P;  5JVG Q;  2MKY A;  1NK5 A;  3S6E A;  1T9W A;  2HGM A;  3GV8 B;  3HD1 A;  2ZEJ A;  3K58 A;  8RUC A;  2YX4 A;  1ZPW X;  5F8J A;  1TEL A;  1DQ8 A;  4CO4 A;  2W4P A;  1TKT A;  1RBA A;  5B08 A;  2VQE F;  5A6W A;  1S97 A;  4EK2 A;  4JV1 A;  3KDN A;  2YNI B;  3BSN A;  3FEX B;  4HLB A;  3MPY A;  2OGU A;  2FLL A;  4P2M A;  2HW3 A;  2W8L A;  5DLG A;  5AXM A;  3C46 A;  5D8H B;  3OSP A;  3ETM A;  3M2R B;  2J7K A;  2MTL A;  3W2V B;  4J9K A;  2AQ4 A;  1HHQ A;  1NK6 A;  4CT8 A;  2MKI A;  3IXQ A;  2UXB F;  1OWX A;  2KZM A;  1WHX A;  5GAG U;  3CCJ S;  3ZXW A;  3M8Y A;  2GMJ A;  1TL5 A;  1FNO A;  3IM8 A;  4DPT A;  2CQB A;  3KK1 A;  2B6A B;  5B0E A;  4DEZ A;  1Q7Y T;  1IQZ A;  4ILM A;  4C8Z A;  2RRN A;  3KHG A;  1IKY A;  4YB6 A;  1GTH A;  2NSB A;  3DOK B;  1RWK B;  3R7B B;  1YG0 A;  2CQI A;  3BGR B;  3OR2 B;  4KH1 B;  4NLS A;  3WIU A;  4F25 A;  3FSY A;  5A8K B;  2W9B A;  3DOL B;  1ZS6 A;  2Y0B B;  1RA6 A;  4NLT A;  5C2C A;  2X1A A;  4DSF A;  2HHH J;  2MJN A;  3IBF B;  2NUU G;  1YBA A;  1T03 B;  1FK9 B;  3JTP A;  1Q86 T;  4OZJ A;  3LP2 A;  1VFJ A;  4L72 B;  4YB1 P;  3H4D A;  3M32 A;  3PX0 A;  1U8S A;  4U9R A;  4X4T A;  1ZTW A;  2NRE A;  3ENA A;  3IRX A;  4PG7 A;  2HFV A;  4JI1 J;  1WC4 A;  1S7I A;  3R5J B;  4Q0B B;  1BXN A;  2DO4 A;  3UW1 A;  3UD5 A;  1UJ5 A;  3CJR A;  4YR3 A;  2CPZ A;  4Q2M A;  5F0U A;  4E98 A;  3G4S S;  3A8K A;  1SV5 A;  1WF0 A;  1ZM2 A;  2GCF A;  1NZ8 A;  3JXO A;  5I42 A;  1JLG B;  3DHW C;  1IUJ A;  3QBC A;  2EI5 A;  2W1B A;  4ZVE A;  3MM8 B;  4TVA B;  2VJV A;  5KFG A;  4LF8 J;  4DR6 F;  2KYX A;  4WKR A;  1B0V A;  2YWK A;  4ZCL A;  4BLG A;  4ATN A;  3AXK A;  3B82 A;  2NXC A;  2VF3 A;  3C6T A;  1M5O C;  4LF7 J;  4P7V A;  1I51 B;  3TAN A;  3KTQ A;  2GS8 A;  4RW6 B;  1EET B;  2WZ1 A;  4KHR A;  1FFW B;  5AXL A;  3RW7 A;  3R7S B;  3H2U B;  1YKW A;  4Y0F A;  2KH9 A;  4JI6 J;  1RI7 A;  1XR6 A;  3QGP A;  4KGV B;  2A6O A;  4F02 A;  4DR4 F;  1YWX A;  1MRO B;  2VC1 A;  2GIR A;  4PWD A;  5THW A;  5H9E J;  2P9E A;  2M8H A;  1HHT P;  4ZVF A;  1MSW D;  4OV6 A;  3M6X A;  2BE9 B;  1H98 A;  3Q83 A;  5GAD U;  4DLE A;  2QGF B;  2EEY A;  1WDT A;  2BJD A;  3KMS A;  5EWG A;  3LWM A;  3L09 A;  4MKB A;  3D68 A;  4ES1 A;  4NEZ A;  4LJM A;  2VG6 A;  1KQF B;  3BPD A;  2G9O A;  2V94 A;  4UW2 A;  4Y2M A;  4A8K A;  3CCM S;  3R1H A;  2DR5 A;  2XI2 A;  2RHS B;  4PZV A;  2KB2 A;  2HHX A;  3VF0 B;  2HS4 A;  3B6B A;  1N5S A;  3PEH A;  3QT7 A;  5D4L A;  4C0O C;  3GR0 A;  4PRF A;  5J2Q B;  2QA1 A;  1P1T A;  2C2O B;  2GVZ B;  3PFE A;  2FVC A;  4DR2 J;  1LWE B;  4B9S A;  1S77 D;  1SL2 A;  4LBH A;  4MIA A;  4Z7Y A;  4HR2 A;  1GMW A;  4KGZ B;  3WX4 A;  1RXO B;  3QT8 A;  1SJR A;  2AJQ A;  1RWW B;  2M70 A;  1SBR A;  3CD5 A;  1R7I A;  3W5Z A;  1Q8I A;  2WRM A;  1RT7 A;  2VIC A;  1TK5 A;  2QLJ B;  4F3O A;  1YJT A;  5KG2 A;  1Y00 A;  2BW7 A;  2CPJ A;  3AH6 A;  3CW2 C;  4IUF A;  5D4P A;  1XNQ F;  2YKM B;  4FKX A;  2CQD A;  2WOM A;  1G3O A;  3NL0 A;  3CPW R;  3MEC A;  4LR8 A;  2H5I B;  5F3Z A;  4UUW A;  4FS2 A;  4ZVS B;  4BBY A;  2C22 A;  3UNG C;  3W61 A;  3MR6 A;  1Y3J A;  3CCL S;  4DV0 J;  1KR4 A;  2I6W A;  4IQX A;  3G2X A;  4LMZ A;  4NZ6 A;  4YDD B;  1UVK A;  2M2B A;  4N77 A;  4ECY A;  1OY8 A;  3H0P A;  2X1F A;  1QTM A;  1WC5 A;  2J6S A;  3W2V A;  1NHU A;  2V9K A;  4JP8 A;  2FLP A;  3HLU A;  2IC3 A;  3KHH A;  5CYM A;  2H5E A;  1U0H A;  4KFB A;  4PQU B;  1GNK A;  2B4U A;  2A1B A;  2J76 E;  3CO9 A;  3QID A;  4UT4 A;  2E5L J;  4OV1 A;  3RU0 A;  4LF7 F;  4NXN J;  4ED2 A;  4CO2 A;  3TUZ C;  1Q16 B;  3I56 S;  3BGL A;  5DGA A;  1EJ7 L;  2COL A;  3DU6 A;  4OYM A;  1R8A A;  3TA2 A;  1HQE B;  1NHV A;  3D9B A;  4ZN1 A;  3CT9 A;  4A8W A;  1NBE B;  2ZIT A;  2OD6 A;  4RBV A;  4DV6 F;  1PG5 B;  4C2M A;  2W25 A;  1E6V B;  4KY3 A;  3HJF A;  1MN7 A;  1RAJ A;  5KFP A;  5KG7 A;  4FYX B;  4DG1 B;  2Z8Q A;  2GJF A;  1TFY A;  3FRZ A;  1YJU A;  3HUL A;  1SKR A;  2XS7 A;  3H42 A;  1FDB A;  1S1X B;  3AOB A;  2NLW A;  2XGQ A;  1TL3 B;  4OX9 F;  1IBK F;  2YVS A;  4M5M A;  2HFN A;  4EFA C;  3RW6 A;  3EVW A;  2R8K A;  1VK8 A;  4WFA Q;  3PRD A;  1N6Q B;  3QJP A;  1I94 F;  2WVC A;  2OSQ A;  2DEI A;  3B4M A;  5DRK A;  4K4X A;  4G3I A;  2Q43 A;  2EK1 A;  3W66 A;  4X66 J;  1K1S A;  2EKY A;  3AOA A;  1BQN A;  5JVH Q;  4U7C A;  2JLE A;  4DZD A;  2KM8 B;  1FRM A;  3W8G A;  1H6K X;  2XLI A;  4EZ6 A;  4DS5 A;  3LP0 B;  1YDL A;  3PR4 A;  1B7Y B;  1HAR A;  3DOM A;  2FIU A;  3FBC A;  4EWT A;  5CYQ A;  1IBM F;  4EO6 A;  1K0V A;  3PTW A;  5K8P A;  4M5J A;  1GQE A;  3CCS S;  3QRR A;  4JI3 J;  2XMK A;  1PAE X;  3PXG a;  2E9R X;  1N33 J;  5FJ4 A;  2IHR 1;  1URN A;  3A13 A;  5BJR A;  1S1W B;  1F1B B;  3CED A;  3TWZ A;  4B02 A;  2MKC A;  4YB7 A;  5K14 A;  3V4M A;  3PW4 A;  1KVI A;  5KFA A;  4K0K F;  3UE2 A;  1JIH A;  1LW0 A;  3U1M A;  1MRO A;  4MYT A;  3U27 A;  2DCL A;  2M8D B;  3NY0 A;  2M3D A;  3GV7 B;  2R2U A;  3T1H J;  1P27 B;  2AP6 A;  1KS2 A;  2DXF A;  3AT1 B;  1R0B G;  2QG9 B;  4V1A k;  3DFE A;  1SJF A;  3NGK A;  2ZE2 B;  4OJ1 A;  4AL5 A;  3LA0 A;  3O44 A;  4CDI A;  5CD4 H;  3JSM A;  3RB0 A;  4MJK A;  2FJV A;  2GHW A;  4OI1 A;  2YKN A;  2K7K A;  4I64 A;  4LIR A;  1Q95 G;  1TUG B;  5F3T A;  2E5J A;  2XHW A;  3UN5 A;  3TZY A;  2RIL A;  4JYA J;  4DL3 A;  4X62 F;  2WTF A;  4RW4 A;  4Q44 A;  5GAE I;  2OFH X;  4NXN F;  2DR6 A;  5DDQ C;  3IS9 A;  3HJV A;  4IOC Q;  4PUO A;  2HQC A;  2HGN A;  4LRC A;  5FDL A;  1CJV B;  1NK9 A;  3FGV A;  1D1U A;  3DRY A;  2GA7 A;  2CPY A;  4TLR A;  4ANE A;  5I3U A;  4V19 X;  5IT9 U;  4DQQ A;  4K5R A;  4TNO A;  3MTJ A;  4B9L A;  2UUB F;  4ITS A;  2Z2L A;  1Z2Z A;  2VJU A;  2UVU A;  1RT2 A;  2DGW A;  2QA4 G;  1FNX H;  1UAW A;  4IYQ A;  2LYV A;  4M95 A;  2BX6 A;  