4HIEB

Anti-streptococcus pneumoniae 23f fab 023.102
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
206
Chain Sequence
b'LINLVESGGGVVQPGRSLRLSCAASGFTFSRYGMHWVRQAPGKGLEWVAVVSSDGRTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKEGGDNKFSFDYWGQGTLVTVSSASTKGPSVFPLASESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPQTYTCNVDHKPSNTKVDKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 023.102
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 206
sequence length 218
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hieB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hieB01
1MFBL 5F44A 3TFKD 4L3CB 3SGEI 2H2PD 4UDTA 2KKQA 5B38B 2ICWB 3HI6H 1UB6A 4PLOB 1ZSDB 5KZCB 1KN2H 3HI5L 4RMWA 5ERWB 3FRPG 5B8CC 4LRIC 3AU1B 4MD5B 3ZE1F 3HMXL 3LN9A 5ALBL 2NXZD 3PQYA 4WHCA 1NGQL 3U9PH 1JYWA 3MRKB 1UADC 2A1WH 1CU4H 4ELKB 3P73B 4JVPA 3REWB 4L29B 5JPMB 3L95A 3UO1H 4PJ5D 3IS0X 3PDOB 4Z0XB 5TH2B 4E41D 3QBTB 3MBEA 1KN4H 1J1OH 2ZUQB 4LPTA 2A74B 3UTSA 4LLQA 3FN3A 1OTTD 4R7NB 1M7DB 2EDJA 3DUSB 1MAKA 4PB9L 4LLVB 2AXGA 3DETD 1YJDH 4QRRB 1YJDC 4LPUA 2EIDA 4QHUB 4MCYA 2FJFB 4JFHD 1A7QH 4M6NL 4TSBH 1E6OL 3QUZC 2YZ1A 3KYNB 4BJLA 1PSKL 4Q6IC 4HBCH 2NQCA 2A73B 3EDDA 3CIQA 3VXOB 4L8BA 2NY3D 4U3XA 3F6LA 4XNYH 3NMEA 2G75A 3EKCA 3AREC 1B90A 3FFDB 5CSZA 1KPRA 2W0PA 1T5WB 4MJ5A 3ARGB 4YQXH 2BC4A 2VLME 5T3XL 3W9EB 3NIFF 4F7PA 3DX7B 4ZYKB 1KN2L 4XPGH 2BCKB 3RKDD 4WFHE 5JXEA 2ITDB 3RL1A 4ZO6A 2IALA 4MA1C 4WU5B 1NH6A 1U8NB 4Y16B 4DKEH 4BK5A 4U6YA 1HDMB 3L6FB 2NZ9C 3O4LE 3RHWF 1JHTB 3C87A 3A6BH 5IHBA 3MLWL 5E9DD 4TUOB 5A2FA 5FYJH 3U9PL 1CFQA 5JHDB 4ODXA 2A1WL 1CU4L 2NPLX 5JOFB 3ZE1E 5IFJB 2HLAA 4U6HA 4NQCD 3CVIH 2V7HA 1TTFA 4LLYB 3S37L 1BJ8A 1KN4L 1TZIB 4YFLI 4AM0B 2VL5B 4Y0GA 2YD1A 3FQWB 3MLVL 5TPWH 3DVGB 3H7BB 2AJSL 1NGZB 4HT1H 2WZPD 3D0LB 4IRJD 4S11A 4NC2B 4KJWD 3IGAB 5BVJB 3L3GA 3S6CA 1NDMA 3OJ2C 4HBCL 3P9MA 4TUJA 4UNVA 4HJJL 4BQBA 2VXUH 4XNYL 3GKWH 5EOQH 4WI9A 3IJSB 2NY5H 4R90H 1M7IA 2NY5C 3QUXA 4LHQB 4O51B 2X1WL 3IKCB 4B7IA 3O4LA 4YQXL 2WAHA 2N4IA 1ZGLA 1Q0XH 3C60B 4OF0A 2R0ZH 4PJGB 2PUQT 3E6HB 4TSAH 4IRZH 4XPGL 4OLUH 4HWZA 4AEIH 5HPOA 3NIFE 4QXUL 1OT1A 4PB0L 3WJJA 4JFEB 1IAOB 5CJXA 3HMWL 3QJFB 3A6BL 4BUGA 4OCNC 5FYJL 1MEXH 2VXQH 1UWXK 1C08B 3X13A 1DN2A 1CGWA 1LEIB 3TBTB 3OKEA 3CVIL 2CMRH 1NCAH 4LLDA 4WEMB 4OQTA 5KN5A 4GKNA 4K71C 3EFFB 5TPWL 4BFGA 4U6XA 1NBZB 3FQRB 4HT1L 4D0BA 5AUMB 4L3ED 2DWEB 5DJ0B 3VFMA 1C8PA 1NFDE 1Z9LA 3LOWA 4GMTH 3P4LA 3MRHA 3UZQA 3QUMA 4MJ5B 4DVRH 2DQCL 4JRXD 1FVDA 3BWAA 5C0AD 2Q76A 3BDBA 2VXUL 5T1KD 3KR3L 3GKWL 5DTFB 4CRPA 4J8RA 1HHJA 2HLFC 3CH8A 4EOWH 2NY5L 4RMVA 4BZYA 4M61B 2HH0H 4HXAL 2XA8L 1GGUA 1PKQE 3DROB 1AIFB 3CSPA 1U8IB 4E42A 2LAGB 2R0ZL 4TSAL 3CMOL 4M1GH 3TLRA 3HUJB 1MVFA 4YDKH 1EJOL 3G04B 3Q48A 4NQDE 2JB6A 2FGZA 1YMMD 2MHAA 5EWIH 2BSSA 2VXQL 2CK2A 2R2EA 3HPJA 3GBLA 4H5SB 5FYLH 4BQCA 1M7XA 5LAXA 5KVMC 1IQDA 4M5YH 3T77A 4PR5A 5EIVA 1NFDA 3OHXA 2P47B 1TJGH 2AKRA 2FX9L 1NCAL 1XFPA 4Z5RB 4OZFH 5ESAB 2QKIA 5SX5K 1RUQH 1UWXH 1HNGA 4TUJB 1OSZA 5J3HC 1II4E 3ARXA 4DZBA 5FKAA 5GS1C 1AJ7H 3KPSB 3F65A 5SWSB 4XP5H 4Z7OE 1ORQA 5EZJB 4GMTL 4ODHH 5DMGD 3IDMA 4GRWB 5HVHC 1DSFL 1PKQA 2CLVB 3U46A 1JGVH 3B9KB 3X3FL 5CD5D 5HHME 4KRPD 1AE6H 4G42A 3BZDA 3NFPA 5KAQF 2DICA 5IOPB 2EE9A 5IJVA 4YDIL 3QUYD 4NFBA 2HH0L 1JWSB 3LB6D 5GHWH 4HC1A 1Q0YL 4NQDA 4NQSA 1J87A 4FQIL 1BWWA 3QIWC 5AG8A 4N90E 1C12B 4YHMH 2IAND 4PGJA 4LCWE 4WU7B 1RK0B 3INUH 4M1GL 5HI4D 3ROLA 1PEWA 3I6GA 1IQWL 3QNZA 1G1CA 2RR3A 4UIMA 4ZDHA 1L7TH 4KWUA 5KN5B 4M03A 1S7QB 1MF2H 4KI5D 3LEYH 1MHCA 4POZD 1FZMA 3NFNB 2P42B 1T83A 5EWIL 3WFZA 5JW4N 3U83A 5BS0D 1UQSA 2GK0B 2Z93A 1A02N 2GJ6B 5E6ZA 1PD6A 1TJGL 4NO0A 2E27L 2WIMA 3FOLA 2ENSA 1D5XA 2IC2A 3T0WA 5DGRA 4J7RA 1OPGH 5FM5O 2EIEA 1AJ7L 2ITCA 3BN9D 3NZHH 1JE6A 4XP5L 3WO4B 4WTXA 2PXYA 4PJ7B 1J0ZA 1JYNA 4ODHL 1H9VA 2FEEI 5FF6A 1S7SB 4RZCB 5FYKE 3ZYOA 1MAMH 4OLYH 4FHBD 4X0KA 3LRGA 1JGVL 2Y07H 4S1DD 2JCCB 2EYRA 1AQKH 1AE6L 4LCWA 2BNQB 1S9KC 3QHFL 3O6MH 3GSXA 4AL8L 2GT9B 3MNWB 5GHWL 1QVOB 5T1LD 1GVIA 4LOUC 4PLJC 3TH4T 4NNXA 3P40A 4R96A 3VRJA 4YHML 4O2FA 4P46D 3QDAA 4WNQA 2YN5A 1CWVA 1MVUB 1KPVB 5K33A 4ZOBA 1CVSC 2ADGB 4G8GD 3UTTD 1P7KA 5J7CC 5D6CA 1FYTD 4KDTA 3RVUD 4OB5H 1MF2L 2OR8A 4FQXB 2X09A 2ZCHH 4JFDD 4DEPC 5MENB 5CFHA 1NCNA 1H15B 2ZKHH 1KSRA 2FIKB 1QFUH 3IYLW 2DS4A 3GSRA 5E8OA 5E6ID 3BP4B 1JGEA 1OPGL 2ZUSA 4NQUA 3STZA 4JDZA 2YA1A 3NZHL 3RJDA 4CU8A 3T2NL 5I1AB 1CQKA 5CGYD 4LF3A 1LWRA 2VR9A 1MAML 4WI7A 4XX1E 2Y07L 2DB8A 3K8MA 5IJKA 4J3VA 4JDVA 3SDDB 1AQKL 5HYJE 1I3GH 1P5VA 1X5YA 2VDKL 5JDSB 1MQKH 3O6ML 3ROLB 3VXUE 4NYLA 4HKZB 2VLLB 4ORGB 1BQHG 2B4CL 1YEGL 4I4WB 1WLHA 2Y5EA 3ZE2E 3I9GH 3GBMH 2QBWA 2ZCKH 3SE4A 1AHWA 3QFJE 2P8LA 2FATH 2RB8A 3LPGA 5DZOA 1E4XH 5HHOB 1V3MA 1FSKB 3D3VD 3STLA 5KVDH 1HI6B 3IDXH 4N8CL 4MB5A 4C59B 1IJ9A 2FX7H 1QFUL 3UYPA 1MCBA 2AK4E 2V9QA 1I8MB 5EU6E 3NCEB 4PRIA 3WXVH 4D8PA 4PRBB 2MWCA 4UBDD 4JPWH 5HYJA 1GGCL 4I0PC 4KHTL 4NQTA 3VXUA 1KJVA 1VFUA 3I02A 1D9KC 1L0YA 3MRQB 4JFQA 4AJ0A 2HJLA 5J56B 4R26L 1HXMB 5D1XA 