4HIBA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with cmp-n4-oh
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel cytidine-based orotidine-5'-monophosphate decarboxylase inhibitors with an unusual twist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
molecule keywords Uridine 5'-monophosphate synthase
total genus 95
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4hibA00
3LM7A 3IIPA 3WJWA 2ZZ3A 3C2FA 2A7NA 4UTKA 1T8XA 1TPDA 2I1OA 4JTGA 4O54A 5AOUA 1QPRA 3NYZA 1QWGA 3E02A 3LCXA 4QQ3A 3WK0A 1OX4A 3LCWA 4IUOA 4UFMA 3G1HA 4MPQA 1E51A 3L5AA 1WA3A 3O6CA 4ZVJA 4FO4A 2VFFA 1GVOA 1UCWA 2VFEA 3G8RA 4I7VA 3RK8A 3W7IA 2V2HA 3VFLA 1GTHA 3HGRA 1R47A 2QEZA 3GLCA 3WK3A 4QITA 2J27A 4GC4A 2J9XA 1W3NA 1LOQA 2DORA 2WSYA 2ZRXA 3EKZA 3W7PA 2V5LA 3TIMA 2PURA 4GUIA 3GYEA 4JTIA 1TPFA 4AEOA 4ADSA 1AW1A 4PTNA 4PODA 4UTWA 3NPWA 5LNRA 3TJLA 3QH2A 3TROA 3G8EA 1Q6LA 2CWNA 1OFBA 4QNEA 3W83A 4IWWA 3KRSA 2Y88A 1ZNNA 2V0TA 1VR6A 1KBIA 2ZA1A 4LUJA 1LP6A 1TQJA 2YX0A 3C6CA 5DY2A 3L0GA 3TMQA 5FF4A 4QISA 3O1NA 3AJXA 2RKXA 1NSJA 4GJ1A 3UZJA 3PBYA 5LKYA 4K8HA 4X22A 3VE9A 2Z6IA 1QO5A 1F76A 1JVNA 3I7QA 2QCLA 2V5BA 4IOTA 3PVFA 5CPMA 4A2SA 1YXCA 1F5ZA 2JBMA 3LRKA 3UPWA 4DO6A 2QUUA 3T7VA 4O19A 2CLLA 4DPQA 4AHQA 3NQ6A 1EB3A 3FLUA 1AL7A 1SZGA 1K7EA 4OV9A 1YADA 3GDMA 2CLKA 1S5WA 1VCFA 3B0VC 1QMLA 3LI1A 2X1UA 1PIIA 2G5WA 1XBVA 4DF0A 2NWSA 4XUGA 1LRQA 4AHOA 3T44A 3W2JA 3QFEA 3NQCA 1F6PA 5DXYA 5BOOA 4ZL1A 4DO4A 1YTKA 3LERA 4ONVA 2H6RA 4UTTA 3FJLA 4LRTA 4YCOA 1WYIA 3SJ3A 4JY9A 1XC4A 2ABAA 3NQ2A 1I4NA 3IVUA 3JRKA 3AO0A 5U4NA 2R8WA 4FX6M 5FEZA 3A23A 1OJXA 4H3DA 4DF2A 5EMUA 2BXVA 3W2MA 2A2IA 3MJYA 1KFKA 3P81A 3KVKA 1WDWA 1KTBA 4JYDA 3VNDA 2UV8G 3YPIA 2NUYA 2YW3A 4O4VA 4JD4A 1I2OA 4N6EA 1OG0A 1OFQA 1LBFA 4K39A 1SPQA 1MSSA 5I3IA 3BVJA 4XKYB 5LHFA 2WJZA 1JCYA 3LRMA 4WJEA 4CQAA 4FNTA 1H7XA 2C13A 1EIXA 2VFIA 5CZTA 5LNUA 4XTDA 4WD0A 5CPLA 3S5OA 1PE1A 2B4GA 2VC6A 3TSMA 5AHLA 1ME7A 1H7PA 4RR4A 1BWLA 3SY5A 2E5DA 3DHFA 1GVRA 5G5IA 1MEIA 3QJAA 3TMLA 3R2GA 4HPXA 1TJRA 4B5NA 2DJXA 4X9SA 3CU2A 5CZ0A 1QFEA 1EP3A 1UBSA 1WXJA 5LNVA 3QZEA 1LOSA 3O15A 1DQWA 1EWEA 4IMDA 3S5YA 1G69A 3KXQA 4O57A 2NUXA 3N9RA 2ZRZA 4O17A 2EAWA 3E49A 1K7FA 3QQ1A 4NX0A 3EWBX 1H51A 2C18A 3C56A 5D09A 1R2TA 5LNSA 1OYAA 4JX6A 1IXPA 3LOTA 4QJ1A 1VGAA 4UMBA 1M7PA 5F2LA 3BW3A 5G1TA 1DJQA 3TU9A 4N6FA 5E0KA 2A5HA 4UTIA 2FJKA 3PG8A 1NF7A 1KM4A 2GQ9A 3EKLA 3IGUA 3W3OA 3LRLA 3G0UA 1FDZA 4OU1A 3NGJA 3NDOA 4O12A 4RZ5A 4LW7A 4O0KA 1VC4A 1TV8A 3B0PA 1P1XA 3LXCA 5D33A 3SSJA 4I7UA 1ZY9A 1VJIA 4WX2A 2FFCA 3UWYA 1I2RA 3N34A 3NQGA 4UC5A 4UR8A 1B4EA 1OK4A 5AHFA 4FIQA 5EYWA 5HWJA 3LLFA 3M7WA 3N2XA 3S5NA 2EGZA 1Q3NA 3DAQA 4PA8A 1IIHA 1PS9A 2ZA2A 3NO5A 2GUUA 3O63A 4LS2A 1ADOA 2FPYA 5K9XA 3M5ZA 3BGJA 1Z44A 4BWLA 4N9EA 3OA3A 4JYFA 1LBLA 4JTSA 3EWUA 1LLZA 3P5YA 3GDKA 2CLOA 5HR7A 1BKSA 3LV5A 3U6WA 3THQA 1C8VA 5CG7A 2P0OA 1CX9A 3PS7A 1KFEA 3KFTA 1OYBA 1YLVA 3DU0A 3W7OA 4NNBA 1HFBA 2V81A 2H8XA 2QCMA 1VYRA 2EF9A 4OT7A 1MEHA 1VHNA 1QO2A 2R14A 3CIXA 1KM1A 4K7YA 1BEUA 1Z48A 4NJIA 1Z41A 1NVMA 3QW4B 1K8ZA 1VS1A 3IVTA 3PUDA 3GK0A 4EWND 2E6DA 2QR6A 2J9ZA 3NM3A 1K03A 5HQEA 2QCEA 3SFKA 2ZRUA 4MJZA 2E09A 3ABRA 2Z2UA 4ADTA 3DXIA 4N4PA 2V2DA 1SU5A 1GYLA 4GXMA 4UTUA 1GT8A 4JDYA 1EP2A 2B7NA 4MZ8A 4OGZA 1ME9A 2XFWA 3HPSA 2CZ5A 4FXRA 1R30A 3E12A 1WAUA 5ABTA 1ZALA 3P5ZA 3FYOA 2AAMA 3O06A 2C1HA 4H6KA 3P74A 4N4QA 3W2UA 3M5VA 3PSVA 2RH9A 5I3GA 1R46A 3JR2A 1VCGA 3IIZA 4XWUA 4TMCA 3O07A 1JJKA 3HGSA 1EUNA 1TJPA 1DVJA 3DENA 4GRSA 5L9FA 3NXFA 4Z0SA 4G1KA 3S0CA 1S5TA 3HPZA 3P61A 2P10A 3EXTA 3OBKA 1X8FA 5LNWA 4TO8A 4BR1A 2WNZA 3PR2A 3STGA 3W7QA 1N8FA 2PRMA 2VEMA 3Q37A 4XBSA 3FIGA 3CPRA 3PSWA 1VPXA 5DCBA 5F4XA 2CU0A 4X3ZA 3QEZA 3L68A 3OVQA 1VH7A 3W7HA 1VLIA 2QDGA 3C2EA 4UMAA 3CEUA 1X6UA 5AYZA 1AMKA 3UQNA 3UNDA 5DY3A 1DBTA 3HG5A 4EF9A 5KMYA 3BG3A 4WQ6A 3L66A 2NXGA 3P80A 2QKFA 1HG3A 4GWEA 3TC6A 4WY0F 1OFAA 3G1SA 3W76A 4E2BA 3ZR4A 1EA0A 4TX9A 5A8GA 4LVBA 2ZZ7A 3W75A 1XXXA 1QAPA 1KM0A 5FEWA 3TR2A 1QPQA 3GB6A 3VI2A 4UNKA 1OF8A 2A85A 4AH7A 2ATSA 5AHEA 4GUHA 4E0CA 1PHQA 3NEVA 1JUKA 3RLVA 1O5XA 4IJBA 4JTFA 3PC0A 4HKPA 3BLEA 4ICNA 5AHNA 3OHIA 1IXNA 1V7YA 3TFXA 4O10A 2YFOA 5C55A 5K4ZA 4UXDA 1M7OA 3EX3A 3ZWSA 2WNQA 4NXSA 3R89A 5IM51 4JX5A 3RU6A 1FUYA 1KA9F 3S5ZA 1P4CA 1WOAA 4LU0A 3TXZA 4AWUA 3NL6A 2YXGA 3RLUA 1MZHA 1DHPA 3QF0A 4OQVA 2GVLA 4MLJA 3W84A 1SO6A 3BK0A 1KBJA 3GAKA 1LZOA 2BZNA 1SZNA 4TU1A 2JK2A 3GR7A 1SW7A 2Y7DA 3TA6A 3M16A 2V30A 3G22A 1KV8A 4TIMA 2YYTA 3CTLA 4K8EA 4NJGA 1BWKA 4I9AA 1WBHA 3W9ZA 3GKAA 2F84A 3UWVA 2QCHA 3ZWTA 5F4WA 1NAL1 2E6AA 3W1LA 2W0UA 5LGZA 4UMCA 2QF7A 1SSDA 3O8AA 1XL9A 1HTIA 5DCDA 3P84A 4GE8A 2ZTKA 4OHQA 1FY6A 2QJGA 3I65A 1XBYA 3NM1A 2HTMA 4DF1A 2WKJA 1F7BA 5U7SA 1EP1A 2YZRA 3A5FA 1SO5A 4BWLC 3NA8A 1XFBA 3DGRA 3GDTA 4ZMGA 4LY8A 3G0SA 1H1ZA 3E96A 4XQ6A 3GDLA 1O5KA 3DFNA 1MXSA 5AHIA 3TSBA 4JTEA 4UTJA 1GPWA 1EPXA 1LORA 1SW3A 1TSIA 4Z1CA 4A29A 2DZTA 3ATYA 1L2UA 3GAYA 3QMSA 5H91A 4UIOA 2A4AA 3HBLA 1YYAA 2CW6A 3W7GA 5EA9A 3CM4A 