4TKT A;  4JI4 F;  2CNN B;  3IRW P;  3GG1 A;  4BS2 A;  5C24 A;  3GP9 A;  5ETK A;  1C1B A;  4JI5 F;  3MR2 A;  2JHE A;  1VQN S;  2FJA B;  4WU2 A;  4TY8 B;  3ZTS A;  3OL7 A;  4R0E A;  2LEC A;  5J2M A;  2FY8 A;  2MQM A;  3K0J A;  3P8B B;  3MMC A;  2W9A A;  4I7F A;  1I6J A;  4YB5 A;  1FXR A;  2BEF A;  4YQW A;  5D3G B;  1YQH A;  3T6J A;  3SIP B;  1AT1 B;  1ZM9 A;  5FII A;  2FD2 A;  2UUC J;  1HNI B;  4NPO A;  1FTC A;  3NCQ A;  1VC0 A;  2HAF A;  5ETL A;  2FVS A;  3NLC A;  1JLF A;  1HW9 A;  3JSR A;  3O5T B;  3GIL A;  3PV8 A;  3AJ2 A;  3OV7 A;  2DNK A;  2KFZ A;  3VQT A;  2ZH5 A;  3CJK A;  4NML A;  3TOQ A;  4CM2 A;  1Z1Z A;  2FZG B;  5EWE A;  4NLW A;  2J0X A;  4IG0 A;  4KPC A;  4J37 A;  3DLE B;  1VK3 A;  2JSX A;  4CH0 S;  2DVI A;  2Y8W A;  4B9V A;  1WD6 A;  1SJ3 P;  3QJJ A;  1BY9 A;  1EB0 A;  5DQG A;  3CCV S;  3VAF A;  1HQE A;  4PQA A;  3CXC R;  2R7U A;  3DDN A;  3LPY A;  3PR5 B;  2JEG A;  5IQQ A;  4B9U A;  3IFE A;  2F1F A;  1LWC B;  2JH3 A;  2R3V A;  1DLO A;  2OJ3 A;  1TQL A;  4OX8 A;  1AFI A;  4LF5 F;  1V9O A;  4LSN A;  2G0J A;  1F5C A;  2L48 A;  1TL1 A;  4F3M A;  1XMO J;  3ISN D;  2HQI A;  2HEK A;  2IMW P;  3HHN B;  2UXD J;  1WJ9 A;  3MAA B;  4CTA B;  1UWB A;  2R4F A;  5E3C A;  4FPI A;  3TA0 A;  1NHK L;  1S6O A;  2NZC A;  3HT0 A;  4PYA A;  3SXL A;  1U1O A;  3PM9 A;  5HRO B;  2PFD A;  3WZ0 A;  3H59 A;  2K2P A;  2YX7 A;  2B6A A;  5B0F A;  2IVM A;  2C3P A;  1YRX A;  1Q79 A;  1HBN A;  2V63 A;  4WKY A;  4E0D A;  5DJB A;  4M8L A;  1JWW A;  2OTL S;  3H90 A;  1RLD A;  3DKD A;  1PBA A;  5BYS A;  1Q5Y A;  2Z2M A;  4NYO A;  6AT1 B;  1ROF A;  5ETS A;  4TYA A;  3SDE B;  3T1Y J;  3M8W A;  3K2Y A;  3ZZO A;  5DQI A;  1RTJ A;  1U8W A;  4X4U A;  3AFG A;  4PAB A;  4CH1 A;  2HK2 A;  4DR1 F;  1JLA A;  1FK9 A;  1RTD B;  2MQP A;  1FVS A;  1HBU B;  4JV5 J;  1F9E B;  2EG1 A;  4DCP B;  2W2Q P;  2MQL A;  1R0A A;  3SQG B;  2H1Y A;  1VI7 A;  1T9U A;  3FMB A;  5M2U A;  2DHS A;  2KVQ E;  2MKH A;  2UXB J;  3DU5 A;  3J7Y U;  2K3I A;  3TAM B;  2ZH9 A;  4KAI A;  2QLX A;  1CS4 A;  3A3N B;  1UA1 A;  1RYR A;  2AEM A;  2UVV A;  2K1R A;  3QSY B;  5HMX A;  2OEM A;  1Q4R A;  1REG X;  5KOX A;  4ECR A;  1EQ0 A;  3AJ1 A;  1D09 B;  4DI6 A;  5ADZ A;  1VDH A;  3UPF A;  4R5P B;  3CC2 S;  3AY0 A;  4QYZ J;  3GWC A;  2XSJ A;  4F7V A;  2HIQ A;  2CG4 A;  2AWZ A;  2RJZ A;  2XNQ A;  1HWL A;  1N5Y B;  1UPM B;  4TU8 A;  1TK0 A;  1S79 A;  2UUW A;  1EAR A;  3HMJ G;  2LCW A;  4IH6 A;  3BO2 A;  1VBK A;  2YWW A;  1WEX A;  1N0V C;  5GAD I;  3J81 U;  1WOP A;  4RL1 A;  2FPH X;  2I9S A;  4FYD A;  3ETO A;  1FO1 A;  1FRX A;  2YQ0 A;  2HRT A;  4ZVO B;  4USK A;  2HHQ A;  4NL5 A;  4R8U B;  3UN2 A;  4KQZ A;  4ZP9 A;  1VRQ C;  4LRD A;  3FKB A;  5SUH A;  3MCM A;  4QPX A;  1HQU B;  5AE3 A;  5F8N A;  2UUT A;  1S0N A;  4ES3 A;  1VCT A;  2HWT A;  5JJB A;  2XO6 A;  2PSZ A;  4O0I A;  2HHP A;  3L7U A;  1FX2 A;  2G0C A;  1TKX B;  4CP5 A;  1Q8L A;  4F36 A;  1XER A;  3PYF A;  2BVZ A;  2KT3 A;  3QAU A;  2M4M A;  4WWS A;  5C24 B;  1KVJ A;  5KFE A;  2ZHB A;  2VG6 B;  3KLE B;  1I94 J;  4JI7 J;  2JEI A;  2ERR A;  2P6T A;  4RBU A;  2DEJ A;  3MXH P;  4QCL A;  2B3T B;  2RF2 B;  2W7A A;  5AE2 A;  2KZZ A;  5KFU A;  1QTN B;  4M5D B;  2OEK A;  4EMD A;  2ZDO A;  1TV6 A;  4GKJ F;  4YFU A;  3LH2 S;  4CLZ A;  1J5E F;  2PC6 A;  2MEW A;  4KKO A;  1X4F A;  2MKS A;  2MY8 A;  1KLM B;  2JJ4 D;  4MH8 A;  1FRJ A;  1S0M A;  2A2D A;  4OYW A;  4ERD A;  3NCP A;  2ALY B;  2CKW A;  3MF5 A;  4IFV B;  1FRK A;  1F5B A;  4IO1 A;  2LMI A;  1G2E A;  2C3O A;  1GMV A;  1Q0N A;  1Y10 A;  2P8I A;  3I4H X;  1LXN A;  2HFU A;  3QNW B;  4M5K A;  4GC7 A;  2IAJ A;  2VA2 A;  1CLF A;  5F8L A;  3HHL A;  1D3W A;  3HHD A;  1XJW B;  4WYW A;  2WHO A;  3RG6 A;  4KR0 B;  4LFA F;  3M8R A;  1K8A T;  1M1K T;  1RTI A;  2HBY B;  1U25 A;  4RU9 A;  2IA0 A;  1X9W A;  1YZ7 A;  4M94 A;  2C2K B;  2I5J B;  5KG4 A;  5I3Q A;  3VHQ A;  3RR7 A;  3CO0 P;  2YKO A;  2Z30 B;  4NOH A;  2ZH7 A;  5IWA J;  5J1E B;  5KFY A;  4U95 A;  1RT4 B;  3IWX A;  2B9X A;  3Q2S C;  5KT6 A;  3A3O B;  3KG1 A;  1S6U A;  4H4K C;  3TP2 A;  1TMM A;  3IR5 B;  4FPR A;  1T02 A;  4G1Q A;  3VV2 B;  5HMZ A;  1LW2 A;  2DHG A;  3PYG A;  5HP1 A;  2EG2 A;  3CC4 S;  4ILR A;  4NLO A;  1VQL S;  1Y0H A;  4W98 A;  5IS2 A;  1UVI A;  2ROG A;  2I8E A;  5KFW A;  3CCQ S;  4WE1 A;  4WCE Q;  2M0G B;  2MZJ A;  3CCW A;  4RKU C;  3FMW A;  2D9P A;  2PMH A;  2VPZ B;  3BEG B;  4OZ1 A;  4DX6 A;  4LFC F;  2GFF A;  2ZH4 A;  1FRL A;  4NLY A;  3HPO A;  1SQF A;  2LP4 A;  1BUX A;  3V4I A;  2FHJ D;  3KXD A;  4L73 A;  1AYE A;  3C6U B;  3DLG B;  1UP1 A;  2KXF A;  4ED1 A;  4ED5 A;  3EZU A;  3UVJ A;  3RAX A;  2L3M A;  1RT5 A;  4O0N A;  3VGU A;  3M1V A;  2L9D A;  2ZM6 F;  4EUV A;  3Q86 A;  2WBM A;  2PMW A;  1KOH A;  2LXI A;  2XEX A;  1JXE A;  3AJD A;  3MAH A;  2HK3 A;  4Q2L A;  1LWF B;  3SQG A;  1NB2 A;  2E66 A;  1Y11 A;  3R5B A;  3Q23 A;  4OZ5 A;  2XS5 A;  1X0P A;  2IIH A;  2W2P P;  4A8S A;  4WII A;  2XMU A;  4MKV A;  3CTR A;  2B9W A;  1FNM A;  2ZKU A;  3MI7 X;  4Q8E A;  4JV2 A;  2ZD1 B;  4MIB A;  4EBC A;  1X5S A;  2DT9 A;  1C1C A;  2MSS A;  1DTQ B;  1RT1 A;  4WZM A;  2W4C A;  3BZQ A;  1FA0 A;  3K59 A;  4F04 B;  4ZKA A;  2MDA A;  4B3T F;  4GKK J;  4KTQ A;  1NH8 A;  4Q0B A;  1MU2 A;  2M52 A;  3GJR B;  2HS3 A;  2BM1 A;  3NGD A;  1VQP S;  1TVR A;  1T9Y A;  1WSR A;  3TR5 A;  1NH7 A;  5KFL A;  2RNE A;  4FNI A;  2HVD A;  3EUN A;  3D0G E;  1GXL A;  4P9S A;  1S6Q B;  2OD4 A;  3PHE A;  4ZIT A;  2LXF A;  2ROP A;  3MEC B;  4G65 A;  2ZH6 A;  5C25 A;  3OPK A;  3PYE A;  1OSD A;  5JXS A;  3CB4 A;  2K06 A;  4FF2 A;  4RBT A;  4KHP J;  1IQT A;  3H5U A;  4IFY B;  3DRS B;  4I68 A;  3VGS A;  1H74 A;  1KHW A;  1WEY A;  4F3Q A;  2VG5 A;  4X64 F;  3CJS