4HIIB

Anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose-galactose
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
203
Chain Sequence
LINLVESGGGVVQPGRSLRLSCAASGFTFSRYGMHWVRQAPGKGLEWVAVVSSDGRTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKEGGDNKFSFDYWGQGTLVTVSSASTKGPSVFPLATAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPQTYTCNVDHKPSNTKVDKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 023.102 light chain
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 203
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hiiB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hiiB01
4OZGB 5HDQH 1FGVL 2KDGA 1A7NL 1U3ZA 4GKSB 1CT8B 1HOCA 1F2QA 3EO0B 4P9HH 4YBLC 4QXUH 3SJVD 3DVNA 3BZDA 1NGZB 4HCRL 5EOCL 4JFEB 4QOKA 1KBGL 2MWCA 5HDLA 5EB9A 5KS9B 5T1KD 5IJKA 3DSNA 1OCWL 2JIXD 3BJLA 3GIZH 4HF5L 1XF4A 2X9XA 5GS2D 1J1PL 5F7DA 2J6EH 3HE7D 4KI5F 3L95B 2GSIB 1KT2A 4Q58C 4V1DA 2AP2A 1X5GA 3O0RL 5IVNA 1KJ2A 5JPNB 4J12A 1LGVA 3B5GA 5HGHB 1CTOA 3ARTA 4O2FB 4YX2L 5EPMB 1I9IH 3TVMC 3MXWL 1FSKB 5C0DA 1YNLH 2YUVA 3KYKL 4H0IA 1I8IB 5IESL 4LQFL 4JFZL 3AAZA 4K3DH 1CFQA 3CFCL 4MHHI 1KJ2H 5L8JB 4G7VH 5GSVA 1I3RB 1R3LB 5C0BB 1LK2A 4JDVB 4YHLL 5FYKD 5GJTL 1K4CA 3TIEB 5KSUB 2QADC 3RZCD 4R0LA 3KHOA 3V0WH 3TF7C 4R2GB 5F8RC 3F6IA 3LS4H 1T1ZB 4PJAF 5GS0L 1K8IA 3D2UB 5CFHA 2A6KB 4Y8AA 4ETQA 2YEZB 1KTDB 5DD3L 1TIUA 3HMXA 4PGBA 4EQ3A 4XH2A 2I5YH 4XNZB 1ITCA 3SO3B 4X8XA 3VGGA 5ID1B 5CGMA 1PAMA 2YKLL 5C0AE 3MRKA 3V5KB 1VKXB 3MCLH 2UZIL 4PJBE 1P5VA 4JR9L 3HKFA 4G9FB 4KPHH 3D6GA 5J56B 5BV7H 3RHWK 1J0HA 4L4VE 1OD7A 5TF1L 4OSUL 4MGXA 3WNOA 3L9RB 3MNZB 1WZKA 1U3HB 3ZHKA 2YD5A 4N0FA 4S0TD 1DVFB 2ICEA 2DTSA 1FN4B 2YUWA 4GMSH 4WI9A 4MD0A 3HC4L 4LVOC 1L6ZA 2OSLB 4Y4KA 1TLKA 1D5MA 3IETB 1NGQL 1T2JA 4WHDA 5JW4N 3MMEA 1WFOA 1DBML 1PYWA 5TE4H 1PEZA 1Z9LA 2CKNA 4PJ9A 4JJ5A 5EUOA 4LCWE 5CSZA 4NYLB 4KY1L 4M9PA 4ZFOL 5JXEC 4JQXC 4I0KA 2YSSA 4X0KA 1YJDH 4AEEA 1NCTA 1E0OB 2AJYL 1T0NA 1UCTA 1U58A 3DLQR 3SDDC 3K4AA 4KK6D 1YQ2A 2LAAA 3VXSA 4CVXB 1MHEA 1W72A 5CJOL 2I9LB 3P9MB 4JHBA 5HDBF 1M7XA 4R6UA 4MXQC 2ZCHH 4APQB 3LKSB 4ZO9A 1DJSA 4QCIB 3ZDYE 5DMYA 2H1PH 1AC6A 3H9ZA 2WQ8A 1R5IA 1NUNB 3JUYA 1R3HB 5I1EH 2AJZA 1W72H 1ROWA 3FQXA 4HZLA 1KEML 4MAYC 3TBSB 5KW9H 2DDQL 4GBXB 4YHKL 2DQUL 5DMGD 3REVB 3SE9H 1KB5A 4GQ9H 3RNQB 3U6RB 3DRQA 1RJZB 3OKDA 4G9DB 1MCPH 1R3IH 3CFJB 2YUXA 3T0EE 3GSOB 3NIGF 4EN3D 5HDOA 1BQLH 2PYFA 3BDXA 4QNPF 4JFFD 3OGOE 3V4VL 5C0JA 4U3CA 3NCJH 3JWOC 4PJCF 3RWEB 5EU3A 5D7JC 2FH8A 3B3IB 3EO1A 3O2WH 3KWWA 3AS3A 5BVJA 3DTXA 4C56D 1L0QA 2BXYA 1A1OA 1N3NA 4YE4L 3BGFC 3MSPA 3QCTH 2P44B 4OGAD 5IVXF 2NY7L 5C3LD 4LNRA 5HJ3A 1Q9OA 5F72S 5ISZE 3B5TA 2NY5H 4ZO8A 6FABL 2WUBH 3GHEL 2AK4A 1HXMB 2J8UE 3FB6A 1CD0A 2JCCE 2XA8H 3QPQC 12E8L 2VB5A 3EOBA 5IMOA 3IAGC 2J12B 4HFWB 3X3GH 4KH2A 2JELH 1F5WA 2YC1B 4NOFA 1QYGL 3MRDA 3O8XD 3V0VA 1F6FB 3SKMA 2H26B 1QBLL 5EU4A 5IF0A 1ZXQA 1FFPA 3GIVB 4FG6C 1BJMA 3D9AH 5D96B 3VGBA 1AFVL 3O6MH 4MLIA 1T1YA 1QR1B 3CLEH 3M1BB 4YFLF 2B4CL 5ALCH 3NN8B 5C09E 3INUL 2RFXA 5DF0A 3UZQA 2QQNL 4M8QA 4KK5C 4JKKA 1QRND 2FX7H 4EEEA 2XTJE 2DICA 4Y0GA 1RZKC 2YPVH 1Z0MA 2CK0H 4WFFE 3MRJB 4BSVA 4UINL 1IC4H 1DUZA 2GI7A 2YPLD 4MA8L 4MS8C 3BKMH 3VW3L 5T5FL 1BREA 3SDXE 4F9LA 5TDNA 1OAUH 2Q3ZA 1DLHA 5I71C 2I9TB 4M9OA 4QRSB 3E6FA 2Z31A 5TGBA 5IGXL 3Q2CA 2O5YL 1QSFD 2DBLL 5I8OH 1CLYL 3H0TB 3OAZH 2PNDA 2FJHB 5BVPL 4Z95L 5F7YC 4JQVA 1NC2D 3C5ZD 4HIHA 4FTVA 4HLJA 2VQUA 1EGJA 1QA9A 1RZ8A 4Y4FA 3MV7E 3ZE2F 4PJ5E 1CYGA 1FNGB 4G6FD 2G2RB 2HFGH 4XCNA 3KDMA 3PP4H 4LK4A 2X4PA 5IW3A 3B9AA 1DQMH 2CO7B 4GLRI 1JHKH 1CD8A 4KQ3L 4DUXA 1E4WH 5FYJL 2GUOB 2VDKL 4R4ND 3FQRB 1Q9WB 4P2OC 4HT1H 4IIQC 5C0GA 3WUWA 1QFUL 2V2WB 2WWKO 3HS0B 1CQYA 3E8UL 2X40A 2XQBL 3HPLA 4ODTL 1GXEA 5E6IB 1U8JA 5HYSA 1G6RL 2VDNL 5IMLA 4NO0D 4HUXA 1RURH 1KUMA 1E4XL 1OSZB 2Y4SA 4F7PB 4KU1A 1ZLSH 3QG7L 4LGSB 2A1WH 2J4WH 1CICC 2LU4A 4F2MB 4JFPA 2CLZA 4PRHD 2AJVL 4X9IA 3QISA 1JFQH 4YAQB 3QIWA 1NMBH 3BESR 5KSBB 3TO4C 4ZUTA 4XP1L 3HLAB 4YDKH 5HGBA 2P8LB 1QRKA 1X4ZA 1RK1A 1T1XA 2OJZL 4WI4A 1TETL 3RL1B 3EOYG 1KV3A 1KELL 2N7BA 1CE6B 1OT2A 3TN0C 5T3XL 2BX5A 3GKWH 1BAFL 1WSST 3MA7B 1X6LA 4PJBB 4X4YB 3C2SA 4KHXH 1P7QD 3UTPE 1HI6A 1MCBA 4N8PA 1BIHA 2GJZA 3GMLA 4K71B 3UDWA 3T2OA 3BH9B 4PJXA 4X98B 1CCZA 1P4IL 4HJJL 3VFOA 3LKRA 1NEZB 5CEZE 4NC2B 1AGFB 1BQHA 5AZ2H 1A7QL 5DWUH 3UTTD 1AI1H 3MRNA 4X4ME 4QT5A 1MCSA 2ORBL 3C5JB 5E9DB 4NDMA 3ULUC 4NCC1 1S7SA 5EUKB 1AXSB 1IKFH 2AJUH 3FFCE 1J18A 5GISH 4FQJL 1WGOA 3PQYB 1OP5K 1S7VB 1CXEA 1T7VA 4LCWB 3FO0H 3S34L 4HJGB 3OQ3B 3DYOA 1G7IA 1DFBH 2X1WL 4WVRA 4WV1B 1T7WA 2HWZH 2ZUTA 3JWNC 4FQLL 1P6AB 5IB2A 4GG6A 1O7VA 1UG9A 4XX1E 1ZOXA 2BSTB 3RA7H 1F90H 2DQCL 2BVOB 4HWZA 5D2NC 1FH5L 2Z93B 5BMFL 3QR2A 1MAKA 1H3VA 4U4BA 2N4IA 1OB1A 2ENYA 5I15L 3I6LD 4KI5D 1OF2B 4AEHL 4H20H 3DPBA 2F53B 3NCMA 2NXZB 1OTSC 3T0EB 2DJSA 3OL2A 3MNWB 5TE7L 4X6CE 1D6VL 5D6CA 4DZBA 3BWAB 1N7MH 5AZEH 3DMMD 5DK2B 4FFYL 1ZK9A 5FA4A 4TNWF 3SPVA 3ZKSD 1BLNA 5JIPA 4NIKB 2FBJL 2W0FA 2ZUVA 3VD3A 2GT9B 5IB4A 5DD1H 5FKPB 4FQCH 