4WOQA 3TE9A 1DORA 4FIRA 1U5JA 2OX1A 3NPXA 2RDTA 3R12A 2C19A 1D3GA 1G4SA 3M43A 2AQWA 1KM6A 3IIXA 5FEXA 3M6YA 2I9EA 2X1TA 3L0KA 1I2PA 3Q2DA 4R33A 3BV4A 3NQAA 3LI0A 2ISSA 2GOUA 4N2YA 5I3KA 2CLIA 2VXNA 5D2YA 3KX6A 3W7CA 4IXXA 2EHHA 2JKAA 2Z6JA 4O52A 1PCWA 4MY8A 3VCRA 5BNKA 4UR7A 3EXRA 1TYGA 4ALDA 5HWMA 3UY7A 1G7VA 2V2CA 2GQAA 3S1WA 3UXAA 3GXPA 4MY1A 1X1OA 1KLYA 4JTTA 2JGQA 2WOQA 4IMEA 3UPBA 1A5BA 3HPXA 2P1FA 1FWSA 2XN2A 1Q6QA 3W1NA 1FCQA 3MP5A 1JQXA 3HGJA 2TMDA 1VCVA 2Q3RA 4CNPA 1O4UA 3CHVA 5E93A 3WK2A 1L6SA 5HMSA 1D3HA 1TRIA 5I3HA 3R5EA 3L65A 4NXKA 4MYXA 4AWTA 2Y6ZA 2NLIA 2WQPA 2XN1A 6TIMA 4I7WA 4DQWA 2YPIA 3M9YA 2WSRA 5EPDA 4A3UA 3V1PA 2QCCA 2Y63A 4WUIA 3ABQA 3NOEA 1XBZA 4M7TA 3UY8A 3IEBA 1HO1A 2H8ZA 4GBUA 2Y7EA 3TAOA 1N7KA 3C61A 5F2MA 3N73A 3T4CA 3LV6A 2ZRWA 5CZSA 3MW7A 3NNTA 5K4XA 3HQ1A 3MHUA 3KAOA 4M19A 2RFGA 3E9AA 1KM3A 1I2QA 3M41A 4MIMA 5F2GA 1W8SA 4IMGA 3SZ8A 3FKKA 3W85A 4Y8FA 3HG4A 4DBEA 1B3OA 3OVRA 2NXIA 5F4SA 3BW2A 4RLIA 1S5VA 3PF3A 4JTLA 5KSWA 1J2WA 1YPIA 4A21A 1W37A 4O1DA 3HF3A 4LVDA 4KKXA 3SR7A 3W7DA 3G3MA 3F1QA 2OT0A 1GWJA 4U4MA 4AF0A 4XBKA 3M1ZA 1ZENA 1RQEA 1CI1A 1K02A 1ZAIA 4NNCA 1JRBA 3LHUA 3UWZA 7TIMA 2XN0A 1KTCA 1Z42A 5I3FA 1U83A 5D2VA 1GQNA 3NPVA 4RZ6A 2YDAA 2TRSA 3N14A 3C2RA 4UTWC 4UCGA 1WBJA 2PE4A 2Y89A 5BMWA 3ZS4A 2QCNA 1YDOA 2B7OA 2BSLA 2Y62A 3KVMA 3T78A 3H55A 4JY8A 3TV8A 5DN1A 3HO8A 3S1VA 4NUWA 3W7KA 1LCOA 3WJYA 1LM1A 1XUUA 4YWIA 1KFLA 1AK5A 1GVFA 4HT3A 3NQMA 1L9WA 4LNYA 4IXHA 4JDBA 2QCGA 1MEWA 1KW1A 4LRSA 5D05A 3L5MA 1F6KA 2V8ZA 5GVJA 3L9CA 4ZQCA 4JTUA 1GVQA 1G4EA 5DXXA 1KLZA 3B4UA 2QCDA 1K8YA 2X2GA 1H7NA 2G96A 1M6JA 4CCEA 3K30A 1LDCA 1UASA 1F73A 4QAIA 1K8XA 3WJXA 3H54A 2C15A 3A24A 2FPTA 3G0XA 3I7RA 2RHGA 3G1AA 3LGEA 4NU7A 5I3JA 3PB0A 1TB3A 2A7RA 2YR1A 3UXDA 5CSRA 3DKJA 3OEXA 2O7QA 3L5LA 5H2ZA 3EWZA 3GNDA 3EWXA 4AF0B 1OFDA 2BLEA 4Q32A 1H63A 2OCZA 3BG9A 5KZDA 4RV8A 4DO5A 4JR5A 5G2HA 1JCMP 4GUFA 2VEPA 1H7OA 1OX6A 3S6DA 3W1RA 3MYOA 1FCVA 3PM6A 3OG3A 1A5SA 3S1XA 3W1AA 3DFPA 1UUOA 5LZLA 1OFPA 2H3BA 5CGQA 5DLCA 3R8RA 1FWWA 1LROA 5AN7A 5KZEA 2GVJA 3HOJA 3W1TA 3CC1A 4ORIA 3LXBA 3M5XA 3WJZA 1AL8A 1F2JA 3PBUA 3DHDA 3TW6A 3TQVA 1PL9A 3W6YA 1W5QA 1PVNA 1TV5A 4K6AA 3MP4A 3GX9A 5FF3A 1TREA 4OWGA 5AC6A 1XM3A 1WV2A 1YXYA 1B9BA 5DELA 1GJPA 1NFBA 8TIMA 4FB7A 1UB3A 3ATZA 1SZEA 4RK8A 4Y90A 2IQTA 3LHVA 3GDRA 1B4KA 1OYCA 2NX1A 3EWWA 4BK9A 2X30A 4HPJA 3EWYA 2B7QA 5K2ZA 1IXQA 3C2VA 1LYXA 4IPJA 4E2DA 2G97A 5BRBA 3KVJA 3A21A 1ZAJA 2YGYA 2CLHA 3THAA 4JX4A 1OFOA 2C16A 2X1RA 2E6YA 5DBTA 1JRCA 1GZGA 3I7SA 3CB8A 1TV7A 1IXOA 1DOSA 5LSMA 3UYCA 3PBWA 1NEYA 3B0UX 1SUXA 3NQEA 3WK1A 3TUUA 2YFNA 4POCA 3P8JA 4N9DA 4UFIA 1L6YA 3TAKA 5HUOA 1VQTA 5D2WA 1QPOA 2E5CA 4S2CA 4MOZA 4S1FA 3CEPA 4ZQPA 4JEQA 2A1YA 3Q58A 1K3UA 1I2NA 3QQ0A 3TH6A 4AVFA 1W1ZA 4MZYA 4GUGA 3D0CA 3NL5A 2ZDRA 3HMJG 3B03A 1RZMA 4NZFA 3GR8A 3UWQA 4ZQRA 1TRDA 4AMAA 4ORMA 3B05A 2QUVA 3SGZA 3G1YA 2CZFA 4ZQOA 1ZJIA 4LV4A 4KWWA 1UJPA 5J5RA 1Y0EA 3MHGA 3G1DA 5AB3A 1A50A 4JN6A 3KOFA 3DKLA 2ZRYA 1G67A 1G6CA 3N9SA 4IMFA 4WY0A 1OHLA 5AFDA 5MHBA 3OVPA 2VOMA 3MMTA 3BPWA 5EY5A 4MJMA 3L21A 4R7JA 4PFMA 2X1SA 2ZA3A 3TQ0A 4FF7A 4P2VA 5HWNA 4W9TA 1XDMA 1FX6A 4A22A 3NZRA 2GJNA 1FBAA 2C0AA 2HSAA 5K9DA 3UWWA 1W0MA 2X16A 4NVTA 1SFLA 2EPHA 4WXYA 4HSNA 2E77A 1K7XA 3KRZA 3G24A 3S8HA 1RR2A 4KFOA 2DZSA 1S3HA 3O6DA 1I45A 4LT9A 4N9CA 1SW0A 1TIMA 3VKJA 3EX1A 4HNVA 3DFTA 5DCEA 1XUZA 1PV8A 4HHPA 5BW6A 3SI9A 1OFRA 1WOBA 1KFJA 3PULA 2FB2A 4HNNA 5HNRA 3QPYA 2W6RA 3MUXA 4Z1DA 2QUTA 4HNUA 4RX0A 3T40A 5KTLA 3A22A 4OBTA 5C5YA 4P61A 3QM3A 4DEFA 3UD6A 3LBMA 1FWRA 4FNPA 2FQIA 1ZFJA 4FX8A 5G1YA 3STCA 3MI2A 1G4PA 3LDVA 4WXZA 3W1XA 3LTYA 1TPC1 4TR9A 2CFFA 3T55A 2DZWA 2PCQA 2WO5A 4S2BA 3MP3A 2C3ZA 4WOZA 2J24A 3SECA 4L4MA 2O7SA 3GVGA 2JKPA 4HIBA 3TJXA 4DXVA 2FDSA 1ZAHA 4AAJA 1VZWA 5FESA 3HIJA 4FNQA 4Z1BA 3M0ZA 3GXTA 5G4WA 1THFD 4JTJA 4CQ9A 4Y6GA 5CPOA 4RKAA 5C54A 3LTPA 3JS3A 4L4LA 2NX9A 2C14A 1JULA 2A21A 3CWOX 4JTHA 2J9YA 2Y61A 3W7RA 2D73A 3PG9A 4QIUA 3RFAA 3O05A 4O50A 4EIVA 2NXHA 2NV1A 2OZ0A 4NJJA 2ZTJA 4E38A 4KFPA 2YSWA 1JUBA 1TMHA 1TPVA 4O4WA 4O0ZA 3N19B 1HL2A 3M47A 3LXAA 1RQBA 4OV4A 3W7LA 3QMTA 5TBOA 2OJPA 3HGOA 4FNSA 1X7FA 3NG3A 3P8IA 4IPIA 3QMRA 3DI0A 3W1UA 2B7PA 1C29A 1X1ZA 4K36A 1VRDA 4UTHA 3LCHA 2DZPA 3NVTA 5D04C 4LS0A 1IGSA 1OK6A 5K7JA 4K38A 2Y7FA 1XDLA 4O15A 2QAFA 1EUAA 3WJSA 2C6QA 1P5BA 1Q45A 1ZHAA 4AB4A 5J5DA 4MFDA 1H5YA 3MHFA 3SIZA 3QSRA 4UTMA 1MO0A 2ZZ1A 3EX2A 5FF7A 1H61A 4YMZA 2E6FA 3BW4A 3CQ0A 3QSTA 2VEKA 4NX5A 1SSGA 3L2IA 2Y70A 3CWNA 2I14A 3ELFA 2FB3A 4FHAA 4UFKA 1GG0A 5E1QA 4BI6A 3TDFA 3C3NA 5EBUA 1RV8A 3W72A 5TIMA 3NL3A 1FDYA 1XI3A 3UZ5A 3KVLA 2Q8LA 3LBCA 1CW2A 2WSQA 1LOLA 1Q6OA 2A6LA 2ABBA 1J5TA 3P62A 1L6WA 3H53A 1I8JA 3W1MA 1PCKA 2V82A 4PCFA 1AW5A 3LHZA 2TYSA 2ZCGA 3EX6A 1B57A 4CQ8A 4RXFA 2QAPA 2RDWA 5K3VA 4Y96A 4JS3A 5HINA 5G4EA 1OX5A 1OF6A 4C1LA 1FCBA 3MI3A 5D30A 4J9JA 5A5WA 4UFJA 4EOUA 3USBA 2DZUA 1W5MA 3QRHA 3DFSA 3LHYA 5D38A 1GTEA 1QNVA 4O16A 1W3TA 1F05A 3BLFA 1YTEA 4DPPA 3LHTA 2A7PA 