A;  1OO0 B;  4HHJ A;  2V0N A;  2ZOM A;  4QIE A;  1NCL A;  3POT A;  2EFO A;  4P2F A;  4EYI B;  1XMQ F;  2HFS A;  4O44 A;  3ZZT A;  1ZZN A;  2IC3 B;  2DNL A;  2MLX A;  5DG7 A;  3CSK A;  5G0R A;  1HFE L;  4HTI A;  1GEH A;  2KXH A;  3OTO F;  1IM6 A;  2DNN A;  1UTA A;  3CDB A;  1QSS A;  4UUX A;  4B3M J;  2VFR A;  1VJQ A;  2F8H A;  1HNX J;  2DGQ A;  1S7H A;  4KH0 B;  4QWB A;  2DPI A;  1HW8 A;  1RHR B;  1T95 A;  2D1C A;  1VRT B;  2DIT A;  2WB1 D;  2KT2 A;  3OL8 A;  2E5H A;  2OPQ B;  4DHV A;  2JLG A;  4K4Y A;  1WF1 A;  1KLM A;  4L3K A;  4DPY A;  3R2C J;  1RHM B;  1WC6 A;  3HFZ B;  4IFV A;  3WHI A;  5BXI A;  5KT3 A;  1NPP A;  3FSI A;  2O1P A;  4DR1 J;  1IR2 A;  1OMS A;  3VVU A;  1LFW A;  1U1Q A;  1RAD B;  2IAJ B;  3I55 S;  1S9E B;  2BOP A;  1UVN A;  2B0G A;  1B70 B;  4CLK A;  3DGP B;  5IWA F;  2CNK B;  2JFK A;  2QO3 A;  3H5S A;  1T11 A;  2LEP A;  2F65 A;  3PJW A;  4QIF A;  3TX8 A;  2CPI A;  1H2V Z;  3H25 A;  4LRA A;  4GC6 A;  4YY3 F;  3J80 U;  2K3K A;  4WP3 A;  2CPX A;  3JQM A;  3VTI A;  4DL0 C;  1NM2 A;  2JDJ A;  1WWH A;  2ABY A;  2IFX A;  1SH0 A;  2DTJ A;  2OLW A;  5FD1 A;  2W7P A;  3M2V B;  3DLH A;  3GFZ A;  3OFF A;  1PC5 A;  3D3B J;  3SI8 A;  1DBD A;  1KFD A;  2FUG 9;  2R2T A;  2BJ7 A;  3VAH A;  3R9L A;  2OPR B;  2VIH A;  2D3Z A;  4DV5 F;  3BKF A;  2DBB A;  4XAK A;  3BRE A;  2BUN A;  2ZOG A;  2DNO A;  1FE4 A;  4IH5 A;  5B7W A;  3H8Y A;  1N48 A;  4KO0 B;  4C8K A;  3QFH A;  1JLF B;  2D41 A;  3UDV A;  4M5I A;  9RUB A;  2V4R A;  1XR5 A;  1JJ4 A;  2A2C A;  3UR3 C;  1RP5 A;  5L1K A;  1XR7 A;  2I2Y A;  3FJ2 A;  3PW5 A;  2V68 A;  5BYR A;  3I0S B;  1SC4 B;  1DTT A;  2AJ1 A;  5D0H A;  4RLE A;  1WG5 A;  1FJE B;  3RR8 A;  5HSP A;  2IRX A;  5C5J A;  4RW7 B;  3TQE A;  1L3U A;  3KUH A;  1F2G A;  2ZH3 A;  2EVZ A;  5I3U B;  5DGB A;  3EJM A;  2DGT A;  2CUY A;  2U1A A;  5CA5 A;  2ZM6 J;  1U47 A;  3NEK A;  2VG7 A;  4JI2 J;  1C0T B;  2PEB A;  5KFZ A;  4K2X A;  3BN7 A;  3JTO A;  3OFG A;  3EXY A;  4JI7 F;  1KVK A;  2OKQ A;  2DJW A;  2HG4 A;  3VAG A;  1NJI T;  1Y5L B;  1TL7 B;  1I1G A;  3OTD A;  3K5L A;  5ETQ A;  2X3D A;  3G8S A;  1O6X A;  2BMB A;  3D0I E;  1DQA A;  3G8Q A;  1ZH5 A;  1BHN A;  1WOO A;  2W9C B;  3PO5 A;  2M7S A;  1NSK L;  2CQC A;  1KBR A;  4N8N A;  1CEZ A;  2B43 A;  1VRU B;  2ZBC A;  4ZVT B;  3D1O A;  3VAL A;  2HSE B;  2Q6C A;  4ECX A;  4OZ3 A;  4KJI A;  4KHM A;  5J2N B;  3UDL A;  4F4Z A;  2AJF E;  2EC0 A;  1WG4 A;  4LFA J;  3Q8P B;  3MD3 A;  9ATC B;  2V8D A;  1HYS A;  1YHQ S;  2EK6 A;  4ICL B;  3KLG A;  2X1G A;  1XMO F;  1TK8 A;  2JX2 A;  4QOT A;  2WAQ D;  2G13 A;  1YI2 S;  3KJQ B;  3OUY B;  2NPF A;  3OJS A;  2XSF A;  3DMJ B;  5ITH A;  3FDS A;  3ISZ A;  1MML A;  1FER A;  4MK9 A;  4ZPA A;  2ROE A;  4B17 A;  4WTO B;  4JYA F;  3P5T L;  1NDP A;  3D7S B;  3MEG B;  5F41 A;  4X62 J;  2K8G A;  4JI3 F;  5L1I A;  8AT1 B;  1RT7 B;  4DV3 F;  3NG8 A;  3HK2 A;  2F8M A;  4XPE A;  2H51 B;  1U1N A;  2UU9 F;  2V2Q A;  1WAC A;  3I5B A;  2CXE A;  3CDA A;  2AYM A;  2B8Q A;  2B56 A;  2DGX A;  3E2E A;  2WOM B;  2APO A;  1PC4 A;  2BJ8 A;  5J1N A;  5BYQ A;  1PYT A;  2XCA A;  2Z57 B;  3NWG A;  4PXC A;  5GME A;  5KFO A;  2LU1 A;  1DHM A;  3W1Y C;  2RU3 A;  2XYP B;  2Y0S D;  3QLH B;  1HNV B;  1P9Q C;  2E7W A;  2NS1 B;  2RML A;  1HD0 A;  3VAM A;  1VLO A;  1EX8 A;  3NNH A;  3OXG A;  5EDW A;  1DLO B;  3CUN A;  4ZOS A;  4ANC A;  3DLB A;  4UY8 T;  1U0H B;  1T9V A;  3NGT A;  5A8W A;  5KTQ A;  1TL1 B;  1N52 B;  3V6K A;  3PCO B;  2NCK L;  5KFH A;  1V6H A;  4KFB B;  3MAA A;  4GMK A;  4UQT A;  1NK0 A;  3PEJ A;  3TVZ A;  3HVT A;  4ED0 A;  5I4M A;  1RT6 B;  2RKI B;  4DQS A;  2ALZ A;  3QIP A;  5LL6 d;  4FBT A;  1R6V A;  4ZVQ B;  4AXI A;  1HI0 P;  3QO9 A;  2RRB A;  3EM1 A;  2CQ0 A;  4LR7 A;  3Q89 A;  3V6J A;  8ATC B;  2IPO B;  2LKZ A;  2B4P A;  3BF4 A;  1HWJ A;  4WP8 A;  2VH7 A;  4HAC B;  5CQG A;  3KJF B;  4OIX A;  1T05 A;  2P9G A;  3RRG A;  1FX4 A;  1OYD A;  4KSE B;  3N79 A;  4KO0 A;  5ETT A;  3G9C A;  1ITP A;  2B8P A;  3UNY A;  3V81 B;  4AXJ A;  2RS8 A;  2V2Z A;  3EDQ B;  4QW9 A;  4DQR A;  2V6A A;  3LAN A;  2V9W A;  3AD9 C;  5LMU F;  4DV1 F;  3QAT A;  4WFZ A;  3GYN A;  3OD2 A;  2HIY A;  3CDU A;  3DDK A;  4ZHR B;  4JI2 F;  2OIH A;  3OTB A;  3JYT A;  4CLW A;  2R7R A;  4JI8 F;  1WKL A;  2GIQ A;  2ACY A;  1TFW A;  5E3R A;  1NKB A;  2ATL A;  2DNZ A;  2QMU B;  1PJ5 A;  2CPD A;  3T3F A;  1FFG B;  1S1T B;  1S12 A;  1YZ6 A;  2DKO B;  3DOL A;  1U6F A;  2V8H A;  3D66 A;  3ZC4 A;  1YJN S;  2V8V A;  2GVD A;  1IM4 A;  1S4F A;  2NXN A;  2DNY A;  3A8I A;  2J7W A;  1SCJ B;  3L95 X;  1QUV A;  4Y34 A;  4R25 A;  2Q1L A;  4CLS A;  2CQ1 A;  1RBO B;  5K14 B;  2MQQ A;  2R7T A;  2HZC A;  3M32 B;  3TJ8 A;  4PYD A;  1CSJ A;  2N4D A;  3OBI A;  4WXO A;  4RWX A;  5KFD A;  3AB2 B;  4ZDN A;  1IN0 A;  4NXM J;  5HLF B;  3FQK A;  1V5I B;  5J1P A;  1R6Y A;  3W9H A;  3LW5 C;  4HH0 A;  1VHI A;  5D78 A;  2KFN A;  1SXL A;  5LXY A;  5D6G A;  2D3O R;  2V4J A;  1RHJ B;  2GGP B;  2BZ2 A;  5I42 B;  2ASJ A;  3C6U A;  5LSO A;  2HWH A;  5KT7 A;  1QE1 B;  2AEJ A;  3MM8 A;  3DM2 B;  3IN5 A;  1U48 A;  1QM9 A;  5KFV A;  2QFJ A;  2HVI A;  3I32 A;  1RT5 B;  4HDH A;  1X4G A;  5IFM A;  3C66 A;  5GMD A;  2VB6 A;  4PXE A;  3RRH A;  2BE7 D;  3S7R A;  2CPF A;  3GCW P;  2MGZ A;  2VZ9 A;  2DB1 A;  4MFB A;  4DXL A;  2OPP A;  4GVL A;  1TUW A;  1HPZ B;  4RNM A;  3DMJ A;  3SMZ A;  4FF1 A;  2XQC A;  1TKT B;  4YME A;  3E3X A;  1FHT A;  1IWA A;  2FJB B;  3Q8V A;  3W62 A;  1PCA A;  4C8O A;  1RHK B;  1O51 A;  1RAG B;  1FEE A;  2MZQ A;  1H7X A;  3HVW A;  4C3M A;  2BQ3 A;  2O01 C;  1UEU A;  1S48 A;  2KN4 A;  1XNQ J;  1H72 C;  2XMT A;  3UCG A;  2B51 A;  4URG A;  3KUE A;  3KHL A;  5CZV A;  5B09 A;  2IMO A;  4ECS A;  3IO1 A;  