4HIIB

Anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose-galactose
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
203
Chain Sequence
LINLVESGGGVVQPGRSLRLSCAASGFTFSRYGMHWVRQAPGKGLEWVAVVSSDGRTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKEGGDNKFSFDYWGQGTLVTVSSASTKGPSVFPLATAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPQTYTCNVDHKPSNTKVDKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 023.102 light chain
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 203
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hiiB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hiiB01
2AXFA 4PRPB 1JZ7A 1WISA 3KJ4C 3P11H 2PTVA 3GJFK 4NO0A 3C6LA 3QWRA 1EX0A 1XGPB 4LIQL 4S1RL 5I0ZA 3EYOA 4MHHG 4KZDH 3HMXA 8FABA 2NW3B 5IVZB 3U0PA 3GSVB 5D7IF 3CPLB 3ARED 5I15H 1W72B 4G7VL 1D6EA 1VENA 4LSUH 4G9DA 4IRSD 4NZTH 5D7SL 3T8XA 5CMAA 3OF6D 1H8OA 1XF5A 2Q86B 1HQ4A 1S7QB 4P23C 1J5OH 3K3QA 5ISZD 2K9UA 3VH8B 3JTSB 4PJCF 5FO8B 2R69L 3VRJA 5LGJA 3OGCB 1QEWA 1AI1H 4X8JB 3QCVH 1R3IL 4PP1C 4BK4A 3VXRD 3UTTD 2D03L 3ZL4H 3LMJL 1L7IH 1KCSL 4IS6A 3QEQB 2DQGH 1BZ9A 2H6PB 5F71A 3GZKA 1J1OL 3B9KD 3VGFA 4L8BB 2RFXB 1E4WL 3ES6A 1YY8A 3BN3B 4DQOL 4NDMB 4N8VG 1OF2A 3O6MH 4KK8C 3BKJL 4Y4HA 3MNWB 4PRHA 1BVZA 5FCUH 4BUHA 3PGFL 3T04D 2GJ6E 3HMXL 2JF1A 4UBDC 1FVDB 4QHLA 3FAWA 2G2RB 4KK9D 3CH1A 3T0BA 5ESQA 1SVZA 3SCMA 1KN2L 5EU6A 3QZWB 4MXWH 5AZEH 4G9FD 4MJ6A 1KTDB 1R3JA 5F1NA 1H5BC 2KQMA 3NZHH 1WV7T 1IEHA 4LSQL 4QGYA 1PAMA 2OI9B 3ETBF 4M62L 2JCCE 4K23H 1KULA 2X41A 4LLUA 4J6RH 2EE2A 1CF8L 4PJGF 3HG1A 1JHKL 5DJ8A 3MROB 3OGOE 3GB7B 3NIGE 1G7QB 2F53A 2XN9B 3UAJD 3BZEB 1VGKB 2VXSL 1HCVA 1MH5B 1QKZH 2ADJA 5LGHL 1RURL 1F2XK 3FFCD 3HZVA 4LK4A 1IKNC 4POZD 3GBML 4O4YH 2J8OA 4KJWC 5A2KH 4YHPB 4DN3L 2QQLH 3OKNA 1RFDH 3GIZL 4X9IA 3MLWH 2C4FU 1CK0H 4HZLA 1H3XA 4K7PL 5BRZA 5C9KA 5ESVA 