3WIIH 5IIEB 4PTTB 4GAFB 4MD4B 5KSAD 4XNUH 3E3QE 3O3AA 2XG4A 3UTZA 1MQKL 4Q6YA 4MB3A 3QHZH 5HGBA 1QNZH 1U3HD 3FO0L 3D39E 2WBJD 3QFJA 3K80A 4H8WH 4H8WC 1UXWA 4HCRH 3FB8A 1UZ6F 3RFZC 1RZIA 1MRCL 3GSNH 4WCYH 3GBML 4EVNA 5JTWA 4ZFZB 3MJ6A 4AQ1B 1NUFA 4JE4B 2AK4A 2OL3H 4FQPA 3NIDE 4V1DD 5D7JA 3E8UH 1MOEA 1T5XB 2FATL 4WI6A 4M7KH 4WW2C 4X9IA 4KK6D 3DBXA 5EU6A 1FFQA 5GGQH 4PGEA 1E4XL 4ZXBA 2WWKT 2AVGA 4LRNH 1CFNA 2X4NB 4UILL 2ATPB 4GAYA 3HR5A 3K8LA 3B9EA 4NRXB 3MRBA 2D0GA 2LV4A 2QSTA 1CFSA 2ED7A 3KJ6H 1A7BA 1YYLL 1IE5A 2XFXA 1JHLL 2RJMA 3BUTA 2J1KA 3ESVF 4JPWL 3T2QA 5KVEH 5DI8B 1T66D 3WNPA 3ECBA 5EUOB 1U8QB 2AJXH 3D39A 3F8UB 3D18B 4LCYA 1S7TB 2HG5A 2VABB 4AH2B 3WIIL 5MEQB 4G9DA 4NQEE 4U1IB 1C16B 5C0BB 4CVXB 4XNUL 3U79A 4GMSH 3MRJB 2JK5A 4HUKB 4YXKL 4LAQH 4AG4L 3QHZL 4GBXA 1INEH 4N0CD 3IFLH 5C09D 4L4JA 5MP6L 5KSBE 1T21A 5DUMH 3BKYL 5JDJA 1GYAA 2ICWJ 3ZHKA 4MAYB 1ZV5A 32C2B 2OL3L 5C07E 3WUWA 3E8UL 3MOBH 4J23A 3ZTNL 4JQVC 4M7KL 2D7OA 4LRNL 4D8PB 1PVHA 5D6DC 1EO5A 3QO0A 1XZ0A 3DPBA 1CI5A 4NN6C 3HPLB 3QDMB 5TDOA 1AGCB 1ZVSB 5KSUB 4BQ9A 2WUCH 1B4JH 4NCDA 5HVWA 2HFFA 4MYWB 3KJ6L 5SX4H 4BQ6A 4NQEA 4YHYC 4Q97A 5CEZE 1YY8A 3EDEA 5KVEL 3ARDA 3NVQA 4UTAH 1IGIH 2XN9D 3KXFB 3VFVB 1NBQA 2H26A 3U4BL 9CGTA 4M7ZC 2AJXL 3EOYG 4NPYB 3RWHA 3WFCH 1UZ8B 5IB2B 3AS3A 2FHCA 2NXYC 1T3FB 2E6JA 3MGOA 4JRYD 1K4DB 5KSBA 4IOIA 3L5HA 2OR9H 1HYSD 4OZHE 2UYLA 3BSZL 3BGAA 1B3JA 5EO9A 4ZUVA 1MCJA 3VXPA 2PTTA 1INEL 3FT3B 3ULVD 4TVPE 1ND0B 5C07A 4DGYL 2QTEA 3KJ4B 4HS6A 3UC0H 1R0AH 3MRGA 4MHHI 5CMAA 1R5VB 4YHIB 1T1ZB 5HYSG 1BZ9B 1X4YA 4K3DH 5DJDA 1JI1A 1MCOL 2A6IB 3CDGA 1G6RA 4H25A 5JMRA 3BJ91 1AC0A 1JZ5A 2RQ8A 4UV7H 4Y4KD 4FA8A 2P1YA 2OZ4L 4PJDF 2HWZL 1B4JL 4H20H 3QIUA 1UEYA 5T3ZL 1XCTB 4DWHA 5I1CH 1U8OA 1DBAL 1JMZA 2EIBA 1JPSL 2F5AH 2PYED 3LN5A 2XWBA 4ONHA 3AB0B 3UDWA 4ONFL 3VXSB 4RBPK 1N6QL 4OZHA 1MRFH 4MAUH 4U1GB 4XVUD 5CEYB 3LEXB 4GBXB 3GO1H 3HZVA 4R97C 3OXRA 5D1ZA 2Q87A 4L1DA 2FYYA 2PO6D 1U6AH 1EFXA 3W9DB 3ARFA 2AGJL 4YWGL 3CLEH 3CX2A 2XT1B 2NY4B 3RVWC 2EDEA 2APTA 4AENA 3H2WA 4MZ2A 5GGTH 5IT2H 3AS0A 2H32B 3FB6A 2AP2A 4ZUSB 3KPNB 3S4SG 3RWEB 5EOTB 3UC0L 4MJ2A 1AGDA 1XZ0B 4PJ9D 4JVUA 1GIGL 1LQSR 4K3DL 3RZWA 4MS8D 2W92A 1EO7A 4LIQH 3TN0C 4CVZA 4UQ3B 1E4JA 3RY6A 2EXYD 1H5BC 1YNTB 4AIXA 5JZ7D 4K55A 4H20L 3VRIA 3X14A 1QSFB 1J12A 1QBBA 2FX8H 4JQXA 4EI5A 1NCDL 5DA4A 5J57B 2K7PA 4JZOA 5B4MC 4HIHA 2YUWA 4HWBA 5D1QA 3CC5A 2GCYB 4R7DA 1EO8L 1MFAH 1B6DA 1X5GA 1JZ4A 4MAUL 1D5MA 3DURB 1U6AL 1NBVL 3QNYB 3X12B 4J3TA 1R3JB 4PV9B 4B5EA 4ISVB 3CLEL 2ZWLT 4N8VG 5HBBA 4RBPH 2OTWA 3B6SB 4LSDA 2ENYA 4K7FB 1RK1A 4OBRA 1DDHA 2UZIH 1K8DB 5CJOL 1E4WH 2A77H 4GS7B 1D3CA 5GSVA 5GGTL 3T1FA 5IT2L 2HN7A 1FBIH 4H25B 5ID1B 4O5LH 1MWAH 3MZGB 3NN8B 4G9FA 3VFOB 2DRUA 3UX9B 1WCBA 1SBSL 2MKWA 3TBSA 3MA9H 1FN4A 1OAUL 1F6FB 4LIQL 2F54D 1C1EH 2XG5A 5GGUB 1P9MC 4YHOL 3FTGA 4O02L 4MX7B 4JJHA 2BSTA 5JHLH 1HN1A 1EXUA 1UCBH 2AV7B 5DT1H 1U8PA 2O5ZL 4C56E 4CKVX 5J8OA 3O6FD 4QGTA 5D7KD 3VA6A 1MFAL 1UVQB 5FKPB 3CCHB 4LQ1A 3QAZB 5HJ3A 2RAMA 1CL7L 3MRNA 1TJIH 4F80A 4PGZA 3S36X 3I6LE 2NLJB 1ZGLP 3TF7C 3MGTB 1KEGH 5I8KH 4JQIL 1ROWA 4TTGA 4NO2B 3VXRD 3QWOA 4J2XA 2UZIL 4NO3B 5HGGS 1E4WL 2A77L 1OAQH 3SKNB 5CKAA 4Z8FH 1F2XK 3G5VB 4UNUA 1YMHB 1T22B 4O5LL 3JTTA 3ARBD 5C3LD 3QJHA 4N68A 1FH5H 3GMPB 5HDBF 1NGYB 4YAQA 1Q1JH 3NOIA 4H1LH 1CD8A 5I0DA 3MA9L 2JIXD 2YPVH 2ZOKA 4KRNA 3LQZA 5AAWA 5HHXL 1AGEB 4C56A 1Q9OA 3T09A 4HIHB 5FUCE 5CZVL 4KVCH 3TNNA 3IETB 3LKPA 3UJJH 4J1UA 3RGVD 4KHXL 1F3DJ 5JHLL 4QRTA 5D2NE 5IEHA 1UCBL 1T0MB 5C1MB 2R39A 1Q8MA 1A2YA 4XHJC 1YUHB 3MZTA 4W4OC 4D3CH 1TENA 2F74A 5GGRY 1BAFH 3H9HA 5FO9A 3KLSA 1VSCA 1CICA 2ICEB 2B2XL 4GQPH 3T0EB 4UOJA 3MRCB 2R29H 1DEEB 3QCTL 1I1FB 5I8KL 5I1HL 2GFBB 1A9BA 3FFCA 1HE7A 4G9FB 1M6OB 1T4KB 5TFSH 1P2CA 2HFEA 1TTUA 3T0BA 3MLPA 5IB5B 1CS6A 5JQHC 4F33A 4Z8FL 2H1PH 1ZLUK 4UT9H 2HTKC 3LKOB 3LVEA 3B2VL 5HHNA 1JUFB 2R56H 1FH5L 4WUUE 1Q1JL 1DUZA 1KCRH 1OW0C 4HMCA 3EOBA 2ATKB 5D2NA 2E8ZA 3W11D 1TIUA 2I25N 2YPVL 1MHPH 4JREB 1CXLA 1NAMB 3T0DA 3LDBB 2ADIB 5L88L 1A6UH 5F6HJ 1NC4A 2VE6B 4JY5H 4KVCL 4XPBL 4OUUA 1U8MA 4V2BA 3TA3C 1S7VA 2DQEH 2XTJD 3MJ8A 3UBXB 4RGOL 3NTCH 3QG6A 3C5SB 4MNHB 5MEOA 2OK0H 1G84A 4D3CL 4DN3L 3WIHA 1XR9B 5I18L 2AERT 2BVOA 4RAHA 4S1DC 5DJXA 5IBTH 2R29L 2IAMA 1HSBA 2VKXA 5ESQB 1XGUA 3V7AG 5BO1H 3WHXA 3HC3L 1EHAA 3HE6B 3RVXC 1ORSA 1CG9A 4IRSD 5GIRA 2X4SB 5F7DB 2GUOB 3TNMB 5ENWA 4Y5YA 3QISA 3VMOA 3D2UB 4WUUA 3O9WD 1ZHBA 1IGMH 2LTQC 5A1AA 1K4CB 1S9XA 1IGFH 5L0QB 2H1PL 4UT9L 1FNSH 5F8QC 1KIQA 1OAXH 4JFZH 4K8RH 3KPOB 4K8RC 4RA0C 3BIBX 4U6VH 5GZNC 1MUJB 1P4BH 3RDTB 4Y2DD 1KCRL 1FNHA 1I75A 1ZLUH 2IPTL 1FZKA 4QRTB 1G7QB 1MHPL 4QRQB 3Q3GB 3VWKA 2ESVD 2X70A 4XNXH 5KSVA 4JY5L 1V3LA 2F74B 1XIWC 2M8XA 2VWEE 3HG1D 4ZFOL 1B0GA 5TJWK 2DQEL 3A6OA 5C0JA 3A6CH 5I17B 3NTCL 1MFDH 4FQQB 1KB5H 2YD3A 5GGSA 4RGND 3FFCB 3KS0J 3VFWB 4OZFG 2OK0L 4JZJA 3KPTA 4JN2B 1DZBA 3SGEH 3V6BR 1L7IH 2Q20A 3L3IA 2NW2A 4S1RH 1AO7E 3QSKB 5IBTL 3TV3H 4G6JL 3UAJD 3BKCL 1U9KA 3IDUA 4X6FA 5DD6A 5C70A 5CSGA 4GG6E 1IGML 2DLFH 4MVBD 