3GU0 A;  3F56 A;  1X5T A;  2RUS A;  3PJX A;  2DO0 A;  2C3Y A;  1QUP A;  1C0U B;  1B0P A;  2F9J A;  2WVF A;  3G87 A;  2RB7 A;  5T7L B;  1NDC A;  1S6Q A;  2DGU A;  2HNZ B;  4ZA1 A;  5ETP A;  1W2B R;  3G71 S;  5HAN A;  4B3S F;  4FYY B;  1AUD A;  4ZIV A;  1P9Y A;  2XZD B;  3CJ0 A;  2EFV A;  3K5M A;  1Y5N B;  1FF2 A;  3FBB A;  4BWJ A;  1VIS A;  3BQ1 A;  3J81 Y;  1JLC B;  3FCW A;  4OYB A;  2ZJP Q;  2RQK A;  3I4P A;  4N41 A;  1RWV B;  4KB7 A;  4USU A;  2YNF B;  1K0T A;  1QY7 A;  4DX7 A;  2OFG X;  3POT B;  3WDO A;  2E5L F;  4I1T A;  1UJ4 A;  2IBO A;  4DUY F;  4L75 A;  1AA1 B;  4P73 A;  4DR3 J;  4FVC A;  1MN9 A;  2Y1L B;  2YKQ A;  2ZWP A;  4NA1 A;  3HP6 A;  1QAI A;  3TRG A;  5E41 A;  2XMW A;  4NLP A;  1VQ7 S;  3RAM A;  2AYB A;  2LQ9 A;  5IM0 B;  1D9F A;  2IM2 A;  2GIF A;  1RAA B;  2YKM A;  4FXV A;  1YBT A;  5HBM A;  3Q22 A;  4LFB F;  2EFN A;  2ASL A;  2HZA A;  5C42 A;  3FZ2 A;  2LVW A;  3K89 A;  1R8P A;  4DPW A;  3K5P A;  3MCS A;  4DV4 J;  3MMB A;  3PIP Q;  2A10 A;  4LVO P;  1KWM A;  2UUA F;  3HKW A;  4HAC A;  2IBK A;  2MY7 A;  5K8O A;  4IR1 A;  1LWC A;  2QIF A;  3SYZ A;  4I56 A;  5CZX A;  3BBC A;  2V8G A;  3WBZ A;  1IBK J;  2QLW A;  4LF4 J;  2Q3P A;  5HJY A;  4JI8 J;  4WFY A;  3CGI A;  1RWX B;  1U1R A;  1UFK A;  1F60 B;  1YGY A;  3GJQ B;  3R5A A;  4O4R A;  3T41 A;  5CYM B;  4LSN B;  5KOW A;  3D0H E;  2B9E A;  3P3D A;  5E3Q A;  4M5N A;  3T9Z A;  2J0Q D;  4RNH A;  1WG1 A;  3JB9 k;  1UWB B;  2Y1R I;  1P6T A;  2HHV A;  2YWE A;  3IBC B;  2H4Y B;  1ZOT A;  5HRO A;  1HNW J;  1NU4 A;  1DTQ A;  1RT1 B;  2UV8 A;  4ZVU B;  2PO4 A;  4PKD B;  3ZZZ A;  4ED6 A;  3RB6 A;  1QAY A;  2KRB A;  5IV3 A;  2KJV A;  3VR1 A;  4YP3 A;  3DXS X;  1NKE A;  2OPR A;  4C97 A;  1ZAX A;  1UKU A;  2P9C A;  1T0T V;  2HS0 A;  3CD7 A;  4G6V B;  4OLP A;  4OX6 A;  2QX0 A;  2ZUG A;  1FKO B;  4AL6 A;  2XZT B;  5D0E A;  4MMO A;  5KFT A;  2XYH B;  1NLK L;  2Q79 A;  2I1R A;  2EBE A;  1FJ7 A;  3V5R A;  2IVF B;  4F8R A;  3W60 A;  4LQ3 A;  1SUQ A;  3DYA A;  1SB6 A;  3KFW X;  1FD2 A;  3CJQ A;  4A8F A;  1RHU B;  1RUS A;  4LVN P;  2KHC A;  2XMM A;  1FDD A;  2B9Y A;  2KKH A;  2V4J B;  1X4A A;  3L7P A;  4N8O A;  4XK8 C;  3TAM A;  1PO6 A;  3DRX A;  5DG9 A;  1N36 J;  1MW7 A;  1YLX A;  2VFS A;  3GE9 A;  2RDJ A;  4KPY A;  3P49 B;  2CWX A;  3DM2 A;  3M2U B;  4YDX A;  1LNQ A;  2IDL A;  4WZQ A;  4HEA 9;  2AMC B;  2DIS A;  3BR8 A;  2EW9 A;  2GQC A;  4NZ0 A;  1JMT A;  2DY9 A;  2HAI A;  2LDY A;  2KG0 A;  4FXD A;  1H7W A;  2E29 A;  4MKA A;  1MMD A;  1NSQ A;  1S1W A;  1C4A A;  2OAU A;  1AB8 A;  4G1P A;  1Y3K A;  2ZOF A;  5HN0 A;  2ZFH A;  2OHD A;  2OPP B;  4X65 J;  3GIM A;  2W4D A;  2BAC A;  3PRB A;  1UZH A;  4WIQ A;  2V67 A;  3AXM A;  3NS5 A;  4WK1 A;  3RRK A;  2DRD A;  2POK A;  4R8U A;  4U7U D;  2QTW A;  1M5P C;  3DC2 A;  1UVL A;  5KFQ A;  4JI4 J;  2FTR A;  4Y6I A;  4HDG A;  1R89 A;  2CNL B;  2RQM A;  1J5O A;  4XTT A;  3CD6 S;  2CG8 A;  1X0F A;  1WKJ A;  2LLZ A;  4ZK7 M;  3OSN A;  2BJ9 A;  4TYB A;  4FF4 A;  1EAY C;  1X4H A;  1HBM A;  1JK9 B;  1TKX A;  3AOD A;  2YWF A;  4NLG A;  3J7A 1;  3HKZ D;  2BE2 B;  3D5M A;  1H38 A;  3Q2T C;  5AJ3 F;  5H9F K;  3NRB A;  3HX9 A;  4J9P A;  3KLE A;  1FKP B;  1U02 A;  2ACM A;  4OYO A;  5K20 B;  4CLF A;  1ZZF A;  1NDK A;  3EPG A;  3IA0 A;  4A8X A;  4X4S A;  3F0N A;  4NE9 C;  2ADB A;  1K47 A;  3MGJ A;  1OPZ A;  4FS1 A;  4OL8 A;  1W2I A;  2YY3 A;  5FLX Y;  3GQC A;  2W2N P;  5DLF A;  3OTO J;  3RAQ A;  1JLC A;  1CJV A;  3SZ2 A;  2R7V A;  2E44 A;  2JEJ A;  2DH9 A;  4UST A;  5EN1 A;  2DD8 S;  4LFB J;  3ZFV A;  4KKO B;  3PZP A;  4CO3 A;  3X1L B;  4X4Q A;  4UZC A;  2QRR A;  4I6Y A;  3T1Y F;  3MM9 B;  4I2Q B;  4OI0 A;  3OR1 B;  3HVA A;  1S1V B;  3M6W A;  3OL9 A;  4AD6 A;  2OPS A;  4DV7 J;  2IYI A;  4OYA A;  5KFK A;  3EPI A;  1QJH A;  2LEB A;  3RGI A;  4Y2I A;  2UUA J;  1RTZ A;  4EO8 A;  5B0A A;  3ULH A;  1U49 A;  1Y5I B;  2R7S A;  1REV B;  2ZNZ A;  1RTI B;  2GML A;  3R3T A;  4XPC A;  4DF4 A;  4J9L A;  4C48 A;  2BXJ A;  3KK2 A;  2V2V A;  3A8E A;  3KK1 B;  2J0S D;  3QLH A;  4RWW A;  3T1A A;  2X7I A;  4PWU A;  4Y2C A;  1SL0 A;  3DOM B;  1IKY B;  5L39 A;  1CJU B;  3BKT A;  3C15 B;  4HHH A;  5CYQ B;  2ZJR Q;  4M5L A;  1U1P A;  2VOO A;  2R7X A;  1H2U X;  2YPZ A;  2RQ4 A;  2C2E A;  2Y9H A;  2LDI A;  4URQ U;  3OT9 A;  1S76 D;  3R2D J;  2ZH1 A;  5DG8 A;  3KKF A;  4ILL A;  3MFI A;  1H3D A;  5CHC B;  4OHW A;  1U1L A;  2KU7 A;  3GB0 A;  3W3S A;  2JC1 A;  3D2W A;  2I38 A;  2MJU A;  4GO5 X;  3Q8U A;  2LQB A;  4DLG A;  4LF6 J;  4K4S A;  4B9M A;  2YNG A;  1XC9 A;  3QWU A;  2CJQ A;  2DNP A;  2GQ2 A;  4LBI A;  4CO1 A;  3V4I B;  5EX0 A;  1VQ6 S;  2FJW A;  2VBX A;  3CCT A;  4QIV A;  1UMJ A;  2C2Z B;  3ITH B;  1XNR F;  3I6P A;  4ALZ A;  2LQJ A;  2ZE2 A;  3DCA A;  2CQ3 A;  4LR9 A;  5J2P A;  2RE1 A;  3PHT A;  3QRQ A;  1CC8 A;  1JLG A;  1QDU B;  5DQH A;  3ZO7 A;  4JI1 F;  3Q24 A;  3EGN A;  4NLD A;  4D3H A;  3GZ7 A;  3V6D A;  3TYT A;  2RRA A;  1LKZ A;  4DSJ A;  4C4W A;  4Q8F A;  1GXT A;  2U2F A;  4DV2 J;  1LFP A;  1WC0 A;  5H9E K;  2VBW A;  3KYL A;  4U96 A;  3Q0A A;  3MMA B;  4K4W A;  3GFH A;  1IXK A;  1YJR A;  1NRK A;  4PWW A;  4RPF A;  5HO4 A;  3OUY A;  4TXS A;  5DDR C;  3KLI A;  1C1C B;  3I31 A;  5FDL B;  4A8M P;  4MK7 A;  4O3S A;  4QZV B;  2AF6 A;  2LXU A;  1FTR A;  1BE4 A;  1R8H A;  3NKY A;  4K8R A;  3CJ3 A;  4C8N A;  2AJ4 A;  1HBN B;  1UW9 A;  3KLV A;  3M05 A;  2MB0 B;  3MCN A;  2MYF A;  3MD1 A;  2GZO A;  1PYO B;  1UVM A;  3K17 A;  4JI0 F;  4FDF A;  1D0E A;  3EDR B;  4LBP A;  2YQ3 A;  1KON A;  3IGN A;  1C1B B;  3THT A;  1YIJ S;  3PIO Q;  1IR0 A;  2WVD A;  1X5P A;  5HLF A;  4DMZ A;  2AEF A;  1VMB A;  2WW8 A;  1N0U A;  2RU9 A;  3RBX A;  3EMT A;  4W92 B;  1Q8B A;  5L1L