3OKEA 5D7LD 1NGZA 4JFEA 3TBWA 5KS9A 1IC7H 1FZMA 1L0XA 3CFBB 3MUJA 2V5YA 3CSYA 2GSIA 3E6HA 1J9CT 3RKDD 1KIRB 5JOPD 1RVFH 5ISZB 5C2UB 3VU2A 2BRQA 5EPMA 4R7DB 2J8UB 5D5MF 2CQVA 3VRLF 3C60A 4UNVA 2X89D 3SGJA 1U8PB 5ICYA 4N0UE 4W4OA 4WEUD 4ODSH 2J5LC 2QHRH 4JREC 5C0BA 4OZHB 3V52H 4KTEL 3OJVC 3PL6D 5F1KC 3HI6L 2C4FT 4RGNC 3TIEA 1FZJB 3VDAA 2A77L 1AGBB 5KSUA 3UZEA 4ERSL 5IW1A 3BZ4A 3ULSA 5L8LB 3FN0L 4GOSA 2I25N 1T1ZA 3X11B 5CLTA 3BQUA 3D2UA 5C0RL 2YEZA 5D7JB 1KTDA 3ME0A 1X5XA 4U1JB 4R26H 5LKNA 3SDXB 4AG4L 2NR6D 4P2RE 1L6XA 4O58H 3V5KA 1VKXA 4DVRL 1Q1JH 4XCFL 5J1SC 4G6AC 3WJJA 1SY6H 2EDKA 3MREA 2W38A 3O9WB 1IGCH 3CVIL 3DX6A 2HG5B 2A6DA 3S88H 1BFTA 3L9RA 3MV8B 5ILTH 3KS0H 5CIPA 2MCPL 1U3HA 1AHWB 3L3JA 1DVFA 2BRRH 4MJ6B 4Y1AE 4WHYH 3IETA 1BEYH 4PJ5B 3STBA 4JPIB 1UJ3C 3WS3A 1TPXB 2HTLC 5CIPH 3ARDC 1U8IB 5CUSH 4I18B 5E1AA 3LEVL 4U7MA 4YDIL 1S7XB 1AIFA 2WP3O 4MDIB 5I16A 4I3SL 3EDKA 3B9KB 4PJIF 4NYLA 5GGRY 4ZUUB 2WZPD 4O51B 1IGML 3D25B 3PE9A 5CJQL 4NGHL 4TTDC 2IQ9H 4XNUH 1GOFA 1DBAL 5IMMB 4KJPD 4RMWA 5F1NB 1UACL 1MJUL 1I1FB 4P2YA 5MI0B 4NO2B 4CVXA 2PXYA 5EO1B 5T5NG 4F33A 4GRLB 3OX8A 2VRAA 1SJHA 3MPCA 4U6HA 3P9MA 4Q9QL 4APQA 4QXGL 2E3VA 4QCIA 1MCOL 3Q6GL 4I3RH 1C16B 2XT1B 1VFMA 1WCBB 1EJ6A 1R3HA 1VESA 4WENB 1EEUA 3NPSC 3V6OA 4Z5RB 3TBSA 2IANA 2ZP0T 1B6UA 5CEXB 2ITCA 4XZUB 3K0WA 1G7QB 3QT2A 2H32B 4BH8B 3DV6A 2ZOLB 1W8OA 4XWGL 5DUPH 1Z0NA 1FPTH 2Z8RA 4F15C 4NM8H 4ZQKB 4IDJL 4JM2F 3QPXH 2QJDA 1I1AB 1KG0A 3KR3H 1YN7B 3GMPB 3WKNA 4QTIH 5DVOA 4MJ5B 3K2UL 1JRHL 2CR3A 3JTSA 4CMHB 4DFHA 2MPAH 4OCXH 3B3IA 4W4NA 4M7ZC 3HE7C 4OM0L 3VH8A 2I60H 4AEIL 4HXAL 1JRHI 2Y36H 3S5LB 1BJ1J 1P69B 1P84K 4P2OB 3MLVL 4HIJA 5J11B 4XC1H 3A6CH 3ABZA 2XFXB 1TQCC 1MWAB 1YEFH 4KHTH 1XGRB 1CZ8L 4PJ7A 1HILA 3OKLB 4OKVB 4XP9L 4JCLA 3FFCB 4Z7OF 2R2HB 1G9MH 4DKEL 2BVUA 3QJFB 4UT7L 4XMKL 1EHNA 4GS7B 4K3EL 2BK8A 4DZ8B 3MFGB 4JPKH 1U42A 4JPWL 4O02H 3WKML 3T2NH 1GGBH 2L4OA 3HZYA 5ALBH 4N8VA 4V2CB 5GRWA 1KXQE 2YRPA 4I77H 5SWQB 2F54E 3PGFH 4DUWA 3NA9H 2EXWD 3FO2B 5E4IA 2H26A 2NTFB 3VA2C 3KYOA 5JIHA 3GIVA 2ZUWA 1IGFL 3ALWA 1E28B 1LO2H 4NN5B 1TNNA 4U3XA 3M1BA 4ENEC 1N6QH 3BAEL 1HDMB 2ERJC 1MFEH 5AWNL 1WWWX 4NCC2 4PY7B 3BO8A 5I74C 1D6EA 5KAQG 5I75B 2GHWB 2NY1D 1FAIH 4HFUH 3SQBA 4P48A 4OCYH 3EW3B 3T0AA 5AG8A 2C3GA 5FV2A 3GI8L 3VG0H 5HYFA 3FB7B 2AABL 2NZ9D 3LEXA 4PD4J 5LAXA 1LO4L 1QVOA 1XIWD 4TULH 1BFOB 4K3GA 4OV6F 1VGKA 1JI2A 4JG1L 5JHDD 2LV4A 2VDOH 1G9NC 1FNGA 3L3DB 2R1YB 5E4EC 5F7EH 2QKIA 1HH6A 1HSBA 4L1DA 1EO7A 1IAKA 2GUOA 1CGXA 3L3HB 2DL2A 2EDTA 4YXHH 3HS0A 4OD2A 1FDLH 3HI5H 4P3CL 2D03H 5E6IA 3SOBH 4M4PA 1LD9A 4Z7UF 1MRCL 4N0UB 1OM3L 1AGCB 3MLRH 4PJEB 1HYSD 2ICWJ 4G80A 1A6TB 5C6PB 5DMGC 4F7PA 5F9OL 3CK0L 1QFWI 4ONGL 3ETBF 2VSCA 3V8CA 4LSQL 2R9HD 1JMZA 5KSBA 3MACL 3D0LA 3HLAA 2P8LA 3MLSH 3HG1E 4FQPA 4XP6L 3ARQA 3G5VB 1OARL 5A2LH 4L5FH 3WE6A 1KPVB 1AJ7H 1CE6A 4P2RB 5JQ6H 2HKFL 1JYNA 3MA7A 1N2RA 3VFPA 4HKZB 4X4YA 1CXFA 5EO9B 4LSPH 4I48A 1CLZH 3A6OA 5B38B 5IV2B 4X6EB 3N0PB 4X98A 1X5IA 3GSWB 4RZCA 2N56A 4MCYB 5FYKU 1Q0YH 4PY8I 3FCTB 2DBJA 4J3OC 1AGFA 1G7MA 4RMSA 4Y1AB 3BT2L 1OT1A 3C9NA 3TVMA 3D3VE 4GO6B 5E9DA 5F93C 4Q2ZB 3MGTB 3MRPA 1AXSA 1XCQA 3G9AB 5C07E 3PQYA 1S7VA 1IARB 4LBEB 1RZGB 2K7QA 3O8XC 4HJGA 1J1OH 5ANMA 2CDFB 3OWEA 4S1QL 1Q72H 4P2QE 4QEGA 4WV1A 4GW4A 4HS6B 3I3DA 4FZEH 4JO3L 5I8KH 4XPFH 3QWQB 4YJZL 1WAAF 4H0HB 4PJDF 5FGCE 4JAMB 3WN5B 5D1QD 2VMFA 4MD4B 3KJ6L 2IF7A 2EC8A 2BVOA 3IXTB 2X4TB 3A67L 3WFDH 1IGYB 3ILPA 3U7WH 4XB8A 3O2DA 3O3BB 4KVNL 3I84A 1KPUB 4U1GC 4KDTC 3WJLC 3NIDE 2AJXL 3ZZ1A 2DB8A 2O26U 5IB5B 3UXFA 3WFBL 2F53A 3O2DH 1I9EA 2XNAB 1MLCA 5HGDB 3V5HA 3SY0B 1Z6JT 3C5ZC 3C09C 3MV9D 5I18L 1SEBA 2V9TA 4L3EA 2GTZA 5D7IE 2E6QA 5DK2A 4U7KA 3HI1A 2V2XB 3GJEB 1YEKH 2VKXA 5EN2B 5DFVD 7FABH 3QFJA 1N5YL 3OKKB 2IH3A 2HRPL 4HUUA 4S11A 2B0SH 4CDGC 5FKPA 4JQXA 4CU6A 1DBBL 4NHUB 4R4NC 1RK0B 5CD5D 1J0ZA 4K3JH 2WLZA 4KJQD 4G8GD 3SDDA 4H5SA 1AY1L 2HTKD 5EZIL 5IJVA 1ZANL 4L8SB 1J8HB 1T20B 3IDYC 1YY8A 3CZFB 5GRVL 4ZAKD 1A6VH 1T04A 2R4RL 1FCGA 4JY6B 3NPSB 3LN9A 5I8EB 4B7IA 2NNAB 4MAYA 3DBXB 4YH6A 4I8DA 1OGAA 4MJIE 5JA9A 2VN7A 2F54B 4IS6B 2EH8L 4OZHA 3EYUL 1K3ZA 3OB0H 4KKAD 4X4ZA 4X6FB 1FZJA 2LAGB 1ULVA 1RUAH 5F44A 4EI5D 3OB8A 3QZWG 4WFED 1ERNA 1INEH 1CDGA 2BVPB 3X11A 1H0DB 3BRGC 5FGBC 4OF0A 1F42A 3H9HB 5D7JA 5K93A 3BYYA 1UM5H 1BVLB 1C12B 1YYML 2HFTA 4PBWD 3U0WL 3SDXA 1RIUL 4CMMB 5EOCJ 4LLDB 3JWOH 3VXRD 3AROA 3UPRA 4XXCC 4NQDA 5GS1B 5J13B 3O9WA 1N26A 4YGVB 2VZTA 2HG5A 5FV1L 3MV8A 4PJFE 4L9LB 4JKPL 4DGYL 4BKLB 3VFUA 4YBHA 1I9RL 1ZT4B 4KROB 1JGDB 3ZSTA 5IEHB 4Z9KB 3QIBC 3QDMB 3LQZB 4EUPB 5JDSB 3BPCB 5GGVH 3PHQB 4FABH 2VLKD 1C8PA 3P73B 2FD6L 3QEGL 2Z8SA 43CAB 4F8TA 3BX7C 1JMXA 1U8NA 3QCVL 4WFHD 3MBXL 3FO1B 3EOAB 1GZPB 5IMMA 3W11D 4RFNC 4MDJB 5F1NA 3SCMB 4NO2A 5FHAH 1UWXH 2VXQL 1N6UA 3NPZB 3R1GL 2FCBA 1OPGL 4KI5C 5I74B 4U1IB 1KGCD 2CH8A 4O4YL 5AEAA 5IHBA 4C55A 4MB3A 1ZLUK 1NCDH 4IRJB 4RRPG 3CFKB 3C87A 5EC1A 4QGTA 1ODAA 4Z5RA 1C5CL 4O00A 1KLUA 4MQ7B 1CGSH 4IOFD 3VI3F 5CEXA 2OJEB 2BSSA 3HG1B 1JZ8A 1G7QA 4H0GA 