3S34L 4MNQE 3U30B 3ZE1F 1S9XB 5FECB 1OHQA 4HH9A 1T7XA 3ISWA 3X11A 2ID5A 4PIRF 2VIRA 5DO2C 4RFEA 4C56D 4ZXBD 3OMZA 5EO0B 3WXWH 4PB9H 2NXYD 5ITBH 1JGLL 1KN4L 2DDQH 2E8ZA 1I7RB 1PZ5B 2G5BB 4P57B 4NIKB 4PGJA 1R5IB 3QA3A 4R7DA 5ERWA 4HWZA 3BDYH 5E2UL 3B43A 1A4JA 1T4KB 2CLVA 4JY5H 5DRXB 4OI7A 3RA7H 2B20A 2DQIH 3QUYB 1CS6A 2XZQL 5ID1B 4AIXA 4ZFFB 1HH9B 2X4SB 4ZUSB 2NXZC 3VXSB 4X7SL 3I6LD 3MBED 1BFVL 3P0VL 3PWPD 5JDSB 1QHOA 5I19H 2CMRL 3HAEG 1J0JA 2Y06L 2ZUQB 3QIUB 3PDOB 2A9MH 1NAMH 2A6DA 3RNQA 3B3IB 4HC1A 1PEWA 2FJHB 3RZWA 3VFSA 4MXVF 1AXIB 1YECH 4LSPL 5C0FA 4OLUH 3MRQA 3RRQA 4F57L 5KSBF 2I07B 2ZUYA 5D1XB 1I1FB 2AJSH 3MLTB 1WSST 5D8JH 4FQ2L 2V2TA 4NQEE 1GJIA 5IBUG 4PJFB 2EKJA 5F3HB 1A6AB 4NZRH 5DVOA 5DFTA 4NQCD 2X9YA 5DJCA 5K9KA 5EZOL 2Z8VC 1JNLL 1NCWH 1F02I 5J6HA 3BKML 1MEXL 5ALBL 2NYYC 4E41D 4I0KA 1ZHBA 4LCCB 3PUCA 1K2DB 1BJ1H 1KG0A 4Q9BA 1FIEA 4Y19A 4LSRH 4Y8AA 2ADGA 1JZ4A 4EQ2A 4BH8A 3SKMA 2IAMD 5JW4M 1URLA 1YNKL 3PQYA 1CE6B 2Q1EA 3C9NB 1ZLVH 3CLEL 2QKIB 4PG9B 3CXDH 2AK4D 3MV8B 4Y4KD 1Q0XH 2GITA 3ZKNC 3W0WA 4HC1L 4ONOA 2I60H 1QUNA 3I02A 1CG9A 4IMKC 1KNOA 3PIQB 2QSCH 1WICA 1KB9J 3I6GA 4NUJB 2YUWA 1HXMB 1UKQA 3KPRE 4HPYL 4QRPB 3X3GH 4BKLA 4JM4H 4RWYH 2AGJL 5DJXA 3I6KB 4JFFB 1FVCB 3ZTNL 1X5HA 1N6VA 1MHPL 4GBXC 4J8RA 4KVNH 2Q8AL 1WZMA 5AWNH 3QDJE 4GMSH 4F8QA 2W60B 4WDIA 3UTPE 1I3GH 3L5XH 5J89A 5F88B 1CI5A 1P4BH 5B8CB 1S7WB 2DLHA 1KEGH 4M1GH 3BWAB 1QQDA 3U46B 1I8KB 3HHRB 4LGPB 4GW5A 4TULH 5D2LA 4OCXL 2IFFH 2X7LA 4ZFZB 2KZ1B 4HULB 4WJ5A 2YPVL 1YEHH 2LV4A 4OLWL 5CD3A 43C9B 1YC7A 4YHKL 1F90H 2ESVA 1ZXQA 1UXWB 4LEOA 5EC1B 4ZSOE 5D1QC 1QO3A 4XNZC 1H3UA 4GQ9L 4K55A 3OJDB 3E2HC 1OSPL 4M3KB 5C70A 2PTUA 5IBLC 5ACZB 3H9SD 1YQVL 4WY7L 4WGWB 1NUNB 1XF1A 2C3VA 5L6YL 4R2GC 1AHWB 2QV2A 1B6UA 1NCCH 3LPFA 4HH8A 1FP5A 5D2NB 3QDGA 3CZJA 1P7QB 3K8KA 1HILB 2BCKA 5DK3A 4Z5RA 3U4AA 3QDHA 4NN6C 