A;  1KKH A;  1NZA A;  4DPX A;  4YY3 J;  4RU2 A;  1K44 A;  2Q6B A;  3RJM B;  2ZWO A;  5EWF A;  3PX6 A;  1SJ4 P;  1B64 A;  5EUH A;  5KG5 A;  4J9R A;  1SL1 A;  2YQ1 A;  2N3O A;  5D15 A;  1JJH A;  1MG7 A;  1FKP A;  5DS7 A;  3VGV A;  2E1A A;  1J5E J;  4YR0 A;  2DPJ A;  2W7O A;  3CJK B;  3KMQ A;  4NRU A;  1WUU A;  1HNZ J;  3QIP B;  2MGZ B;  3BM7 A;  4CZC A;  5IC4 B;  3VQS A;  4C6A A;  1ZAV A;  1VQ4 S;  3VAK A;  4URS A;  2HND A;  2H65 B;  4K59 A;  5H1S V;  1DY3 A;  4BWM A;  4LF9 J;  3VVT A;  2WVB A;  2XWX A;  3IG1 A;  5A6P A;  1HQU A;  2XNR A;  1X7V A;  3M8S A;  5A8R B;  2XC9 A;  2WW4 A;  3BJY A;  2RUG A;  4KIA A;  1T05 B;  3P4U B;  1S99 A;  2OMO A;  1U0S A;  4C98 A;  3CDW A;  4XO0 A;  3R8Y A;  1S9E A;  2LA4 A;  5HVF A;  2R8G A;  2NSC A;  3GON A;  2QL7 B;  4ZHR A;  2HZV A;  2O3D A;  5LSL A;  1Q1K A;  3QGI A;  2JEF A;  3KWM A;  4ZLL A;  3OW2 R;  5E5N A;  3QYY A;  1WTF A;  2GHV C;  2ZVI A;  1GXU A;  2YNH A;  5KFX A;  1T3N A;  5L9X A;  2MZS A;  2BOA A;  4XIU A;  2XY5 A;  2F63 A;  1N34 F;  1Q78 A;  2KL8 A;  3S1T A;  1PAU B;  1VR6 A;  1QAJ A;  2HQD A;  1ARO P;  4ID5 A;  5KG3 A;  4LFC J;  4F4K A;  3R5G A;  4EGL A;  3DNC A;  1LOU A;  2CDR B;  1L3V A;  2MZR A;  4HI2 A;  1JLA B;  3VCD A;  4ES2 A;  2KTQ A;  2CJ9 A;  4PXD A;  2KDO A;  1R0A B;  4ELT A;  4JI0 J;  3MEE A;  1TL3 A;  4H4M A;  1R8B A;  5IM0 A;  2QJ3 A;  1V3R A;  4L76 A;  1CUL B;  1T8E A;  1T7P A;  4NCA A;  3UDC A;  2GHP A;  1N6Q A;  3S8S A;  2HQF A;  1M1H A;  3ITH A;  4RUA A;  2VV5 A;  5G4D A;  2UVR A;  4C9D A;  1VJW A;  2HFZ A;  3DI6 A;  2BAB A;  1JLQ B;  1UW4 A;  3G8T A;  4ZJL A;  4EBD A;  2Y1J A;  4C11 A;  3TZZ A;  5AXK A;  1VC6 A;  4IKA A;  3TQ1 A;  3CCZ A;  2HVE A;  4N7T A;  3C14 B;  4B3O A;  5B0D A;  1VQ5 S;  1GFW B;  2BA9 A;  2DH8 A;  3RBD A;  3HSJ A;  3MTK A;  4KE5 A;  3US5 A;  2K7J A;  3MPD A;  4USM A;  2V4Q A;  4EEY A;  4I67 A;  1DRZ A;  2J9C A;  3DXB A;  3MPV A;  3W9I A;  4K5S A;  3MR3 A;  4CT9 A;  3GIJ A;  2FLO A;  7FD1 A;  3A4T A;  3GII A;  1LK5 A;  3W2W A;  1Z4U A;  3IGV A;  1N33 F;  3L3C A;  4DBQ A;  3OVB A;  2KVI A;  1NK4 A;  2VOP A;  1M0S A;  3RTV A;  2N82 B;  3BDP A;  1ZA1 B;  4X2B A;  4OX9 J;  2HNY B;  3BS9 A;  3U7J A;  5K8M A;  4KGK A;  1KEK A;  1DZ5 A;  3QJL A;  5K9F A;  3P45 B;  2DNH A;  2QEX S;  2XHC A;  1RAI B;  1PBU A;  2QL5 B;  3N01 A;  3N5F A;  2SXL A;  5HK4 A;  1UCN A;  2F5G A;  4NMX A;  3PY8 A;  3EWG A;  3FC9 A;  2J8S A;  4WBF A;  3UI3 A;  3MR5 A;  4B3R J;  4IOB A;  3M1V B;  1MMN A;  1ZPV A;  1LXJ A;  3SCK E;  4C3K A;  3EGW B;  4LF1 A;  4X64 J;  1YTY A;  2FY1 A;  3D6H B;  5DO2 A;  3VAJ A;  4RO0 A;  3M8P A;  1JKH B;  4W4M A;  4QU6 A;  4R0J A;  1X4C A;  2ZDP A;  3PG9 A;  4DUZ J;  2VL1 A;  1TV6 B;  4OMF G;  3FFI A;  4QBU A;  2OP5 A;  1RSC A;  3MAQ A;  2BBE A;  3MEG A;  1KDN A;  2CPH A;  2LA6 A;  1B99 A;  4PPD A;  3M30 B;  5HJX A;  3K5O A;  4KRW A;  5CH7 B;  2L41 A;  5F8G A;  3PW2 A;  1NK8 A;  2R7Q A;  3ZTO A;  4AUK A;  3M8Q B;  4QJV A;  5KFN A;  2GQQ A;  2XO7 A;  4MKY A;  1F9F A;  2D9O A;  1OS5 A;  1PIE A;  1U2R A;  3KUG A;  1F2H A;  3MM5 A;  4NEY A;  1RT2 B;  3A12 A;  4QR2 A;  1HIY A;  5HMW A;  1FXL A;  2V8P A;  1OYE A;  4O4G A;  4USW A;  5A2Q U;  4YEA A;  1F6T A;  4PG8 A;  1U2C A;  1YJ9 S;  1TUV A;  1A7G E;  3BBF A;  3G82 B;  3P96 A;  2MXY A;  2PA3 A;  4F4W A;  2BR0 A;  2OTJ S;  4A8Y A;  2W8K A;  4TY8 A;  3B4D A;  2P5V A;  5C2G A;  5J2M B;  1VQ9 S;  4FP9 A;  3DRS A;  5C7P A;  2RVJ A;  2HHS A;  4RZR A;  1X5O A;  1UWA A;  1DAR A;  4I7F B;  3JS9 A;  1S9G B;  5GMK a;  2PN6 A;  4G1Q B;  1K73 T;  1WC3 A;  4XDC A;  1LW2 B;  2AHO B;  2A6M A;  2HMI A;  1Z2L A;  2JLF A;  3IR6 B;  3AHP A;  4Y28 C;  4N5S A;  2BE2 A;  3MUM P;  1KQS R;  4WJB A;  4B3S J;  3BGF A;  3UD4 P;  4FYW B;  1ACM B;  5G0R B;  2NYI A;  1BMQ B;  4P72 A;  4ZVP B;  3LP1 A;  4F67 A;  2MKK A;  2GC8 A;  3H5X A;  1XK8 A;  3BB5 A;  4O3Q A;  4PQU A;  3FQL A;  4K4U A;  4CLL A;  1RT6 A;  1WDD A;  2CJY B;  3BSA A;  3QO9 B;  1N5V A;  3JAM U;  2VPY B;  4Q45 A;  4K4Z A;  2OEL A;  5E7O B;  3LOU A;  4PXB A;  1I5O B;  2E7X A;  5H9F J;  2UXC F;  2RD5 C;  1WI8 A;  1X4E A;  2Q66 A;  1O0P A;  5JUM A;  5ETO A;  3CVK A;  1URR A;  3SFG A;  1HHS A;  4NCG B;  4IH7 A;  5DET A;  4DSL A;  4J7C A;  4ZIW A;  3GYG A;  5DDO C;  2KO1 A;  2FYX A;  1IJE B;  4DL4 A;  3DGP A;  1NDL A;  2VFV A;  2OPS B;  4QYR A;  1OQ6 A;  1RCX B;  3LF0 A;  3IR7 B;  3LPE A;  3IWN C;  3JYT B;  1FWK A;  1TP7 A;  2MQO A;  4CNY A;  2DGO A;  1JXL A;  1KFS A;  4F2S A;  4FXW A;  1IVZ A;  1YX2 A;  1PJ7 A;  2QV6 A;  3H2V E;  1RDR A;  2D3O 1;  3NS6 A;  4EU0 A;  3HSZ A;  2UXD F;  1H2T Z;  4DL7 A;  2XZW A;  3UCU P;  3LUY A;  4ED7 A;  4ZPV R;  1RJJ A;  3M2V A;  2CZV C;  2D74 B;  3R97 A;  1U6B A;  1FD8 A;  3T5H A;  3KNG A;  2FDN A;  3W5X A;  3H5Y A;  2KXN B;  4B3O B;  2HQ3 A;  1S10 A;  4PPZ A;  1OSC A;  5SZT A;  4KGX B;  1S1T A;  5KFS A;  2F3J A;  1TVR B;  2VQE J;  1TR0 A;  4ZP6 A;  2J9D A;  1FVQ A;  1OY9 A;  3GIR A;  4AE5 A;  4K4T A;  1GX6 A;  1JLB A;  2J6T A;  4DV7 F;  2LFV A;  1WC1 A;  4IDK B;  4FYV B;  1OQ3 A;  1HWU A;  2FGO A;  2MMY A;  2AV5 A;  3I0R B;  4P10 A;  4ZPC A;  3KNA A;  1U09 A;  1ZBT A;  5LMN F;  5KFM A;  1HQ2 A;  2KYZ A;  2VG5 B;  1J5O B;  4EBE A;  1ZTT A;  1KC8 T;  3N6L A;  2QA4 S;  3J7A N;  4NLX A;  1RWM B;  4O44 B;  1F5A A;  3M7V A;  4LF5 J;  1FJG J;  1X9M A;  3MM7 A;  1IBL F;  1ICE B;  4A4J A;  2XSJ B;  1S1U B;  4IG3 B;  1TU0 B;  2VFT A;  4ED3 A;  2F4V F;  1RBL A;  5EX3 A;  2W2O P;  1X9S A;  1N5Y A;  4A48 A;  2VBY A;  2B4O A;  2E5I A;  2EKN A;  3D3C J;  4RW9 A;  4YUD A;  2CNO B;  1SQG A;  3MPU B;  2DGV A;  2N7Y A;  4M63 A;  3FRY A;  2MZ1 A;  5CAA A;  3MMA A;  2W2M P;  2HQG A;  4ED4 A;  4CLU A;  3RZA A;  2ASD A;  1JXV A;  1HPZ A;  2R8H A;  3FFI B;  4WYL A;  1AZS A;  5E2Q A;  3K57 A;  3DRR B;  3EZ5 A;  4ZMM A;  1HKA A;  4J91 A;  5HAT A;  3KK3 A;  2FQQ B;  2FC8 A;  2BQR A;  2OSR A;  5L8R C;  3G96 A;  3CCE S;  3CE8 A;  3W64 A;  4YHH J;  2LQ5 A;  3G6V A;  3TO8 A;  2VHG A;  5KG1 A;  3LAM A;  4RNF A;  5F9N A;  4RX6 A;  4K2J A;  2WSC C;  1S1V A;  6FDR A;  3BGU A;  3B8H A;  3ZTQ A;  2XI3 A;  1Y9O A;  2CDQ A;  1FKA F;  2W01 A;  1C0U A;  1UZD A;  5T7L A;  3SCJ E;  2ATC B;  5IV4 A;  1V3S A;  1EP4 B;  2J7U A;  2YPY A;  2XM3 A;  1L3S A;  1X4D A;  3KJN B;  1QLN A;  1CPZ A;  1YK9 A;  2HRU A;  4DPU A;  5LMU J;  3FZB A;  3G6Y A;  3N4W A;  1FI4 A;  3TNV A;  1RAF B;  2E1M C;  2HNZ A;  3UDE A;  4CWB A;  2Y1I A;  2L08 A;  4QWE A;  3CME S;  3UFC X;  2HHT A;  2IY5 B;  1NB7 A;  2FLN A;  2A0F B;  4M5D A;  2HPU A;  2YNF A;  2OH2 A;  1DQ9 A;  3W7B A;  3UD3 P;  3C15 A;  1HWI A;  1RHQ B;  3VGT A;  4NA3 A;  3Q8S B;  2G4B A;  2MKJ A;  4FVM A;  5DZ6 A;  1N56 A;  1MNE A;  4QR0 A;  3C8Y A;  4OYI A;  2MQN A;  4HT5 A;  4DL2 A;  2KT5 A;  3SSQ A;  2PEH A;  1WSV A;  5CYJ A;  2GAG C;  2N4C A;  1N32 F;  1BLU A;  1Q7L B;  2FVP A;  5C42 B;  1DTT B;  2YNG B;  1D9A A;  1S57 A;  2HUR A;  4OQJ A;  1E6Y B;  4O23 A;  4OJG A;  3EZO A;  4RW7 A;  3IC1 A;  4WPA A;  5KT5 A;  2JL9 A;  1GK8 A;  3D1H A;  3IP0 A;  1RU1 A;  3NNC A;  4JB8 B;  2RSQ A;  3AD7 C;  3MDF A;  1SIZ A;  3JSB A;  4UOF A;  4N47 A;  5LMN J;  3QGG A;  3HZE A;  5L38 A;  5HQL A;  4B08 A;  3OL6 A;  1JNZ B;  2G2Y A;  5B0B A;  1WTB A;  3PNI A;  2CJK A;  4WP9 A;  1RWU A;  4J9Q A;  3T5J A;  1NUE A;  1T94 A;  2NQP A;  1P8G A;  3EGZ A;  4P71 A;  2CA9 A;  2MZT A;  4DX5 A;  4X66 F;  4OZ0 A;  2DNR A;  4ZP8 A;  5HAO A;  5HP1 B;  3D1Q A;  2J9E A;  5MLC V;  2AJ0 A;  2FC9 A;  4MIW A;  5GVQ A;  4U6P A;  2RQC A;  1QSL A;  2VPW B;  4OHV A;  3PVX A;  1MWZ A;  4WFB Q;  3Q8R B;  4NLQ A;  4P52 A;  3TEH B;  2BJ3 A;  4AQY J;  3RB3 A;  4USV A;  3EVM A;  4CYU B;  2QYG A;  3VWS A;  3M9M B;  4XDD A;  5JMN A;  3EE3 A;  4ZS6 A;  3RYL A;  2VFU A;  4DF8 A;  1FWP A;  2VQF F;  3J80 Y;  2PII A;  5L9N A;  4NCB A;  1HL6 A;  2LU2 A;  2ZVS A;  4I6A A;  3W8P A;  5F8H A;  3RB4 A;  3TVY A;  1HLW A;  4BCA A;  1G4C A;  2XCP A;  4OHX A;  2G1D A;  1XNR J;  3ELH A;  2CQG A;  1T03 A;  3OTC A;  2W24 A;  2ZBQ A;  4GO7 X;  1ZAW A;  3LP2 B;  2FZK B;  2AGQ A;  2VON A;  5T14 A;  4AND A;  3DRP B;  1VQY A;  1RWP B;  1GMW D;  2G2O A;  1S59 A;  1TL4 A;  4DL5 A;  2GO9 A;  1SIW B;  2BW2 A;  1U24 A;  2BAN A;  3N6N A;  1VC5 A;  1L3K A;  1YRT A;  3ONQ A;  1LK7 A;  4FKY A;  3IMQ J;  2FB0 A;  4ECQ A;  2AGP A;  1IBL J;  2CZ4 A;  3E01 B;  4E8U A;  1SV5 B;  2H4W B;  2ZC4 A;  4OFZ A;  1JX4 A;  2IRY A;  1RTD A;  4W90 B;  1YJ7 A;  3M2U A;  3D6F B;  3F41 A;  3HF5 A;  2AZ3 A;  3R5D A;  5T41 A;  1NPK A;  3D54 A;  2BM0 A;  4M5H A;  4DV5 J;  4IRK A;  2BV3 A;  1NJZ A;  2VDI A;  3QWP A;  2VKR A;  4MT1 A;  2QMX A;  3DDI A;  3J81 j;  2QA2 A;  2JC0 A;  3PDN A;  1W26 A;  2QZ8 A;  2CYY A;  1HMV B;  4Y65 A;  5AT1 B;  4QR1 A;  3D4J A;  4DCJ B;  5IT0 A;  2XGP A;  3KJV B;  1DJ0 A;  3EXC X;  3BGO P;  5LOQ A;  2EFP A;  3TAP A;  3WX8 A;  5LM7 E;  3DRR A;  3FUY A;  4ZVG A;  1VLY A;  4ECV A;  1HNV A;  2RS2 A;  1S0V A;  4QU7 A;  3QGH A;  1ZA2 B;  5CXT A;  2ILY A;  2YX1 A;  2B4V A;  1S9F A;  1VQS A;  1L5U A;  4DCO B;  4UOG A;  3THP A;  3HD2 A;  1W7W A;  4UOH A;  3FCV A;  3I87 A;  4KHP F;  4DV2 F;  1RAE B;  4C8L A;  1KN6 A;  3D6M B;  3GR1 A;  2PE8 A;  3HVT B;  1T9T A;  1X4B A;  1KD1 T;  1Q8K A;  1TTH B;  4AFF A;  3C2P A;  1R3N A;  1UET A;  3UR0 A;  3QPI A;  2BJE A;  3CUL A;  4IRD A;  1DUR A;  2B5J B;  1UEV A;  3DGV A;  1KQG B;  2UUC F;  2AKW B;  3HXM A;  3PKM A;  4CLP A;  2CFX A;  4I0W A;  4X4O A;  4N76 A;  3TAQ A;  3RUB L;  1IKW A;  2L9W A;  1B0T A;  3MM6 A;  3EIC A;  5E0O A;  3UWT A;  4ENO A;  5AE1 A;  2IA6 A;  4ZPT R;  2IM0 A;  2KM8 C;  1VQO S;  2IM1 A;  3EGV A;  3M30 A;  1AXQ A;  4I2Q A;  2AIR B;  2EBG A;  4ZLN A;  4CO0 A;  5E33 A;  2QSW A;  2C42 A;  5GAE U;  4LRF A;  3OR1 A;  2LEA A;  4BHQ A;  3PKY A;  1WOR A;  3HZG A;  5HL7 Q;  4DFJ A;  4H4M B;  2R2S A;  1RGV A;  5U47 A;  3FBE A;  5KFB A;  3PO4 A;  2VUG A;  1NND A;  4LF2 A;  2C3U A;  3LWL A;  2P6S A;  3HDS A;  3NOG A;  5HQ8 A;  4Q5V A;  4LF4 F;  1FJC A;  1QVF R;  3P5B P;  4LRB A;  2P2C B;  3I5A A;  1VQK S;  3OLB A;  1FES A;  3OLA A;  1OJ4 A;  1R8C A;  2UP1 A;  3PW7 A;  2C28 A;  2CQ4 A;  2E5G A;  2ZKT A;  3C14 A;  3CC7 S;  3DLK B;  1BQX A;  1WHY A;  2QC3 A;  3CIM A;  1JJC B;  5IT4 A;  2FHO B;  2KI2 A;  4RNO A;  4CIO A;  2QE5 A;  5CCL A;  3P6Y C;  2J8A A;  2R8J A;  2YTC A;  3GSD A;  3KLF A;  1NEE A;  1KOO A;  1BD6 A;  1HNX F;  1N34 J;  1EET A;  3CIZ A;  3W2W B;  4NA2 A;  2YWG A;  2F40 A;  3NGR A;  4OI3 A;  4A46 A;  4EYH B;  3VZH A;  2HWI A;  2M88 A;  3BN4 A;  3GYX B;  1H73 A;  3I0S A;  2NPI A;  1KHV A;  3TUI C;  4NZ7 A;  1N5T A;  2DXE A;  3D67 A;  5L1J A;  3MMB B;  4ZP7 A;  4MK8 A;  4OI4 A;  4NWB A;  3CD0 A;  3BV8 A;  2HLT A;  4USJ C;  4DN0 A;  5IZH A;  4DQP A;  1JLE A;  2X1B A;  2WON B;  1RKJ A;  3ILI A;  3L9Z A;  4NCG A;  4OYX A;  4I4B A;  5LJ3 Y;  1OY6 A;  3KG4 A;  5J2N A;  2ZBP A;  2ZHO A;  3NS7 B;  1LWX A;  1RKI A;  1WHW A;  4HT7 A;  3TAR A;  1U45 A;  1QVG R;  2DGS A;  4OJH A;  1F3V A;  1SC3 B;  2RDD A;  3A3P B;  3DRP A;  2H54 B;  4ZVR B;  2ZH2 A;  2VA3 A;  4MFB B;  2HFO A;  3BSO A;  1GH8 A;  2BAN B;  1RAO A;  5IT9 Y;  4WU3 A;  4O3O A;  3HSD A;  3ILO A;  2DY1 A;  1M5K C;  3BR9 A;  3C16 B;  3T5K A;  1IKV B;  3NGS A;  5KFC A;  3MWB A;  5J2Q A;  4Y3C A;  1UJ6 A;  3MHY A;  1MWY A;  3SV4 A;  4NI2 B;  4MAK A;  4WK3 A;  3N9U C;  1FWL A;  2DH7 A;  4FNH A;  4KYZ A;  3M9O B;  3TZW A;  2J9D E;  4DOZ A;  3OXL A;  5LT5 A;  2UZA A;  5M2P A;  3S01 A;  2HRY A;  