1ICSA 3W86A 1T0OA 4O53A 2DZXA 1QPNA 1D9EA 4NZJA 3TFCA 3PWAA 4LUIA 3TXVA 3QPZA 4MKNA 1FQ0A 4LC8A 2OT1A 2Q8ZA 1TPWA 4MYAA 3NL2A 3MBFA 4AXKA 2NWRA 3FFSA 3W7EA 2BX7A 3IGSA 3KRUA 5FF0A 4WZHA 2QCDB 1QR7A 4X2RA 3ZFHA 1HUVA 4LC6A 4MZ1A 1N55A 3PY2A 1RD5A 5LGXA 3GNNA 2DJLA 4PL2A 1O60A 5CSSA 4N9BA 2HMCA 2G95A 2PRLA 2DU2A 5DBUA 4FNUA 2GVGA 3F4WA 1O95A 3N3MA 1W5NA 2ZYFA 3C4UA 1VYPX 1LTDA 1W3IA 2E5BA 3PUOA 4DELA 1GEQA 3FYPA 4Z0JA 2WPBA 1KTNA 3ABSA 2PC4A 1QCWA 3EB2A 2WNNA 4PL1A 4Q4KA 1VYSX 3BLIA 4O18A 4RZ4A 4LOCA 2VFHA 4KWVA 2ATMA 1G4TA 1SZFA 5F2IA 4ML9A 1AG1O 4Q33A 3W71A 2H3DA 4IX0A 5D03A 3W23A 1LRTA 1OFEA 4FEZA 3KHJA 3M5YA 4PH6A 2YW4A 3W88A 1YXDA 3FA5A 2VELA 2CLEA 3WFAA 3NQDA 2CLMA 3G1XA 4O13A 5KITA 1LLWA 3TX9A 3TW7A 3E0IA 4C1KA 1W5OA 4BFAA 5KINA 3MI6A 1V5XA 1H1YA 1YPFA 5AC8A 2YYUA 2OMAA 4KFNA 2QJIA 3W2NA 1DKWA 3W2LA 1LBMA 2AGKA 3C0JA 4O1CA 3PAJA 1UUMA 3G1FA 1A5AA 1FDJA 5FI8A 4LV9A 4NJHA 3NQFA 1BTMA 2QDHA 3W22A 3W2KA 1JCXA 3LCIA 3DFQA 4O28A 1M5WA 5C2XA 2Q3OA 1SR9A 3GXNA 3FEMA 4PEKA 1H62A 2ZRVA 3NAVA 1O94A 4HNTA 4O1BA 4YLWA 4AHPA 3GIYA 1GOXA 3FKRA 4K7VA 4M6VA 4O8RA 3LCFA 2FTPA 2VFGA 1YTDA 1TTQA 2A0NA 2Z0IA 4R34A 2F7FA 4BI5A 5KZMA 2LLEA 3SW6A 1XCFA 3RMJA 4O14A 3S1UA 4UFLA 1W31A 1RVGA 1EEPA 1XBXA 3U2OA 1OVDA 1PHWA 3G1VA 4XKYA 1JUEA 2YCEA 6ALDA 1VHCA 2CLFA 3LX9A 2V9DA 1DV7A 3FS2A 3RF9A 5AC7A 3IGXA 4UTLA 2W79A 1JR1A 5AYYA 3PBVA 1JCLA 4ADUA 1TPB1 4Z08A 1AW2A 1DQXA 1QOQA 4N02A 2DZVA 2WV8A 1LRNA 4JGDA 4JXCA 4MVAA 5BMXA 2ZZ5A 4U28A 1QDSA 3QYQA 1T99A 2ISWA 3B06A 3L0NA 4EF8A 1JCJA 5CPNA 3A9IA 4M6QA 3S9YA 1P0KA 2GPTA 4D2JA 2TPSA 2VKZG 5HUPA 3CLMA 1YDVA 3W7NA 1F74A 3LLDA 3W07A 2B0MA 2ISVA 5K9CA 1TTIA 2ZZ2A 3W1QA 4QM1A 1TCDA 4BI7A 2TSYA 3QC3A 4CLMA 4LTSA 5AHMA 2Y85A 1ZCOA 5G2WA 3CIWA 4QNWA 3NQVA 4MFEA 2FIQA 4DBDA 1KFBA 3I68A 5AYXA 3P7YA 1W54A 1OX4B 1KM2A 4JYEA 2HS8A 1KFCA 4AWSA 3DH7A 3HB9A 4YXGA 3CT7A 4JICA 4H4IA 4BF9A 3B8DA 4RXGA 1H50A 3F03K 5HR6A 4O11A 2VEIA 3S42A 3I6RA 2NUWA 1IIGA 3PB2A 4MUZA 4RJEA 3G18A 4LVGA 4LVAA 1RQHA 1TPUA 4ZQNA 3B04A 2ZQ0A 4Y9AA 3TCEA 1HO4A 2GJLA 4LVFA 2ZFAA 4YCPA 3HG3A 3V75A 1J4EA 3LTSA 1TTPA 4UFHA 5F1VA 1SFJA 3EEGA 2ZZ6A 3G3DA 1JCNA 1H7WA 3GKFA 3N2MA 1GYNA 4ZQMA 5G2IA 2FPVA 5D2TA 1FXQA 1YDNA 3W74A 1R2RA 1SO3A 2ALDA 3MBDA 5HJLA 4HSOA 4XTIA 2Z1BA 3BGGA 3TSDA 1ML1A 3A5VA 4CNOA 2R91A 1C9DA 3C52A 2VENA 2BWGA 5T26A 2GQ8A 1GVSA 4IMCA 5L6UA 3NQ8A 2RDUA 3DI1A 1FWTA 1OABA 1DL3A 1EX5A 3P60A 2FLIA 4GFSA 2DP3A 2JKEA 3STFA 3IRDA 5D32A 3W87A 3HG2A 3NPUA 2QCFA 2EKCA 1VLWA 1XKYA 1T96A 1TPEA 1RPXA 3W73A 4ZZ9A 1H7RA 4NJKA 5F1UA 3W7JA 5D37A 3IVSA 2R94A 3HJZA 1SO4A 4NNAA 4GUJA 1TQXA 3W1PA 1H60A 4WY0B 3F4NA 3LCLA 3VE7A 5IBXA 1TTJA 3BARA 3DFOA 3IV3A 2CZDA 4A2RA 3C2OA 5SWUA 5C6MA 3W7MA 3LHWA 1WQ5A 3P67A 1FWNA 1NF0A 1IF2A 3C8FA 5FF2A 1TPH1 4K37A 4TMBA 5TQLA 4QSHA 3NZ1A 4RCXA 2H90A 3DZ1A 3O16A 2ZBTA 3ABOA 1A53A 1EWDA 2ZZ4A 1KM5A 3TKFA 2HS6A 4JTKA 1W5PA 5FEPA 2QJHA 5EKYA 3NQ7A 5D2XA 1A5CA 4FNRA 3Q94A 4IGHA 2VFDA 3O6YX 2CZEA 4NT0A 1ICQA 3LCGA 4OE7A 5CZJA 2PRHA 5D02A 3QW3A 4PC8A 4UUIA 3ANYA 3GZ3A 3IIVA 2Y7GA 4CCDA 3R13A 1R2SA 1G7UA 3PUEA 4FXSA 4JNMA 2NZLA 1TO3A 3BG5A 3DBPA 3MO7A 1ICPA 1DJNA 5HULA 4JIQA 4CNNA 4Z1AA 5IBXC 3LB0A 3P82A 2E1DA 4MLRA 1ALDA 4IQLA 4GNJA 2JGYA 2NV2A 3NR0A 2A6NA 3BO9A 1JQVA 1SQ7A 4FX7A 5EL1A 3TNOA 4M7SA 1KV5A 4NQ1A 2KZHA 3U8GA 5LHEA 4UNLA 3SGUA 1P0NA 4MY9A 4XZ9A 1QOPA 3INPA 5CKSA 3FJ6A 3MWAA 3L67A 3OIXA 4R53A 3TC7A 4LWWA 4YL2A 3TK7A 3IIOA 3UWUA 4IX2A 3M44A 2J6XA 1GG1A 3RNDA 2NX3A 1Q6RA 4UTTC 3EX4A 3STEA 4O1AA 4CCCA 3EXSA 1FXPA 1W56A 4LS1A 3MYPA 3TQKA 1ME8A 2BTMA 1FCUA 4JIPA 4HN4A 3FOKA 3W70A 2E68A 4M5PA 2J88A 4EVZA 4M6PA 1ONRA 1WX0A
chains in the Genus database with same CATH superfamily
1KCZA 3LM7A 4QFUA 4WSJA 3IIPA 3WJWA 3VDGA 4J4KA 1J10A 2POZA 3FNDA 4O54A 4OIFA 4QQ3A 3LCXA 3WK0A 1EC8A 4UFMA 3U7BA 3M4HA 3COTA 1E51A 3L5AA 1FHLA 4ZVJA 4MMWA 3A3XA 3GIPA 1J0YA 4GYPA 3UJEA 2QEZA 3WK3A 1O1HA 2VM8A 2J27A 4C7GA 2FZ8A 2ZRXA 3W7PA 1JG9A 2PURA 2YLLA 3JVAA 4JTIA 4Y7EA 1XRVA 1ZBCA 4GNVA 3CUHA 4UTWA 3NPWA 4H9TA 3TJLA 3IUDA 3WQ8A 4ES4A 2ON3A 1I60A 3CZLA 4LUSA 3VCNA 1VJSA 1JXJA 3TROA 3G8EA 1OFBA 3SUWA 1JYXA 4I6KA 2NQ9A 1A0CA 1VR6A 2DW7A 1TQJA 2YX0A 5DY2A 3NSXA 3O1NA 1J6PA 3VNKA 1JIBA 1WDDA 3BJTA 3PBYA 5LKYA 1CT5A 6A3HA 1QO5A 3KL5A 2DUXA 2I56A 3R0DA 1QI5A 5CPMA 3GFZA 2VNCA 1M7XA 4QLLA 3U0HA 3TN5A 3U9IA 3B97A 3H7RA 4DO6A 2QUUA 3BZGA 3WNOA 2PCEA 1TJ1A 5FOOA 1SZGA 4JZ5A 3VGHA 3GTFA 1HGWA 1IWBA 2CLKA 2X1UA 1UWQA 1NY1A 2OEKA 4KEUA 2ACQA 4XUGA 2VX7A 1MW0A 3Q65A 1OCBA 3QFEA 1A4MA 4ZL1A 5BOOA 1YTKA 3ZLHA 4ONVA 4JY9A 1KWGA 3JRKA 3AO0A 2HDJA 2R8WA 5FEZA 3A23A 5MF5A 1E0XA 3BE7A 4H3DA 4DF2A 2D0GA 3RJXA 1C91A 3AIBA 1WDWA 2UV8G 5JXQA 3YPIA 2NUYA 3QV8A 1OG0A 4REQB 5LXEA 1VKFA 4W88A 1TV4A 3XIMA 2DT1A 4XKYB 1D7FA 1ZLPA 2ISFA 1JCYA 2GDUA 3LRMA 3ARVA 3L4WA 2PLMA 1H7XA 1EIXA 4HBKA 2VFIA 2I5GA 4IMAA 3S5OA 2B4GA 2FZDA 2RGLA 3QZ6A 1H7PA 5I7GA 2E5DA 1X6NA 1MEIA 1BFNA 3UVIA 1W2VA 1TJRA 4X9SA 3VM7A 1UBSA 3O15A 4G5DA 4MB1A 1EWEA 1J2BA 1BHGA 4FLSA 3N9RA 