4LPYA 3S5LB 3CFKB 4JO1H 4ZO6A 3UYRH 5F7FA 3VJ6B 1PG7X 3TZVC 5CSGA 3QDME 5SWSE 1S5IL 1J8HB 3EJYD 4NO2B 4BQ6A 2CK0L 4JRXB 1JE6A 2P48B 5D7LD 2CH8A 3VFMA 2BOBB 3ARGB 1XFPA 4B7LA 4C4KO 1YJDC 2OJEA 4LAQL 2NY3B 2NNAA 1UJTA 3UBXG 4GG6A 3WYRA 5CINL 3VWJB 1H15A 4CJ1A 5D71H 2QHRH 2JJTA 5E00A 3VGBA 2GCYA 3MRLB 1INEH 4BSWA 1MQKL 3KPNB 4Y5YB 4YE4L 5FGBA 4OGYH 1P4LA 3V7AG 3SHSA 4RAUA 5E08L 1BVKB 1VFAB 4P4KC 1WBZA 5HHXL 4L5FH 4ZUTB 3O2DA 4UILH 4WW2A 5HHNB 2JB6A 4YDVB 4NYLB 3M8OL 5DHXB 1ZHNA 3IJHA 4M6MH 3LKRA 2XQBH 5IB5B 1FN4A 4G3YH 5DK2B 4W4OA 4IIQB 1UEYA 1QR1A 2YRLA 3LZFH 3CFCL 5C08D 3ULUE 3SDXA 1MSPA 2VXUL 2BVQB 5GRUH 3FT4B 3WUZA 2XA8H 3T3ME 2I25N 5KJRH 4KZDL 2VLRA 5DK0B 3MNVB 1N4XL 5JPNA 1OB1A 1KJMA 5J13C 1DBJL 3L3DA 3BQUB 3K81A 4LSUL 1PX4A 1ORSA 2ED7A 3MRRB 3CDYA 3SGEH 4NZTL 5C0EB 4KKBD 5CBAA 2EKSA 1CVRA 3GDBA 4IOSD 4P2OB 1T6WA 3CDFA 5KN5A 3VW3H 1QFWH 2Y7QA 3GMPB 1J5OL 3ZDXE 1MI5D 4OZHA 3RPKA 5HHMB 1CYGA 1WQVT 1BEYL 4L1DA 1SEQH 4RMQA 4MD5B 1BD2B 3HMWL 3WO4B 1WZLA 3SDCD 5DZNA 4MDIB 1DUZB 3BOVA 2QQKH 5EOCJ 2YMXH 4IRJB 1X5YA 3QCVL 3VD3A 4QY8B 2P5WB 2BVOB 3I3BA 3ZL4L 4DKEL 3O2DL 5C0CA 5CEZL 1J0YA 1NGYA 2EDDA 4JQVC 4N8CH 1FZJB 5IW1A 1U6AH 1YZZA 4PJIE 3T3PF 2XICA 2PUQT 4J12A 2HA1A 4H25B 3HZYB 5AUMB 1KPUB 4LLYB 5BZDB 4G6AC 4HHAB 1I3UA 3QISA 3G6JF 2KZWA 5DRWA 2ARJB 3O6ML 4G6FB 3OAYH 1WF5A 2OSLB 4UNTA 4JLRB 15C8L 2LVEA 3HNSL 2VLJA 4L9LC 4WW1B 2P7TB 5GRZA 1EFXB 4RGMB 1UM5H 4XPHL 1IM9A 5T1KA 2O5XL 4Z9KB 1DEEB 1CD1B 1CIUA 2D4DA 3MXWH 4JM2C 3MRGB 3QH3B 1RHHA 3JXAA 3BPNC 4MXWL 4WUUA 5AZEL 2RAMA 1QRNE 2ZCHL 1E28A 1IC5L 3NZHL 4YGAB 3HZKB 3NN8A 3RTQD 3TVMB 4UOJA 5TF1L 4BK5A 4J6RL 2WBKA 5C0JB 4NOBA 2H26A 2ZSWA 2A77H 1QBAA 1BOGA 4P2QD 4QXUH 3SBWC 1DUYB 2C1PA 4DN4H 3KNBB 4XCEB 1C16A 4KZEL 5IT2L 4TUJA 5I1JL 3EYVB 1QKZL 2J8UB 4LCWB 3QUZB 3LN4A 1UJ3C 2AKRA 1UH2A 2R8SH 1JPSH 1U9KA 1GOFA 5LAXB 