1FNSL 1HHIB 4OZIB 4LVHB 3G6JB 4JFZL 1IL1B 2LU7A 4U6VL 4E9LA 2DM3A 43C9A 2EYSA 4XXDB 4FN0A 4FRWA 4EN3A 2BVTA 3LRSB 4QHKJ 5MERA 4U1KA 5IMKA 4XNXL 5I66A 5L9DL 1KJ2L 5J4MA 5EN2A 3WJLA 3QQ9D 4UDUB 5IUSA 3MBXH 4G5ZH 4JGJA 5AZ2L 3TIDB 1AO7A 4RSVA 4UBDC 3BRGC 4Y1AE 1HSBB 4NNPL 1MFDL 1KB5L 5D7LE 5JPNB 3CZJA 1CG9B 5EDXA 4FZEL 4JCMA 1S7UA 2NW3A 4GG6A 5CZXD 1V7NL 4JM2D 1L7IL 1S9XB 3V5HB 1XGYH 2DN7A 3GK8H 1HILB 5KSAC 3QB7C 4JKPH 1LNUB 2OTUB 3TV3L 3HB3D 4IMLB 3HE7A 4WENB 4BYHA 3OF6D 5DD5H 1C5DB 4UINH 1JK8B 2VQ1B 2UY7A 5EOCH 4KKBC 5B22A 2IADB 2HMID 2DLFL 2YR3A 2BSRA 5I75C 1W72H 2Z92A 1BOYA 1N64L 3QDJE 4ODSL 5IHLB 1F4AA 1QBMH 2JJVA 4NBYB 2D2OA 1DP0A 4HS3A 2HYMA 5I1LA 4XRCA 3VXNA 5F7UA 5EBLA 2HT2C 2P44B 2JJTC 1HEZB 1TJHH 4MXQC 4Y1AA 5BQ7A 3SO3C 5D7LA 5E8NB 5EC2A 1K3ZA 3SKMA 5J1SC 4MA8L 4NKDA 1RV6X 2VIRB 3HZMA 5TDPA 4X4YB 5AYQA 2M2DA 3QRGH 1L6ZA 4PJ8A 2FSEB 4KKCC 4PJEF 3RTQA 4Z7UF 1CVRA 5CZKA 5FOJA 3T2OA 2ICES 4NQVB 1XGYL 3D85A 3MRMB 2NYYD 3GK8L 5IKCA 1R3IH 4WWKA 2X4OB 1MSPA 3QDJA 4IIQC 2PW2B 4DCQA 1IGYB 4Z7QF 4XCNB 4XCYA 1HQRA 2E7LA 5DD5L 1OAZH 3MRRA 2Y23A 2MQCA 1IAMA 5EOCL 5DDHA 3GSVA 1QEWB 1WBYB 4JKLA 5KS9B 3IAQA 2H8PB 1CLZH 4TYUA 1AXIB 1W72L 3WN5A 2AJZA 5IMKB 3IFOA 3MACL 5E70A 2QQLL 3TZVC 4N1CA 1VGEL 4QRUA 3HC4L 4ESKA 1KJMB 4HK3J 2BHYA 4M7LH 1G7LB 2DD8H 1P4LB 3BPNC 5SWZE 4XB8A 5DYOB 3ILPA 4CJ1A 1TJHL 1EEYB 1VFAB 4YPJA 1CF8H 2FO1A 3EYQD 4I18B 4FMFA 3VFTA 3LN4B 1NKRA 3EOAB 4ZAKD 5E2JA 3KPMA 4Y5XA 3Q1SH 2X9WA 1CZ8H 1JF6A 4XNMA 3P30H 2V2WA 5B39A 3SCMD 2V2TA 4F7MA 5E5MA 5H2BB 1VFMA 3L3HB 1EHLH 3H3PH 2Y6SD 3LKSB 3VWJB 3RIFK 4CUCA 1WFOA 4JKKA 5K9KB 4GKOA 1A3LH 1RULH 5JW5A 5HGHA 1PX3A 4PJFF 5DLML 1HYSC 1R3IL 3H9ZA 1KPUA 5INDB 1JTPA 3X3GL 1AR2A 4TRPH 3SDXB 2FLRT 3O8XB 1OAZL 4G80A 5DQ9A 3NGBC 1EUTA 3OKOA 5SWZA 5C3TA 4P4KA 5IQ9B 3B4NA 4I48A 2Y9RT 4F7TB 1FIGL 4L4TD 3ARRA 4OZGB 1KF9B 4OQ1A 3DTXB 1HH9B 3HS0A 4LKXA 1RIUL 2P8MB 5IK3B 1YNLH 1F11A 3EDFA 4ZUUA 1SEBA 2VLJA 1HOCB 4OCYH 1CLYH 1NJ9B 1CF8L 3MNZB 2EDRA 1LEKA 4RMRA 1JNHB 1QRNB 2M1KA 3DMMA 3SKOA 2L7JA 5ELIA 5I8CB 2O61B 3ROOA 4XNZC 3OKMB 3Q1SL 3D85B 4MA7L 5MI0C 3EGSB 1MHHA 2D9CA 3DX8A 5EORH 2Z8VC 1EHLL 4XB7A 4XVUC 5EU7E 4XCCH 1LP9E 4GFTB 4XCYB 3KAAA 1AD9A 2LABA 3U7WH 4Y5VA 3L3OB 2EZ0C 4UV4H 1E0OB 2WWMD 2F58H 3DI3B 1HIMH 3KWWB 4L4VA 4U1LA 5DUBA 1LMKA 1OGAE 2OMNA 4XWOC 2AJZB 3O41B 1T89C 3SDAD 5I30H 2R0WH 5J6HA 1ZE3C 5DC9B 3DWTA 2FB4H 2G9HA 3MRDB 2IPKB 1NC2A 5I1DA 1BD2B 3K4DA 4LU5L 1CFTB 1E28A 1JV5B 5KZCD 1QR1A 5E5UB 1Q38A 4GKSB 5D70L 1ZLSH 1JRHL 3HAEA 5DFWH 2FGWL 4O2CA 2HVKA 1CLYL 4E5XA 2R9HD 4KKAD 3BUYA 5T3ZE 3PWUB 3IU3B 2YPKB 1IC7H 1LP9A 3TVMB 4P2RB 4KGLA 4C83A 4FTVE 1OGAA 2P48B 2V5TA 3MTRA 5EFIB 5EORL 1QKZH 4XCCL 3BP6B 5EBWA 3W5MA 2I07B 4YDJA 3MMEA 5TDNB 4HH9B 3U7WL 1KEMH 4UV4L 3NH7H 2DJ4A 2F58L 5BZWB 5J0BA 3VMNA 4OFVA 2W91A 3B9AA 4K9EH 4LASH 1MJUL 4WHYH 4K9EC 3MLYH 1JFQL 2CIKA 4LNRB 1S9WA 5C0CD 4U4BA 5I30L 1JZ2A 4CBPA 3A67L 1R5WA 3QXWA 4Z7WE 5E8DL 1P4IL 1H3TA 4OM1H 4QHMB 2OZ4A 4K7PY 2FB4L 4X9HA 1YN7A 5C0IB 3EJJX 2DM2A 4PJ5E 1EHXA 4PYGA 2HT4C 4WV1A 3O11B 3BMVA 3VI3F 2FJHB 1ZLSL 4Y16D 5E99L 2DYPB 4UUJB 3S3JA 1BQUA 4NSKA 3GMMB 4FQHA 1JNLL 4FTVA 2I60H 1FL3A 4JFHE 3F7YA 4P2OD 4DK6A 2Z35A 2FEEL 5EPMA 1FC2D 4F8TA 4L4VB 4X7TA 4XMLH 3SN6N 2DDQL 5HHPB 3T3ME 5I9QC 1I3RA 1RURH 3NPSC 3O2DL 2VN7A 5F1IA 5DJCA 1P7QA 3V5KB 3NA9H 5HYQB 4Z7WA 1S7XA 1KEML 5EA0H 5L8KB 1Y6MR 3ULUE 1PY4A 4R4BA 4M4RA 4G8FA 4K9EL 4JM4L 3MLYL 5LQBL 5BXFB 1U58A 4PJ5A 5FV1L 1RJZB 1VACA 3NCYP 4KDWA 4OM1L 1CDYA 1DCLA 2XPGB 2ZUUA 5E9DE 4WEBH 2HVKB 2V5SA 1KLGB 4GW5B 2VZVA 4RRPG 3PQYD 3W2DH 3C60D 2YEZB 5DRXB 3MGAA 4ZUTA 4APQB 4ZUWA 4P5TC 4HJGB 4PTUB 3WKNA 2DQTL 2OXHA 5CBAA 4KK8D 1EAJA 2OJZH 4MSWA 2X05A 3VD7A 5DJYB 3WNMA 4F7CB 3NZ8A 3VI3E 4EDWH 4HFUL 4LVOB 3ZDYF 4MJ6B 5H94B 4NUJA 4DUWA 3RGVC 1R24A 4YHNB 2FR4B 5EBWB 5INCB 3WKMH 1IGTB 2JLLA 1DVFB 1RURL 3IF1B 3FQXA 3CZFB 2NY4C 3IT8D 4X98A 2NMSA 1S9WB 3QXAA 4NM8H 3C8KA 3CFBA 3O2WH 3WXWH 1IBGL 5CWSA 5JNYA 1UJ3C 5E9DA 3HKFA 2XKNB 1IC1A 2Q6WA 1DEDA 2AXFB 4PJIB 3CH1A 2XWTB 4HUVA 1N26A 1S7RA 4MA3B 3KPQB 1A4KA 2DQUL 2JTDA 3JV0A 1YEKL 4JAMB 4WEBL 1F3JA 35C8L 3ELAT 4GW1A 1QHOA 4S2SB 2IH1A 2VLRB 3QDGE 1RUPH 4F15B 4X7TB 1MLCB 2X4QB 4LP5A 4Y4FB 1I3RB 4H88H 1L0XA 3FJTA 2R0KH 4JFFB 5DSCA 1FNEB 1P7QB 3RX7A 4BA8A 1UM4H 1I9RH 1E27A 4KJQD 1XF1A 2NY2D 4KPHH 5DHYA 3BEWB 3NCFB 1OTUD 4JRXE 4WHTB 1ZHNB 3GMOB 1LK2A 4NZTH 2BRRH 4ELME 2VLMD 3PHOA 4OI7A 1KBGH 1DBKH 3FMGL 3NCCB 4NM8L 2NTSP 5SWSD 4U1HB 4YEFA 4OM0H 2H6PB 4NRYA 3WSQL 2GTWB 1GH7A 3U36A 5LXGL 4L9LB 5EU3A 5ESVB 3O4LD 5JR1H 2ARJA 3PNWA 4LSUH 3T65B 1T0NA 1I1CA 3FONB 4F9LC 1XF4B 1WT5A 1GAFH 3QDGA 5F7KC 1YMME 3V0VA 1A6WH 4HF5L 3QI9A 1N59A 1HK6A 2HFTA 1QPPA 2W07A 4GRLB 5I71C 4PJHF 4HMEA 3BYYA 3IDJA 2HVJB 3MLZH 2XWJB 3NIGF 1RUPL 4JRXA 5IMOA 3JBG7 2YSSB 3LEVH 1NL0H 4P23B 4LPWA 4ELMA 3ZT6A 2UZXB 1JBJA 4H1LG 4D0DB 4IHOB 2PCPA 3G5XB 43CAA 3QAZC 1Z5LA 1X5LA 2V2XA 1UKQA 1I9RL 5F9WB 2YRLA 4KPHL 15C8H 1GOFA 3DHJA 4XXCA 5IB3B 4EDXA 1CQYA 3PP3K 7FABH 1N3NB 4XVSH 2G2RB 2BRRL 1MCEA 5T5NF 3O6LH 