5ETN A;  4ECZ A;  1CQN A;  2CVI A;  1FKO A;  4ZPD A;  1U1M A;  1XMB A;  1RTH A;  1RE1 B;  3GPA A;  3NMA A;  2QN6 B;  2F7V A;  1NJW A;  1HYS B;  2CRL A;  2YXL A;  1RT3 A;  4HH1 A;  4QYZ K;  2MST A;  2XLK A;  1RK8 A;  4B3R F;  1VIO A;  3NCR A;  4DV4 F;  4P2S A;  4X4N A;  4DFP A;  5D0R A;  4FN5 A;  4GRS A;  2DHX A;  4DN9 A;  1C2P A;  5AJ3 J;  4PEO A;  3UN3 A;  2DRA A;  3AOC A;  4F4Y A;  5F8I A;  4JV0 A;  3CMA S;  4DSE A;  3T5L A;  2HMI B;  3ENQ A;  1WHV A;  4DSK A;  2PMZ D;  1KTQ A;  1GAO A;  3W65 A;  4HI1 A;  2BRK A;  2F4F A;  4OZL A;  4P74 A;  2YKN B;  4ZCI A;  6FD1 A;  3J7Y I;  3F73 A;  3LP1 B;  1CBK A;  5ETM A;  3UQS A;  1U26 A;  5GAG I;  4DV3 J;  2XUL A;  2RF2 A;  4JI6 F;  4TLQ A;  2HND B;  1RU2 A;  3TVK A;  2E9Z A;  2HHW A;  4P75 A;  4OZN A;  2CPE A;  4DPO A;  2AW0 A;  3E8O A;  1IKW B;  1IR1 A;  5HVH A;  4J9M A;  3W9J A;  3U02 A;  5IXU A;  4EZ9 A;  4ZCK A;  4ZJQ A;  4YOE A;  3N6M A;  5A8R A;  1K1Q A;  3KK3 B;  4WXW A;  2Z58 B;  1RZM A;  3O6Q A;  4DQI A;  4CCH A;  1RAB B;  3DN9 A;  4ZJO A;  1JB0 C;  2XMJ A;  3QMQ A;  4AT1 B;  4AYB D;  1S1X A;  3OHB A;  3M2R A;  4JBC A;  2PI5 A;  5L46 A;  3NAI A;  3MPW A;  5LXR A;  2IRU A;  2D69 A;  4USH A;  3LAL A;  1EP4 A;  4OYP A;  3QQC D;  2DR8 A;  4IR9 A;  2WK4 A;  2ZZN A;  5IOL A;  1F0X A;  2RKI A;  3LGN A;  4HHU A;  3FBF A;  1YIT S;  4X84 A;  2O66 A;  2X51 A;  4F0K A;  1Q81 T;  4F2R A;  2HBZ B;  4UY8 5;  4JOU A;  1FT8 A;  5IC6 B;  4ZLJ A;  3I82 A;  2CQP A;  5J1E A;  4DR2 F;  2AX1 A;  4C8M A;  2ASY A;  1RT4 A;  2BKP A;  4LF6 F;  3QRP A;  4I2P B;  2M9K A;  5D3G A;  1NSA A;  2AX0 A;  2EWH A;  3DOK A;  3DLK A;  1RCO B;  1V3Z A;  3SCI E;  2XBP A;  5KT4 A;  3J7Z 5;  4DFK A;  1A9N B;  2CVE A;  5E3P A;  1NJY A;  7AT1 B;  3CCR S;  3TUP A;  2C2R A;  1VYA A;  4KT0 C;  1KQK A;  2JRS A;  2DHA A;  4FZV A;  4WE1 B;  1HR0 F;  5AXN A;  4IDK A;  3IAM 9;  4NLV A;  5KG0 A;  4RNN A;  2DCU B;  4ECT A;  3GG0 A;  3IRX B;  1BC6 A;  3MZI A;  3HT3 A;  2GMH A;  1REV A;  3NWR A;  1HA1 A;  2NXE A;  3MMJ A;  3A1Y G;  3MOZ A;  4J90 A;  3T19 A;  4RUC A;  1G1X A;  2B7B B;  3H98 A;  3KK2 B;  4PG6 A;  1R31 A;  4DR5 F;  3FCH A;  3R1L A;  2E1R A;  2DIV A;  4C11 B;  2BDP A;  1YJV A;  4OYZ A;  3DI6 B;  3JAM Y;  3HSG A;  1CJU A;  3H4B A;  3UVJ B;  2AYE A;  4OX7 A;  3BQ0 A;  2JVO A;  2PT0 A;  2NYH A;  1XMQ J;  3H20 A;  3N0V A;  4ZN3 A;  4CLT A;  2EPI A;  5I3P A;  4HVZ A;  1S6P A;  1M5S A;  3C6T B;  4DU7 A;  1LWF A;  4A8O A;  3HVR A;  1M5V C;  2FZC B;  2GW8 A;  4RJV A;  2Z4P A;  1X31 C;  1EZZ B;  3M6U A;  4P7T A;  3TJ9 A;  2FVR A;  4TU9 A;  3IS9 B;  4PUO B;  3B78 A;  1S72 S;  4IQM A;  2R7O A;  4PWD B;  2J0W A;  1S5Z A;  5HMY A;  3BQ2 A;  2BKN A;  4X4V A;  3I9V 9;  2V69 A;  3ICL A;  3B54 A;  3CWJ A;  4C0B A;  3AQO A;  4Q43 A;  3MUT P;  1SH3 A;  2GGP A;  2J5A A;  4HKQ A;  2A18 A;  3FK4 A;  1VBY A;  1VQM S;  1TKD A;  1QE1 A;  3F44 A;  2LQ8 A;  4C0H A;  2AT1 B;  4J5O A;  5LJ5 Y;  1RTH B;  1RYS A;  1FEH A;  3PRV A;  3SEO A;  2PI4 A;  3OFE A;  1A6L A;  3ISN C;  4M1K A;  2HBR B;  4DFM A;  2XWY A;  3HFK A;  3BO3 A;  1U1K A;  4LSZ B;  3AB4 B;  1B3T A;  1AUS L;  2CZ9 A;  1XTZ A;  4L3N A;  3DLL Q;  2BJ1 A;  2FJD B;  3ZNU A;  5HI7 A;  4MTP A;  5IQ6 A;  2RAQ A;  3O1L A;  2YBV A;  3ENW A;  3GFY A;  2MLZ A;  3MOJ B;  1WF2 A;  4CM0 A;  3KLH A;  3E01 A;  1HBO A;  1SPB P;  1XQI A;  1FE0 A;  4QIG A;  2KG1 A;  3ET6 A;  3HFV A;  1IKX A;  3OVA A;  1IBM J;  1JNR B;  1LWE A;  3TA1 A;  2VQF J;  3MED A;  2IM3 A;  5D4N A;  3MM9 A;  3UCZ P;  3OQ2 A;  3KHR A;  1RQ0 A;  3QFW A;  5F8M A;  3M8Q A;  3ADA C;  1NO8 A;  1H0H B;  1HI8 A;  1UFW A;  3HHL D;  4CI0 B;  3NAH A;  3WC0 A;  1BQM A;  1RIS A;  4LF9 F;  1HMV A;  2XLJ A;  3G82 A;  3W5Y A;  1VRT A;  4UQG A;  5F9L A;  4YHH F;  4TU7 A;  3M4X A;  1HI1 A;  4NLR A;  3SCL E;  5K8N A;  1WEL A;  3G6X A;  2FGC A;  1M1G A;  1SC1 B;  4H4O A;  3BSC A;  2VU5 A;  1SH2 A;  4U7U K;  4NYZ A;  3X3U A;  1IJF B;  1IBC B;  2AGO A;  2PA8 D;  4DR7 F;  4YN3 B;  3WQP A;  3PFO A;  3AD8 C;  3V6H A;  4J9U E;  2IJF A;  5GAH I;  5ETR A;  5CD4 A;  5KG6 A;  2KJW A;  4NX9 A;  2PFF B;  4OJ3 A;  2I0X A;  4ZPW R;  1VQ8 S;  2B7C B;  1X60 A;  1RWN B;  4OLO A;  4CRJ A;  2Z2Y B;  3CF5 Q;  2AU0 A;  2ILZ A;  1MWQ A;  2M5Y A;  1VIX A;  4ELU A;  1D8Z A;  1WNE A;  1U4B A;  1F3F A;  2E9T A;  2C1E B;  3OFH A;  3JSY A;  3CJ8 A;  3HCX A;  2RIJ A;  4LSL B;  4C3L A;  4DUY J;  4UTG A;  4GVB A;  4G1I A;  5HBM B;  3BPS P;  4YR2 A;  1EKR A;  2RT3 A;  2XMA A;  2BKO A;  2H3E B;  1NSP A;  1SKS A;  2CJA A;  4DR4 J;  5KT2 A;  5J2P B;  1EHW A;  3R5C A;  1WI6 A;  3MFH A;  2YNI A;  4L74 A;  3ZZU A;  1R43 A;  3OJU A;  5CCM A;  1HR0 J;  3SDE A;  2BYC A;  1E6V A;  2VDH A;  2WSE C;  3OHA A;  1JJ2 R;  1RTJ B;  3V6D B;  2H5J B;  4DG1 A;  2EFQ A;  1AW0 A;  4OI6 A;  4J9S A;  4BDP A;  1KP6 A;  4QW8 A;  4ZPB A;  1B4S A;  4WF9 Q;  2CQH A;  4JI5 J;  4ID8 A;  4CO5 A;  1Y7P A;  1Q82 T;  4LF8 F;  3CJT A;  4BC9 A;  3KLI B;  3QZ7 A;  4OI2 A;  1HWK A;  2XG8 A;  3MR7 A;  3N5B A;  1XN9 A;  2R2R A;  2K1R B;  1BQN B;  4KC5 A;  1YRU A;  3I96 A;  2DXD A;  4AQY F;  2QL9 B;  2Y8Y A;  3OR2 A;  3BGR A;  4R5P A;  1C0T A;  2W9B B;  1BWV A;  1YVF A;  4LUB A;  3CCU S;  3ZZ0 A;  4DU8 A;  4ID5 B;  1FCA A;  2OEJ A;  4PG4 A;  2ZC3 A;  5ETV A;  4F4A A;  1T9X A;  3QSI A;  4RW8 B;  4J9N A;  2N3L A;  1HD1 A;  1P1L A;  1JLB B;  1BGX T;  1ELO A;  1SJ1 A;  3ZZP A;  3KJV A;  3C3L A;  1NME B;  2VAS A;  5CAB A;  2AZ1 A;  3IWL A;  2YKP A;  2ADC A;  1CUL A;  3H7H B;  4Y00 A;  4C7Q A;  5HQM A;  1PGZ A;  3GIK A;  4RUH A;  4TQR A;  4P6Q A;  1KTV A;  2AJ2 A;  2NXU A;  4L6V 3;  2E1C A;  3QZ8 A;  1M90 T;  1VRU A;  5GAH U;  1JLQ A;  1SJQ A;  1A0O B;  2GJI A;  3TW0 A;  2IDE A;  3DLG A;  3VZI A;  2VC0 