4XNUH 5SWQA 5DQJB 4WWKB 3GK8H 1NAMA 2QQLL 3QYCA 1RFDL 2NTFB 4FFVC 4FFYH 3MLWL 5BQ7B 4CGTA 5I1KL 1CLCA 3G5XB 4XVUC 4KRPB 5MP6H 4L3CA 2VH5H 4JKPH 1RPQA 5EIVA 5C71A 4PJ8D 2M1KA 4EVNB 1MFDL 4OZFG 4PY7A 1IM3A 3O9WD 4GRMA 3AS1A 3T4YA 4K7FA 4D0DA 5IK3B 2UZXB 4PB9L 3CK0H 2HLFD 3JTTB 1MHHA 5ITBL 2Z91A 3WD5H 3FT2B 2VZSA 5DJDA 2D9CA 2XOTA 2P8MA 5SV4A 5H94B 2GW5A 4R90H 1J88A 1E27B 2AQ2A 1AGEB 1SBSL 4JY5L 4MLIA 4KJPD 5D93B 2AJ3B 5HGBA 3VXTA 1KLGA 2EC9T 4GW4A 4XGZB 4IRZL 3ZKMC 3L9RA 3GMLB 3BD3A 4MQSB 4HLZG 2D0HA 1R5VA 4FP8H 4NT6B 3MRDA 1FAIH 2R2HA 5I19L 3BDBA 1JV5B 1NAML 3SGJC 4FQXA 3RWGB 5L7XH 3MZTA 4PGZA 4XH2B 4HT1L 1JPST 3X12B 2D4FA 5F89B 2EDYA 1NKOA 1M7DA 4MA3A 2UV3A 4X8XA 4MQTB 5T3ZH 2AJSL 1ETZA 4GXUN 4PRIE 3V6FB 4PGBA 2EH7H 3OKOB 5F9AC 3DUSB 5CWSA 5MEOA 5HXMA 4PP1D 5ANMB 3LHPH 4L3EA 3D25B 3KXFE 4ZUUB 2BP3A 1A7NH 3QBTB 2P1YA 3PXJA 4N9OB 2IMMA 4GRWE 5KG9B 5DDHB 1BFOB 4O9HH 4WENB 1FNGA 1NCWL 3TIDB 3N50A 5BZWA 1XR8B 1JGDA 3LOWA 5D1ZC 1ZWIA 1U42A 1RZ8B 1RVFH 3HI1B 3D39D 4V1DE 5JO5B 3DYOA 3P4OA 4FQ1H 4LSRL 1RULH 2D7TL 2CLZA 3BP4B 3KJ6H 1PEZA 4NO5A 2QTEA 1T21B 3KLAB 3DXAA 1SJVA 5F7DB 4Y5VC 1J1XH 2J5LB 5K93A 1ED3B 1TQBC 3FFDA 3QWOA 4DKDC 1U0QA 3ARFA 2NY5C 3CXDL 3RZCA 3C5ZC 1U41A 1Q0XL 1HOCA 1RI8A 5EUKA 4OFIA 3V6OA 1MLBB 5IEHB 2F74A 1KTLA 2EEDA 4G7YH 1F5WA 2QSCL 4G43B 2DTMH 4PRHE 5J0BA 3X3GL 1IARB 4JM4L 2VAAA 1FPTL 4M8QB 4EI5C 2YWZA 1PYWA 3QJHA 4Z7VA 4KVNL 3Q2CA 1LILA 3NFNB 5EU6E 1MJJA 1TJGH 1Y0LA 1F4WL 4QHUB 5ICXA 1I3GL 3L5XL 1DL7H 1FO0A 4ZFOA 3HLAA 1P4BL 4UV7L 2PCPB 4OTXL 1KEGL 4PJ5A 3PL6B 2X40A 1KYOJ 1IAKB 3EBAA 4M1GL 3VFGL 2B5IC 4KJWD 5D70L 1DQJA 4I13B 3RY6C 4TULL 3O0RH 1U8KB 4TTDD 1VADA 2IFFL 2DQHL 3W5NA 3HG1E 5HYJB 6FABH 3GSRB 1YEHL 3WIFA 5AYUL 1F90L 4HWNA 2F53E 1KEMH 4UINH 4WHTB 5IB1B 1EHLH 1M6OA 3QIWB 3MTRA 4ODWA 2J6EH 2AABH 2VE6B 4DKFH 3ULVF 1X7QA 4LCUB 2P8PB 3SE3A 