2VXSH 3MLXL 5BMFH 3CSYA 1DBKL 4QYOB 2Q8AH 5F7EH 3E2HC 3CFEA 4PP2B 4OM0L 4EUPH 5FA4A 2QSQA 3VRLF 4WJ5A 2AJ3B 3QO1A 3E0GA 1YMMA 4HIXH 3CVHL 3LRHA 2A83A 5JR1L 5EU4A 1MJ7H 1PGRB 2YC1B 1M1SA 3D9AL 4IJ3B 3EJZD 4Z77B 1JGLL 2XZZA 3U6RB 4Y4HB 4HXBL 1GAFL 1GZPB 4WDIB 3CPLA 4CW1B 4K2UL 4KI5E 1IVLA 2H45A 4PP1C 1GCFA 1A6WL 3LQAH 2DLGA 3LQAC 4I2XE 3VE0B 4UAOC 3O0RH 4GKZA 4DFIA 3MLZL 3FB5A 5ILTH 3OR6B 4O00A 2VAAB 3RIAF 4YHKH 2C1OA 4PJHE 1NL0L 4M8QB 1I7TA 4FS0A 2CGRL 4FQXD 4P59H 3MC0A 3P4NA 5MEND 2W0FB 2X4UB 1BQHB 1U8JA 2A6KB 4XCEA 3P2TA 5I76A 3KPLA 1QLRB 2OXGA 7FABL 5DJ2B 4XVSL 4LCUB 2VXSL 3O6LL 2ZG3A 2GY5A 3T08A 3W82A 2Z31A 5C6TH 1WCQA 2IMMA 4MZ3A 4OKVA 3FOMA 4ODWB 3PP3H 4NHUA 3P11L 1W8OA 5DXWA 4FQCH 5CSBA 4MQ7A 3UPRB 2DQJL 4Y19B 3LQMA 2RIKA 1IT9L 3QI9B 3MV9E 4I2XA 3PGDB 1F42A 1SYSA 2BNRB 2QL1A 5B3JF 2IH3A 1NAMH 4JREC 5T5NG 4FFZH 4GW4B 3U1SH 4PJHA 3IDYB 4JFPA 5D71L 3C5ZC 1N2RB 2YD4A 3LQAL 1MCFA 4YO0B 2E9IA 1FE8L 4NT6B 3T8XB 1Z6JT 3O0RL 5TF1H 1SJEB 5ILTL 1HXYA 5F71A 3WE6B 5DJ6A 4U6TA 4YHKL 3WCYA 5CIPA 3ZKND 1UXSA 3GRWL 3WMSA 3SGJC 1S3KH 5E1AB 4JZNA 2V5RA 4IS6A 3AM8A 4NBXB 3UP1A 5BRZB 4EI6B 1A7OL 1ACYH 3AXLA 2PXYD 3EO1A 4PJAF 1JYXA 5DD0H 2GSIB 5JW3H 3HE6C 3L3JA 1G7IB 4LP4A 3H0TB 3MV9A 4KMLB 1BJMA 4P46A 2GITB 4Z7VE 4PGCA 3QEQB 4RAUA 3O3UN 4FQCL 3WNKA 1I9JH 2WINB 3UEZA 4U7MA 2BY0A 2HKHH 2CR3A 1OP3K 3RDTC 4N0UE 1BBDH 1ZT7B 4YFLF 3EOTH 3RWIA 1FO0B 3K8KA 5E6IA 3O45B 5D9SA 4NDMA 2A0LC 3WDHA 1W8NA 3OQ3B 4FFZL 4CGTA 4CJ0A 1UWGH 3D3VE 2RFXB 1X7QA 5IFHL 4JFXB 1MHEB 4JJ5B 4P2QA 4J12A 3RZCC 1MQ8A 5DO2C 2XRAH 1XF3A 1V8HA 1NDGA 2GHWB 5EBMA 1V3KA 2B5IB 4HUUA 5D5ME 3MJ9H 2JB5L 5I6XB 1S3KL 2DIAA 4KC3B 4KV5F 4OV5B 2ZSVB 4P3DA 4Z7VA 2Q3AA 5DC0A 3SBWC 2CLRA 4RAVB 1ACYL 4AZ8A 1KXTB 1PBYA 1T6WA 3M17A 5JW3L 3BZEB 2EKSA 5C0GB 1X9QA 1SJHB 3B43A 1E6JH 4I5BA 5IQ7H 4N0UA 4XBPB 1F58H 2R2BA 1MCRA 3UTOA 4KZDH 1RZGB 4HKBA 5FAAA 4HPYH 2BVEA 5HVFB 2FZ3B 2X1QA 1DN0A 3CUPA 4QRPA 1RIHH 2OI9C 4FFWD 3D3VA 2HKHL 4NM4H 3DIFA 2MCG1 3T0XA 3FO9B 1B88A 1ES0B 1TVBA 1A7PL 1I1AB 2J8UF 4V1DE 4FQ1H 4MDIB 3Q0HA 3HI1A 5JIPA 2ORBH 5CIPB 3W0WE 3MFFB 3C6LA 1OP3H 5D5MA 1HSAB 4U0RC 5CINH 3Q6GL 4PV8B 2EXWD 5ANME 4LEXH 3CFJA 1MJJB 5AYUL 1H3WM 2C3WA 4JHZA 5LGJA 1ZVYA 3BGFB 2B0SL 4MAYD 3IJHB 3VA2C 4JY6B 4PRID 2MOVA 1U92A 3FN0H 3P77A 3MUGA 1U3HA 1ZEAH 2DL9A 2WBJA 4HLZH 2W1NA 1A6ZB 2P7TA 4LHUG 1IKFH 4RNRB 5F1NB 2CKBA 2XY1A 1T1XB 2NY0D 4NN7C 4IOFC 3L3KA 5F6IC 2FO4A 4N9OB 5HYSB 4K94L 5IQ7L 1AR1C 1AXTH 4HV8A 4R3SA 2X4PA 1DE4A 3KXFD 4N0FA 4WTZA 1R3HB 4HG4K 1YN6A 5C09E 4V1DA 1BVKB 3FB7A 3S97C 4JFOA 2CLZA 4PBVC 1B6UA 3QULB 3W0WA 5F88B 4NM4L 2VC2H 3QUKB 2NR6D 5ANMA 4P2QB 3O3EB 4LK4A 1KLUA 2F8OA 1F3RB 4QWWC 4XI5C 5ICXA 1UM5H 5D7JD 2ADFH 4RFNC 5EU6D 3S35H 4OSUH 1UYWH 1MCPL 4KROB 4ZXBD 1FV1A 1K8IA 4HBQA 1V5JA 4GAJH 5F96H 1WTGT 4KKAC 1IEBA 4QT5B 1G6VK 4OCXH 3ZSSA 3UZEA 3DSFL 3SOBL 4QHLA 3ZKMD 4LARH 2EKSB 1RZ8A 3U4EA 2XN9E 4J6RL 2IJ0C 3GJFB 2AEQH 3K81A 4R0LB 1N8ZB 4LHJB 3TYGH 5DQJB 5C09A 1G1YA 3R06A 5DQDH 3QUZA 4M6MH 1IKFL 3S4SB 3D39D 4PRAA 4QRPB 3N1FC 5CJ5A 1AXTL 1JWUB 1DBJH 5DMKB 1KCSH 4LCIH 5DRWA 3VXSD 1V7MH 3ULVE 4YXHH 5HD8C 4GBXD 2QR0B 3TBWB 3QZWG 1CTOA 3JV4A 4YPGB 4U1JA 3QXDA 3H9YA 1EEQA 3ULSA 4X6DF 4OFPA 5K9OA 5E08H 3OGCA 3ORJA 1MRDH 2YS4A 1I7RB 3SJVE 2EE3A 4P57B 1Q72L 1RI8A 3X11B 1Q9KB 4W68A 3IXTA 1KTKE 3H42H 4K3EH 1T80A 4PJCF 3RBSA 2DOCA 3QIBA 5DEGB 2ADFL 5IW6B 3S35L 4OSUL 1Q9WB 1Y6NR 2XN9A 1DLHA 1T2JA 3P77B 2CIIB 1NUNB 1EZVX 4GAJL 5F96L 2C26A 1NFIB 3F12A 5JO5A 4N8VB 2Z91A 4PJDB 2PYEE 2AJVH 3VFUA 2GAZA 1VADA 2BOBB 3QDHA 5GSRA 3JZ7A 2J2ZA 3TYGL 4B7LA 4ZFGH 5DQDL 4M6ML 5I15L 4BQ8A 4NP4L 1CLOH 2CLZB 5EIQA 1XCQB 1FGVL 4M43H 3SJVA 1DBJL 1KCSL 1ONQA 5F93C 4PRHB 2X4RB 1ULVA 2IQAB 3CDCA 1PG7X 4HKXB 4YXHL 4PJXF 1VESA 5HGDA 5DK2A 5HDQH 5B8CB 3VCLA 5C07D 2LFGA 5E08L 3OKKB 1DL7H 4Q58C 2EDDA 1MRDL 1FL6A 3F7PC 4Y4KA 3PHQB 2J88L 4ODVH 4X6DE 4NC1C 1OGTA 1FNAA 1LEGA 4JY4B 5KJRH 4BZ1L 3G6DH 3H42L 4K3EL 4PBWD 4R4NC 2EEAA 4KKNA 2D31A 3DGCR 4XAKE 1FNGB 5FHBH 5DRZA 3HCVA 1FG2B 4CNIB 3MBEC 4KK8C 2NX5A 3EYOB 1MAJA 2YZ8A 4NCC1 4X5WB 5DEFB 1IGCH 1H8SA 2YOCA 5JA8B 4U49A 3QIUD 3K4ZA 4FQ2H 4NQXB 4Q6IB 5ID0A 4RQQA 1M71B 2AJVL 1UG9A 3L5XH 2A6DB 4HUXA 2H3NB 4X8JA 3V6FB 4BKLB 3G5YA 3ARZA 4AIZB 4ZFGL 3AREB 3BN3B 1GOHA 1W0VB 3D25A 5FGRA 3MXVH 1LO2L 1EFXD 4OJFH 1D6VL 3FHQA 4QXTB 4PJ9A 4M43L 1G7JA 4PREA 3HC0B 1FCGA 1CIDA 4Z95H 4X6DA 4MA1B 3KNBB 1BLNA 3UTQA 4PJBE 4XZUB 5JXEC 1JZ6A 1DL7L 2IBBA 1IC5H 1TNNA 1DQJB 5DS8A 3GSOB 4ODVL 4WHYG 3THML 3WUZA 3G6DL 5IF0A 4IOSD 3PJSA 4K23H 4NWTH 3ESUF 3O2DA 4HFWA 5FHBL 1RJLB 2FECL 5E8PB 1LO5A 1XGRA 2C3HA 4YBQD 4ZOCA 3SE9H 4NN5C 4U1SB 1L4IA 4UTBH 3EIFA 4FQ2L 1AQDA 4OZFA 4ZPVB 3QR2A 4MDJA 5D7KE 1MCQA 2NY2C 2I9TA 3L5XL 1R3LA 2OSLB 3K2UH 1ED3A 2V7NA 3H3BC 3MRIA 4QO1A 5E7BA 1PG7W 4E0RB 4TTDC 2VOTA 3S37X 4D94A 3MXVL 4PJBA 3I2CL 3VXRE 3RHWK 1ZT4B 4PY8J 3VFRA 1UWEH 1NEZG 1WBZA 4XVTL 5JIIA 1A6AB 4Z95L 5DJAB 3QUXC 4KRMB 5A16A 3HNSH 1SJXA 3T0ED 1JMXA 4M6OH 1NMBH 3FO1B 2XXCB 4XGZA 1OF2B 1IC5L 4G9FD 4L8DB 4RMQA 1Q9LA 1YEIL 