2H32A 4XX1G 2ZOLA 3G6DL 1EHXA 5HGAB 1LE9B 2C3HA 5EA0H 1FYTD 1CGWA 1OY3B 4NQTA 2EIZB 1C7TA 4HH9B 2VZUA 4Z0BH 3T65B 1OAZH 1YN7A 4W70A 5EOQL 1CBVL 4L3CB 4M6MH 4JLRB 5JR1H 1IGIH 3K7UA 4IJ3C 3KYMA 4FZ8H 5HHXL 2YA0A 4WUUB 2FGWH 1X5LA 2J88H 3RKDC 5J57B 3BZEB 3QO1B 1KCUL 3EOTL 5T3ZH 4P2OA 3TJEH 5GGTH 1EZVY 4JHAH 2V5MA 1WQVT 1BX2A 5C0CB 5ESQB 5DT1H 3SGKC 2F5BL 1N59A 1R0AH 3OKLA 4OKVA 2X1QA 5GRJL 4R8WH 4YUEL 2R2HA 3L5XL 2NW3B 1R6VA 2ZUYA 2FYYA 1NBQA 4PTUB 5CBEB 4DZ8A 3Q48A 2Z4QB 3BKYL 3UZVB 4X9FA 4DEPB 1CICA 1JGVH 1IVLA 4XNMA 1J1XL 3ARGD 3WEXB 4P2QB 1J11A 1M6OB 4WW2C 4OLUL 5HYJB 3BXNA 5SWQA 2UWEF 3TO4A 1RUMH 3GSRA 4E5XB 3KNBB 1B4JH 4GUPA 3FO2A 2NLJA 5FGCB 3ARYA 1Q38A 3EZ8A 2NTFA 5DLML 1U91B 2JK5A 3RVUD 1HQ4B 4MA3B 1JPFB 1BBJB 1FORH 4OCWL 3WFEL 3GK8H 1HHJA 2NR6C 5EIIB 5DD6A 3ZE0E 3JWDL 5SX5H 4LRIC 4EI6B 5ECJE 1E4KC 4ZD3H 1ONQB 3NFPB 2R1WB 1NBVL 3KPSB 4C59B 2L7UA 2QSVA 2YA2A 5BCAA 3QXDB 5HHOE 1FG2B 1J0JA 2OL3B 4KZEH 4MCZA 4OJFL 1UB5B 5D7IB 5I1CH 3J8F7 2BMKB 2ITDB 5IVZB 1H8SA 1RFDH 3C5SB 4YR6A 4Y19D 2BHYA 3EYVA 1UCBL 1IM9A 1BFOA 4TYUA 2AEQH 3WLBB 3KPMA 4XGZA 4YHZH 2A74B 3L3DA 1KCSH 4L4TE 3DX8B 5J7CC 3OSKA 4KJPC 4LFHG 2EE3A 1NJ9B 1K85A 2JJVA 3VFGH 1O7SA 2JLLA 3QUKB 4YBQD 3MLUL 5KVMC 3L3HA 4MJ4A 5D2NA 3RGVB 1FC1A 1NAMA 4WJ5B 4K23H 4LSVL 1YQVH 1NAKH 4NBXB 3F6LA 5M95B 4NNXB 1CDIA 5JDJA 4PJEA 2E8ZA 1GOGA 5T33L 1KEGH 1F3JB 1NAMH 2YRLA 1T7XA 4JN1L 4M1GL 3SQOL 4X5WB 5DRNB 4AL8H 1ZA6B 3TBVA 1EMTL 3GMQA 5FO7B 1NFDA 5JTWA 1A3QA 3OR7A 2VDPH 2VLLB 1IC5H 1CE1L 4LSUH 3KPOB 2O5XH 2GFBB 1AO7D 5F1IA 5IR1A 3RWJB 1WJ3A 4JFDB 1KPVA 2DTML 4OD3L 1RIHH 2IMNA 5D1XB 1T80A 4RQQA 2VXTL 3OPZL 4CNIB 3NIGE 3QCUH 1SVZA 4HBCL 3ZE1E 4QNPE 5IV2A 1H5BC 1A3LL 5DJYB 2Q8BH 3HUJE 1XT5A 3X12B 3RU8H 3GSWA 4UQ2A 3QRGH 3RAJH 4PJFB 2VXSH 5L2KB 1IILE 1NDMB 1J0IA 3FCTA 5MP6L 5E2JA 1XFPA 4CJ0A 2XN9E 4U3HA 3BP5B 4F3FB 4U6VH 4JN2B 4Q2ZA 5JIIA 2FIKA 2OR9L 3PDGA 3GDBA 5EORL 3E3QE 4KDWA 3ZTJH 4LBEA 5IVXE 2NX5E 2ADGB 5TH2B 2EXWC 3U9PL 1MLBB 4XPBH 1J0YA 2IALA 1QSEE 1I1RA 2OI9B 1URLA 5DGQA 3WHE0 1BFVH 1S7QA 2A6IB 3LEYL 3KLAA 5LCVL 5JLZB 1X4YA 1FQ9C 4PRNB 1FYHB 2DKSA 4JAMA 4MD4A 2E5EA 3RWGB 5L88L 3IXTA 4F58H 4JRYE 1RU9H 35C8H 5GRUH 1ZHLA 4Y16B 2B1HH 1S9XB 2NY1C 3O3BA 4HPOL 2ZPKL 4CN6A 4B53A 4S2SA 1P4LB 3O45B 5KTEL 1WT5C 3DXAA 3L5HA 4XAWL 1A4JB 4G6MH 5IB5A 1CL7L 2JJSC 1JYVA 2NZ9C 2UYLB 4TOYL 3SY0A 1ADQL 1XIWC 1H3TA 1MHCA 2VQTA 2YMXH 5EG6C 5F7NC 1UJ3A 3T08A 1T2QL 3T0XA 4XBPB 3D1MC 4YEFA 4Q9RL 2V2XA 3ARDA 3QIBB 5FGRA 3OKKA 3HR5B 3K74B 1DZBA 5ACLA 5LXGH 3WUWG 1CDYA 4PS4H 1N6VA 3LKQB 3F58H 2D7QA 1NMAL 1B2WL 3G08A 2EECA 5J4MA 4NN7B 1XGQB 1QNZL 4NCDA 1Y6NR 3KXFD 1RK0A 4U1SA 5HYSG 1YYLH 3IU4L 4YXLH 4OB5L 3WDIA 3KPPA 2VL4A 2NY2D 3IKCB 4UV7H 3GMMB 3AB0C 5E99H 1NLDH 1UA6L 3EDEA 1MY5A 1J8HA 5EWIH 5E2VL 3H9YA 3PUCA 2ILLA 3RWCA 1HYSC 5C92A 1NCCH 1TJIH 2BOBB 4KRMB 4BFGA 3CMGA 5K9QI 3P9WB 4JY6A 1Q94B 3F7QA 5GJSL 4XVJH 1JWSB 5I8EA 4HEME 3QUYC 3G5ZA 3FQNB 4TRPL 1A64A 1MCCA 5DVNA 1A6AB 3RI5F 3U82B 3EGSB 2R9HC 3UJTL 3D85D 5HBBA 4IS6A 4N9OB 5E00B 1F4HA 1FIEA 2EDWA 2FJFB 1PG7H 2HFEA 3NACL 3WFZA 5C1MB 1BOGB 1ZHBB 4X6FA 3F65A 3G6JE 3V2AR 3W0WD 2R0WH 1YN6A 1MFDL 1MI5D 3LSOB 4RGOL 5T1KA 4CVWA 3VD5A 4QRUB 4HULB 3O4LD 3D39E 3MLYH 4LCCC 1BVLA 1C12A 1M1SA 3STZB 3HE7A 1D5BB 1UZ6F 1LVEA 4CJ1A 3WO3B 3OF6A 4E41E 3RHWF 4CMMA 3VGAC 3CDCA 1MEXL 1A3RH 3MJ9A 3ARFC 4YLQT 4QHMB 4YGVA 4PUBH 2O93L 5JIKA 1BPVA 3MJ9H 4TVPD 5HHPA 3VXUD 1MCWM 5DA4A 3RQ3A 3VFTA 2AV7B 3IDNB 4GRWF 3OV6A 5IEHA 4L4TB 3QDMA 3LQZA 3VXTB 4D9RE 4EUPA 5JDSA 3BPCA 1D5XA 5A1AA 3P73A 2C7UB 5F8QC 4V1DD 4GQPH 4YFEA 3IGAA 5FYKH 1B0GB 1INQA 5D1QC 2A9ML 3DUUB 4WUKH 1WWCA 4TSCH 3FO1A 2P49B 3EOAA 3FRUA 4XBGB 3ZTNH 4U0RB 1DBKH 3HNTL 4OZGF 4NQCE 4YDJB 3GBML 3RWFB 4URTB 3NCEB 1C1EH 3R06A 4WY7H 3LKOA 4ORGA 2D0GA 4RX4D 5GGSB 5CGTA 3UC0L 1JHTA 4U05A 2RIKA 3CXHK 1A6UH 1QKZL 4KKCD 1RMFL 5IQ7L 3RWIA 4HIEA 4IRJA 3CFKA 5CGYC 2XWTB 3JV6A 3NCYS 1M71B 3FN9A 3HFML 2DJ4A 2AV1B 3VFSA 5IW6B 2OJEA 2R56L 1WWAX 3HG1A 4HG4J 1SQ2N 5J6GB 1RSFA 3BPOC 5DFVC 1LE9A 1CF8H 5JZ7D 4I0PB 4WU5A 2EIZA 4MA1C 3RRQA 1T66C 4LLWB 2Q87A 1YMMD 3T65A 1JPGB 2DD8L 2Q7YB 3Q1SH 2X4NB 1OAYL 3HCVA 4L3CA 2QSCL 3WFCH 3SKNB 4ODWB 1TENA 3CIQA 4WUUA 4PBXA 1CTNA 4PJCB 2EZ0D 4NFCA 1A7RL 5EU5B 3BZEA 3QO1A 4WW1A 4OZFA 4XAKD 4XBEL 1WBXB 4K7PY 4Y4KD 2MSPA 5C0CA 2WSKA 2P8PA 5ESQA 3QULB 1JZ6A 3VD9A 4WI2A 4HC1L 4S1RL 4ZAKC 8FABB 1YMHA 1KB9J 4NQEE 2CRYA 3C08H 3PP3K 5DJAA 4PV9A 4OZFH 2ZSWA 4PJ9D 4XP4H 2PYEE 5IVXB 2NX5B 5CBEA 4PLKD 2LVEA 1WZ1L 2DI9A 2Z4QA 4LHUD 2ICWB 1QLEH 1NLBL 1C7SA 3WEXA 4KKAC 1QSEB 5C86A 3MR9A 4P2QA 4BQ9A 1MJ8H 4PJ8C 2BVTA 3BGMA 3TIDA 5D5ME 5HYJA 4JFOB 3VRLE 3P9LA 4E5XA 4EI5C 4JFFA 4QRQA 5GHWL 1QHOA 3QDJD 5L6YL 3QUZD 3FT3B 2E27H 3GNML 3RTQB 4HAFA 2FX9H 2A73A 2V17H 3RUGF 3U0PB 4MA3A 1A9EB 1ZWIA 4JRYB 1T0PB 2AGJH 4NKIL 4WHYG 1X7QB 3TT1H 4Z7NE 3VXQA 4XI5D 2QV2A 1AKJB 5EIIA 1ZEAL 1IAOA 1QO3A 4EI6A 4Z7WF 2XZAL 1H5BB 4NRZB 1ONQA 2W92A 4JEGB 5SWZB 4AENB 3KPSA 4J8RB 3CC5B 1DUYB 3QXDA 1XF1A 5DMIL 3VD7A 1XGYH 3BKJL 3CVHB 4NQVB 4UT6H 