3QQ1A 5AZ1A 3WDPP 1UHVA 2QHAA 1DJXA 4X0NA 1R2TA 5LNSA 3TN4A 2IKGA 4H9YA 1XQLA 2XZ7A 4GX9A 8XIMA 1M7PA 1TZ7A 5F2LA 1DJQA 4N6FA 2PB1A 5CCZA 4BQ5A 2GQ9A 4PTMA 4C6FA 3W3OA 4E3VA 4IGSA 3VO0A 1FDZA 2J78A 1NOFA 4RZ5A 2XHYA 1FWJC 1VC4A 4JIRA 2PDQA 1ITUA 3B0PA 3N12A 5D33A 3KCLA 3SSJA 2BODX 2WLZA 3N34A 3DDMA 3NQGA 2AL2A 1XLFA 3R94A 5CPSA 1OK4A 4FIQA 2A3LA 5CGTA 4AU0A 1D8WA 5EYWA 3VD7A 3DYMA 3LLFA 3S5NA 1Q3NA 1CTNA 2Q6ZA 2F6KA 4PA8A 1H3GA 4U5KA 1UH4A 1ZJAA 1IIHA 1C8XA 3AHTA 3NO5A 3MKVA 3K8KA 1KQYA 3FAWA 2OSXA 4WCJA 2FPYA 4HA3A 5K9XA 3DFHA 3M5ZA 3CUFA 3KTXA 3CHDA 3BL3A 3BQ5A 3P5YA 2CLOA 2G3MA 1VFLA 1DIKA 3U6WA 1A80A 4BZYA 5CBJA 1BYCA 2OELA 5CG7A 4Q22A 3EOEA 3HJEA 1HFBA 2GSEA 1V3HA 2ZOXA 4NILA 1R6WA 3MCNA 1DIOA 3GIQA 1PX8A 1QO2A 1AQ0A 4HQVA 3BOLA 1Z48A 3IJDA 1A5NC 1NVMA 1VS1A 3PUDA 2QR6A 2D3LA 4W7VA 1K03A 2QCEA 2ZRUA 5IHRA 2MNRA 3ABRA 4ROQA 1F61A 2XGBA 1F3TA 5RUBA 3C0SA 4MZ8A 1GGOA 3MANA 2CZ5A 2P76A 3U4AA 2D2HA 4NAEA 1QBBA 2IKHA 3FYOA 1T6MA 3QVQA 4BQ4A 4H6KA 4LUTA 5T8GA 3P74A 2PUZA 3M5VA 2WVUA 2VX6A 1VCGA 3IIZA 1E9YB 2F38A 4GCAA 1JJKA 5CZKA 3N6QA 4Z2HA 2XGIA 3S0CA 3HPZA 3P61A 2P10A 2OQHA 3EXTA 4FLQA 4GVHA 1M53A 2WNZA 4BR1A 2YCIX 3EAUA 3RRXA 3FIGA 1XICA 4GX8A 1VPXA 3PSWA 4GH1A 4IUGA 2CU0A 4LAUA 3AIEA 1S2TA 1VLIA 2HXUA 1DE5A 4HZ7A 2V3EA 1PKLA 3GYCA 1EJTC 5I24A 5AYZA 1AMKA 2E8YA 3UQNA 3UNDA 3HG5A 5KMYA 2ZXBA 4LCSA 3BG3A 4BQ2A 2AKMA 4GWEA 4WY0F 1HKMA 3ZR4A 4P8WA 3MT1A 3UESA 1XXXA 3GU2A 1KM0A 5LA2A 1OF8A 1PIGA 2O56A 4AH7A 2ATSA 3EGJA 3M0LA 1PHQA 3NEVA 4OBRA 3RLVA 4IJBA 3VD3A 1QW7A 3M07A 2QMKA 4ICNA 5AHNA 3TJIA 1TVNA 3TFXA 1NQKA 3DHPA 4O10A 4OOZA 1OM0A 4O8AA 3ZWSA 5M1TA 2W9MA 3WH6A 3RU6A 1KA9F 3MMDA 4LU0A 1UR8A 4JCMA 2ZIDA 5CG0A 4MHBA 1Z6KA 1PTAA 3NL6A 3RLUA 3WELA 2GVLA 4QAWA 3SCNA 9XIMA 1ZZMA 1P0DA 3R79A 4AIEA 5DANA 3WLPA 4UQEA 3EDJA 5BWAA 1TA3A 2YYTA 3NO1A 5A95A 4WJXA 3GKAA 1E9LA 1TIWA 4D8ZA 1XSKA 3ZWTA 4AX6A 3T1GA 2QF7A 1S2CA 3O8AA 5DRIA 2PEVA 1HTIA 1XIFA 3MTWA 4GE8A 4OHQA 1WPCA 3KDOA 4GC3A 4UQDA 1XBYA 2HTMA 1FHDA 2WKJA 1CLVA 2DW6A 3T09A 2YZRA 4BWLC 4HYRA 3NA8A 3GDTA 1EXBA 2GFTA 3OGRA 1R5YA 1XX1A 3LM3A 2ZC1A 3E96A 4XQ6A 3GDLA 1O5KA 3DFNA 2OSWA 1MXSA 2Y0FA 4AZGA 1U2YA 3N25A 4B3ZA 4KWOA 3N18A 1M7JA 4UTJA 2OB3A 1GPWA 3HU7A 1LORA 1AA1B 2BVWA 1TZZA 3OZMA 4A29A 4NL1A 1L2UA 4ZXLA 1W1IE 3QMSA 5A6AA 3W02A 4MADA 5JU6A 1L8NA 3TE9A 4GH3A 4FIRA 5EB8A 2OX1A 3R12A 4GCXA 4WIWA 3KOXA 1S2VA 1G4SA 3NDYA 4S3FA 1QI3A 2E3ZA 4R33A 4N2YA 4Q8MA 4EPBC 1TE1A 2VXNA 1HJXA 4DLMA 3VXGA 2EHHA 1SJAA 1QK2A 1UROA 5REQA 1XF0A 1VPYA 2Z6JA 4O52A 3VCRA 4UR7A 3LPPA 4XK2A 4QS5A 4ALDA 1E71M 2BDQA 1DIDA 2V2CA 3AI0A 2G4FA 4CQDA 3ERPA 4B3LA 2JGQA 2WOQA 4MJ4A 3H22A 2GVEA 3B9EA 2PFHA 4A4AA 5IDZA 3ARYA 3QLDA 1XWYA 3ZJKA 5H8UA 2TMDA 2Q3RA 4CNPA 2OG9A 1UD2A 3KWSA 3WH5A 1UZ1A 4W8AA 3IWPA 3BJSA 4W5UA 1P43A 3L65A 3RX4A 2E28A 4UQ9A 3WF2A 1UWTA 2XN1A 1ZP4A 1E0UA 2WSRA 5EPDA 4WUIA 3UY8A 2Y7EA 4D8AA 3C61A 3BURA 3N73A 3T4CA 4H6QA 2ZRWA 3PJWA 4B2DA 5CZSA 3NNTA 1U5HA 4M19A 1S1PA 4XV0A 4MIMA 3RM4A 5C9UA 1NQ6A 4PFHA 5FJUA 1EGMA 5T9CE 4O1EA 1HJUA 3PBMA 4J3WA 4MB3A 8XIAA 3KL3A 3WLNA 1J2WA 4L1WA 3VM5A 4AZ5A 2QQ6A 1ISWA 2WZMA 4KKXA 4REQA 3W82A 3EPNA 4G7FA 4JHZA 1UR9A 4DJFC 3AYRA 4U4MA 1QNRA 1NWRA 1GKPA 2D22A 4KRTA 1CI1A 1K02A 3OYZA 3RR1A 4PUWA 3UWZA 3CV1A 4GJIA 1ONXA 4M24A 4HOXA 1W3JA 2I16A 3NDZA 2YDAA 1PKYA 1YBQA 2WVVA 4C6LA 2PE4A 5BMWA 5HBFA 2B7OA 3TLLA 3TV8A 1OB0A 2WB5A 1CGXA 3SUUA 1LCOA 4HZMA 1GVFA 1XG4A 2OTDA 3GHRA 5HNUA 3NQMA 4IXHA 4JDBA 4LQ1A 4QX4A 4YYFA 1HJVA 4ZQCA 1A49A 1G4EA 4F3HA 5DXXA 2REQB 3HURA 1FWCC 2X2GA 4J28A 3S2NA 2EPOA 3R8GA 1KKOA 1K8XA 2OGJA 5C0QA 4I5XA 3G1AA 5I3JA 1TB3A 3W25A 2YR1A 3SY1A 3CLWA 4K2SA 3G6LA 4B5WA 3EWZA 3EWXA 1OFDA 4H9VA 3VILA 1E1FA 3KCJA 1ELSA 4JR5A 5G2HA 1JCMP 3QGVA 3AZTA 2V6AA 3PM6A 1R7OA 3C3UA 4JTCA 3OZOA 3GG1A 3BOXA 4AC1X 3R8RA 1FWWA 2HPMA 1LROA 1EJWC 3OBEA 2PU1A 3W1TA 4DYEA 2DEPA 1UBPC 2DY3A 4ORIA 3DHDA 4QDMA 3ZVHB 1PL9A 1W5QA 3VK5A 1PVNA 3EMCA 1UR4A 3N4EA 1TREA 3HQNA 1V6XA 3ABZA 1WV2A 2R1MA 1B9BA 1GJPA 1K6WA 2DUAA 3I3EA 2AOSA 4KGJA 4RK8A 3SQMA 3WD0A 1HIZA 3EWWA 4BK9A 4HPJA 4F2BA 3B8WA 3USZA 1LYXA 2HRWA 2JIWA 3AFBA 3KVJA 5TF0A 3POHA 4UOZA 2OZTA 1E40A 1CWYA 2C16A 3R25A 5DBTA 4NSBA 4PMQA 1JYVA 1QBAA 1TV7A 1QWKA 3URNA 5C9WA 1NOUA 1QPKA 3FXYA 1O7AA 4WK9A 2NQLA 5D8WA 2PF8A 2R1NA 3WK1A 4DVOA 4UFIA 1L6YA 3SEPA 2V38A 5HUOA 1VQTA 2YA2A 1QPOA 1GVYA 2E5CA 4S2CA 5CQ1A 3OA5A 4H04A 3RN6A 1GNXA 3LGGA 1M41A 3QQ0A 3TH6A 1W1ZA 3BSMA 5CSYA 2HEJA 2ZUSA 4MZYA 4DRSA 4ZE5A 2GQ3A 3NL5A 2ZDRA 3B03A 4TVDA 3TLQA 5FSDC 3FK4A 2RUSA 4ZQRA 3BLDA 1JFHA 3T0CA 3MSRA 2WMHA 1ZJIA 1XIHA 3G1DA 1TA3B 2IPFA 2ZRYA 1G67A 3N9SA 4IMFA 4PUEA 3L4UA 3RUBL 1ZTVA 5MHBA 1P6WA 2VOMA 1I1WA 3BPWA 3L21A 4R7JA 4PFMA 4IJRA 3TQ0A 4FF7A 1KCXA 4TVCA 3UETA 1MYRA 3VINA 4A22A 3N11A 1GKRA 3FY1A 2DVXA 3UWWA 1SFLA 4MNKA 1FFRA 2AMGA 1B3XA 3KRZA 5EMYA 2EO7A 1MUCA 5GQBA 4UB9A 2NSXA 1SW0A 4LAOA 3EX1A 4HPGA 1US0A 3SCRA 5HQMA 3DFTA 2WSKA 4HHPA 2J7GA 5BW6A 1WOBA 1I75A 3VGGA 3BLLA 4HA1A 2QZRA 3LPGA 3TZFA 2W6RA 4ROPA 2CKSA 