5CJXC 2P24A 5CILL 1A4JA 1I8KA 3O6FA 4K23L 1K3IA 4K71B 4NWTL 4DGIL 3S8WA 5HYIA 1F02I 2DAVA 2VH5H 3LD8C 2P8PA 4OQTH 3VFPA 4UTBL 1Q94B 3BPCA 4TSCH 3VXRA 3GMQA 4FFVD 4XP1H 5KTEH 2APWA 1YEDB 4QCIA 3RWDB 4MCZA 2FL5B 4NJAH 2WIIB 1VEOA 3IU4H 3QUMH 1FFPA 3TJHC 3U0PB 3RNKA 1INDL 1WV7T 4WO4B 3VU2A 4Q9RL 3ARBA 4YGVB 2HFGH 4XPTL 4G8EA 4YNYB 1U91A 1S5HA 1YPZE 1KCKA 4P99A 5J1TC 4KMQA 1UWEL 2R15A 3VGAC 4JPVL 3DVFA 1A0QL 3HNSL 1M4KA 3EJYC 1YEFL 4I3SH 4RIRA 1FC1A 2JE8A 4JRWA 1BEYL 4M6OL 3RY4A 1ZHLA 4N1HB 1AGBA 1KJ3H 1NMBL 5ADOH 1WSST 3JUYA 3ARPA 1H3XA 3RI5F 5AD0B 4HDIB 1ZLWK 2P46B 1Y18B 3D2UD 3QCVH 1OTSC 1UJTA 5J6GA 1PX4A 3JVGA 4KUCD 2AQ2A 4XH2A 3DLQR 3BD4A 4JANB 5B3NA 3HFMH 3TT1H 4P9HL 1G7MB 2I9TB 4FMKA 3I84A 5GS1B 5C71A 2XTJE 4OQTL 1F45A 1MFEH 1GGIH 2JF1A 3M1BA 4P3WA 1BBJB 4ALAH 3VXME 4BFIB 2CSPA 4TULL 1YPZA 3BQUA 2LVEA 1RZKL 4NJAL 4G8IA 2WP3T 3O3DA 3IU4L 2ZUXA 3QUML 1PQZB 2VXTH 3PV6A 1D5BB 4NO5B 5DVMA 3BE1L 3T4YA 1KV3A 3WHE0 1URLA 1BFOB 3QEGH 1TQBC 5FM8A 1GL4B 3FFCD 3QIWB 3RRQA 3PGFH 2W9LA 1CXFA 4HC1H 1T7ZA 5JW4R 1UH2A 4LQFH 2P24B 4I3SL 1AY1H 5C08E 1UB5A 2E9WA 1KENL 1I7ZB 2C3VA 4BUHA 2Y1VA 1LK3H 1KJ3L 1IZJA 3WIFB 2FJGA 5KG9A 2F53B 1U8KB 2AJUH 4X5XB 3QYCA 1RIVH 4X6EA 3RPIA 2ESVE 5F9JB 1T83C 1NLDH 3MSPA 3GGWA 1I4FA 3VXMA 1WBXB 3HFML 3TESA 1ZLWH 5IM7A 2UVFA 1CD0A 4BSVA 1MFEL 4OZ4A 2IF7A 1QA9B 3SDCA 4QRSA 4BZ2H 4JM2F 3QNXB 2MMXA 2NTFB 5D7IF 4RGNE 3DX9A 4IRSA 3MXWH 3O9WA 3U7YH 4CN6A 4U0QB 3IKKA 4L8CB 4I0PA 3S5LG 3SQBA 3GMLA 5EG6C 5JMOC 2WUBH 3BHBB 5C08A 2H2SD 1FJ1B 2IAMD 3IRZA 1PYWB 3QEGL 3G9AB 4X8XA 1FVEB 3BH9B 2NNAA 1A5FH 1QLFA 3GUTA 5AZEH 1HKLH 1FZOB 4LQFL 2ESVA 3IJYA 5IMLA 4GRLC 4N9GA 3TC9A 4EUPG 1LK3L 1EH9A 4DEPB 1CD1A 5FUOH 5HYFA 3P0VH 2AJUL 4MHHG 1NSNL 3HNVH 4KDTC 4P23C 4X7EC 4XMKH 3TO2B 1EUUA 1NLDL 2EDQA 4WW2A 2WP3O 4DGVH 1D5ZA 1YDPB 1D6EB 1I9EA 2ZUYA 3RUGB 3ARSA 1X5FA 5EZIL 1H3PH 5FYKH 4XMPH 5JUEL 3S96B 3FQTB 4DZ8A 1QACA 1PZ5A 1LO3L 4LEOB 3PL6B 4BZ2L 5CBEB 1BFTA 2FBJH 5JLZB 3EHBC 1WICA 5C8JA 1MFCH 2G5BA 5EUKA 4OGYH 5D7IE 1NFKA 5ICZB 4WGVB 1C7TA 1LD9A 4HGWA 2AI0L 2R23B 2EE6A 2WUBL 5IJKC 3PWJA 2IFFH 2EH7H 2QADD 4HGMA 3QXUA 5TE6H 4QLRA 2DTSA 1P84K 4XP6H 3UROR 2KZWA 4FFWC 5FGCE 3EYUH 3KPPA 2XKSA 2CDEA 3MOAH 8FABA 2R1YA 3GRWA 3VGGA 4I1NB 1GZQB 3C09C 5FUOL 1AHWC 3HNVL 1G7PA 3KYMA 4F3FA 4OCSL 1K5NB 2O5YL 4BH8A 3HZKB 4DGVL 4ZSOB 4Q9CA 1C5CL 3OX8B 5D6DA 3MROB 3QQ3B 5D7IA 4PLKD 3R0NA 3QPQD 4I0PB 4CMMB 1H3PL 5FYKL 1HWHB 4XMPL 1D9KB 1QOKA 2EDWA 3N1GC 2C4FU 3DYMA 3K74B 2BDNL 3FT4B 2FBJL 3KPRB 4RMUA 2DKSA 3SY0A 2VDPL 2FEDD 4J4PC 5FB8B 4OGYL 1MCSA 4PJEB 4YX2H 1WFNA 4B50A 2KZ1B 5D1XC 3QA3A 4FXKA 2DQGH 4Z7UB 1WWCA 3JXAA 4Z9KB 2R1WA 2EH7L 3OKDA 1NANI 5C0DA 3HE7D 5F7MC 1GGBH 5DRNA 3C9NB 3MLSH 5FDWB 3GSNB 5TE6L 4ZPTB 5HY9B 4XP6L 5C0RH 3DUUB 4KDVA 3N1MC 2B20A 1LGVA 4JO3H 2OL3B 4Q9QL 3MOAL 3WFHA 2YMXH 1OAKL 2UWEF 4PGBB 1ZHKA 5L2JB 1FHGA 4M1CD 5C2BH 3DO7B 3O8XD 5IVZA 1MCWW 4JHBA 4NBZB 4YFEA 4ZS6C 5EU5A 4DVBB 4ZXBC 1KIRB 3OKNA 1XF2B 3DYOA 5ISZB 1N5YH 4XVJL 4XBEL 5GRYA 4OAWA 5D7LD 3M8OH 1GXEA 1WEJL 3AGVA 2J8HA 1INQB 1CL7I 3LKQB 4X7FC 3MNVB 4N5ED 3ZKMC 3U0WH 5JIKA 2W38A 3N9GH 1J5OH 1FFOA 1FRGH 2OQJB 2HA1A 5MEPB 5D2LE 4PJ8D 3E3QC 1OP9A 3RTQD 1R5IB 2YPLB 4S0SD 4NRZB 1QRND 4MQXC 4J3WA 3RWJA 4KGJA 3D85D 3GB7A 1DUYA 3DVIA 4CN1A 2QLVB 1VDGA 3GI8H 3LKNB 1FO0H 5E00A 5BJTB 4KY1H 3S3SA 1GGBL 4PJFB 3CFCL 1CE1H 2CKNA 1P7HL 3BP5A 3UYOD 4JO3L 1ZMYA 1A1OB 2PTUA 2V17H 4L4TE 1FZJB 3REVA 5DJ8A 5LCVH 3P4OA 4LVNC 3BESR 5C2BL 4ENEC 4RDQG 1JZ8A 3G5ZB 3MJ7B 2Q3ZA 3IFNL 4NN6B 5E8EB 3SCMA 2B5IC 3RBGA 1EBPA 1UKSA 5D2LA 2LE9A 3MLRH 5K9QI 3F5WA 4YHYB 3EYSH 3M8OL 3RL2B 5IVXF 1MELA 1DQTA 1OAYL 2EKJA 1WC7A 2H41A 3U0WL 3U0TB 3LIZH 1J5OL 1FRGL 2YD2A 1JWMB 2PF6A 2NXYB 2VLKE 3MYJB 5C0EA 3D69A 3ARDC 3PWVA 1W0YT 4RFEA 4U1NA 2CK0H 2VO5A 2EICA 3C6SA 3WS6A 2VZSA 2DQFA 1R3KA 4NNYB 3SQOL 4HQQL 3EDKA 4KZEH 3TVMD 3L5JA 1J05A 2AAVA 3L7FA 3EYFA 4DTGH 2GW5A 3FQUB 5LBSH 4WY7L 4L4TA 3KYOB 4KY1L 4G43B 5ACZA 2C5DC 5EIIB 1I1AC 1A9EB 5J13C 4PUBH 2B1AH 4OLWH 3NPZB 2F9BT 4L9DA 4WHDA 2V17L 1EHNA 25C8H 4NZRH 1E4KA 5IB4A 2W65A 1TDQA 5LCVL 4OAWB 5ITBH 5FECA 2DQHH 4Z18A 1KXQE 1A1MA 4E41B 5ADPH 3N50A 4K3JL 5SWQB 3IFPA 4NKOB 1G6RH 4G6KH 2VLJD 5TE4H 1CFBA 3ES6A 4NC0B 3VDAA 4A6YA 5CEZH 3FRUB 4JCLA 3VH8G 2VLKA 2Y5TA 3LKRB 4K3GA 1K85A 5F3BB 1EMTL 5KVFH 3C8DA 5EO0A 4HUWB 1RVFH 4YHPA 3DMMD 5F7FA 3BVNA 2J4WH 4P4RB 1W0WA 2XYCA 4NUGH 5IBUG 3R1GH 4R97B 3LIZL 2HJFA 4JG1H 2NY3B 4QRRE 3SDAA 3UDWC 2P45B 3MRPB 5DJZB 2CK0L 1CGYA 5A43C 3DV4B 1BX2B 1DQMH 5D1ZC 4L3CA 4TVPH 4POYA 5B38A 2ICWA 5GRJL 3ARFC 4L4VD 3MJGX 4DTGL 1ZSDA 2XOTA 1PLGL 3GIZH 5C0CE 1DQDH 3OJDB 3L1OL 1SMAA 1SYVB 5ERWA 3FQNB 5F1SA 4PJGF 1KTRL 3AU1A 4MD5A 4LLUB 5FGBA 5IMMB 2ZCLH 2EIZB 1QFPA 2VJXA 1XGPB 3MRKA 4ELKA 5KBNC 4NFDA 1WZ1H 3P73A 4X4XB 2RCSH 3TN0B 3REWA 4LSVH 1KIPB 4L29A 3AS1A 4NZRL 5JPMA 4NQCB 1UA6H 3PDOA 4Z0XA 5TH2A 1KFAL 4DKAA 1AKJB 1OM3H 1QBLH 1Y0LB 1ZA6B 2A74A 1H5BB 1JTOA 4G6KL 4R7NA 1N5AB 5TE4L 2D0HA 5E4EC 4C54A 3ZDXF 1M7DA 3DUSA 3I3BA 4LLVA 4XAWH 3VI4E 4QRRA 3RY6C 3RY5A 