2P5EB 2O5ZH 1UB5A 5KVFH 2ITDA 2DQHL 4JKMA 4I4WB 3H9SE 3RDTB 3C5SA 4LOUD 4R4BB 2VABB 3O4OB 4FFZL 3WLBA 3T0BA 4PREA 3OKNB 1GHFL 1XZ0B 2A74A 2DLIA 2VDLH 1UM4H 3N85H 1MHHB 4LMQE 3ZDZE 4M93C 1BM3H 5LBSH 1GGUA 4ONFH 5TQ0L 2MKWA 2VXUL 3WNPA 1NJ9A 1C5BL 2MMXA 3VFMB 2DWDA 3UTQA 3QUKA 3QUXC 1QRNA 1UKQA 3I50H 1R5WB 3S8WA 2D7NA 3EYFA 5DSCA 4X6DE 2DM7A 2AK4D 4DKFL 4HKJA 1G7PA 3QI9D 2F5AH 5D71L 1SEQH 1FRGL 4R90H 4NO3B 1FZKA 1QSFA 3BIBX 3TBTA 5CKGA 1JGLH 3QH3B 3LKNB 4LPUA 5GGQH 4TNVF 1ZA6A 5IFAH 2GCYB 5FO7A 1TVHB 3C5ZA 5JUEL 1GGTA 4ZTOH 2ENSA 4FRWA 1PVHA 4H8WC 4NZJA 5EU6E 3VH8G 4JFHD 2B2XH 3OR6B 3OAUH 3D39B 3P30H 4M7KH 1W8NA 4JFDA 3VMOA 2FWOB 3Q3GB 2ZCLL 1KIPA 3CMOH 5ERWB 3C8KA 3CX5K 4UV4L 3U0TB 2Z31D 3CXDH 5DJYA 1EXUA 1QD0A 3LDBB 4X80H 1YEIH 2Z35B 5L2KA 2NPLX 1HZHH 4OCSL 4UUJB 2VDMH 4N8VG 5CEZL 3DJ9A 2ZSVB 5F3HA 4FTVD 3QIUB 2XZQH 3BP5A 3QFDB 1RUQH 2NXYB 4YPGA 5C0ND 5KSAD 4Y4FD 4JN2A 5FUOL 2VSDA 3MXVL 2W9DL 3ARGC 1XGTA 3QUYB 4A6YB 5HDQL 2ID5A 5HI3D 5D7KE 1IEAB 2DLFH 4X8JB 2R2EB 5TH2A 1AR1D 4AM0A 1PBYA 1VFUA 4NUGH 2JJTC 5A3ID 1U8QB 1U3YA 3RNKA 1U36A 1U95B 2HJLB 4QXUL 4QHKI 3O3EA 5E2TH 3LMJH 3N9GL 1T3FA 2A6IA 2B8OT 3FJTA 1TZHB 3BSZH 3GIZL 4NQCB 2J6EL 2CD0A 4TSAL 3FTGA 5ID0A 3QB7C 4M03A 3RWGA 3TYFB 2C26A 1AE6L 4F9PA 4Y16A 1S9XA 1I9IL 4LDLB 4OAWB 3HNVH 1P4LA 3ARFB 3IJYA 3UTTA 1Z9OA 3P2TA 4XXCA 5HTSA 3ZKXB 3BPLB 4P4KB 3MC0A 3QEQE 4K3DL 4MNHB 1KJ2L 1NGPH 4G7VL 3AM8A 5CJ5A 2XPGB 3LIZH 3UBXB 3QDAA 4PRPE 5FO9B 1MFBH 1G7HA 3HAEB 4XBPA 3W39B 1M05B 5K9JH 3QIBA 3G04A 3V0WL 4LKXB 1DEEB 4UAOC 4GXVH 4FQ1H 3LS4L 4NRYA 4GW1B 5D9SB 1T1WB 4R97B 3HR5A 4QHLB 1YY9D 2F19H 3VXMB 1TVBB 2ZOKB 2I5YL 4GG8B 5KAQF 1XGQA 3SJVE 1U8OB 4YBQC 3O3DB 1UGNA 3MCLL 2H3NA 3PIQA 3RIFF 4UB0H 3UTSE 3CPLB 2ZG1A 3V7AE 4OGXH 2V6HA 2OTWA 3GMMA 4KPHL 5BV7L 5DRZB 1V3LA 1HK6A 3QAZC 1MCNA 1NDGA 2EYRA 3QUMA 1PG7X 3MQIA 3NBNA 3EHBC 4Z77B 4GMSL 3T0WA 3ULVD 3WYRA 4OBRA 2XOTA 2P24B 5T3XE 5EOTB 5D5MB 4LCYB 3DYPA 5DEGB 4HDIB 3QUMH 1GAFL 1MHPH 3GKZA 5JORA 5HYQB 5TE4L 2Y5EA 5IBUG 4Z7UE 2FO4A 1FO0A 5IK3A 5BO1H 1NANH 4CKVX 1RJYA 1MUJB 2FJFA 3FAWA 1GJIA 5EH1A 5HYIA 1BOGA 4MA1B 5HHVH 5H8DA 4MA7H 4Y5XC 1Z9SA 1I7RB 1YJDL 3OKOA 4MNGE 2Z8VC 2EXYD 4UT9H 4X6BB 5D7LA 1FO0H 5KVGH 3MRBA 5EFIB 4QRUA 3HRZB 4PJAA 3S37H 3STZA 2J8HA 4MLSA 2YD3A 1INDH 1W0VA 4LLQB 4RMVA 2ZCHL 1EJOH 1KJVB 1IBGH 5B21A 4JO1H 4JY5H 3UAJD 3SGKA 1LE5A 4YK4C 5CMAB 3MRFB 5I1EL 1W72L 3QJHA 3TNNA 3PJSB 5DURB 4ZUWA 1MSPA 4OD1L 5KW9L 1CGYA 3DO7B 4WNQA 4L8CB 1KFAL 2YA1A 3THMH 3H3KA 3H9SB 5FYLE 1P4BL 5E95B 4GQ9L 1LEGA 1MCPL 1R3IL 1BWMA 2IBGA 4ZG1A 2VR4A 1BQLL 2AV7A 1FP5A 3IDNA 4JFED 3OKMB 2F58L 4WW2A 5F9JA 2BVEA 1KJMA 3TCLA 2OTUB 1QHPA 3NCJL 2C7UA 1VCAA 3GGWB 2VTFA 2VC2H 3MLTB 5F88B 5LWYH 1SBSH 3U79A 1ZE3C 2YPKB 3CDYA 4PJIB 3NZ8B 2XWJA 1YNTB 3V0AC 4XBGA 1U8KA 1AD9A 4XPAH 4LRIA 1E4KA 2VZSA 1HINH 3RWFA 3QCTL 2BNRB 4PBVC 4HK3J 4WI6A 1WAAE 5ACZA 5C0BD 5ICZA 2YD7A 4PJDE 2NY5L 4KMTH 2WUBL 4FQQA 3FOMB 2VH5H 1SYVB 4OQTH 2XWTA 4AH2B 2XA8L 1FIGH 3ZYOA 4M62H 1CFSB 5EU6B 5SWSE 4R2GD 1U8MB 5F7LB 5IFJA 2AV1A 5ETUB 2R39A 5IW6A 3ZKMD 2JELL 3D2UD 5F71A 4KUZH 1DN2A 4U1MB 2FGZA 1RZFH 1D5IH 1DQLH 1QLFB 4RFOH 3OAYK 1UEMA 3VXNA 3I75A 3D9AL 5DFWH 3P11H 3QYCA 3O6ML 3DOSA 4P5TC 2X4NA 3DGCR 1CFVH 4JM2B 3V79C 3CLEL 2JCCF 1ZVHA 5ALCL 3TPUA 3VDCA 4G9FD 4M93B 5DD5H 4PG2C 3MJGX 3SKNA 3LVEA 2FX7L 2NY2C 2DQIH 2Y72A 3FAXA 3K4DA 3CUPB 4PJCA 2YPVL 2CK0L 1KIUA 4X9GA 1IC4L 4M43H 1U3HD 4M7LT 1I8MB 3BKML 1DVFD 3EKCA 4HK3N 4C56E 2BHUA 4HSQA 4PGDB 1WBXA 3MUHL 3X14A 1KNOB 1OAUL 3WV0A 2XY1A 2WANA 4OFDA 4WI5A 4GFTB 4QY8B 4M7LH 5DJXA 5I8OL 4ZNEE 2AK1H 2X4QB 4K9EH 1U92B 5GZND 2X1PA 3O2VH 2IJ0C 5E8PB 3V4UL 3GSNA 4TUKH 3BVNA 5IMKA 4FA8A 1ZSDA 4QTHA 1NGXB 2HFGL 1UWEH 3PP4L 2FZ3B 3FT3A 4C4KT 1DQML 3GSNH 2RB8A 5F7UA 3U0PA 1JHKL 4K07A 4APQD 4D0DB 4JRYA 1E4WL 1U6AH 2CIKB 1X7QA 4Z18A 4YXKH 4HT1L 1HKLH 3GSUA 3JV0A 5BW7C 1H5BA 1L7TH 4MMZC 5SWZA 4GBXD 4AENA 1H8NA 4J8RA 3GHBH 2YPLE 3P3YA 3U30B 3UYRL 1RURL 3SDYL 5TDOB 1F45A 4PRPB 1TJGL 4WEMB 4NQVA 2P5EA 2J4WL 3FT4A 5CZVL 1TTFA 1MJJB 2W60B 5DS8B 2IAMB 5K59E 2W07A 1U3JA 1NMBL 1Z3GH 5FK9A 4I4WA 1R3JB 4YDKL 3RDTA 1P9MC 3QA3B 1A02N 1IQWH 1G6RB 4Q0XH 3ET9F 3QDGA 3C8HA 4HHAA 1K5NB 5FKAB 3VWKB 3CSGA 1XZ0A 5I17B 3GKWL 4OLVH 1MHHA 4N1CA 4NBZB 4FQXB 3UTSB 1RJLB 2DIJA 4U31A 3BEVB 5TE6H 1LNUB 3QNZA 5MEQA 2WINA 5F1SA 3T09A 5I73B 3NH7L 5MHSD 4OCMC 1BQUA 2P5WE 4OGYH 1FL3B 3FFDB 2ADFH 5AZ2L 5KSVA 1RQ5A 2Z9TA 1AI1L 3N1GC 3STLA 4KKCC 4JVUA 2DRUA 2FRGP 3O6FB 1WT5A 2UZXB 4NO3A 1QSZA 1IKFL 2AJUL 4Z7UB 5GISL 4ZO7A 1LO3H 3CNKA 3QH3A 2JJSA 3LKNA 5HHNB 1JNHB 5CEYA 3FO0L 3WNNA 1JV5B 3SKOB 2GCYA 2BOCA 1MPAH 1JF5A 4PP2B 1XIWA 5E08H 3QHZH 3RZCB 3JXAA 4MNGB 3IDXH 5IM7A 5JHDA 2HWZL 1CFNB 2VDQL 2HAZA 4WI7A 4KMQA 4LLMA 4NOBA 4KTYA 4E0RB 5I66B 3NABH 3RA7L 5FUZH 1DQJB 3Q3GA 1F90L 4HXBH 2V5RA 2R8SH 5I1KH 2VZVA 2XIDA 2DQJH 3GSQA 5DJ0B 4JB9H 1J05A 5DJ8A 3SDCB 2X4SB 3BZFA 4Z8FL 5CWSA 4H20L 3TV3H 2VQ1A 5HPOA 4W6XB 2ZSVA 3QIUA 4PLKC 8CGTA 4WEBH 1A4KB 1ETZA 2X4RB 1BGXH 3HNSH 3TEUA 2FBOJ 5FECB 5AZEL 1MNUH 3T1FB 