2VDHA 2QUTA 4HNUA 3A22A 4OBTA 3QM3A 5A8NA 4FNPA 4W7UA 5G1YA 3H2OA 4RL3A 2PF0A 1OC6A 3GXFA 3LDVA 2ZX6A 3W1XA 3AU2A 4TR9A 2XIBA 3L4XA 2D3NA 2CBIA 2DZWA 4N0RA 2DT3A 1KRAC 3G2GA 2PDCA 3TJXA 4RE2A 2VWSA 2QF8A 4GVIA 1VZWA 4F0KA 3TJ4A 5FESA 4QXIA 3WX7A 4NI3A 5DRCA 3M0ZA 3GXTA 3H2AA 4CQ9A 4Y6GA 4KRZA 1TELA 4RKAA 5C54A 3LYEA 1HQTA 1CPUA 4UTFA 4E4PA 5C2CA 2A21A 1VP5A 4JTHA 2OR2A 2Y61A 3A3HA 2ZUUA 3W7RA 2D73A 3PG9A 4NYUA 1CIUA 4QE1A 4HA0A 3OZPA 1MW1A 4EIVA 2GVYA 3IGHX 4DB7A 3DIPA 1A4LA 2OZ0A 1W1VA 2ZTJA 5I6SA 4KFPA 2YSWA 4Q4QA 4MWAC 3OBAA 1ZBWA 1HL2A 2IQDA 3D5HA 1E5JA 3L4TA 1H2JA 2PDXA 4MNJA 5LXXA 4FXFA 1X7FA 2FVLA 4IPIA 4U3CA 2YL6A 2CERA 2CESA 1VRDA 4KEMA 1AJ0A 1IR1A 3EOLA 2DZPA 1JDDA 3I3BA 4UWMA 1OADA 3UJ2A 3NVTA 4LS0A 1OK6A 5K7JA 4S39A 4K38A 3WLIA 4YS1A 3ITVA 2GL5A 4AD3A 5J5DA 1B9ZA 1LT7A 1N2VA 4M80A 1H5YA 1MO0A 3EX2A 5E0CA 1P0BA 5FF7A 2PDBA 1H61A 4XD4A 1EDGA 4PCSA 1RK6A 4AD5A 2Z00A 4NX5A 1FWFC 3CQHA 4YVVA 5E1QA 4KIRA 3BICA 3C3NA 5EBUA 2PC8A 3BV7A 4US6A 3LQLA 3OYXA 1TR1A 1XI3A 3UZ5A 3KVLA 3UR8A 3LBCA 1J0ZA 1Q6OA 2A6LA 3P62A 3QLLA 1VD6A 3A4AA 5M03A 2BNJA 3GBEA 1E1EA 4KRUA 2NVDA 4DZHA 2V82A 3WIJA 4D6DA 1PZ0A 3VDAA 1MUMA 4CQ8A 2I5IA 4RXFA 3H2CA 2QAPA 1YNPA 1V08A 4Y96A 3GC2A 1OF6A 4C1LA 4LGXA 1F3WA 4J9JA 4UFJA 3FHAA 4EOUA 2QUNA 2DSZA 1EF3A 3LHYA 3L12A 1RCXB 4O16A 3KDNA 4GKTA 5AY7A 3S4TA 2NV9A 1YTEA 5DO8A 1G9HA 3LHTA 2A7PA 5D9NA 1T0OA 4O53A 1AJZA 3WLKX 3KBVA 1QNPA 2FTWA 3AXMA 1LT8A 1XISA 2QPXA 3TFCA 4LUIA 4UBPC 1D8CA 1YBQB 4AMCA 3FAXA 2Q01A 1NTHA 1JD7A 3ZQ9A 1UZDA 5FKYA 1V3IA 3MBFA 2DIJA 1OD0A 4L6OA 2NWRA 2OKTA 2WJFA 3KRUA 4WZHA 2QCDB 3SN4A 3ISIX 4FI4A 1DWIM 1NDZA 2DJLA 3KCOA 2W67A 3W00A 5CSSA 2G95A 1A3HA 2DU2A 4FNUA 3H12A 3ITOA 4IGNA 5IFTA 1VYPX 4DELA 2E5BA 1DPMA 2VRQA 2P3EA 5JQ9A 1JAEA 2WPBA 4ZODA 4UQAA 4MAZA 2XFYA 4PL1A 1AJ2A 4O18A 1HKKA 1WCGA 2WKGA 4IG2B 4Q33A 2H3DA 5D03A 3MSYA 4FEZA 3WQ5A 3MUY1 1UMYA 3R8HA 3RM8A 1HJSA 1YXDA 3FA5A 2CLEA 3WFAA 3PZGA 3CZKA 3LPFA 3G1XA 4GA8A 2CXGA 2CXEA 1D2KA 1W5OA 3OOQA 4BFAA 2HE8A 4RZBA 5AYBA 4GIEA 1YPFA 2YYUA 3UR5A 3W2NA 4E8GA 1LBMA 4GISA 2ADAA 3ZVHA 3PAJA 4P7QA 1UUMA 3G1FA 5CLTA 3PANA 2E9MA 3WH8A 1QASA 4NJHA 1L0PA 3NQFA 1V6WA 6TAAA 3DG7A 3W2KA 3WBYA 3DFQA 3D3AA 1M5WA 5C2XA 4GGHA 4Q8OA 1E72M 3GXNA 3GNXA 4HD5A 4O1BA 2NQHA 4H41A 4AHPA 3CV2A 1R85A 4M6VA 4O8RA 4D6GA 4HGXA 1OT2A 1PWMA 2A0NA 3TNBA 4BI5A 5KZMA 3WENA 2OYMA 4LBSA 4TTGA 1KO0A 4IFRA 1K9TA 4UFLA 1W31A 1W1YA 1OVDA 5CC7A 4KGLA 4ACYA 2V9DA 1JCTA 5AC7A 1JR1A 2XGZA 3EA1A 4ADUA 4C1NA 1DQXA 2PGRA 4N02A 3WD1A 2J4GA 4AZCB 5BMXA 2ZZ5A 3QYQA 4MJ2A 4YJ5A 1T99A 3L0NA 1BLIA 3A9IA 4M6QA 3W01A 3QV6A 5C9XA 2VKZG 3KOWA 3ME3A 5HUPA 3GXIA 3CLMA 3WLJA 1US3A 3PZIA 2D2GA 3W7NA 1F74A 2WPGA 3LLDA 4AY7A 4F79A 2OO6A 5K9CA 1TTIA 2ZZ2A 3T8LA 4QM1A 4HCDA 2TSYA 3SBFA 5AHMA 1MW3A 5G2WA 4CEXC 4BY3A 2NQ5A 4GD0A 1WKYA 5E0FA 3PZUA 3E74A 1KFBA 3A64A 2HV5A 4HJFA 4DZIA 3CUIA 3D47A 2XSAA 3A9BA 4CGTA 4W89A 4JQ2A 3HB9A 2R9RA 3CT7A 3BXWA 4H4IA 1H50A 1LQAA 3F03K 1RJRA 1V0MA 1AODA 4H2CA 1HKIA 3G18A 4CEUC 1TPUA 3B04A 3TCEA 3CO8A 3NZGA 2ZFAA 4Y9PA 3LTSA 1SFJA 3EEGA 3CV7A 3GM8A 1GYNA 3OW1A 3QY8A 1BGGA 1Q7QA 3RU8X 1SO3A 2ALDA 4HSOA 2X09A 4J2PA 1RCQA 3WBXA 1C9DA 4ATDA 5T26A 1HNYA 2J7BA 3JUGA 1GVSA 4GY1A 1POKA 3NQ8A 4PTWA 1SZRA 1VFHA 2RDUA 4GIYA 1EZ2A 3DI1A 2PDUA 1OABA 1DL3A 4Q8UA 2VZVA 1EX5A 4GFSA 3EOSA 2W27A 1BVNP 3C8NA 4JFVA 5D32A 1Z8AA 3UXKA 4GI6A 2WLYA 3UWEA 3HG2A 2QCFA 2HROA 2Z26A 3FW6A 2V67A 3W73A 1ISYA 3CH0A 4XZHA 2PZNA 4QJ4B 3CB3A 1AQMA 3CWHA 3E2QA 2FGZA 1SO4A 1TQXA 1H60A 3WDQA 3LCLA 4PCPA 1ZQ5A 3BARA 3DFOA 1Q13A 1OEPA 5XINA 2BB0A 3W7MA 4H9MA 3P67A 3UVAA 1FWNA 1K9DA 1IF2A 4PMDA 4J5NA 4QSHA 1BXBA 3DZ1A 2Z28A 3BAXA 2ZBTA 1EWDA 2ZZ4A 3RG6A 2YXOA 3H2FA 2E9BA 4YNGA 5FEPA 3C0QA 3VOFA 5EKYA 1B3ZA 4TVUA 2J7EA 3Q94A 1KXHA 4IGHA 3M6DA 2WC7A 1UC5A 4WGHA 4Q7NA 4FMVA 2CZEA 2HWGA 4ZXOA 4MWAD 2DIKA 3KTCA 1ICQA 1JAKA 3ALGA 3LCGA 3QOMA 5D02A 3QW3A 1P0EA 4DWDA 1XSIA 1WZKA 1RA0A 3H7UA 4LAZA 2Y7GA 4CCDA 3WLSA 3R13A 2IQ0A 1MXGA 3MO7A 1ICPA 1OQFA 4E6MA 4JFTA 3GC5A 4CNNA 1K1DA 5FJRA 3WMSA 3LB0A 3P82A 1ALDA 3KP0A 3NWRA 2JGYA 3ABXA 3ARTA 3HFYA 3SCSA 1BG4A 3NR0A 4XD3A 3UCQA 2JIEA 1JQVA 1REQA 4FX7A 5EL1A 3TNOA 4M7SA 4MWAA 1EC9A 2KZHA 3V0SA 1IE7C 4HJWA 4LXFA 4MY9A 3INPA 5CKSA 3S6OA 3VABA 3CMJA 3TC7A 1G94A 3ICJA 3UWUA 4IX2A 1GG1A 1J9YA 8A3HA 2QIWA 2NVAA 2YDQA 4I8DA 3SRKA 3HMCA 4C5YA 4O1AA 1E9ZB 3ZZ1A 4LB3A 4LS1A 3AWOA 3TQKA 2GUYA 2BTMA 1LL7A 3BJFA 4CVUA 3FOKA 3W70A 4DHGA 3VOCA 4M5PA 4M6PA 1GQKA 2XH7A 3LN3A 1F8MA 1M1BA 3T42A 4L9XA 4ZOEA 4M8UA 1XPGA 2OPJA 1QWGA 3E02A 3NYZA 4QG6A 1SVDA 1GHRA 3TW9A 1JZ4A 1YNYA 3LCWA 4AFYA 4MPQA 3ZM8A 1SFSA 2Z1XA 1TUFA 3F7JA 2F2HA 1F3EA 3MKCA 2BASA 2VFFA 1GVOA 3F5JA 3W7IA 4WSKA 1GTHA 1PIFA 1YIXA 1R47A 4QITA 3KZPA 4LEFA 1NIUA 3ITYA 1LOQA 2OYLA 2WSYA 5DMMA 4GUIA 1HX0A 3VDHA 2Q09A 3A3WA 2D0FA 3TYBA 2GGGA 1RH9A 4PTNA 2O4MA 1UH3A 4GIRA 3QH2A 3SQLA 3WDJA 1FH7A 3CIVA 4V15A 4S38A 1DWAM 2ZA1A 1KBIA 4LUJA 1LP6A 3TYEA 3C6CA 3IS4A 1U5VA 3TMQA 1PZ3A 3TYCA 3M0KA 1JZ6A 3AJXA 3QTGA 4B9YA 