3GHEH 1U3YA 1H9VA 1T22A 2LU4A 4MD4A 1GYAA 2HFEA 4F9LC 1NCCL 4JG0H 1A7QL 1HSBB 1U8HB 1YPZA 4NC0B 3VD4A 2H2PC 3WJLA 1A1OB 1AP2A 4KH2A 5BRZE 1IAIH 5GGTH 2CRZA 3IETB 5C3LD 1XF2A 3DMMC 1A14H 4JO1L 4ZQKA 2IGFH 1CGSL 3UYRL 2CDEB 4F37K 5F21B 3OZ9H 2PO6A 2X89A 1FO0L 4ZFOL 4KV5E 3KGRA 4FTVE 3DURB 1N2RB 4JHWH 1EHAA 3ARDC 12E8H 3QAZB 2F58H 1K4CA 4M6AA 4QOKA 4U6VL 1E4KA 3ARWA 4NFCA 2X9WA 4OZGB 1INEL 1P5UA 4CN1A 3IDMA 2E9IA 4HIIB 3KPPA 1L6ZA 3MUY1 1VB9A 3IXAA 3TH3T 5I8CA 5D96B 3ULUC 1A3QA 1A6WH 3P30H 4L5FL 2V6HA 5HHOB 4M6ML 4MSWB 1ADQH 3F12B 4Y1AD 5L9DL 2XQBL 1SM3L 5ICYA 2NYYD 4ZNCD 3FB6A 5EZIL 2EC9U 5BS0A 2YRZA 3LZFL 4S2SB 4ZDHB 4K2UH 1OP3K 3VFPA 3AM8A 3QFDB 4KKCD 4N0UE 5E9DB 2XA8L 4NFDA 3EZJB 1RK0B 5GSRB 2EDEA 5KJRL 3NCEB 4U6XB 4HDIA 4ZS7H 5HPMA 3W39B 4ERSH 1T0NB 3Q3GA 5J3HD 4PV9A 1DQQA 5IGXH 3HE7B 3DLQR 1CFQB 2NY4C 3ZKND 5ITFA 1NBZB 3LEVH 5IF0B 3VW3L 3BO8A 3KYNB 4NKMB 3MRBB 1CFTA 4Y19E 2XNAA 4LSVL 4M7JH 3P9MB 3D0VA 4JFEA 3V4PH 1OSZA 1XH3A 3VH8G 1TQCB 2E3VA 3MCLH 3O4LA 5KVDH 4P5TA 1B0GB 3PQYE 3OPZH 5F6IC 4LAJH 5JQ6H 4MMZC 4PV8B 1UCTA 4GBXD 4RA0C 4RFOH 3HC3H 3LN5B 3O3BB 4F7TB 5F7UA 3KYKH 2Q8BL 3F6IA 4TSCL 5KZCB 3E6HB 1KB9K 1IGYA 2XTLA 4N8CL 1MCIA 3UPCA 3W0WE 1U6AL 4NC2B 2FGZA 3HAEH 1LEKB 2VXQH 4Y16C 5K59F 3Q5YA 4PJBF 3C6LB 2M8XA 3EYOB 1T0MB 1KIPA 4YHNA 3WL9B 8FABB 2FSEB 5ALCH 1YMHB 5GRXG 1VCAA 1H0DB 2G9HB 1D6EB 4G9DB 5D1QD 3DRQA 5C0AD 3RVUD 1UM5L 3T8XB 4JFPB 3MXWL 1XF5B 4MJIA 5JHLL 5IBLD 1KPVA 5F93C 5FO9A 2EE3A 4N0FA 1C5DA 4L4VA 4R2GD 5D2LE 3MV9E 1B4JL 1TZHA 1EUUA 2BZDA 3ZMRA 3DVFA 3O3AA 3QHFH 4U3XA 2ESVE 4LQFH 5B3NA 5C86A 2MHAB 4NQSB 1WAAE 2A77L 2AXJA 4QXUL 4NJ9H 4DN4L 4IS6B 1TMCB 1BZ9B 3BFOA 1OAQH 4QRQA 2VC2H 4JGJA 3TZVD 2OTUB 1B3JA 2W65A 1OGAD 3T0XA 5CJXC 2R8SL 5KSUA 1JPSL 2Y36H 5IJVB 4R4NC 1FFPA 1II4E 3KPMA 1S3KL 4ZAKA 4XNUL 5SX4I 1TCMA 1W8NA 5IFHH 1MCSA 4PRBA 3QRGH 5D7IA 