3QUYA 3CGTA 4A6YA 1WFNA 1AR2A 5CS7A 2J3SA 2I07B 3OMZA 1S5IH 2OM5A 1NEUA 2DQEH 5DEZA 2R2EA 3QUZC 5ABDE 2RQ8A 3U4EB 4K2UH 1T83C 5DD1L 1DLFH 1BZ7B 4FQCL 3JV4A 4X6CF 2CDGA 4KRPB 5T1DH 1NUGA 2KZ1B 3FL7A 4XI5C 1ZA3A 1TZHA 5E6ID 1GOHA 4BSWA 4KTDL 1ORSB 1DBJH 2UWEE 4LCCA 3WNKA 1BBDH 2QSQA 1BMGA 1RVFL 4PJDB 4LP4A 4EDWH 2VLRE 3D18B 1U8HA 4CN1A 3ARFA 3LB6D 3RBGA 4HCRA 4BFBD 2EIEA 1UT9A 5SWSB 3I6LE 3NCFB 4P4KA 2AQ3A 1ACYH 4HBQA 5HI5C 3TA3B 2V7HB 2QHRL 3V52L 1XGPB 4LOUC 1JTPA 2ATPB 1KIQB 4OZIF 4EN3B 4HCRH 2HJKB 5FO9A 2OL3L 3HAEA 4XCCL 1GRWA 4Q6YA 2WBJB 4HF5H 1Q8MA 4KKNA 5GGVY 1M05A 5MERB 5E56A 4LKXA 1DEEA 1IAIM 5D9SA 4BFIB 4GW1A 3RPIB 1A1MB 1T1WA 3RFZC 5I9QB 4QHLA 3O0RH 3VXMA 1TVBA 4P99A 2IQAB 2ZOKA 1TJHH 2AKRA 1UXSB 2D4DA 5D1QA 3T3ME 4L4JA 1U8OA 3MXWH 3DO3A 2G9HB 2X2YA 5IESH 3BN3B 4LQFH 4N5EC 3QHFH 4J7RA 3CPLA 1B88A 5E9DD 1SY6L 3QI9C 3U46B 5DRZA 1EPFA 5DHVB 3S88L 4AIOA 3PQYD 4U1KB 3P40A 5HVFB 4XC3H 5TFSL 4LCWD 4PV8B 1UVQB 2BRRL 2ARWA 3NTCH 4BZYA 5J89A 3AY4C 4P5KB 5E8NA 1BEYL 2L7JA 2P24A 4NM4H 4HDIA 1CXHA 2NY4B 2PCPA 3MJ8B 5CUSL 3H3BC 3KLHD 3MRLA 4AQ1B 5KZCB 3S37X 1Y6KR 3AREB 3HC0B 1MUJA 1UH3A 3ARZA 2VYRE 2UZIH 3IFPB 1I7RA 1I1CA 2R0KH 2IQ9L 4XNUL 4F9LC 4KK9D 3QEHB 1LO5B 3QNXA 1XF2B 5TF1H 5FO8B 4OSUH 3HRZA 3GBLA 1BVKB 1EAPA 3ZTJG 2FR4B 4ZOEA 2F53D 2PO6B 4RAHA 1ZTXH 2NXZD 4YNYB 1EFQA 3SEPA 3ROOB 3T77A 1KJVA 3LRGA 4ZFOA 4I3RL 4RISH 5EU7C 4R4FH 5C0NC 1DBMH 5KSAC 4Y4FC 4ZAKA 2EYSB 2CGRH 3PJSA 2PW1B 3D0VB 3VXOB 4CBPA 3DO7A 4CADA 4PR5B 5DJZB 4IMLA 1JPSL 5HI3C 3LZFL 1BIIB 1FPTL 1AR1C 3GSXB 4NM8L 2H2PD 2WMPA 3HE6C 3HZVB 3QPXL 3KR3L 4J3TA 3D87B 2YXMA 4LIQE 4H1LA 4PJ8A 1MRDL 3BUYB 2FX8H 3E0GA 4UQ3B 1CLOL 2HLAB 1FFOA 4IRSC 5A2FA 3O6KH 5CJOH 2DQFB 3U7AA 4OCXL 3GGWA 4Z78B 4WDIB 3I2CH 5ISZD 2I60L 5F88A 5F89B 2P5WB 2YPKA 3IYLW 4H1LH 2Y36L 4C83A 4PJIA 3NZ8A 1YNTA 3DVIA 3A6CL 4XC1L 1DDHA 2YUZA 5F3BB 5J6HB 2DDQH 4YHKH 4KHTL 3PABB 2BNRA 1G9ML 2PW2B 1I7UB 3B9DA 5LGJB 5FA3B 2HVJB 1UJTA 2ZWLT 2EDFA 4JPKL 3I6GA 4O02L 3RVTC 3T2NL 3FOMA 2DYPB 1SYVA 3IDIA 5ALBL 3T8XB 4P4RA 1M7DB 3PHSA 1CFSA 1HQRA 4PJHA 1H8OA 5ETUA 5ITFA 3QXTA 4I77L 3L7EA 3PGFL 5D7JD 3NA9L 4WFFD 1U93A 5CD3A 4ETYA 1YY9C 4RWHA 1KSRA 3LRSA 1Q9KB 4YE4H 1LO2L 4ODUB 4P9MH 4J4PA 3OG6B 4M61B 4P46B 3SE8H 4EXPX 3L3OB 1OP5H 1UFUA 1N6QL 2PTVA 1EEZB 2PKDA 4QRTA 2GJ6B 1MFEL 2NY7H 3O9WD 1CFTB 2YN3A 4EIGB 1N4XL 1IZKA 3MV8D 3QUXA 1I8MA 4PPTA 5I1LB 1MJ7H 5DK0B 4PGDA 1FAIL 3OGCB 4HFUL 3IF1B 4OCYL 4AY0A 12E8H 3QPQD 4PJ5D 2OQJA 1Y6MR 1UM6H 3LOWA 3ULVC 3K8MA 3FHQA 4I5BA 2OMBA 3FB5A 4N0CD 3VG0L 1U92A 2CKBB 5IWLC 3SO5A 4XNYH 3DX9B 3B9KD 5E8PA 1MCLA 3DROB 1FYTA 4LLUB 5IOPB 4OF3A 4XPHH 2VLJE 5I1JH 5I76B 1A7PH 4J6RH 5F7EL 1K8DB 4GRLD 2UWEB 5I2IB 3VW3H 5JOEA 3V6BR 4NWTH 4NKOA 1GIGH 2PR4L 4MS8D 4D0DA 1CDUA 2CIKA 4LPXA 4NC0B 2X7LB 4H8WH 3OKYA 5J1AB 1VEPA 4YXHL 1WV7T 2VLRB 5E94B 1FDLL 2C1OB 2PTTA 3AMLA 1T21A 2YXFA 3EO9H 5C08B 3UAJC 2D03L 3VG9C 4UNUA 3SOBL 1IMHC 4FFWC 4WWID 1CVRA 2GYSA 4ELME 1MAJA 2XWBB 4GLRH 4ZDHA 1I1AD 4EUPG 1MJJA 1H3PH 2W60A 3I02A 4UZGA 3ARGA 3IDGB 3KPQB 3UTPD 3ZSSA 1XCTB 1R3JA 1HHGA 3MLSL 3ARVA 4KQ3H 1PQZB 1JPTH 2VDKH 2EDNA 1KF9B 3AXLB 3G6AA 4L5FL 3LN5A 4P2OD 3VWKA 5FKAA 1AJ7L 2X05A 5JQ6L 5C9KA 1G7JB 2A6JA 4JRXE 4WU7B 1P84J 4HK0B 4LSPL 1RJLA 1CLZL 4L29A 2VDNH 1LDSA 3CFEA 3FFCD 3SGJC 5CINH 2NY3B 5EBWB 2QR0B 1Q0YL 4U49A 3FFDA 2M2DA 3S96B 1ZT7B 2AJVH 3CJJA 3PNWB 4DOHB 3L3GA 2XG5A 3MBEB 4XP1H 3JWDC 5IG7B 4P57B 2L0DA 2Q76A 1KENL 1S78C 4R2GC 2X5PA 2H2SD 1TETH 2XQYK 3QQ9D 4HV8B 4LPTA 1KELH 1JNHA 1A0QL 5A2JH 2P45B 1XR9B 2CLRB 1PKQB 1YPZA 3DWTA 5HPMA 1EO5A 4M48H 1UB6A 4F37F 5IROA 4ZSOB 4XNZC 5DTFB 4KMLB 3SO3C 3W82A 4LNVA 2VAJA 1T0MB 3GMOB 4MX7B 1Q72L 3HMWH 3EJJX 2APVA 4P3WA 1CFNA 5CBAB 3VD4A 3B2VL 3K1DA 4OZFG 2VOTA 2Q86B 4HJJH 1RUKH 5I66A 1DQJA 2WLYA 5BOPA 4H26B 1OLZA 2BSED 3ARBB 3WFDL 2R0LL 5KANG 3FQTA 5CJBA 3ZT6A 3ULUD 1WISA 3EFFB 3MRCB 2CMRH 1H15B 5AUMB 3SDCA 4QHUA 1Q9LB 3S34H 4IOIB 4GKZB 3O2DL 3FONB 5GZNC 1EV2E 1TQBB 3R8BB 1OWRM 5INDA 1CG9A 5FOBB 4EOWH 2X4RA 1WIOA 3CFDB 2D7PA 4GSDH 3PDOA 1NC4B 4JDZB 4CVUA 3NIDF 1GC1H 5CKAA 2ZKHH 5JW5A 1OQOA 4HX1A 1FH5H 2B0SL 3EJZD 2DMCA 1C5DB 4APQC 4KKLD 1WUNT 4Y5XA 4UOW0 1TZIB 3NA4A 4Z7QE 3MGOB 4X9HA 4GH7B 2R4SH 3DVGA 5D7IF 2ICWI 4LCUB 3EDFA 1FVEB 1RI8A 5IUSA 4FQHB 4GBXC 2EEDA 1X5ZA 3RUGE 4YO0B 1D6VH 5B4MC 1S5HB 4H25B 1FE8H 3IFNL 1HHKA 1I3GH 4BYHA 4XVTH 3L3KA 2NMSA 2BNQB 1IZJA 4PB9L 4Z7WE 2VZ3A 3MX0A 4LEOA 3TA3A 2V7HA 4DCQB 2FBJH 4Z0XB 5FB8B 1I1YB 1SM3H 2E7BA 4JZJC 1XGPA 4E9LA 2ATPA 1KIQA 3CVHL 4P2RD 5FM8A 3HE6B 5MENE 1F3DH 1FFQA 4WWKB 5AYQA 1N64H 1INEL 4LQ1A 3RPIA 3VFRB 1A1MA 5DZOA 4BFIA 2ARJB 3P77B 4IRSB 2FHBA 5DVKA 2BFVL 4UDTB 4NHCH 4MB5A 1UM5L 2C4FU 3IB4A 1UXSA 3MRIB 4Y1AD 3JBG7 3EDDA 4YIQA 2GSGB 3ARPA 4MVBD 4QRPE 2FHFA 1CXKA 5C0EA 2G9HA 1HCVA 2AVGA 3JWOL 4IHOB 3RIAF 4G8GE 3U46A 4GXUM 3PV6A 5DHVA 3WD5L 4G43A 4U1KA 2YR3A 1WBZB 3U36A 4PV8A 2G5RA 4YC2B 2XRAL 3QNYB 1G7LB 1UVQA 4C54A 1DANT 1GVIA 2OBGA 1GGIH 1X9QA 4RGND 1ZKAA 1EEYB 5D96C 2P42B 3FN0H 1T6VN 2YWZA 1LEIB 3KGRA 4C58B 2VLJB 5BZWB 3X3FL 2FEEL 4U1LB 5C0RH 4ELKB 2NQCA 2R0ZH 2IFFH 1YEEL 4FABL 3AREA 3HC0A 1ZHNA 1JP5A 4N5UA 3H42L 4DVRH 1R24B 4XCFH 3GJFB 4P5TA 2VR9A 1SYSB 3EYQD 5MEOB 3KXFA 1HHHA 3U1SH 1XF2A 3VFWB 5FO8A 4W6YB 1P7KA 1BVKA 2MCPH 2FR4A 4NPYA 4XTRD 5T1LB 3O3UN 1M4KA 3B83A 2WIIA 3L3IA 2D0HA 3ROOA 4D8PB 4ELMB 1LP9E 5DRWA 3BDYH 1NCDL 3VXRE 1I9JH 3IFLL 5JW4R 2IPTH 3LEVH 2PW1A 3EDJA 3J7HA 3NAAH 1CGSL 1NPUA 2W59A 4RDQG 3ARWA 4YDIH 5DJDB 5DJZA 4XVSH 3L6FB 1T6WA 3RY5A 2XI9A 4Z76B 4J3UA 1IGMH 3BUTA 5CJQH 1F58H 4NGHH 2XQYG 4MQXC 4U2ZA 3PWNB 2Q1EA 3HZVA 3PHOB 4BM7A 1XAUA 1OAZL 5D1ZC 4JRXB 3BUYA 2VE6B 3FO9B 5IEKA 4UQ3A 1JVKA 4M6ML 4JY4A 1ACZA 2VLKE 2BCKA 4F7CB 2DQFA 5E6IC 2YD4A 4FZ8L 4Z78A 4WDIA 3W9EB 1J8HD 1IEBB 5CZXD 3LH2H 2J88L 3SBWC 5H35B 1RZIA 5T3ZL 3TJEL 1T7ZA 5GGTL 2BY3A 4JHAL 1PX4A 4M7JL 1QLRA 5DT1L 4KDVA 5GGRB 5BW7A 1R0AL 1DQDH 4R8WL 2F54D 1D7FA 3TBYB 4TUJB 4HQQH 4JCMA 1DQQA 2HVJA 1KCKA 1S8DA 5GSRB 2O61B 3F7YB 1JNNH 3OJDB 4KVCH 4WCYL 1WWBX 5FHBH 2VWEE 3S3JA 1EIBA 1JYXA 3T8XA 1JGVL 3F5WB 2HFFA 3VXUA 1J86A 2HVKA 3VWJC 4HS3A 4RAUB 3BPNB 1RUML 2AAVA 3HN3A 1P9MA 1UH2A 3AU1B 4NQXB 1HEZB 1A1NB 1GPOH 1QEWB 4K71C 1S9YA 1VFAA 3OF6D 4TVPH 4QXTA 3LHPL 1FORL 1Q9KA 5BS0B 4ODUA 1MCKA 3GK8L 4M61A 2WUCH 1CZ8H 3BW9B 5EZLB 3MOQA 3UBXI 3VXPA 2GJ6A 5JMOC 1IEHA 1YZZA 4K3EH 5JHLL 1X5YA 1EUUA 2QSTA 5D2LE 1YDPB 4ZPVB 1S9WA 3OGCA 4MNQB 3IF1A 4RX4A 1KXVC 3UJJL 5B39A 1PSKH 4HIIB 4LL9A 5BRZE 1MFAH 4KZEL 4QRRE 2OR7A 4MSWA 3ZE0F 4KROD 2XKNB 2APTA 3IXAB 5ADPL 5I1CL 3QDMD 3HZKA 4WV1C 3I6KB 1RFDL 2MHAB 3KLHC 3N50A 4PRIE 2V9QA 3WIFA 4UILH 5I30H 4DN4H 5I8CA 2EDXA 4LLUA 4LLAA 5J9PB 2AEQL 1IGJB 3BAEH 3M17B 3PGDB 4YHZL 2H8PB 4ENED 1YMMA 3RWDA 5AWNH 5I76A 1KCSL 4KK9C 3SCMD 1K8DA 3AS0A 5C0FB 2VIRB 4JDTH 5I2IA 4UOJA 4U0QB 3VFGL 3HMXH 3MRRB 1VACA 2IEPA 1FVCB 2KL6A 5D6DC 3TYGH 3RUGB 5FM4A 2NXZC 4IRJD 4N9GA 3T0EC 5E94A 4K23L 3GI8H 1YQVL 1NAKL 4R7NB 5FM5O 2Q8AH 5C08A 4PYGA 3IVKA 3P4LA 1AXIB 1R3KB 3O11B 4Z7WB 3W81A 3HG1D 5E5MB 3MRQA 3DX7B 1VADB 1KEGL 1NAML 3O3AB 3PG2A 4NQSA 2QQQA 3C6LB 3FQWB 3BIAX 4AL8L 4FMKA 3GSVB 4LHUA 4WRLA 5MENB 4LVHC 2H2PC 4LSUL 4AMKH 1JN6B 1SJVA 1XCTA 2NY6B 1MFCH 4Y19E 3HC3H 4WUUD 3PWPB 3BISA 5K9OB 3QDJA 4CW1B 3QUZA 3AXLA 3RL2B 1E27B 3WBDA 1T83A 2EYTA 1RIHL 4QRPB 4X5XB 5C0CD 3QCUL 1GZQA 4GW5B 4HK0A 1MRCH 5HI4D 1OM3H 5F6IB 1QFWH 3F7VB 1FJ1A 4G8GB 5C8JB 2ESVE 2Q8BL 2YBRB 3MZTA 4YEEA 3H3PH 1MIMH 1ZV5A 3RU8L 4LMQI 3QRGL 3RAJL 1NFIB 1RJCA 4ONGH 1F11A 5MEPA 3S96A 1ZT7A 5KVEL 5L2JA 1B0RA 3OXRB 3B9EA 4CRPA 4CVZB 2X6MA 3ECBB 4ZFFB 4P2QD 3MV01 2HKHH 4U6VL 4BUGA 2G5BB 5HYJD 3ZE1F 4P57A 1KB5H 4XP6H 3D69B 3HUJF 2EH7L 5IBTL 3GO1H 4HIXH 2W65B 1G9EA 2EDQA 4JZJB 1XR9A 2CLRA 4BZ1H 1PKQA 1JTOA 2ZUUA 4AIZA 4ZSOA 3GMRB 4B7LA 1CD1A 5DTFA 2Y07H 4MX7A 5IBLD 4N90D 5DQDH 5BZDB 4CGTA 4JRWA 1BFVL 3TNMB 1AO7E 3KPSD 3O9WC 1QPXA 4MXWH 2EE6A 5LG1A 2CIIB 3CH1B 4PP1D 1ZT1A 4H26A 4F58L 1ND0A 1NL0L 1RU9L 3ARBA 5GRUL 1VPOH 1LP9B 1AHWC 2B1HL 3LKPA 4QLRA 5GRZA 5KG9B 5KOVC 2UV3A 3QI9A 3MRCA 5AUMA 1TPXC 1KXTB 5M94B 4I18C 4G6ML 4BK5A 4N0CC 3UEZA 5DRXA 4NSKB 3FONA 3DUSA 3LV3A 3W2DH 5I1AA 4B50A 3B9KC 1DR9A 4TNWK 3V6FA 3AY4A 5JXAH 1FAKT 1TTGA 2EDDA 2MNUA 3CFDA 3IFOA 4HUMB 4JO3H 1QSVA 2YMXL 5FGSA 1F4XL 1S9KC 1A9BB 4O5LL 4JDZA 1F3RB 1ZLUH 5SX4I 5MI0C 1JF1A 2AXGA 4GRLC 3A67H 5LXGL 4DW2H 3QO0B 1QFOA 3F58L 1C5DA 3RGVD 3G5YA 4ZUVB 1TZIA 3MGOA 4MAUH 2X4OA 4QYOB 4JFXB 1WVZA 2QL1A 1YYLL 2AEWA 1I3VA 1XF3A 4LCUA 3WFBH 3K46A 5E99L 1NLDL 4JHWL 3S36X 4RA3A 3NFNB 5HY9B 3UTZB 2DLHA 4BH7B 4HKBB 1LDPH 3KPNB 3K81A 2VITB 4NN6C 1NCCL 1ORQB 3U4AA 1I4FB 4ODXB 1I1AC 5KSAA 4XVJL 4C57C 2BNQA 3BHBA 1EZVX 5HSFA 5L7XH 3JVGC 4DCQA 3P4MB 1VFBA 4Z0XA 2Y06L 1I1YA 1MCIA 4CMHC 1DE4B 5BJTA 4NC1C 4JFDD 1EGJH 1PG7L 5C6TH 5BXFA 5ADOH 2Y5TB 2NW2B 3HE6A 4NZUH 1SHMA 5GRYA 5D1ZB 1SJEB 5J11C 3EJYD 1KYOJ 3IJSA 1ZGLB 4RAVB 1S7UB 1FNHA 1OHQA 3RWHA 3VFRA 4F7MA 4OIBA 1FG9C 2ARJA 3P77A 4IRSA 4K7PH 3EAKA 1B3JA 4WGVB 1A21A 4L8DB 4PLOB 5L2KD 4OV5B 3MRIA 2HMIC 5HHQB 4M5ZH 1ZVSB 4GS7C 4Z7VA 3G6JF 2BY2A 4HZAA 3TJHC 5BRZB 4QRRB 2EDHA 1A3RL 4XHJD 3WFHA 3WHXB 1E4XI 4NP4H 2D31B 3EYUH 4PUBL 5C0IA 5LGHH 5EC2A 4PRIB 5A16B 3QNYA 3HA0A 5H2BA 1LEKB 2H2SC 3QQ9C 3AS1A 3SGDI 3HTLX 3LY6A 3CFIC 1MREH 1EEYA 4OLXH 1KTKE 5D4QA 4NN5C 5GGSY 5C0AB 3BP7B 1OAKH 2F74B 2FSEA 4U1LA 3VWJB 3PGCB 2Q3AA 5GIRB 4L4VB 4ONHB 5FYKL 1RIUH 2DQGL 3X13A 4G5ZL 4Y16D 4WUKL 2AJ3B 4TSCL 5I75C 1F4YH 3W0WE 1KPRB 5H94A 4K3HA 4Y5YB 4GAYB 1YUHB 3ZTNL 1MI5E 3VFWA 1KLGB 1YEJH 3X17A 5JOFB 3P4OB 4MYWB 3O4LE 3B8SA 2EICA 1C1EL 4WY7L 2FHCA 4JM4L 5DEFB 3A0OA 3Q5OA 3MNVA 4RMQA 2JE8A 1I9RH 1X3DA 4XNQB 1ZS8B 5DC4B 4LF3A 4XP5H 4DN3H 3QIBD 2B5IB 4IMKC 4Y4HC 1AGDA 3QEGH 3V8OA 1I7TB 4HGMA 5FYLL 5BV7C 4UIKL 5IWLA 1FV1A 3KS0J 4Z76A 3LAFA 4FOMA 1CF8L 3QCVH 2LQRA 4TVPE 1NUDA 3PWNA 2B1AH 3PHOA 4K55A 3ULVH 2Y7QB 1XH3B 4QOKE 3BFOA 2GIYA 1VEOA 3EJZC 2VE6A 3FO9A 3Q1SL 4KKLC 3L5WB 3BYTA 4TPRH 3T3PE 2ESVB 2EDBA 3WFCL 4V1DE 2D0FA 3C6SB 1IEBA 1UADC 2AXFB 3MUZ1 3MYJB 4WTWA 3B6SB 5H35A 2OCFD 4I2XA 3ZT5A 2CXGA 4GRWH 5DJ2B 1X5AA 3S7GA 2BDNH 4G3YH 3DIFB 1WBYB 