4GJ1A 1RVKA 4EAYA 2J62A 2Z6IA 3WD4A 3RXZA 3CHEA 4IOTA 4S3CA 3T6CA 3UGRA 1QW9A 5CJMA 5C70A 1Y5VA 4NZCA 3T7VA 4O19A 2D20A 3BAJA 3JZUA 4DPQA 3NQ6A 1EB3A 3WF0A 1K7EA 1YADA 2QPSA 1W17A 1EQPA 3LI1A 5E6ZA 1IYXA 1PIIA 3V0TA 2NWSA 5JBFA 2V3GA 1FTXA 3UR2A 1GQJA 2UY3A 4DO4A 4FPSA 2H6RA 1R3WA 3ZYZA 3FJLA 1BRLB 4LRTA 1XIJA 4Z17A 1V3LA 5U4NA 1RUSA 4CD5A 5LYRA 1OJXA 4Z2LA 4IIDA 5EMUA 4IH3A 3W2MA 2A2IA 3MJYA 1KFKA 3K13A 4HSHA 3VNDA 4R7OA 4GQ0A 4RE3A 4LCRA 1I2OA 3GG0A 4GBDA 1LBFA 2IW0A 1OGSA 1CLXA 1EJ7L 3FXGA 2BMBA 5I3IA 2J25A 5LHFA 4QR6A 2UY5A 4WJEA 1AFSA 3M0VA 4X61A 5ENLA 3UG3A 5CZTA 5LNUA 4XTDA 1TMQA 1QRQA 5E09A 2D1ZA 1FWDC 3GU1A 1BWLA 3S46A 4ZSTA 3DHFA 1GVRA 1H41A 1CENA 2VDGA 2PWVA 4HPXA 5GPRA 3QZEA 1DQWA 3NEHA 4H7VA 1UWUA 4IMDA 3KXQA 2I9UA 3CYJA 3IJ8A 4NX0A 3O6AA 6REQA 4RE0A 4DWSD 1SM9A 2ESCA 1Q6CA 3OG2A 1VEMA 1XPYA 1CECA 3U2CA 4JIIX 4YN5A 1VFTA 4AISA 2GGJA 4PMZA 2GUBA 4LH8A 3B0YA 5G1TA 2QUMA 1R38A 2Y5EA 1DWGM 3CHFA 4Q7BA 2BOEX 4ZB5A 1FHUA 2PLCA 4CU8A 2PTZA 3IGUA 3LRLA 5T9BG 4W93A 4GACA 3NGJA 1Q6EA 3DC0A 1TV8A 5FAJA 1P1MA 1ZY9A 4L65A 2VZUA 1DE6A 3VGEA 1I2RA 1N8IA 2UWFA 4UC5A 5HA7A 1D3CA 3BLKA 1OWQA 4Q4SA 3EWCA 4C6CA 4FR1A 3FYYA 2E7FA 2EGZA 3Q4DA 3DAQA 1PEZA 3ZR5A 1WDPA 3O63A 1WB0A 5I77A 1ADOA 2GJPA 4L1GA 3ZLGA 3NSNA 1EHNA 5HMFA 4HU3A 3RX2A 1Z44A 3URQA 4PEEA 4N9EA 2WWCA 3AAMA 1U33A 3I6TA 4JTSA 1XH1A 1J5SA 5HR7A 1BKSA 3WQ4A 2CCRA 3THQA 1C8VA 1LUCA 1CX9A 3PS7A 1KFEA 1OYBA 1E55A 4NNBA 2V81A 2QCMA 3VYLA 3GHTA 2EF9A 1SGJA 1MEHA 1VHNA 2Y5JA 2R14A 4GZEA 3CIXA 3UG5A 4K7YA 1EBGA 4NJIA 1K8ZA 3IVTA 4CUCA 4EWND 2E6DA 4ZFCA 2J9ZA 3EB3A 4NI8A 1XRTA 5FJPA 1MRAA 1W9VA 4ZR8A 3IK4A 4PBFA 4ADTA 1YX1A 2PGFA 3DXIA 3V3WA 2V2DA 1SU5A 1GYLA 1V3JA 3MCOA 1EP2A 2B7NA 1Q85A 2FDMA 1XP3A 2W61A 1Z3NA 3AMLA 4XIAA 2P3ZA 2XFWA 1XW8A 3PK7A 5ABTA 2OO0A 1ZALA 3MV01 3T9PA 1GVEA 5B7ZA 3VIGA 1W3HA 4JNZA 3S3GA 1FP9A 2BS9A 3O06A 4D6IA 1XFCA 4DLFA 1TV2A 4AD0A 3PSVA 1VEOA 3WD3A 1R46A 3ARSA 3N4FA 2PPGA 4EXAA 4XWUA 4Q4MA 3O07A 4P7RA 1EUNA 1V6TA 1TJPA 3T8QA 3CAKA 3QR1A 2XH2A 4Z0SA 3PNZA 2GGEA 1S5TA 1TG7A 1X8FA 2FZBA 3PR2A 4XBSA 2PRMA 3Q37A 4KS0A 5F4XA 1GUVA 3QEZA 4XAPA 3A6OA 4Z2KA 3V5CA 4Y9MA 1VH7A 2BVTA 4ZOAA 4UMAA 3CEUA 2J66A 3VD5A 3REQB 1YKWA 5I3DA 3IRSA 2NXGA 4WR3A 1OFAA 3TC3A 3W76A 5BRPA 3MCMA 3AIVA 1EA0A 2FVMA 4BEUA 3W26A 3AROA 5I07A 4K1WA 5FEWA 1QPQA 2C1IA 1EX1A 4URIA 4YTSA 1Q8AA 1U22A 2A85A 5ECVA 5MKGA 1ZSXA 3LBOA 4JTFA 2QIIA 1UA3A 3H8AA 1J6OA 3A4XA 1V7YA 3VU2A 1GHSA 1K4HA 3W6MA 3E2VA 4IIEA 4F9JA 2OEMA 5K4ZA 4UXDA 4RNJA 2WNQA 1XINA 1ONEA 7REQA 3HM7A 4XB3A 4IFOA 5BXRA 1P4CA 1MZHA 4MUPA 1DHPA 3QF0A 4JHMA 4QBXA 3W84A 1SO6A 3BK0A 1KBJA 3GAKA 1LZOA 3GR7A 3S83A 3TA6A 3M16A 4PRRA 2XM1A 2OOGA 1AD1A 4K8EA 4NJGA 4I9AA 3MKKA 5I79A 3IUIA 4JQ3A 4TTUA 2QCHA 4ZFMA 2E6AA 4HNLA 3PNUA 3OJGA 1XL9A 3B40A 4KETA 5EMKA 1EEXA 1GOQA 3RITA 4A3HA 2Z29A 2QJGA 3KHDA 2IKIA 1JZ3A 1Z7AA 3VZXA 4U3AA 2J13A 4I6VA 1LG1A 3R43A 3VTRA 1XFBA 3DGRA 3HN3A 3TYZA 1QW8A 1E4MM 4LY8A 3ES7A 3LNPA 1Q65A 2RAGA 4K8GA 4GXPA 3U5YA 3MDWA 5AHIA 3EYPA 3KM8A 3SCWA 1R3TA 3IJ6A 4JTEA 2PWUA 1EPXA 9RUBA 2P8BA 1HW6A 3WQDA 1DJWA 1TSIA 3QQWA 4PSRA 3ATYA 1Y8BA 5H91A 4B4FA 3HBLA 1XD0A 3AS2A 4CNUA 4YWSA 1V0KA 4A3QA 5KZ6A 3GG7A 4WOQA 1B1YA 3WDRA 3K5XA 3M43A 2AQWA 1KM6A 5FEXA 3SRDA 3HPFA 4XAGA 2X1TA 1E43A 5LA1A 1TJ0A 3WFZA 3NQAA 3LI0A 4QJ3B 4KCVA 3KX6A 4XBJA 4E2OA 2BVYA 3OLEA 4IXXA 2CKRA 3TWAA 3N29A 4NY2A 2PWDA 2YJQA 1TYGA 4OKDA 1X97A 1G7VA 4HU8A 1Y5XA 3K8MA 5A6BA 4A35A 5J04A 2PP3A 2BVDA 3UPBA 2GDVA 2YB4A 4B5TA 4XISA 1CEOA 4I5RA 2P1FA 3V0UA 5I0DA 2XN2A 4KERA 1UC4A 1Q6QA 2R82A 3MP5A 1JQXA 1O4UA 3WK2A 1L6SA 1AZ1A 4W4QA 1D3HA 2OWCA 4WKHA 5I3HA 2OVLA 3R5EA 3GWQA 4J3ZA 1FKWA 8RUCA 4NZ1A 3UBPC 4NYYA 4B9ZA 4E2VA 5A6BD 1C7TA 4DQWA 3OLGA 2YPIA 5C7HA 3RLHA 1QUMA 2J7HA 2ZX7A 3GW0A 4AYSA 3ABQA 1ESWA 3NOEA 2ZICA 4M7TA 4G7EB 4HHLA 2BFGA 3IEBA 1HO1A 3P0XA 4GBUA 3TAOA 2PDYA 3W28A 5REQB 3I3DA 4ILSA 4AY8A 4RNFA 5BYWA 3UCCA 3LV6A 4JBRA 1NDVA 2BGQA 1KM3A 1I2QA 3M41A 1FWGC 1W8SA 3SZ8A 2VURA 1DYSA 1B3OA 1ODUA 1R9ZA 3BWWA 2NXIA 5F4SA 3UCDA 3LMZA 4QRNA 4JTLA 2WMIB 3WQWA 1YPIA 4H9UA 1OZQA 4PTDA 1XYFA 3W38A 3RIKA 3AIRA 3ZR6A 4O1DA 3GUGA 3HF3A 3W7DA 2F6XA 1E6ZA 1GWJA 1V77A 4U5IA 1DJGA 4AF0A 4XBKA 4LYQA 1RQEA 3KUMA 3TN6A 1EYWA 1MUWA 3ZT6A 1KTCA 1Z42A 5I3FA 1HVQA 1GQNA 3NPVA 3G5EA 4I5UA 5CBBA 3C2RA 1WBJA 2Y89A 3H4WA 1PSCA 3ZS4A 2QCNA 1YDOA 2O9RA 2BSLA 2Y62A 4P7OA 3UPMA 4XZMX 3K1GA 1N8WA 3GVRA 3W7KA 4PN2A 3WJYA 4PUJA 1CCWB 1L9WA 2ICSA 3WYZA 2QVNA 1ONWA 1KW1A 1C93A 3L5MA 5GVJA 3S9ZA 4L61A 4QCFA 4M1BA 3GD6A 2QVHA 4Y2WA 3BMXA 3K2GA 3JW7A 4TQTA 1NH6A 1XH0A 1WKEA 2G96A 1XS2A 3K30A 1F73A 4QAIA 3WJXA 1TKKA 4IICA 1NDYA 2OYKA 2QGHA 4HMCA 2UY4A 3LGEA 1EGVA 3PB0A 1R86A 1Q4WA 5PTDA 5CSRA 2DSUA 2XUCA 3OEXA 4EPKA 5H2ZA 1Q6GA 2IXVA 2W5FA 4AF0B 1BPLB 1H63A 3ANUA 2ZVIA 2WSPA 2RGMA 3FGCB 1SJCA 2XG9A 3WEOA 3OG3A 4FLRA 2G4JA 4JNYA 5LZLA 2H3BA 3RILA 2YDRA 2ZUWA 3BCDA 4WDXA 7TAAA 2GVJA 4ZA0A 1LWJA 2P5NA 3TW6A 3TQVA 1EKOA 2INEA 3UXIA 1BXNA 3B4YA 1MZRA 3ARPA 1E6SM 3GVQA 3I10A 