4IRJB 1Z9SA 1T1YA 3U2SB 4QHUA 4YBQC 4QTIL 2FJFA 2F15A 4X4ZA 3ZT5A 3QG7H 4APQD 3K0WA 3F58L 3KYNA 4JQXC 4KK5C 4EI5C 3R1GL 2A73A 3OZ9L 4HWBH 4TNWK 5D1QC 3VXOA 3HI5H 3SHSA 5DWUL 5SV4A 1XGQB 4HGKC 3FFDA 1OVZA 4TVPL 1J1PL 3ARGA 5ALBH 3W9EA 1DVFD 3DX7A 4ZYKA 3GIZL 2BCKA 4MLIA 2ITDA 3R0MA 1DBMH 1IFHH 3GZKA 5IBLD 1DQDL 1MWAB 4Y16A 1U8NA 1H3VA 5FUZL 1F8TL 3I50L 1HDMA 3L6FA 4YE4H 2ZCLL 3DO3A 1JHTA 2E5EA 4LSSH 4M7JH 1VFBB 4TUOA 5JHDA 4LVEA 4OCWH 4PJGE 2RCSL 4OLXL 4PB9H 4LSVL 5JOFA 5IFJA 4OGZA 4LLAA 5BW7A 4LLYA 3VFNB 3ZYZA 3CU7A 1X6NA 1QBLL 1EIBA 4JFEE 1TZIA 4AM0A 2K9UA 1PSKH 2VL5A 1OW0A 2CRZA 3AS2A 3OKLB 5HHVH 1JNJA 3FQWA 5JA9A 3DVGA 3H7BA 3MODH 1UACL 1ZA3B 1NGZA 4L3EB 3PUCA 4M62L 3D0LA 5F1KC 5CUSH 1ZGLM 2DM7A 3L9RB 3QG7L 4KXZI 3IGAA 5BVJA 2OBGA 3HHRB 3VFSB 5T3XH 1J8HB 4HWBL 2XA3A 5C0AB 4OGXL 3ZDZF 2VN4A 4JFFD 1P7QD 1A64A 5E0QA 1NGWB 2M26A 1IGJB 3IJSA 3L3DB 1IM9B 5T5FH 2OCFD 5GGRB 1F4XL 3MRFA 3O3BB 2LQRA 1U42A 3TCLB 4O51A 3IKCA 4HJ0C 1X6LA 3DX6B 2P43B 3BOVA 3MLWH 3W39B 3C60A 4KJPD 1OWWA 1L0QA 3DGGB 4IM8A 4PJGA 3E6HA 4CU7A 1DBML 1IFHL 3ALWA 3S37H 2K3TA 1CLCA 4JFEA 1IAOA 1T7WA 4YE4L 4H1LB 4UT6L 3QJFA 4M7JL 4LSSL 2EDYA 2MNUA 5JXAH 1ZVHA 1FFRA 3MLTB 4ZFFB 4OCWL 5CD3B 1C08A 3MLVH 5GXBB 2AJSH 3RX5A 2CDFB 1LEIA 3TBTA 4LAJH 1T1YB 1Z9OA 4NZUH 3CSBA 5BV7H 3HUJE 5BV7C 4HZAA 3B2UD 4NJ9H 3PIQB 1XH3B 2OX5A 4P5MB 2AV1B 4S1QH 5HHVL 3JWOH 3EFFA 3GM0A 3JWOC 1F90L 4HJJH 5DZNA 3MODL 1NBZA 1TCRB 3FQRA 3GBNL 5AUMA 3EYVB 2DWEA 5DJ0A 5CUSL 1F4WH 3VG9C 1BGXL 4XHQA 4DN4H 5ALCL 3V0AC 3H8NA 4U3CA 3ULUD 4R8WH 4KRPB 3DUHA 3WBDA 3HZYB 3KPSE 5DTFA 5SWSE 3RX8A 1CICC 3QUYB 4QXUH 5T5FL 3P3YA 3V6ZB 3HRZB 4M61A 4GRWE 4PB0H 3ZDZE 3TM6A 4CADB 2I9LB 2CXGA 3HMWH 3DROA 4PGDB 5IROC 1AIFA 1U8IA 3BP7B 2JJSA 2IANB 4GUPB 1NMAH 5T1DH 3GSWA 1QYGH 3HUJA 3JV6B 3G04A 3QT2A 5I8EA 5JXAL 1NFDF 5HI5D 4H5SA 5FUCC 3ZE0F 5BS0B 4W6YB 2YD8A 4NZUL 1ADQL 5BV7L 5D2NC 4Z5RA 3J8F7 4Y4HD 5E24E 1G9EA 5ESAA 4ZFOB 4NJ9L 2DQCH 3TA3B 4JO2L 4S1QL 3JWOL 2HKFH 4X9GA 3MQIA 1TZHB 2VB5A 4XWGH 3KR3H 3KPSA 4N0YH 2VDRH 4JN1H 4XC1H 5SWSA 2GJ6E 1F4WL 5EZJA 5GJSH 1VGKB 4DN4L 4S10A 3MRFB 1D7FA 4HXAH 2XA8H 2CLVA 3RNQB 3GFUA 3B9KA 4AK1A 4R8WL 1NGXB 3CMOH 1U3YA 3WIHH 3NAAL 4PJ7E 5IOPA 3SGKA 1UH4A 1MJ8L 4U7SA 4LPVA 5T1LB 1JWSA 1X5XA 1EJOH 2LTQB 5C0FB 4NFCA 1BOGB 2IAMC 1IM3B 2BSED 2AXJA 2JCCE 5T1DL 1C12A 1NMAL 4Y5YC 1QYGL 2BNQE 1RK0A 4ODTH 4WU7A 1YC8A 4EKXA 1FAIL 2E3VA 4GXVL 3H6JA 4G8GB 2FX9H 3UTTB 1HNFA 4O2EB 3H9SB 1FYTB 2EO9A 5LWYL 3QDGD 1S7QA 3EZ8A 4JFDB 1X44A 4Z7OF 3NFNA 3MA7B 4Y19D 3WL9A 5I74C 3RWFB 5J1AB 1M05B 2CO6B 3ALPA 2GK0A 3QI9D 2GJ6A 2BNRD 2Q86B 1T2QL 1P1ZB 4EZMA 3ZE0E 1XIWB 3GI9H 1DSFH 4KTDL 3HR6A 3VWKC 2ZG2A 2QQNH 1Z3GL 3JWNC 5IB1B 2HKFL 4JVWA 3X3FH 5J12C 3LMJH 4UOW0 5MENE 4XWGL 2DMBA 2JKXA 4XC1L 4N0YL 2VDRL 4JN1L 1VENA 1KB5B 4PJ7A 5GJSL 4YDVB 4YDIH 2D3VA 4Z76B 4WO4C 2VDOL 5FO7B 1S7SA 4RZCA 1Q0YH 1BVZA 4FQIH 1DANT 4JZJC 2JCCA 3GSWB 2BNQA 3WIHL 2ZOLB 5A3ID 1IQWH 1PZUB 2GT9A 1KNOB 3MNWA 1QVOA 2CDGB 1ZKAA 4GSDL 5I8EB 1G9MH 1G9MC 1LDPL 4PYHA 4ODTL 1DQLL 1MVUA 5F97E 1KPVA 2E27H 2BRQA 2ADGA 1JRHI 2APFA 1KT2B 4GG8B 3JUZA 4FQXA 4OIBA 5I1IH 5E2VH 5MENA 2O5XH 1H15A 2VWEC 2EEBA 1I8LA 2FIKA 4U7KA 5DHVB 3GI9L 4EN3C 3BP4A 3KYKL 1CDGA 4CDGC 1AP2B 2IGFH 5I1GH 2QQNL 5IR1B 5GGSY 3LMJL 5HHOE 4IDJH 2YWZA 4BFBD 2DBLH 3QHFH 1JPGB 1C5BH 4AL8H 5I1AA 5HDOA 3CK0L 1RJYB 3VXTA 5F89B 5I16B 5KSAB 5ICYA 4OUOA 3PABB 4JFYB 4X9FA 3SDDA 4PJAB 5I8OL 3I75B 2YD7A 5JDSA 3T4AB 1NGPH 2Z31D 5F3HA 2DL2A 2XNAB 1J0YA 2BOCB 4HKZA 2VLLA 4ORGA 4GRMB 1NCWH 3BIKB 5FFLA 3TGXA 3OR7B 4I4WA 3SPVB 4OF8A 1S9VA 3ZSTA 5EZOH 1G9ML 3GJEB 5FOBB 3WL9B 5I75B 3RKPA 3SEPA 1W72B 4BM7A 2NY1C 1QQDB 4YIQB 1KG0B 3ZZ1A 1F5WA 2LAAA 2ADJA 5CJBA 5TGBB 1MCLA 3T0AA 3UYRH 4ZOAA 3WS3A 2EYTB 5I1IL 2J5LC 5E2VL 5L2KB 2EDNA 4M1CC 3MREB 3WLBB 5HHOA 2O5XL 3ILQC 3MO1B 3SO3B 1T6VN 1HI6A 3EO9L 1L6XA 4ONGL 3T2NH 4LHUB 4AT6B 3N85L 3RWCA 1I8MA 2IGFL 3SKJH 5I1GL 3AFLA 3MRLB 2NY6C 4FZ8H 1HH6B 5FXCH 4PRBA 1EA9C 2VR4A 4IDJL 4LL9A 2DBLL 4GXUN 2VDKH 5IHZA 1SVZA 4OT1H 3ZE2F 1C5BL 3B5GA 3MRQA 4Z78B 2B4CH 1YEGH 3EDJA 2B4CC 4M93C 1UT9A 4PJ8C 1HXMA 5E2WH 2HTLD 3DVNB 5IIEA 4PTTA 2EEDA 4MD4A 2PETA 3PG2A 4IIQB 4C4KO 1I9IH 3MV9D 4NOBA 5EUOE 1NGPL 2X7LB 3MV01 1NCWL 2FWOB 3VD5A 1Z9MA 4BK4A 4WWKC 5CHNB 2MKLC 1A14L 5EZOL 1S8DB 4TNVF 1PDKA 1AD0B 5C0BE 4PRNB 5KAQG 1T89A 2BY1A 5GRXG 3IXAB 4N8CH 4ZFZA 3TZVB 1BJ1H 2IG2H 1VKXB 3UYRL 1YZZA 1CXEA 5F7WC 3BPNB 4QXWA 1T5XA 3WN5C 2OJEB 2J8UB 2X4NA 2ATPA 4QOKB 1GGCH 3PWPB 4KHTH 3P9LB 4OD1H 4P2QD 1VPOL 1B0WA 3MUZ1 4NRXA 3PL6C 3VXTB 4R26H 5ITFB 3VJ6B 1I3UA 3C2AH 3SKJL 1HWGB 4PRIE 4FZ8L 5ICYB 4Y5XC 1BF8A 4KROD 2VSDA 2Z0BA 5DI8A 5EUOA 4OT1L 5F3HB 3QDME 3QZWB 4KK9D 1U8QA 4R2GD 3FO0H 3TBYA 1ZOXA 3D18A 4JRYB 1N0XL 1S7TA 1S9VB 2VABA 4AH2A 5E2WL 5MEQA 2XI9A 2EDKA 5HGAA 2BVYA 4U1IA 1HQ4B 1C16A 5C0BA 4FQJL 4CVXA 4XX1G 3VDBA 1I9IL 3MRJA 1MRCH 3KXFE 3NIDF 4YXLL 5K9JH 2ADJB 3FT2B 4L8SB 3NGBB 5IW3A 3VDCA 2D7NA 1A7RH 5C9KA 4OD3L 5BVPH 3WS3B 1K9TA 2BNUB 3BXNA 3WEXB 3JTSB 4QRPD 4UILH 3BPOC 3DSNA 2GTZB 4Y2OA 