3MROB 1H3UA 3VRIB 5D72L 4P3DB 2VL5B 4OZGA 2DIAA 1QG3A 4TUJA 4GKSA 2ZNXA 4XP4L 1CT8A 3FB8B 5GSRA 3UX9B 3HAEG 2O61A 3F7YA 4MHHG 2JB6B 1MY7A 3EO0A 1QLEL 4GAJL 2FO1A 1VFOA 5EOQH 2V7NB 3F5WA 4LVHB 5FF6B 1MJ8L 2JTDA 5LVEA 2PUQT 4RAUA 5E8DH 5HHXH 1AO7B 5B8CB 4NQXA 1HEZA 2LU3A 1A1NA 1QEWA 3ZHDA 3L95A 2E27L 3T0VA 4WI8A 3EOTH 2V17L 5J1TC 3GB7B 4QO1A 4N0YH 2MOVA 2OTPA 3M8OH 4ZPTB 1T4KB 5BS0A 2AGJL 3TT1L 5JPNA 2ARJQ 4YDVB 5AYUH 5HGHA 4OZIE 1QPPA 4J1UB 3BW9A 4MVBC 4O2FA 2GY5A 4WO4B 5EZLA 1IL1B 4POZD 2JCCB 4UTBH 1I8IA 1JZ5A 1B9ZA 3WNMA 1K3IA 1P7HL 3H7BB 4QHNB 4ZPVA 1I3RA 1R3LA 4MNQA 4JGJA 4JDVA 1XGYL 4MWFB 4Z7NF 4JANB 4UT6L 4OLUH 2O5ZL 3IXAA 2R69L 3S97C 5JO5B 3I6KA 3L7FB 5C09B 1TCRB 4KK8D 1CI5A 3G5XB 4HPYH 5EUOE 2A6KA 2XTJB 2APWA 4OCWH 4ZTPL 3WN5C 4WHCA 5J9PA 2NY5C 3Q6FB 3JWDH 5ID1A 1F97A 5FUCE 3VE0B 1Z5LB 1TFHA 4W81A 1U0QA 3S4SG 1G0DA 4JFQB 1KJ3L 3EYQC 5C0FA 1BM3L 1NBVH 5LBSL 2VIRA 3VXSE 4ONFL 1NBYB 4G9FA 4OT1H 3MRHB 3TFKC 1FVCA 3I50L 1NFDF 3MNZA 4XTRC 3FT2B 3RBSA 3BKCH 1PLGH 3CCHB 1FN4A 4A2MA 1CN4A 2OSLA 3CXHJ 4J2XA 2F5AL 3ZDZF 1SEQL 3MV7B 4R90L 4I9WE 1UCBH 3BMVA 3DX7A 1VADA 4PRBB 1A22B 1D5ZB 4ODHH 1F6AB 3FQWA 4H1LG 4I0PD 5GGQL 4DQOH 5I0ZA 3LPGA 5IKCB 4X6DF 1A5FH 3CX2A 3KPLB 2HN7B 1F13A 1ZVYA 2B2XL 3QZWB 2F8OA 3IDUA 3PWPA 5K9OA 3P30L 4CW1A 4M7KL 1E27A 2I9LA 4L8SC 3NFSH 1H3GA 3F8UB 5CZXC 3LKSA 4YHPB 3F7VA 3VFNB 5C8JA 3CXDL 4N8CH 1CDCA 2GAZB 4X80L 1LMKA 4GBXA 4M1GH 2NX5D 3REVA 1HZHL 3RNQA 3U6RA 1RJZA 2VDML 4G9DA 4ZXBB 3TT3H 2AK4E 4NN6B 3OXRA 2XZQL 3CFJA 4CVZA 1RUQL 3GSOA 2ZUQB 1QP1A 5FDWB 2VNCA 1YEHH 1WTLA 3D69A 1MRFH 1NCAH 2DLFL 4PGEB 2VN4A 2W65A 4LCIH 4JZJA 3RWEA 3QXWA 4JRYD 4KUCF 5DD0H 2NY0B 1HH9B 2VXTH 3GMRA 2B20A 1EFXB 3KJ4C 1JHLH 3ORJA 1AKJD 1MAMH 4OLZH 1A3LH 5E2TL 2A2QT 3LMJL 1KCVH 5BZDA 4JFHE 2C1PB 3TNMA 5SWZD 4OCNC 3O4LB 5GS1C 5J13C 1NBZB 4POYA 2VUOA 2IBZY 32C2B 3CH1A 5MP6H 4X7FC 1JBJA 2X1OA 4P23B 5DQ9B 4L9LC 2P5ED 3LS5L 5KG9A 1YECH 2AERT 1HXMA 3HNVL 4JO2H 1PEWA 4NNYB 4KROC 4MD5B 2X4UB 3RDTD 5CSBA 4HFWA 2BJML 1NGPL 2YC1A 2APFA 2CUHA 4FTVE 3LIZL 2YD8A 3QDGD 4DTGH 4QOKB 2MKLC 1MFBL 1DEDA 4YHML 1A9BA 1RZJH 1QR1A 5LCVH 1O5DT 3K8LA 1OP3H 1HYRC 5CLWA 5K9JL 3NN8A 2JJWA 4GXVL 3PWVB 4Y2DC 3SCMC 2CKBL 5L88H 1JNLH 2F19L 5E2UH 1KJ2B 3QO0A 3MRJA 3ZHLA 2I27N 4ZUVA 1RHHB 1ADQA 2CJUL 5KTEH 2I9TA 4IRJC 2FB4L 4X6CB 4UB0L 4QRSA 2BY0A 4OGXL 2QEJA 5J0BA 4DAGL 5FAAA 3NFNA 3ZMRA 3H0TA 1LK2B 2FJHA 2OXHA 4HKBA 2GITB 1DCLA 3KPNA 1ADQH 1K4CB 5D7SH 3NGBB 4HG4K 1I4FA 4CU7A 4LGPB 4Q9RH 5CILL 4PB0H 2FLBT 1TXKA 3RVVC 1U2HA 1HWHB 4K7PX 1K8IB 2FJGB 3Q5TA 1MHPL 3QUML 4Y4HB 5DI8B 3WIIH 4ETQB 3P4MA 2G2RA 5BV7B 2MQCA 1TNMA 5BO1L 1B2WH 1DE4A 4XH2B 4D2NA 4FNLH 4FHBD 2XV6B 4MJ2A 3MRKB 5HHVL 4LSSL 3FQRA 3PP3H 4MA7L 1Q9WA 5D1ZA 1SJEA 3IU4H 4OZIB 5DC9B 1ZGLA 5HVGB 1U9KA 4WTZA 1S7UA 2V2WA 4UT9L 5KVGL 1CGTA 3CX5J 5HI4C 4PJXE 4L8DA 4OV5A 3GBNL 3S37L 6CGTA 2QLVB 1I7ZB 5HHQA 2ICEB 3M45A 3SBWA 3QIUD 3BRFA 1OSZA 2NXYD 1EJOL 2R15A 4DEPC 4F2MA 2W9LA 4JO1L 4TRPH 2XZCH 1NKOA 1PYWB 3QUYD 3WHXA 3MOBL 2D31A 4YAQA 3THML 4JJ5B 5EUOB 1VA9A 1JWMB 5CSZB 3NACH 2Z0BA 4DVBB 2BERA 1MCEA 3RL1A 4X0KB 4L8BB 2XICA 3ULVE 4G7YH 3TGXA 5C0AA 1T0NB 3BP7A 1U58B 4EXKA 3VWJA 4PJBA 3MLPA 5IBLC 4NQCD 2HT4D 3VXSB 4NJAH 1W72B 4GG6E 2D9CA 4ZS7H 4OLEA 1BJ8A 1MF2H 2I24N 4IEFB 5GIRA 4L4VA 3O81A 4ONHA 3BH9A 2VC2L 5LWYL 1SBSL 5JQHC 4PP1C 2AJ3A 1NEZA 4POUB 4PRDB 1UYWH 1RAMA 1BF8A 3SE3C 2WAHA 1YUHA 3ARFD 1IT9H 2E9IA 1KLGA 3SGEI 3MUY1 4P4KD 5JOFA 4YHOH 3C5JA 3DRQB 2KQMA 3OKDB 5EUKA 4XWOC 2UY6A 4WHTB 5DEFA 4KMTL 4LCWA 3TM6A 3T4YB 5L8KB 4OIAA 4XNQA 5FDYA 4OQTL 4HMEA 3IJHB 1FIGL 4M62L 1I7TA 4XPTL 5E03A 3EO1B 1KC5H 4KUZL 1EAJA 3VXMD 3KWWB 5E2WH 3DTXB 1D5IL 1DQLL 2BSTA 4OFVA 4X83A 2N7AA 2Y7QA 1XH3A 1A1OB 3UJIL 3RGVC 2Z93A 4LIQL 4D94A 4PLNC 2C3WA 5DD5L 2EDLA 4Y5VC 5JW3L 4XCYB 2ZNWA 1Q9OB 5GS0D 1OF2A 2AXFA 3UC0H 2Q6WB 1QKZH 4M43L 5D6DA 1RMFH 5IQ7H 2GK0B 4W68A 5DJ2A 3FB6B 1HCFX 3T0EA 5CGYD 3MROA 1K6QL 1WBYA 3MNWA 3KYAA 3HFMH 2DMBA 4L3AA 2R56H 3BWAA 4K94C 2W0LA 4P3DA 1EDQA 1UXWB 2AK1L 1UWGH 5ITBL 4OZ4B 3SKMB 4K9EL 1X4XA 3FB8A 5EU4B 5IF0B 3ESUF 2JB6A 4JPVH 1IQDB 1T66D 1X5KA 1T1YB 2GT9A 3WXVH 5D1XC 3S35H 5FF6A 2QSCH 1JK8B 2WQRA 2R23B 4M8QB 4OI9A 3EJYC 3CFBA 4HC1A 3RX8A 5B8CA 1UWEL 4BSVB 1DUZB 1A7RH 3GSNL 5INCB 1KIRA 4CDHA 4ZPTA 1U6AL 5ISZA 5TDNB 1T4KA 2IADB 1F4WH 4YXKL 1JNJA 4HUNB 1HKLL 2XY2A 4HC1H 4J1UA 3E6FB 4S1RH 5TGBB 4R7DA 2J8UA 1IL1A 2JCCA 2DF3A 5DURD 1L7TL 1V7NH 1BHGA 4XHJC 1OOAA 3H9SD 4HUWB 1U8PA 1N0LA 1NCBL 3GHBL 3H7BA 4P59H 1JGEB 1CXIA 4HIHB 2HA1A 1CU4H 1P53A 4JANA 4FS0A 4PJ8D 1AGBA 2OI9C 4XCNB 5JO5A 3KDMB 1Z3GL 2X4PB 5C09A 3L7FA 1TCRA 1OSPH 3GNMH 1L9MA 3G5XA 4YDLC 4Q0XL 2I26N 5JMRA 5C0GB 4U1JA 1FNSL 3KJ4B 1KACB 1Y0LB 4F9PC 4QGYA 3VE0A 4Y16C 2XZAH 4OLVL 2DM4A 2RBLA 3FZUD 4JFQA 3JUZA 1U8JB 3GM0A 5K59F 5HYSB 1NBYA 1A6ZB 5F9WB 1AP2B 2BNRD 3EYSH 1JTTA 3ZYIA 4EDXB 5DMIH 3TZVB 3AM8C 1CD9B 1V3KA 2ADIB 2CLZB 2ADFL 1AHWA 4MJ6A 3CCHA 3EBAA 4I3GA 1KCRH 3QIWB 3V6OE 2A0LC 3MV7A 1QBMH 3GZKA 2IANE 4PJ5A 4ZUTB 4JPIA 5HGBB 5H37H 1U8IA 4I18A 