4ZCWA 3MP4A 2VGFA 3WF4A 1TFVA 1XM3A 1JNDA 1BGAA 4P7NA 1RY8A 1TWIA 1F4HA 2YBTA 4FB7A 4H2HA 3AHYA 1D7KA 3ATZA 1K8CA 1FRBA 3CAWA 5DX7A 2IQTA 1B4KA 3WMCA 2XU2A 3GW3A 2X30A 1IXQA 4RW5A 3C2VA 1EQCA 4IPJA 4E2DA 2FYMA 5BRBA 3WZ0E 1ZAJA 4AX7A 2CLHA 2HVOA 4JX4A 1IEXA 2X1RA 4XD5A 1JRCA 4J3TA 3I7SA 4DAIA 2Y5SA 4IPPA 1ZCCA 3CB8A 4XZLX 5B80A 3R7MA 2GK1A 1IXOA 1V79A 5LSMA 1REQB 3UYCA 2VEFA 3PBWA 4IL2A 3NQEA 4F2UA 3U57A 4JCLA 4LY4A 4H83A 2VHLA 4MOZA 4ZQPA 3RO6A 4W5ZA 3AYVA 1KXQA 1UR0A 3ITXA 4NZFA 4IP5A 4KBXA 3CMFA 4ORMA 3SRHA 3SGZA 5JIPA 2W92A 1MFUA 2CZFA 4ZQOA 3DBNA 4LV4A 1JDAA 4KWWA 1UJPA 1H09A 3AHXA 4CNSA 3DKLA 2FHFA 3QKEA 3P93A 4PB4A 4HHHA 4DWSC 2WCAA 2V5JA 5HWNA 2GZXA 4XSLA 3QN3A 2GJNA 5K9DA 1W0MA 2X16A 5H8MA 3G24A 4AZ6A 1S3HA 4AXNA 1W1B1 4LT9A 1TWDA 1TIMA 2WMFA 4B3KA 2XSXA 4B5VA 4FOJA 2VZOA 1PV8A 3T0TA 1OFRA 1UOKA 1HKJA 2P0IA 3PULA 1R9YA 1S38A 4HNNA 2OQYA 2BY2A 3QPYA 3RR4A 1V6UA 4RX0A 3T40A 3NIYA 3IV8A 4DEFA 1B30A 3LBMA 1MNZA 1X8CA 3B3DA 1G4PA 4WXZA 3O7UA 2CFFA 4S2BA 3OTRA 5BROA 3MP3A 1WXZA 2C8NA 4J27A 1C7SA 4L4MA 2O7SA 3FCPA 2J8TA 3H4GA 2PP1A 5XIMA 2FDSA 1Y65A 1U1JA 3SAZA 4OZOA 3BQ6A 3T0DA 4IPLA 4AZIA 2DV0A 3VZZA 5GJMA 4O1FA 3TTEA 3U3HA 2C14A 1XH2A 3RX3A 4QIUA 1PKMA 3MMUA 2J8FA 3WDIA 4HPNA 2NXHA 3KW3A 1M9HA 1HF6A 3AMKA 1TMHA 1TPVA 3ARUA 3MJMA 2PODA 3LXAA 3URAA 1RQBA 4OV4A 3QMTA 5TBOA 4B90A 3DCPA 4CD7A 1AD4A 4XZBA 2YA0A 3NG3A 3MC5A 4QDPA 4UTHA 1E56A 3LCHA 1JPMA 5D04C 1IGSA 1JGIA 1XDLA 2QAFA 4R88A 3NYDA 2XFFA 3WJSA 2C6QA 1P5BA 1ZHAA 3OODA 4MFDA 2FZMA 3SIZA 2ZZ1A 3AXKA 4YMZA 1DQUA 2PDGA 1VFMA 5HDRA 3BW4A 3CQ0A 2VEKA 1ADDA 1Q6FA 3L2IA 2I14A 1XIBA 1ZPTA 4FHAA 4UFKA 1GG0A 4BI6A 3K46A 1OINA 3HQPA 2VWTA 3W72A 1MDLA 2OX4A 3AIUA 2WSQA 2ABBA 1J5TA 1L6WA 2DZBA 4PUUA 4HZ8A 3POCA 1I0DA 1PCKA 3VIKA 2ACSA 4Q3MA 3OP2A 2ZCGA 1B5TA 1B57A 1UIPA 3B9AA 4LBUA 4LSBA 1DJYA 4GI9A 2EG8A 3VOHA 3J7HA 4U2YA 3ANVA 1FCBA 3FJNA 3WUGA 5EMJA 1XYCA 1W5MA 3RCMA 4INFA 1F07A 4Q8VA 3DFSA 4D6EA 3ZXWA 1DWJM 4P7LA 4H7ZA 5CJNA 4D8LA 2DZXA 1QPNA 5I5RA 1UR1A 2C79A 1EOKA 2Y24A 4ZE4A 2BGNE 4MKNA 5FJTA 1GOKA 1K9EA 2OT1A 4MYAA 4U33A 2XH0A 3VC6A 2O0TA 1V6YA 1IT7A 4AXKA 2OXNA 3QYSA 4NZ4A 4DI8A 2BY1A 2CHOA 4X60A 1EDQA 2X0HA 3IGSA 5FF0A 1JYWA 4MWAE 1QR7A 4JOMA 3VIHA 1KNWA 3ZFHA 4L4OA 2E4TA 1HUVA 4LC6A 4KEZA 4MZ1A 1N55A 4PL2A 2EPMX 3AMCA 4N9BA 3F4DA 3BCFA 1KRBC 3UA4A 3BAWA 1Q6DA 3MS8A 2ZYFA 3C4UA 3P14A 1LTDA 1W3IA 3ID7A 3AWNA 4Z0JA 4LUSB 3LSCA 4IIFA 3WSUA 3VNIA 3ABSA 2PC4A 3PTQA 4Q4KA 1VYSX 4F0SA 3BLIA 3JZEA 4RZ4A 3FGCA 4LOCA 2BHUA 4M56A 3W71A 3W23A 1OFEA 3KHJA 3M5YA 1FKXA 1KKRA 4HYWA 1ZL1A 1MXDA 2CLMA 3R11A 4BEQA 5KITA 4GQRA 2ONEA 2WW5A 1LLWA 2PBGA 3LD5A 3TX9A 3TW7A 2D2OA 2J77A 5AVHA 1MI3A 3MI6A 4GZJA 1O5QA 2HJPA 1V5XA 1E73M 1IWAA 1C3FA 2AGKA 4O1CA 2OEJA 1A5AA 1FDJA 1VF8A 3ITGA 3SGGA 3NTYA 3MY9A 4LV9A 2DT2A 2L5HA 1OCQA 3II1A 1QNQA 1JPIA 2ZX5A 1JCXA 3LCIA 1JI1A 4O28A 4IM4A 4GPNA 4PMJA 4GQBA 3SM0A 3VVGA 4EAMA 4QS6A 4D1JA 3H2EA 2ZRVA 1RK5A 3NAVA 1ZUAX 1NP2A 4W84A 1X39A 4LEQA 1M03A 5GJPA 4Q6JA 2VL4A 1EGZA 3LCFA 2FTPA 1PDZA 1YTDA 2ZKMX 3IANA 3SW6A 1XKJA 4EE9A 4ZSUA 3S1UA 4HA4A 2DSWA 4F9DA 5BRQA 1ISXA 3KLKA 4ENLA 3G1VA 4XKYA 4Q4RA 2VZSA 3CGTA 6ALDA 1VHCA 2CLFA 2XDFA 3EOOA 2Y8KA 3FS2A 4B5SA 4HK5A 2BXZA 4YIWA 3WLHA 4LBRA 1AW2A 1LRNA 4QGCA 1UWRA 4YVPA 5C9ZA 1V3MA 1DTNA 2R6OA 2QXWA 4C6JA 4EF8A 4HHMA 3S9YA 2GPTA 4MNMA 5I02A 2TPSA 4AZBA 1MMFA 4LUYA 1L8PA 1VAHA 4JPGA 3EBVA 3TCSA 2PLJA 4RPQA 5IHSA 3W07A 3FN9A 4QSFA 4A8IA 5JH1A 1GW1A 3QC3A 4CLMA 4LTSA 1ZCOA 3IJLA 3CIWA 1O66A 5E5CA 1H1NA 3GNRA 1FVPA 1TX0A 4MFEA 1WUEA 5AYXA 4H9ZA 1OX4B 4M51A 1IZJA 4CNTA 4DBSA 4DY1A 3HV9A 4HOZA 1OCJA 4GYKA 2BGSA 1UMLA 2VEGA 3I6RA 5HANA 1IIGA 1LUCB 2BY3A 4MUZA 5ECUA 4ZQNA 1GZ1A 2IUZA 4KT2A 2ZQ0A 1HO4A 3AS3A 1QI2A 3PJTA 1J4EA 5D9OA 4YHEA 2VP8A 2ZZ6A 3IJ9A 4DM1A 3KS5A 3N2MA 2NVCA 5H6HA 4CD8A 2FPVA 5B7YA 3SJNA 1FXQA 2VMFA 3W74A 1R2RA 3MBDA 5HJLA 3BLPX 3LU2A 4IHCA 1E6XM 1ML1A 1E6NA 3C52A 3CZ8A 4XAZA 4GABA 4IMCA 1LL4A 2PDIA 2XVKA 3EOUA 4JIEA 2IPGA 1XG3A 3AS1A 5A2BA 1FWTA 3P60A 2BBFA 2ZADA 2DP3A 2JKEA 1IR2A 3SFWA 5CC3A 3W87A 1FWIC 4HPHA 3I4KA 1RPXA 4ZZ9A 1KGUA 3SRFA 1BYBA 3MB9A 3IVSA 4D6FA 2YZ5A 4GUJA 4WY0B 1K9FA 1TTJA 1VFOA 2HISA 1J0KA 4L7ZA 2CC0A 1PWLA 5SWUA 5C6MA 1MRQA 1PXGA 1BD0A 1TUXA 3LHWA 1DTUA 2IKJA 3C8FA 4TMBA 5TQLA 4DUXA 4A3RA 3WBEA 4QCEA 3ABOA 2BY0A 2WHMA 3TKFA 2HS6A 4JTKA 3S2LA 1XRSA 1E9IA 2QJHA 1UKTA 4L56A 4IIHA 4P8UA 4FNRA 4YYCA 1BF2A 3QR0A 4CQCA 3O6YX 1XIIA 4JKMA 2PRHA 4F40A 2OFJA 2J74A 3ZT7A 3IIVA 2JF6A 1I1XA 4PZVA 3PUEA 2NZLA 3BG5A 1SFTA 5HULA 5CSUA 1G5AA 5HPCA 4GNJA 3LNMA 2VUYA 4Z2IA 5FIPA 2GK1B 2E1WA 3QR3A 3KLLA 2WJDA 4MKVA 1E70M 1KV5A 4B2DD 1A5MC 3SSZA 4UNLA 3SGUA 1P0NA 4XZ9A 1DJZA 1XGEA 2XM2A 1GZJA 3FJ6A 3NUKA 4YL2A 3M44A 2J6XA 2X7WA 5H8PA 1LF1A 3RNDA 1RJPA 1WE5A 4MDOA 4HOWA 4FLOA 3SCVA 3GTXA 1OGBA 1AUSL 1GOWA 1GQIA 1RPKA 2QJMA 4JIPA 4HN4A 1XHGA 3THDA 3N6HA 2V68A 2O9PA 4EVZA 2B81A 1ONRA 2XJ7A 5D9PA 1W3KA 1NU5A 1BWVA 3C2FA 4AIUA 3PZVA 4M1RA 2A7NA 1R3RA 4UTKA 1TPDA 2V5KA 4JTGA 1EO7A 5AOUA 2PDWA 