3PWNB 4MAYA 2IG2L 32C2A 4P4KC 4RWYH 1TCMA 3RWCB 4KKLD 5IW1B 5I1EH 2XQYG 3PHSA 3LPWA 1YYLH 2ED8A 3C6LD 1JHLH 3LSOB 4P9ML 3F7VB 4OD1L 3BH8B 5IHZB 3HPLA 3QDMA 5DGQA 4P2CG 1AGCA 1ZVSA 5KSUA 4LBEB 4XNZB 3BISA 1NEUA 3C2AL 5MI0B 1P5UA 3RU8L 2DTML 2JELH 3KXFA 4YXKH 3VFVA 4AG4H 1YY9C 4NPYA 5KSBF 2XICA 4MXWL 4PD4K 2PO6B 3MV7B 1UZ8A 1VA9A 2A6JB 1MCNA 4YC2C 4ODUB 5IB2A 1FYHB 1T3FA 1LVEA 1K4DA 4X7CC 5MP6H 2QQKL 4KVNH 3AAZB 1BZ7B 4ETQB 1CDCA 3VXSE 2XV6B 3BKYH 2DLHA 1RZ7H 5H37H 5K9JL 1ZS8B 1ZTXH 3FT3A 3TBVB 1A7RL 1ND0A 4HIJB 5BVPL 4RMSA 3ZTNH 1B4RA 1IAKB 2FH8A 3W0WD 5FO8B 1ITCA 3DV6B 2CO7B 1R5VA 3TYFB 1J88A 4YHIA 1T1ZA 1S7WB 1BZ9A 2D03L 4PRHD 4HIEB 5CP7B 4G6ML 4JHAL 4RWYL 2A6IA 1JGDB 5I1EL 1EAPB 3RGHA 5FA3B 4WW1B 1OB1B 3HAEH 4PJCB 1KC5H 3U4BH 4PS4L 2GIYA 1CGUA 3VXQB 3TBYB 1XCTA 4QEGA 1IEHA 2CRMA 4OZHF 1O7VA 2YBRB 3CXDH 5EU7C 1ZWIB 5HGAB 3QPXL 1QSEB 3VXSA 5IWLC 2JELL 3BSZH 4W70A 3V4PL 4H26B 5CEYA 3LEXA 4JGUA 4P48A 4DGYH 2DKMA 1LHZA 3W9DA 3T1WA 3QUZD 2KH2B 1CE6B 3BXNB 4ODBD 4KVNL 2RGSA 1RZ7L 2VR5A 3TPKA 2GYSA 1ZTXL 1MREH 4QTHB 1RUML 1MCOH 2H32A 5IV2B 4FP8H 1ZLVK 1HHHB 4ZUSA 5LG1A 3KPNA 3V0WL 3RWEA 5EOTA 4HX1B 3U9UB 3KLDA 4PJXB 3TO4C 5I1JH 1MI5B 1G9NH 3PWLB 4CL7A 1G9NC 2OZ4H 1GOGA 3EO0B 2V5YA 1QLEL 3BZ4B 2XQBH 4JR9H 2HWZH 2PYFB 1NMCC 5T3ZH 2F54B 1X5KA 4UQ3A 1DBAH 1WJ3A 1JPSH 2NZ9D 4LLMB 1KTDB 2HJKB 3QIBD 4WV1C 1CT8B 4F37F 3DRQB 5FYJD 4ONFH 1N6QH 1KC5L 1KXVC 1YNTA 2VYRE 1JF5A 1BECA 4FABH 1QSFA 3C5JB 2C1PB 4XC3H 2AGJH 4YWGH 3BPLC 3CXDL 3NPSB 1NEZB 5I9QB 2GCYA 3TFKC 2H2PC 3WNNA 1P53A 4M4PA 4ETYA 2X42A 3DURA 3BKML 2Q8BL 3QNYA 3X12A 1R3JA 4PV9A 4ISVA 1SBBA 1JPFB 1CTNA 4MMZC 2QHLA 3B6SA 4K7FA 4PRPB 3SJVD 1PKOA 1K8DA 2NXZC 4QF1B 1ETZB 1GIGH 2ZPKH 1MREL 1RPQA 6CGTA 4FP8L 3CDYA 3P0YL 5ID1A 4OIIH 4MGXA 1B0RB 3NN8A 5I1JL 3VFOA 2YXFA 1G9NL 1OTTC 2JIXB 2XQBL 4JB9H 4JR9L 4F9LA 1KB9K 1FLTX 4P5TB 3QP3A 3DETC 1NCDH 1ZLVH 3T3PE 2APXA 4H0GA 5GGUA 1WWWX 1LE5B 2BK8A 1EO8H 3MV8B 3RGVB 2KQMA 4MX7A 2VZOA 1RMFL 3QHTC 2NX5D 2MCPH 4FABL 2AV7A 1OD9A 2GSGB 3BEVB 2NY3C 2YRPA 1NBVH 4XC3L 3B5TA 1UVQA 5FKPA 3CCHA 4JLRA 3ULUH 3GHBH 3NCJL 4TNWF 5CJOH 3ULUC 1HHGB 3C2SA 1UJ3B 3RKDC 4XNQB 3ARVA 2NLJA 1A3QA 3MGTA 1NANH 4MB4A 4OCLC 3G6AA 4NO2A 2PTVA 5A2IH 4NO3A 1SBSH 4WI8A 3SKNA 2ZPKL 2HLFD 2J6EL 3B9VA 3T0EE 5JOPD 3G5VA 4ZTOH 1OAUH 4OCRH 1YMHA 1T22A 1VB9A 1B9ZA 4OIIL 4ZNEE 4XAKD 3O6KH 4YHOH 4KUCF 4G9FE 5GRVL 3GMPA 1NGYA 4O02H 5IFAH 4JB9L 5GISH 5FK9B 2UUDK 4TQEL 4YK4C 4LSRH 3ZMRA 1T1WB 2BX5A 2O5ZH 5C2UB 1AGEA 1WUNT 4IRJC 5C9JB 1QO3B 4KJWC 1IKNA 3IETA 5FYLD 1AFVH 3V8CA 1CL7H 1KCUL 1I7UB 2MCPL 2XY2A 1T0MA 5CJ8A 1A6PA 2R4SH 3CLFL 1YUHA 2BVQB 4D0CB 4JQIH 1UM6L 4HKJB 5IG7B 5J3HD 1KYOK 3DRTB 4GQ9H 4X4ME 5L8JB 2ICEA 3ULUL 2IBGA 3GHBL 4X6BB 1H8NA 1S78D 4GOSA 5GPRA 3DJ9A 1H0DB 3T0EA 4U3HA 3FCTB 3MRCA 1DEEA 1I1FA 5F70A 4BELD 2W0LA 2GFBA 4ZNEA 3CVHB 2BFVH 1FL5B 2W60B 5LGHL 1M6OA 1T4KA 4GT7A 4HZLB 1T04B 5IVOA 5IB5A 3FO2B 4P49A 4NKQB 3LKOA 4ZTOL 2PW1B 1N6VA 4OCRL 3NACH 5HHXH 1JUFA 3VFGH 3DXAB 1T7YA 3O6KL 1WAAE 5CZVH 5FM5M 4Q2ZB 5DK0B 4Y2DB 1KTLB 5I71B 4DUVA 4YDLC 4KHXH 3ZKXC 2R2HB 3VG0H 4W6WB 5IFAL 5E94B 4QHNB 2ATKA 5GISL 1NAMA 4LSRL 2ADIA 2Z4QB 4UI2A 3C5ZA 4PBXA 2VE6A 2DMKA 1MCKA 3S5LB 3HG1B 4X4MA 5HHQB 1AFVL 1EPFA 1A3RL 4JLRB 2F53D 2QHRL 2UUDH 2B2XH 4ZS7L 5EO1B 5D72L 3UBXA 4OFDA 2R4SL 3QCTH 3GSQB 3C5SA 4MNHA 4D9RE 5I1HH 1GHFH 3G6AB 3SGJA 3MR9B 1RHHB 4GQ9L 1XR9A 4XXCC 2IMNA 3TT3H 4RX4D 3E2HB 1XF5B 3N1PC 4EUPB 1F4YL 4LDEB 3B2VH 5ESQA 1CGXA 3CXHK 1J86A 3FFCE 2BFVL 1F6AB 1MH5B 3HE6A 1WAAA 3TNMA 2X4SA 5F7DA 2GUOA 5TE7H 3D2UA 4LDOB 4LLWB 1K4CA 1MLBB 1ADQA 1JPTH 2IBZX 5IGXL 3NACL 4MNQB 5ETUB 3BW9B 5L88H 3KPOA 3VFGL 4UQ2B 4LOUD 4PLJD 2EDFA 3MCKB 1OARL 3GMNB 4XPBH 1MUJA 2D7MA 4UAOB 5EOCJ 3RDTA 1KOAA 3VG0L 1AXSB 1G7QA 4QY8B 3C08L 1NBYA 5GGVH 3OXSB 4RGOH 4QRQA 4OZIE 3Q3GA 4MD0B 3G6JE 3QEUB 3OGOE 4P2YA 5E6YA 1REIA 4NKMB 4DN3H 5DMGC 1LE9B 2DM4A 4MJ4A 5DVOA 4AQOA 5I18H 1Z2KA 5I2IB 5CD5C 5I17A 4KRPC 2GKIA 5D96C 4FQQA 4HAFA 1GHFL 2EO1A 3VFWA 5MHSE 3HC3H 3QUYC 4HHAB 4JN2A 4DOHB 3BQUD 3LB6C 5E2UH 4LKCB 3TT3L 4JPIB 4U1MB 3TIEB 5HI4C 2Z31C 2BVPB 1U2CA 3AROA 5EB9A 3QXVA 3VW3H 5TE7L 4KQ3L 1T20B 5T1MB 4OFYD 4KI5C 2ICWI 2IPTH 1YEEL 1KACB 4MWFB 4POZC 1JPTL 1HHIA 2VDNH 4OZIA 5GGVY 3G6JA 1OWRM 1IL1A 1DR9A 3RIAK 2WM0A 3C5ZB 2MTPA 5BZDB 4XXDA 2XXMB 2P5EB 3V5DB 5DD1L 4ZO8A 4G6AD 4DW2H 1QR4A 3IDNB 3LRSA 5GGVL 3BYTA 2Y72A 3BN9C 4X6CB 4XT1C 3VXMD 1HYRC 2H9GB 4UDUA 2VITB 4RGMC 3MCLH 3TIDA 2I26N 4F2MB 3SDCD 4GG6F 4G6JH 1A6TB 3BKCH 2QSCH 3WYRA 1DFBL 2PR4H 5JPNA 2N56A 2AJYL 5E2UL 2MPAL 5JW4M 3V5HA 1PY9A 4I0PD 1HILA 5DURB 1D9KD 1LNUA 2OTUA 5C08D 4IMLA 1GRWA 1CGSL 1I1YB 4P46C 1K2DB 4P5KB 2R1XB 2AABH 1C5DA 3VW3L 1JK8A 4Y8AA 3Q6FB 2SEBB 2VQ1A 3L5IA 3RVUC 2IADA 4BH7B 1IEAB 1NBYB 4BSWB 1KUMA 2VDNL 4JPKL 1S5IH 2Q7YB 5L9DH 2P5WB 1KJ2H 3B8YA 1AGFB 5AWNH 3L7EB 2DI7A 5L7XH 5E6IC 3IVKB 5AZ2H 3RZCB 1HEZA 1I8IB 5KS9E 3LCYA 4DW2L 5CP3A 4NNPH 4NZDA 1DLFH 4FXGB 5E8NA 1S9YB 3GIVB 4ZAKB 5CGYC 3ARWA 3UZVB 4FZEH 3VGBA 2DLTA 4KXZH 1B2WH 4MJIB 1V7NH 4XBGB 2VIRA 