3G6AB 2Z8SA 3MV7A 2P5EB 5FOJA 5MI0B 4QHLB 1BQLH 4P99A 3CH1B 1WT5C 4KMTH 4WI6A 5MP6L 2VH5L 3HRPA 4JKPL 4NRZA 3C5JB 4QHMB 1UVQA 4RMWA 1U8OA 4J3UA 1XGRB 4XMLH 5HPOA 1H8SA 3VG0L 1NC4D 1P7KA 5E5MA 3REVB 1IAOB 3MUGA 5EBWB 1R3JB 4KHXH 1IC7H 1J9CT 3CK0L 2VDOH 1IBGH 2ZG3A 1I8LC 4X80H 1OTSC 5I1GH 1UACH 4R90L 1JMZA 3WNMA 4IMLB 4N0RA 1BP3B 3GI8H 2Z4QA 2ZZUT 4O58H 1CDHA 2AV7B 5E5RB 3TV3H 2VABB 1C08A 2V2XB 3U4EA 1SJEA 3PABA 2EE6A 2Q7NA 4PJEE 3HZVB 3TF7C 3EZ8A 4FP8L 4E42A 1FAIL 3BDXA 4DOHB 4CNIA 4DEPC 3OKNB 3PF2A 2ERJC 4P4RB 5I8EA 4R4BB 3WEXA 5C0RH 4WO4B 4LVNB 5ESVB 5I16B 4LHUA 5T3ZL 4HH9B 4O2FB 1JGVH 4XPBH 3TO4A 3D9AL 1W0WA 2EH7L 4RFEB 4W81A 1EZVX 4AEHL 3LHPL 1Y18B 1NCAL 2X4OB 1A7NL 5GRVK 2VL5A 4LLVB 4XPGH 4Q9CA 3P77B 4O9HL 1DANT 4PJGA 1VEOA 4R8WH 1IEBA 3UTSA 1V05A 3G5ZA 1ZE3C 2GJ6D 1A4JB 1Q9OB 1RVFL 5ESAB 4G6AD 1YNTA 3FQWA 1EXUB 1KIRA 4FQ1L 5ETUB 1IZJA 1RULL 3KJ6L 4PTTA 1YYMH 4NQDA 1BAFH 4OV5A 1IILE 2XY2A 4MJ4A 1J1XL 3CX2A 4YJZL 1OQOA 2CLRB 1GH7A 2DIAA 5J6GA 1K8DA 4Y4HC 2VLLB 3IDNB 3DSFH 2W92A 2NY3D 3VFSB 4JM2D 3K4DA 3SDDB 1WC7A 3HRZA 5DGRA 4HQQH 5L2JA 2J4WL 2DQCH 3ZKXC 3TBVB 4YDJA 3SCMC 4G7YL 4MDJB 2DTML 1F6FB 3S9DB 1U8MB 3ZO0A 4AT6A 4N8VA 2FECL 5FF6A 3T2PA 5IHBA 5IFAH 3EYQC 4XVTL 1CBVL 4U1SA 4N9GA 4OKVA 3KPLB 3U48A 5TF0A 4FN0A 3SKOA 3CU7A 4HAGA 4WUUE 3NPZB 1DL7L 1ZHBB 2DL9A 5C8JA 1KG0B 1YEDB 1IJ9A 5HDQL 4YHMH 1UXSA 2ADGB 4MNQD 3IXTA 4P9HH 1FL6A 2GTZA 3IF1B 4FFVD 5I1AA 4PJFF 4Q6IC 3AUVA 2HKFH 4JPIB 6FABL 3KDMA 3SE4C 1KPRB 1BWWA 4XVUD 4GKNA 3V5HA 2DS4A 1KEML 4UINL 1EHLL 2X4UA 4MZ3A 3FRPG 2DMBA 1FV1A 3OXSB 2GITB 3FN9A 2AABL 4DKFL 5DFVC 3LS5H 3BE1H 2GK0B 3HC4H 3I02B 5EB9A 1Z9MA 2P46B 3RPIB 3I6GB 4JG0L 4BKLB 5KSVA 3VXUB 2DLGA 1A8JH 4RIRA 5DJXB 2C7UA 1IAIL 3ILQC 3MX0A 1N59A 4J8RB 2OL3L 4K8RC 1D5ZA 1KCLA 4PJAB 5GS0H 2VLME 4JZOB 2IGFL 1JI2A 1LO5A 4OD2A 2UYLB 3S5LG 3OZ9L 3ZKMD 