1V0LA 4HNOA 4LYKA 2GGIA 4F66A 3N2OA 3DGBA 1WA3A 3NGFA 3O6CA 3V5OA 2E8ZA 3T05A 5A8MA 1F9CA 3A4WA 2VFEA 3G8RA 3RK8A 3ZOAA 2V2HA 3VFLA 1JZ2A 3GLCA 4HMNA 3MA8A 4MF4A 4AD4A 2WHLA 2J9XA 2X0SA 4I90A 5BCAA 2DORA 3EKZA 2V5LA 3GYEA 1VJZA 1TPFA 5D4YA 4RDWA 3AZSA 3A4JA 3AZRA 1FA2A 3O0KA 5CAHA 1R9XA 2WWDA 2X2YA 4RDZA 5A6MA 3OO2A 1UPMB 2CLPA 2DIEA 2CWNA 2AL1A 3W83A 4FK9A 4KCUA 2Y88A 3EWDA 5CJ5A 2DZAA 3L0GA 3WNNA 3K8LA 3CTTA 1AZ2A 2QV5A 1IEVA 1LLOA 2UBPC 5LIUX 3AICA 4QISA 3PAOA 1NSJA 2DSKA 3UZJA 1XD1A 4X22A 4K8HA 4WJ8A 3PWGA 3VE9A 5I2UA 3S47A 4GMEA 3S2CA 1V4YA 2AL2B 2V5BA 5AZ0A 2YL5A 2VVNA 1EO5A 5A2AA 1OIFA 1YXCA 3QBUA 4I3GA 2GGHA 2JBMA 3LRKA 3WQ6A 1KBBA 3UPWA 1GJWA 2VO5A 3DUGA 4AHQA 1CNVA 2VRJA 1AL7A 3B8TA 4MKSA 3VIFA 3ARQA 4NAFA 1S5WA 3B0VC 3T4WA 4PB3A 2G5WA 1XBVA 4DF0A 1V7AA 1LRQA 1ISZA 4M29A 2BHYA 3EPMA 5DXYA 3W81A 1AVAA 3S5SA 3EMZA 4UTTA 1S5NA 4GK8A 1S2UA 1WYIA 3SJ3A 2ABAA 3NQ2A 2Z1KA 1I4NA 1ZBVA 4FZIA 1JPKA 3GVVA 4AEFA 3NFUA 1DP0A 1Q7MA 4PMNA 3QOKA 4FX6M 5BU9A 3VMPA 4EKJA 3V5FA 2BXVA 4C60A 4YTTA 4MM1A 2XYLA 3THUA 3O3RA 3KVKA 4JYDA 4O4VA 2YCLB 3R1ZA 4N6EA 4EP8C 2ZUMA 3WLRA 1DHKA 3ZIZA 1SPQA 4CVWA 4Z1YA 2Z2AA 4FNTA 1UQZA 2WQDA 4XG1A 2Y4SA 5CPLA 1EXPA 4Q8NA 3K4AA 2VC6A 3TTSA 1NJJA 1ME7A 4RR4A 4ZO9A 3SY5A 4DAFA 5G5IA 3RJYA 5I09A 2XWEA 2WZIA 3TMLA 3R2GA 2QGYA 1BYAA 2DJXA 5CZ0A 1QFEA 5TD4A 1LOSA 4IQEA 1BYDA 3S5YA 1G69A 2NUXA 2NT0A 4O17A 2EAWA 3L2LA 4JQAA 1QI4A 2C18A 5D09A 1UR3M 5I03A 4JX6A 2FZ9A 3LOTA 1QOXA 1GJUA 4QJ1A 1VGAA 4UMBA 2OZ8A 3TYAA 2PBOA 1OC5A 5E0KA 3VAVA 3EA3A 4LJ3A 1VBGA 4UTIA 1E4NA 1KM4A 1S2WA 4RW3A 4HK6A 1RBAA 3M0JA 1WZAA 4MSSA 2FTYA 1CXKA 4MPKA 1XYLA 4GY0A 1EC7A 3U5UA 4MAVA 3APTA 3MDUA 3BSHA 3T81A 3QZAA 1UJQA 4I7UA 1UOZA 1VJIA 2WJEA 4WX2A 2FFCA 5BU6A 3W4RA 2R1KA 4M6UA 3QY7A 2REQA 3N9KA 3E5BA 1M04A 5HWJA 3VC5A 3WLLA 3M7WA 3OLIA 3IJIA 2JEPA 1XC6A 1PS9A 2ZA2A 1J0HA 1LQ0A 2GUUA 4LS2A 3AXIA 1W2PA 4E5TA 1DXEA 3V16A 4BWLA 3ENLA 1KR1A 4P8XA 1LBLA 3EWUA 1LLZA 5BOFA 3PZNA 3GDKA 4MB4A 3LV5A 1FH9A 2JF7A 1B90A 4J1OA 1GCYA 1YLVA 4AD1A 2H8XA 1YW1A 1VYRA 1K70A 3C5QA 4NRRA 4TV5A 1JYNA 4WF7A 4C6NA 3NM3A 3BUVA 3DYPA 1JNEA 4Y9NA 4KPLA 2O55A 4MJZA 1E15A 4DX3A 1LJYA 4KQNA 2D69A 2Z2UA 2VC7A 3LUTA 1DWFM 3HFTA 1J12A 4UTUA 1GT8A 3SCPA 3R6IA 4JDYA 4R85A 4TXEA 4OGZA 3PFRA 4C6EA 1ME9A 3HPSA 1H49A 4FXRA 3E12A 2VC9A 1WAUA 3GG8A 3UEQA 3W27A 1Z69A 3F2BA 3BAIA 3FVMA 4G9PA 3P5ZA 2C1HA 4JTAA 4L1XA 4N4QA 3UFYA 3K4DA 1OCNA 2X0YA 7ODCA 2NT1A 1BRLA 3JR2A 1UZ4A 1YPXA 3HGSA 2J7FA 2CHRA 1X96A 1DVJA 3DENA 9CGTA 5EU9A 1GOIA 1W1A1 2F6UA 4FA3A 1PO9A 2QJNA 2PMQA 1H5VA 3B8VA 4A8NA 3T0BA 2G3FA 2YKKA 5LNWA 4TO8A 4V1XA 2Z2BA 3EDKA 4MG4A 3STGA 1N8FA 3W7QA 2VEMA 3CPRA 1XLKA 5DCBA 1CB7B 2ZWYA 3L68A 1A5OC 4MWAB 3W24A 3GZAA 3C2EA 4CKQA 5FAGA 3QKZA 4H6RA 3D46A 4O0QA 1XCWA 3KBJA 3CZEA 2OSYA 4M0XA 1E1CB 4EF9A 5DY3A 3F4VA 4WQ6A 3L66A 4R9XA 1HG3A 3TC6A 4NASA 3G1SA 3QGKC 5EMLA 4MGGA 4LVBA 3W75A 1MDRA 1W3LA 3CASA 1QAPA 3ZJ8A 1CGVA 3VD4A 3PTKA 4UNKA 1Z89A 2J7CA 4XZWA 2EJ1A 4GUHA 3M7SA 1VBHA 3KZSA 2Z1VA 3VOJA 1JUKA 4HKPA 4D9PA 1RCOB 4L6DA 1WNOA 3U7VA 2YFOA 1IT0A 5C55A 1XSJA 4ZO6A 4DIAA 3CQIA 4KF1A 3U2ZA 2VCCA 2YCKX 3R0UA 1EJRC 4NXSA 1XJBA 5IM51 3S5ZA 1FUYA 4DZ5A 2WXDM 4PCNA 2NW0A 2DH3A 2OOFA 4AWUA 2YXGA 3WEZA 4P8VA 3RYSA 4MLJA 3AIQA 1RD6A 1SW7A 4ZO7A 3P6LA 2X8RA 6PTDA 2EEXA 1UYQA 1NARA 4TIMA 3TZNA 1BWKA 3TTYA 5E9AA 3PPHA 4DNHA 2F84A 4HCHA 3UWVA 2VX4A 5F4WA 2Z1SA 2HXTA 3W1LA 1TVLA 1YE4A 5LGZA 4UMCA 1W1PA 3CS2A 4YPJA 1J0JA 3I65A 1JF6A 4CQBA 3NM1A 2XIJA 4GO8A 1UZHA 1F7BA 1PX4A 1WDQA 1T8QA 1VFFA 3C0LA 5CAKA 3XISA 4ZMGA 4DXXA 1SR0A 4YHGA 2ZXQA 2I17A 1Q8JA 3G0SA 2A3HA 2YL9A 1AQHA 1QVBA 3O0FA 3IJQA 1JXKA 3NCOA 5EFFA 4GZ7A 4XVEA 1LWIA 1VEPA 1TJ2A 2HZGA 3LPOA 1ODZA 2XSBA 3OGVA 3VPLA 3L4YA 2A4AA 4MTVA 2EXOA 1YYAA 2CW6A 3T2QA 1P7TA 3W7GA 1M01A 3SQSA 3CM4A 4G7EA 2C19A 5MKGB 1UP3A 1C9WA 3BAKA 4GXWA 5LIWX 3M6YA 1I2PA 3Q2DA 3SURA 4ERIA 5I3KA 1KFWA 2WHKA 3SDOA 3WUFA 3UGVA 3TN3A 3RLGA 1XLAA 4PBGA 1PCWA 4MY8A 4WSHA 1VRXA 4PRWA 2D23A 1VPQA 1VB9A 3UXAA 4J3VA 4G6CA 2E40A 3GXPA 1R3SA 1LL6A 4JTTA 1T5AA 3ZMRA 1FWSA 3ZJ7A 2I57A 2VR2A 3WQPA 4B4HA 2WZEA 5DMLA 1FCQA 1XLLA 1Q4NX 3HGJA 1VCVA 1ADSA 3CHVA 4H19A 2QLYA 1G1YA 4IJCA 3TR9A 2Z25A 1TRIA 3MUIA 5LIYX 4GQGA 4OTKA 3LG3A 1EJSC 2Y6ZA 2NLIA 5FJOA 6TIMA 3R0KA 4ZGYA 6REQB 2ACRA 2HCVA 4ECLA 3SY8A 1P6BA 3V1PA 2QCCA 2VQUA 3GH5A 1E6RA 2XVPA 3MUAA 1R7AA 2QNEA 3BAYA 3MW7A 3A13A 3OLDA 3MHUA 3KAOA 5GNXA 1CGTA 1IEIA 4J3UA 3WNPA 3E9AA 1J18A 3N6JA 5F2GA 2YCJA 3LS9A 3MSGA 3FKKA 3MUZ1 4Y8FA 3HG4A 3OVRA 5CH9A 3AMGA 4EPDC 2X41A 1JPHA 4RLIA 3PF3A 3SCQA 3GHUA 2FH6A 3PZOA 5KSWA 1O6IA 1W37A 3SR7A 3F1QA 1BVWA 2DQWA 2TAAA 2QJJA 3RGTA 2F61A 3PJXA 2G37A 2PAJA 4FF5A 1ZENA 5IXEA 3K4WA 4L80A 4US5D 4NNCA 1ZAIA 4PULA 1JRBA 3LHUA 4U10A 2QS8A 3IK2A 7TIMA 2XN0A 1VIWA 5HMDA 2XTKA 1KCLA 3P3BA 4RZ6A 2TRSA 2QPUA 2Q02A 1JF5A 1VBUA 4XO6A 1UKQA 4D72A 3H55A 3GR4A 1J8VA 2X05A 2FFIA 5DN1A 4E4FA 4NUWA 5AYIA 1LM1A 1XUUA 3CL8A 3KOZA 4YWIA 1AK5A 4HT3A 1S5MA 4H8NA 1RP8A 4LNYA 5CC5A 3VKBA 4I9TA 2G3JA