3MCLL 1FVCB 4X4YA 2FSEA 2QSCL 2PR4L 2WBKA 1DBBH 1G7HB 2ERJC 3CJJA 1BWMA 8CGTA 5FIEA 1QSZA 3NABL 4NQVA 3OB0K 3V52L 3MRMA 1HHKB 3BO8B 5EZLB 4KTYA 5ACLA 2X4OA 1N64H 2PW2A 4ODSH 1IGYA 4UU9B 2X4TA 2OI9B 3LHPH 3QH3B 4XCNA 5J89A 2AABL 2YPLD 3TJEL 3BGMB 1QEWA 1WBYA 5KS9A 4HW6A 2H8PA 2MFNA 3TEUA 4XP9H 1P6FA 3G08B 1S5IL 1BIIB 1N4XL 3RP1A 1XR8B 3SDXE 1Z0MA 4U0RB 5AWNL 3CFDB 5DHVH 2BY2A 5L7XL 1KJMA 3RWGB 1TZGH 2ZJSH 4MA8H 3S34H 1G7LA 5E03A 2FECI 3IDIB 1P4LA 4OIAA 2UWEB 3E6FB 5DYOA 3CGTA 4PPTA 4Y89A 2D7PA 3C6LC 4WUKL 4XCFH 1EEYA 1VFAA 4I18A 1DLFL 3LN4A 4OZGE 3EOAA 1WZKA 1B2WL 4HIIA 4PG9B 3V2AR 5J9PA 4LMQE 5H2BA 3L3HA 4MNGB 4OBSA 3LKSA 1QRNE 4NN7B 4UB0L 1VERA 3MYZA 2O26U 3VWJA 1TPXC 1U3HC 5F6IB 1DBBL 2WBJC 1RHFA 3BKJL 5K9KA 2CKBH 3LS5L 3R8BB 3ZL4L 3EFDL 4GLRI 4PLNC 5INDA 2NXYD 3MACH 2QQLH 3SDXA 3LHPL 1VGEH 3O8XA 3HC4H 4ONOA 4Z7NE 1WQVT 3OB0H 1ZT1B 1A1NB 1RFDL 4KK6C 4OD2B 1T03H 3VH8B 3CFKB 4XP9L 3D0VB 5IQ9A 4HK0B 1CXIA 2YUVA 1BVLB 4F7TA 4OZGA 4RFNB 1QD0A 3PF2A 4G6FD 3DTXA 1HH9A 5M94B 5BOPA 1TZGL 2P8MA 5IK3A 2ZJSL 3S34L 5IBUB 1HOCA 3OJMB 2ZZUT 5HPMB 1BD2E 1NJ9A 1T7VA 4WRLA 4XCFL 2GJZB 2VUYA 3PGCB 4EQ3A 3MNZA 2DWDB 1T66C 1JNHA 1QRNA 5IEKB 4U31A 5I8CA 2O61A 1YQ2A 5CLTA 4I0CC 3OKMA 2BMKB 5F7NC 1CR9H 1A6VL 4JDTH 5IHUH 5DLMH 3EGSA 5IVXB 3FRPA 1BMGA 3X3GH 2X4TB 2BY3A 2F5BH 2R0LH 4X99B 3RAJH 4N0CC 3L3OA 4P2RE 1TLKA 2CKBL 3KWWA 5FYJU 5HI3D 5EC1B 2Y4SA 1I85A 3OB8A 1TITA 3BWUC 3GHEL 3O41A 1WK0A 5B39G 1FIGH 5K93A 5C0CB 2DI9A 1U8LB 4MQSB 5I1KL 3N0PB 3GMRA 3ZYJA 1RIUH 2WQ8A 2ZSWB 3RVWD 1ITBB 3MRDA 1JN6B 2IPKA 4DKFH 1T03L 3KDMB 5E95B 3HI6L 1BD2A 1OQOA 3TPUB 1MCCA 1CFTA 2VISB 1JV5A 4I8DA 1MIEH 4LGPB 4QKXB 4GKSA 1MCHA 1CD9B 3RVVD 3K4AA 4HIIB 1F00I 2VLJE 4MA7H 4V2CB 5DMIH 5J9PB 3QIBC 1LP9F 3Q2CA 3PWUA 2EC8A 3IU3A 3TN0D 2YPKA 3UO1L 1BHGA 4P2OB 4NWUH 5KVGH 1TMCB 3CX5K 3LS4H 4R4FH 3N06B 3TVMA 1CR9L 1EEZB 1AKJD 1FFNB 1J1OL 4JDTL 4P2RA 4YR6B 5IHUL 4NGHH 1YC7A 5EFIA 3MFGB 3EW3B 1YJDL 1BP3B 4OLEA 3BP6A 2F5BL 2R0LL 2I07A 5B4MD 3ULVH 4L8SC 5TDNA 3ULVC 3RAJL 4HH9A 1A7QL 3S35X 4TSBL 5BZWA 4L4VE 4UDTB 2I27N 1UB6B 3BT2H 4LU5H 4LNRA 4HLJA 1NLBH 5D70H 4PJIF 4QHMA 3OJVC 1JRHH 2IEPA 3DNKA 5AAMA 2FGWH 1BIHA 4DKFL 3PQYB 5C0IA 5H37G 2UV3A 3ZLQC 2DQDH 4Y4KC 3AY4A 1MIEL 3L95B 3O11A 2FJHA 5F6HI 4DKEL 2DYPA 3MBEB 4L3AA 4UUJA 3UTSB 4LLQB 5DMIL 3GMMA 2AXGB 2VLKD 1JF1A 1JYVA 4NWUL 5KVGL 4MCYB 3LS4L 2PO6C 4R4FL 1OLLA 2L4OA 4JKMA 2WANA 1WTLA 5HHPA 3HAEG 4Z7WF 3MUJA 4NGHL 1MJUH 4L8BB 1JFQH 3M07A 2BP3A 1BPVA 3V5KA 3T0VA 5HYQA 3A67H 5E8DH 2G75B 3GMRB 3ULVL 1P4IH 4KQ4H 3UPCA 5CSZB 1KPRB 3SO5A 5GQBA 2BC4B 4Q74A 4F7PB 5C6PB 3BT2L 1J8HD 4M6AA 5BXFA 4PJ9C 3NBNA 1XAUA 5ECJE 1RJZA 1TQCC 3RL1B 2IALB 3ETBF 3BI9X 5EOQL 1NLBL 4MS8C 2AEPH 4K7PH 1IM9D 4R90L 5E99H 2XACC 4U6YB 2XPGA 5KW9H 3FKUS 4YBHA 4Q7DA 1KLGA 4GW5A 3F7QA 4PJIE 1CFQB 1JNLH 1Q0XL 4ODXB 1CK0H 2DQDL 2EXYC 4IRZL 2YEZA 4OLUL 2YK1H 3HA0A 2HLAB 4U6HB 4AEIL 5DRXA 5JZ7C 2J7LA 3T3MF 4APQA 2V7HB 4HJGA 4PTUA 3WFBH 4F7CA 2DDQH 5DJYA 1U41A 2QJDA 3OAUH 3U30C 3O2DH 4NN5B 1MEXL 4MJ6A 5H94A 3TWCH 3ULUF 3SGDI 4QRRD 3VD9A 4YHNA 2FR4A 2ARWA 5E7FA 2NY2B 1A7NH 2VLRE 5INCA 2XIDA 2CMRL 1IGTA 3L3GB 1QFWI 1NDMB 1DVFA 3P9MB 3IF1A 4JM4H 3CZFA 5LQBH 4JFFE 1J8KA 2C3XA 1S78C 4XHJD 4LPCA 4PG2C 5I0ZA 1NQBA 4KQ4L 4AEFA 1M7IB 3QUXB 3O4LB 2ILLA 2XKNA 4DVRL 3ARGD 3SE3A 1ZGLB 2AXFA 4PJIA 2XWTA 5I73B 3WDIA 4MA3A 3S7GA 3KPQA 3UMTA 4JG0H 4HWZB 2AEPL 4EOWL 1JTTA 4K7PL 2DQTH 5ABDE 4JAMA 5KW9L 2LU4A 4AIOA 4HFUH 1CK0L 5JHDD 4XPFH 2HTKD 4QHKI 2VZTA 3X13B 2YK1L 1JF1B 4S2SA 2VLRA 3OKEB 3LD8B 4YDKL 4LLDB 3WFBL 1UH3A 3Q5TA 4YEEA 3O6FC 1MLCA 2X4QA 3OAUL 4GKNB 4Y4FA 4ZO9A 1BFVH 5FYLL 4JFFA 1FNEA 3TWCL 4M5YL 4U6XB 4D0BB 1A7NL 3VFMB 4LCCC 2X9XA 1IBGH 3BEWA 3MRHB 1ODAA 4WHTA 1ZHNA 3GMOA 1OL0A 3QUMB 4IEFB 1RUQL 3TA3D 3K3QA 2J6EA 1FVDB 3BWAB 2Q76B 3OKYA 4J8RB 1HHJB 4U1HA 3KYAA 2DQUH 2Q7NA 2H6PA 3VGAB 2GTWA 1YEKH 5SX5H 4L9LA 5ESVA 3ARBC 2Z8RA 35C8H 4IMKA 4E42B 3T65A 3UTPD 3PXJA 1EGJA 4JG0L 3VGEA 3FONA 4HUNB 5IP4A 1XF4A 3RVXD 1TETH 4JFED 2JB6B 1EBAA 5ACMA 2MHAB 2BSSB 2R2EB 3HPJB 4XPFL 4GRLA 5LAXB 1IQDB 3T77B 3INUL 4PR5B 4K8RD 4ELMF 3KLHD 1NFDB 2HVJA 1OLZA 2AKRB 3OHXB 2WQRA 2XWJA 5GZND 3JVGC 1L7TL 2YSSA 2QKIB 3H9SD 4P23A 1BFVL 3LEYL 3TCXA 1OSZB 4DZBB 4D0DA 4IHOA 4Q0XH 5FKAB 3G5XA 1IMHC 3FMGH 1ORQB 3WSQH 1SY6A 3IDMB 5IB3A 1XIWD 5LXGH 1PKQB 1N3NA 3U46B 2YRZA 2G2RA 3BQUC 1IAII 4G42B 4QYOA 3MPCA 4WWID 1TQBB 3NFPB 4PP2A 5IJVB 2AJ3A 3RI5K 4NQDB 1EVUA 4OLYL 4NQSB 2YC1A 4HF5H 2QSVA 4Z77A 3U6RA 3W11C 1T7XA 2EDHA 3I6GB 4Y4HA 3QNZB 1GZPA 4UIMB 4WDIA 4ZDHB 4CW1A 1TETL 4Y19E 1KIUA 2X1OA 1MHCB 1FZMB 5E5RB 3VE0A 2BNRE 1UQSB 4YBLC 2Z93B 2XTJC 5DFTA 4G6AC 3MV11 1ACZA 4NO0B 3FOLB 3OR6A 2VAAA 4X7DC 2DI8A 1WITA 1D5XB 4OB5L 4M8QA 3MLXH 2ZCHL 2C9AA 4WVRA 4Q0XL 4B0MM 5HHMB 2ITCB 2W0FA 2ZKHL 2X4UA 1BQHA 3KPSD 2A6KA 2PXYB 2WBWB 5GJTH 4W6XB 5K9QG 3SDCC 1PJ9A 1QLRA 5FF6B 5DJ2A 3CVHH 4X0KB 4LCUA 3O4OB 4IRSC 3B9KD 3O9WC 2EYRB 3D9AH 3ZKSD 4KI5F 4LCWB 1JGLH 1WWAX 5BRZE 1ZXQA 4J4PA 3GSXB 4ODWA 4HXBH 4HPOH 4K2UH 2X9YA 1CDIA 3UPRA 4Y19A