3DRTB 4KJYA 4ZUVA 2XT1B 5HYFA 3VRLE 1ZV5A 3LKQA 2EDNA 3MMEA 3VXMB 3ZE2E 4JHWL 1QZ1A 1AO7E 5A2IH 3LB6C 4GS7C 12E8L 2F58L 4F7CA 5EDXA 3KYOA 4NQED 3O3DB 2VDLH 3L6FA 4NQUA 3SE9H 4OD3H 1LDSA 2R2BB 5GIRB 1QO3B 4HFWA 4WI9A 4AL8H 3I50H 4M4RA 4BFEA 2Y6SC 3ALPA 2FL5B 2WZPD 3GMNA 3WIIH 3ZT7A 5DGQA 3O6FA 1A6WL 5C0DA 3P30L 3RWIB 2OR7A 3SJVA 3RVWC 3BUYA 1MWAB 2PXYD 3QDGB 1H3PL 3BZ4A 5D1ZD 3HAEA 4Z5RB 3IJYA 5DJZA 5B4MC 2D7OA 3B5GA 4RAVB 4X6DB 4WU5A 3CIQA 4L4JA 2AEQH 3FMGL 5I1LB 1J0KA 3B2UC 2WBJA 4P5MA 5LCVH 4K3JL 5FIEA 2R15A 4XNQA 4ZS7L 3F5WA 2UY7A 3UJJH 4ERSL 1NJ9A 4OZFH 1JWSA 3D69A 3VFMB 4ZOAA 2FH6A 4WWKD 5IGXL 2E9BA 4HIXH 2OJEB 3BIKB 3C5ZD 4BZ1L 4GG6B 3R1GH 3KPRD 4AY0A 3EDKA 3WNPA 1H15B 3QUXC 3U1SH 2DAVA 4G8IB 2D7NA 1LNUB 1EAPA 2GCYB 1FNAA 4M7JL 4BSWB 5JHDE 1GRWA 3LKPA 3QDJD 1LEIA 5KVDL 1D5IH 1N3NA 1U8QB 3BJLA 4Y4FA 4PR5B 2DM3A 5DYOA 3RKDC 5GHWH 4X9HA 5IB3A 4K3DL 1S7VA 8CGTA 4WW2B 4YZFF 1ZHNB 3OJVC 1RZFL 3HC3L 4RFOL 3IJHB 4HLZH 3V5DA 3KYKL 3LKRB 3EGSA 3U7AA 2HJKB 3FOMA 2APWA 3TBWA 1FG2A 3PGCB 3T1WA 3V6OE 3H6JA 5I9QC 3TC9A 5J11B 2VXQL 4KDTC 5TQ2H 1G9NH 1EHXA 1NFDB 3T0EA 4YX2H 1JPTL 3P0YH 1G1CA 4PB0H 4LVHB 2VLRB 2GUOA 2DKSA 3NCYS 5ALCL 4HUNB 1MCBA 1KJMB 4Z7VE 3SO3B 1KYOK 3EIFA 4XWOC 3WN5A 4PJ9B 1YMMA 1MFEL 5CBAB 3HS0A 2XFXA 3ARSA 2AEWA 5D7KE 5ID0A 4FQQB 1I4FA 2DLTA 2XXCB 1PKQA 4RX4D 2HT4C 2Y7QB 4PJ5E 4OZHB 3U7WH 1GGIH 5EIIA 4KRNA 4CW1A 1JNHA 2AJXL 1UB5A 3ULVH 3T77A 4J2XA 4X6CB 4QNPF 2ZOLA 3IS1X 2H2PD 3QDMD 3QHFL 3ILPB 2NZIA 1SYVA 4LQFL 2HG5B 3ZYJA 3PWJA 5C0CB 3DMMD 3DX7A 1NGYB 2UZIH 3HI6L 4NJ9L 2CGRH 4P4KB 3VG9B 5JORB 2XWTA 1OAQL 2VC2L 1IL1A 5IW1B 3UPRA 2DQFA 1L7TH 4NHUA 3MR9B 3PWNA 3QCUH 1ITCA 4FXKA 1F3DH 4JANB 1FC1A 2F5BL 5IFHL 4NKOB 2FBOJ 4ZUWA 3TT1L 1YPZE 3ARDD 3QHTC 3QRGL 3MV01 2GAZB 1GHFH 2VLJB 3RIFF 1MCOH 4JGUA 3L5HA 2H2SC 4LLQA 4OM1L 2YA0A 4MNHB 2X05A 1MJUH 5FGCE 