1LO3L 4PRBA 1S7XA 1BP3B 1D5ZA 1F6AA 4MDIA 1N0XL 4CAGA 2CRIA 4MZ3A 1GHFH 3R4DA 3B9KA 3FQUB 1MPAL 4ZUUA 4J4PD 4O51A 4NN7C 3D25A 3QHZL 4JM2D 5DR5H 2VXUH 4WI3A 1LHZA 2GJZB 3GMLB 1I1FA 4Y2DB 3QUXD 5EO1A 3LKRB 4GRLA 3NABL 4RBPH 3T2PA 3UYPA 3ZDXE 1CDHA 3OHXB 3MRNB 1YEGH 4D3CL 4XNXH 2R8SL 1C16A 5I1KL 4NDMB 4PJ7E 2ZUSA 3VFNA 1WCBA 4RWYH 4B5EA 2DQJL 1RZKH 3L5JA 1QBBA 4XZUA 2E7HA 2VISB 2Y6SC 4BH8A 4ZXBA 3VDBA 5JUEH 4NKMB 5AD0B 1A14H 4WEBL 3HNSL 4ZQKA 1BGXL 4DGVL 1I1AA 4BZ2H 3MOAH 3GMPA 2N1KA 2EC9U 4MJ5A 2H32H 3JVGA 5IB2B 5IT2H 2DQEL 1KN2H 4KV5E 2ZCLH 1OAXL 1EFXA 5DUBB 1DLFL 3S5LA 4UV4H 1QR4A 5IFHL 2XFXA 3K4ZA 3CDFA 3D3VB 4HAGA 5T1DL 4X4MA 3SN6N 1MWAA 5DK3A 3GRWL 3FHAA 1XGRA 4POZC 1DBJL 32C2A 3FFCA 5D70L 1BBDL 5C07B 5B39G 3QJFA 4P23A 5DQ9A 2OK0L 2APBA 4PRPD 2C3VB 2YWYA 5FYJD 4D9QE 4EDWL 1MWAH 5D6CB 3WO4B 3MXVH 3GMNB 2W9DH 3AVEA 2MTPA 2VAAB 2IAMD 4XMLH 2VLME 4RRPA 4NNYA 5FA4B 4MD5A 5GRVK 4CN4A 1X5FA 1ACYL 1G6VK 2C9AA 2X4UA 1BLNB 5E8EB 3SPVB 3BE1H 1RZ7H 4KI1A 5F7WC 2J6EA 2W0FB 1EO8H 4XB7A 5IB4B 1PKOA 4KK8C 3VWKD 3OKEB 5L9DL 3N9GH 1CK0L 1N8ZB 3TBWB 1WICA 1G0XA 3IRZA 4KXZH 1E28A 5I1IL 1FZMB 3CSYB 1WFUA 4FQXD 3UTSD 4JGMA 3MLWL 3PWVA 3E6HB 4OF5A 1HDMA 4U0RC 3MO1B 4TSAH 4X99B 1AE6H 4PY7A 3SKUD 3BDBA 1DN0B 1TJHL 5FCUH 3C2AH 5J3HD 1JL8A 5DUMH 1RHHA 2VXVH 4NJ9H 1EBPA 3C60B 5T3XD 3B9VA 4X6CA 3QHFL 3O6FD 5ICYB 3OAYH 5HHME 5TPWL 2Y23A 4LHUG 3FB7A 4XC3L 2GITA 2HT3D 5DXWA 3WHE1 1BWWA 1GGYA 3UO1L 3RI5K 3T3MF 4NZRH 4X7SH 5IW1B 4CUCA 4I0PC 3NTCL 2COQA 3BZ4B 3ULSB 1KCLA 4Y8DC 1RD6A 3ULUH 5KSBE 3GJFK 4NM4L 3BQUB 3CD4A 2FJGA 4IMKA 4Y4HA 5EBMB 5DI8A 1YA5A 2R1YA 2E9BA 5B3NA 1G0YR 4ZFGH 3CZJA 4HEPG 4LAQH 4OZIA 1S3KH 2R0KL 3F62A 3MREB 1U8LB 3PWJB 3DX6B 2A6DB 3OG4B 4Y5VB 5FYLD 3SDCD 4MJIB 5CIPB 4N0UA 5DO2D 1W0WB 1AGCA 3VGEA 1I7ZA 4HS8H 3E3QC 3L3JB 1A6TA 4O9HL 1ZTXL 3EHBD 4WW2F 4HUKB 1FNEB 3VCLB 4RISL 5E9DE 4R4FL 1GAFH 3WS3B 1MCRA 3ROLB 5E1AB 2CGRL 3PQYE 1AIFB 5I16B 1JWMA 4DVBA 3G5VA 3RTQC 4RFEB 5ANME 4L8BA 5CCKH 1UH4A 3L1OH 4ALAH 4P2RA 1UENA 2IGFH 4KRPD 4JG0H 2FX8L 4HKZA 5EO9A 2PXYB 4F33B 5B38A 3OX8B 3O6KL 1SJHB 4U6HB 4X6EA 2VO5A 3I2CL 4ESKA 3W5MA 3B2UC 2D7OA 1RIVH 4IRZH 4MCYA 3KPRE 4PRDA 4PTTB 4Y1AA 4NWUH 3RVXD 1YNKH 4OD1H 2CUIA 5SWSD 2W9EL 1KFAH 2IANB 3A6BL 4LGRB 1B90A 1P4BH 2ITCB 1OWWA 2LTQC 3MGTA 3TA3D 2F53E 3HPJB 3DV6B 4TQEH 3RDTC 4WHTA 3KLDA 3U7YH 1RZGA 4RNRB 1KG0B 3T4YA 3E2HB 1JGUH 2F58H 3O4OC 3OJ2C 1NMCB 4UBDC 3EIFA 4L3EE 2CDFA 2WBJD 3IJHA 4LLYB 2CUMA 3QWRA 3JTSB 4HS6A 3QFJE 2ICES 4OFKA 3VH8B 4LASH 4YDLB 2X70B 4KZDH 3WN5A 4R3SB 4HIJB 2X4TA 1FNFA 4P9ML 2ZCKH 1IGYA 3SE8L 1A7OH 3BP4B 4S0SD 4YWGL 4PJ7B 2X44D 1HILB 1O0VA 1KPUA 4XCYA 1EX0A 1JE6A 2Q6WA 3SDAC 5I1DB 2P7TB 1MJ7L 4FMFA 2GK0A 2XNAA 3HZYB 5HGDA 4N8VB 5E5UB 3S35X 2DWEB 4LLVB 3WIHA 1JWUB 2AI0L 3MTRA 2WWKT 1UM6L 1OGAE 1V7MH 2NY4D 1CL7I 1FGNH 5DMJB 1UXWA 5KZCD 4OZ4A 4OZHE 3GJEA 5I19H 3IDMB 5EN2A 3ARED 3KYOB 4XNYL 4ODVH 3WIHH 1IQDA 5E6YA 3UMTA 2M8XA 9CGTA 1CR9H 4P5TD 3VA6A 4NHUA 1ZLWK 1F02I 4YHIB 1JK8A 2R23A 4XPHL 1EBAA 5I1JL 1A7PL 4J6RL 2DL9A 3BO8B 1FLTX 3LDBC 4YHYB 1TCMA 2PO6D 1D6EB 4NWTL 4UNTA 5INCA 3O6LH 1GIGL 5HGGS 4L8SA 5C71A 1T03H 4H8WL 2IADA 1T20A 4IBLT 4F7EB 3CZFA 1LO0H 3QIUC 1WEJH 2NXYC 1OP9A 4OCRL 4NQDE 1KOAA 3EO9L 4M1DH 1JZ4A 2A38A 2H6PB 3MV8E 2NNAA 4HUWA 3DBXA 1WITA 3LEXB 4RGMB 1JGEA 2F54A 4KAQH 1RULH 5LAXB 1QVOB 4OLYH 4FFVD 2RCSH 3V4UH 3ALXA 1VGKB 4M6NL 1YC8A 4D9LH 3S3PA 4LARH 1H3PL 3MLXH 4Q6IC 2G60H 1MCJA 4O2EB 5IB3B 2QKIB 1FBIH 2BVPA 1H0DA 1HH6B 5I1GH 1HSBB 4DK3A 2HT4C 4EBQL 1CDBA 4ZOAA 1IAKB 3H9HA 1JPTL 1BQHG 2P5WD 3GI9H 4ELMF 4OD2B 2C3XA 1Y0LA 1H3WM 1S7RB 2AEPH 5HHOB 2VDRH 4BUHA 4YQXL 4LLDA 5GZOD 1LD9B 5HHMB 3VGDA 1A6ZA 1AP2A 3UYRH 5D8JH 4R96B 3BPLC 4G80B 4P4KC 3ZKXC 5GS1A 3SDYH 4EDXA 3TZVA 2KUTA 5CINL 1TJGH 2EDJA 2ADIA 5CZVH 4L9LA 1WLHA 2DYPD 4AYFA 4BKLA 1ZLVH 2C5DC 4RIRB 4M02A 4TNVK 3D0LB 1ZT4A 5FOJA 1JGDA 3U9UB 2E6PA 4R97C 3S3SA 3PHQA 3WE6B 5IBUB 4FN0A 5JW4Q 4YBLB 4M48L 3FQUA 43CAA 4PGCB 1N2RB 1SMOA 4R9HA 3VFPB 4P46D 5T3ZE 1D9KC 4I48B 5HVWA 4QF1B 4EUPH 3HMWL 2GJ6D 1GZPA 4JO4L 4JVPA 3RVWD 5C2BH 4MDJA 4NC1E 3NH7H 4Y2DA 3SCMA 1WIPA 4RZCB 4ZODA 5IP4A 3VMNA 1RUKL 1G7MB 5GS0C 1OVZA 4U1IA 1ED3B 3NIFF 2QBWA 3C9NB 3OHXA 1E6JH 1OP3K 3TVMB 1S9VB 4M5YH 4M1CD 1UC6A 3MRPB 1L4IA 3QEUB 1XCQB 2CMRL 4MQ7A 4EQ2A 1DSFH 4HWNA 2VISA 3WS6C 3LQAL 4XRCB 4HWBA 1I85C 5ANMB 4NKMA 5HGAA 3U83A 5AD0A 4EOWL 4DKAA 2OZ4L 2QADB 4GW4B 2R29H 4HH9A 2P8MB 3V4PL 2VDQH 1IFHH 3W5NA 1IJ9A 3HB3D 4GSDL 4JLRA 4HWBH 1DP0A 4HMCA 3HUJB 1GC1L 5TJWK 2ZKHL 5ESVB 3ILPB 3HR6A 4JFYB 4X7DC 3KPRB 5DUBA 3SKJH 1G9NH 2VLRD 2XN9B 3D3VA 2R4SL 4K8RL 2ED9A 5C08D 1MCFA 4Z8FH 2K1MA 3ARSA 1MLCB 4LEXH 5C07A 2NW3A 1BOYA 5E8OB 2C3VA 1A6WL 3K8KA 3V5HB 4PTUA 5KJRH 1E6OH 4LVOB 2HH0L 1FE8L 3GMNA 1SEBB 4Z7QF 1I3GL 4L3EB 2GTZB 2VAAA 2VR5A 4XVTL 3ULUE 3HI1B 5EZOH 1M6OA 1IAMA 1FNLA 5E8EA 3QFJB 2IH3B 2IMMA 2PF6A 4GKOA 3U2SB 3I3EA 5F96H 3KNBA 3S36L 4OCLC 4HUUB 1SM3L 3LD8C 1U91A 1HQ4A 1N8ZA 1JPFA 1BBJA 2E7MA 3ALPA 2EE2A 2IG2H 1AH1A 1N64L 3EUUA 4KTDH 3SDDB 4H5SB 3FZUC 3MO1A</