A;  1OPI A;  3LGH A;  1N36 F;  5RUB A;  1ZYQ A;  1PKU A;  3LGM A;  3VAI A;  1B7F A;  2V50 A;  2R7W A;  4RW9 B;  4X4R A;  3KLG B;  4UZB A;  5F0W A;  4EI2 A;  4DUZ F;  3T6B A;  4IRC A;  4RW6 A;  4DDF A;  1CVJ A;  1C4C A;  1AZS B;  2XYG B;  3BYP A;  1V5V A;  3JTN A;  2OUG A;  3SSS A;  2FJE B;  2UU9 J;  1FFS B;  3WC2 A;  4QQB A;  3R6G B;  1HBO B;  3UO0 A;  3TI0 A;  3IG1 B;  2CIM A;  4QIW D;  1IKX B;  4TN2 A;  1XWL A;  4TY9 A;  4Z7C A;  3NMR A;  1XBW A;  2DYA A;  2PD1 A;  5A76 A;  4X65 F;  3OTE A;  1PJ6 A;  2VPX B;  2QYC A;  2GX8 A;  3OVS A;  4HYK A;  3GMG A;  2WVE A;  4IO9 Q;  4U8Y A;  3HHL B;  1Q5V A;  1TMJ A;  2H48 B;  5A0Y A;  1BQM B;  4F0H A;  4UOC A;  4ELV A;  4OZ2 A;  4LRE A;  3R7N B;  4DX8 H;  3GTY X;  2VBZ A;  4LQ9 A;  1NK7 A;  4DR7 J;  4OHZ A;  2XY7 A;  4C8Y A;  4DUT A;  4K7Q A;  3D28 A;  5LSR A;  2YNH B;  1YBU A;  2I5J A;  4H4O B;  4QWC A;  3MMC B;  4F4X A;  3HO1 A;  4ZCM A;  3K8V A;  2XS2 A;  4CQ1 A;  4U67 Q;  1APS A;  1D9D A;  2FVQ A;  2CAD A;  3V2U C;  4ZLP A;  3JQJ A;  1SC6 A;  3SFU A;  3MCO A;  1F9H A;  2BRL A;  5KFR A;  5A8K A;  5DZ7 A;  2OI2 A;  2JZ5 A;  3D6T B;  3Q8Y A;  4QWD A;  4ECW A;  4H54 A;  2YH0 A;  1SKW A;  4O3N A;  2UXC J;  2NXJ A;  2BQU A;  1VGY A;  3NOC A;  4DJB A;  3KDO A;  2XY6 A;  2ZZM A;  4RUB A;  1I3O B;  3KLF B;  2MPU A;  5EGY A;  4QPT A;  5BR8 J;  4NAS A;  5B0G A;  2HYI B;  2ZNY A;  4FBU A;  5EHH A;  4DWI A;  4O4G B;  1T3O A;  4QWA A;  4HL9 A;  2ZHA A;  5B0C A;  4CNZ A;  5KFF A;  2G0I A;  2RDI A;  3FVY A;  2HHU A;  1G6B A;  3L4B C;  2OO4 A;  3DLE A;  3L7O A;  1TAU A;  4KBI A;  2R8I A;  2GV1 A;  2OPQ A;  2CWK A;  2DRB A;  1CJT A;  2MHN A;  2JVR A;  1YSJ A;  2O67 A;  3BBB A;  4F0M A;  5DDP C;  1N88 A;  3T1H F;  2YH1 A;  3TJA A;  2ZJQ Q;  1JLE B;  2C2M B;  3PYD A;  2MHE A;  1CG2 A;  2UVW A;  1S9G A;  4P2X A;  3SQO P;  5DM6 Q;  4DV1 J;  3V81 A;  1ZET A;  4WTY A;  2DNG A;  1KLN A;  1R27 B;  3W63 A;  2QLB B;  3NBP B;  3E51 A;  3IAS 9;  3ILJ A;  1Q53 A;  4CTA A;  1CJK B;  2ZBR A;  3NGU A;  1R0C B;  3AA8 A;  5HVG A;  2ZH8 A;  2UV8 G;  4Q7A A;  2CJB A;  3GV5 B;  1YJW S;  4TQS A;  1PYS B;  3EYZ A;  2QMW A;  1UA0 A;  1HNZ F;  2G1H A;  3MEK A;  4RR5 A;  2R42 A;  3U1N A;  2NZ4 A;  2RHQ B;  1VBX A;  4CYU A;  1FDA A;  1UL3 A;  1VBZ A;  4UF4 A;  3PW0 A;  4NXM F;  3QT6 A;  2V2K A;  3C19 A;  4I2P A;  4ED8 A;  1KNZ A;  4V19 J;  1ZM3 A;  1TKZ B;  3NXZ A;  2GVD B;  2C2D A;  3BKU A;  3SV3 A;  2UUB J;  4K0K J;  1LEO A;  4A8Q A;  1QSY A;  2V34 A;  3PAC A;  4NRT A;  1NAQ A;  4ER8 A;  3BH7 B;  1HBU A;  4NYP A;  1O8B A;  1FJG F;  1ULR A;  3HHL C;  3M8P B;  2NR0 A;  4IOA Q;  2JWN A;  3CJ5 A;  1FXD A;  4DV0 F;  1CQM A;  2A3J A;  4BC7 A;  2F4V J;  2JNJ A;  4OHY A;  1SI9 A;  3PX4 A;  2QLF B;  2JOQ A;  1CS4 B;  1GX5 A;  2E1P A;  2GVZ A;  2WBR A;  3CJ4 A;  3NNA A;  3R6L B;  3LP0 A;  2EC2 A;  2DK2 A;  2DHH A;  3MM5 B;  4I6W A;  5M2R A;  2HKE A;  4H4K A;  1S6P B;  4J9O A;  2PDA A;  4NLU A;  3Q8Q B;  3GFX A;  4B9N A;  3CJ2 A;  1RA7 A;  2C3M A;  3ENV A;  3HHK A;  4ETX A;  2IJR A;  5KAK A;  3LTO A;  2X3G A;  3BYR A;  1TL7 A;  3FEZ A;  1VOM A;  2E7V A;  3I0R A;  3FSX A;  2Y3Y A;  4KV8 A;  2FHJ A;  4Z2X A;  1SKU B;  4DV6 J;  4O3P A;  3FNN A;  3GSI A;  3T9N A;  1K9M T;  3RBE A;  2FJX A;  3THV A;  1NKC A;  4DL6 A;  2RH3 A;  4O3R A;  1DFD A;  3TEG A;  2HGL A;  1ZM4 A;  1JQG A;  2HBQ B;  3N28 A;  4S0M A;  4X4P A;  2QFI A;  3MUR P;  2KFY A;  2PGC A;  2DIU A;  2YKA A;  3MM7 B;  2N7C A;  3EVO A;  5A0Y B;  2GAH C;  3H2L A;  1S0O A;  4DR6 J;  4LT6 A;  1XIQ A;  2Z0G A;  4PR6 A;  4K50 A;  2JFD A;  5MAO A;  2EXU A;  3IM9 A;  2VOD A;  4ICL A;  1IWG A;  2KRR A;  4Y2K A;  1U2F A;  1Y4Z B;  2HLU A;  4U8V A;  1S49 A;  1FRH A;  3SSR A;  4K4V A;  4AL7 A;  3U1L A;  3I5C A;  1KRP A;  3HM9 A;  2DR9 A;  1FDN A;  1GT8 A;  3O3L A;  3BDE A;  2AD9 A;  2B5J A;  3IBW A;  7FDR A;  4M5G A;  4DSI A;  3GCX P;  1EQM A;  1UPP A;  2IVY A;  2QT7 A;  5E3A A;  4KGM A;  5KFJ A;  1HNW F;  4B3T J;  4GKK F;  3HI9 A;  2F8E X;  3MM6 B;  3ZTR A;  4B3M F;  3ET6 B;  3O2I A;  2XMV A;  5BR8 F;  1U7L A;  2G2Z A;  4PCQ A;  4PG5 A;  3MUV P;  1N32 J;  2YWH A;  5DM7 Q;  1RLC L;  4E2F B;  3AA9 A;  3A8J A;  2KHD A;  4ECU A;  2L9N A;  1BWE A;  1SQE A;  4USI A;  2IYG A;  4JV5 F;  2V5H G;  2HVH A;  4B9T A;  3NP5 A;  3ZZY A;  2QSF A;  1D8Y A;  3J7Z T;  1LQ9 A;  3JQK A;  1XEZ A;  2F9D A;  4DZ6 A;  1CJT B;  1EIY B;  1N4L A;  3PJ9 A;  2CQ2 A;  1QD1 A;  1WKK A;  2D7S A;  3KOA A;  1FRI A;  5A2Q Y; 
#chains in the Genus database with same CATH homology
 5IWA J;  2KL8 A;  3D3B J;  1HR0 J;  4KY3 A;  4LF4 J;  1IBK J;  4DV1 J;  4JI8 J;  4LFC J;  2HHH J;  3R2D J;  1XMO J;  2UXD J;  4JI0 J;  4JI5 J;  1N34 J;  4LF6 J;  4JI1 J;  2MQ8 A;  4AQY J;  4X66 J;  1HNW J;  2ZM6 J;  4LF8 J;  3T1Y J;  4JI2 J;  1XMQ J;  2UUB J;  4JI3 J;  4K0K J;  1N33 J;  1XNR J;  4LF7 J;  4JV5 J;  4DV2 J;  4RJV A;  4NXM J;  2UXB J;  2KVQ E;  4PWW A;  4JI6 J;  2F4V J;  3IMQ J;  3T1H J;  1N36 J;  1IBL J;  4V1A k;  4KYZ A;  3J7A N;  4GKK J;  1FJG J;  4LF5 J;  4B3R J;  4DV5 J;  4LFA J;  5FLX U;  4NEZ A;  4JYA J;  3D3C J;  4X64 J;  4X65 J;  3J81 U;  2UU9 J;  5LM7 E;  4KHP J;  4DR5 J;  4DUZ J;  4JI4 J;  4DV6 J;  5AJ3 J;  4YY3 J;  4DR2 J;  5IT9 U;  1IBM J;  4YHH J;  4X62 J;  2VQF J;  1XNQ J;  4DR6 J;  4NEY A;  4GKJ J;  1J5E J;  4B3M J;  1I94 J;  4JI7 J;  1HNZ J;  2VQE J;  4DV3 J;  4DR7 J;  5A2Q U;  5LMU J;  1HNX J;  3W1Y C;  3OTO J;  4DV0 J;  4LF9 J;  2MEW A;  3R2C J;  4B3T J;  4LFB J;  2UUC J;  1N32 J;  4DR1 J;  4DR3 J;  4B3S J;  2MTL A;  2UXC J;  4DV7 J;  5BR8 J;  2E5L J;  2UUA J;  4DUY J;  4NXN J;  3J80 U;  4HHU A;  3JAM U;  4DV4 J;  4OX9 J;  4DR4 J;  5LMN J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...