4CN6A 2C1OA 4J23A 1RIVH 3D18A 4UUJB 4XMLL 1RHHB 5CS7A 1E4JA 4BQBA 4M7ZC 2VXTL 4WHYG 3AS2A 3ULUD 2IALB 1IC7L 3FB7A 2JJTC 5INCB 4F9PC 1DBAH 4QOKE 1TZIB 1P2CA 2V9RA 1LDPH 4F15B 1XIWC 4YPGA 5E6IB 2N7AA 1BOGB 1DBMH 1RAMA 3UBXA 2C1PB 3MRHB 3V52L 3QO0B 5J9PB 1T83A 5DMKA 5I1EL 1ZMYA 3P3YA 5FGSA 3UMTA 4XWGH 3C6SA 4S0TD 3G6JA 4YBHA 3EYUH 4ETYA 5I74B 3KPSB 4GRLA 2EYRA 4GKZB 1CWVA 4QRRB 4MYWB 1AY1L 1I8MB 1NGWA 1GAFH 1T3FB 3THMH 3DIFA 2AXGB 2PTTA 1QFWI 4LLWA 3U83A 1JGVL 4TPRH 2J8UF 1OPGH 1D5XA 3N1FC 4WFFE 3DX8A 4HIJB 2VZ3A 4HK3N 1S7UA 3DV4A 2JB5H 2Z91B 5DJDB 1BQHG 3TT3H 2X4NA 1PGRB 4PYHA 4R8WL 1X5GA 1QD0A 1CQKA 4Y16D 5IW6A 3NFPA 5F9WC 1XZ0A 3P0GB 5HGBB 3P73A 3QNXB 1A3RL 5BO1L 2DJ4A 1MFAH 1YYML 1X4XA 3BEWA 3OKYA 4OCSH 3L9RB 1TVDA 1BAFL 4Y5XC 1GC1H 4OZIB 1R5VB 1JBJA 2UVEA 5T1LB 2Y9RT 4MWFB 1DBKH 2R2HB 2AJYH 1AKJD 4GO6B 4Q9RH 1O0VA 2XTJE 4LBEB 3B9AA 3RI5F 2DM2A 5CLTA 3VXQA 1MUJA 3G5YA 1MCCA 4U1KB 4FQXB 3DSFL 1OGTB 4X98A 3PP3H 2N7BA 2UZYB 5I1HH 4NJAH 3DV6A 3GO1H 4HQQL 1I9RH 4JDZB 4KDVA 4MA3B 1ETZB 1ZEAH 3VFOA 2EIDA 2XG4A 2ED9A 3LDBC 5CWSB 1TVHA 4XVSH 4P46C 2WWMC 4X5XA 5IFAL 3NTCL 3K7UA 1YN6A 3INUH 2YBRA 2OTWA 5BZWB 5GGQH 4ELME 4MJIE 1JGDB 1HHJB 2ICWJ 1ZWIB 1W72H 2GIYA 4L4VE 1OM3L 4DCQA 4YHML 2CLZB 4K71C 1KELH 4LLDB 2ZKHL 4NO5B 1MCRA 1EO7A 1FGVH 1W0YT 4L29A 4HKJA 2Z31A 3SY0A 2HKFL 3U79A 3QWOB 1MRDH 3CSYA 2ZJSH 3GM8A 3MYJB 43CAA 1HHHA 1DVFA 3RZCB 1ZLUH 3DI3B 3EO1A 3PHQB 3WFBH 2AJVH 3OKKA 2P8LA 5EUKB 3M1BA 3BE1L 3S35X 3HC4L 2F8VA 3RNKB 3BPCA 3F7VA 4P2RA 5D7IE 3SOBH 1PG7H 1OTSD 1UZ8A 3MV7E 3OKLB 2EO9A 2K7QA 3DO3A 2DTSA 1QPPA 4LVOB 1YEIH 1PYWB 5MENE 2BSTA 3QJHB 5T3ZE 3RJDA 3L3KB 1IZKA 4OF6A 1Y0LB 5GS0L 4YHYB 4WI4A 4HPOH 1AGFB 2F15A 1FO0B 3HLAB 3PP4H 3TCLA 3WCYA 3UJIL 4PJCE 3N1MC 5E94A 2VDQH 4OZFA 2SEBB 4CVZB 1ES0A 4DGIH 4NO0D 4QTHA 1GCFA 3QWRD 3ESUF 4CRPA 1NQBA 4PRID 1NGPL 4HEME 3UTZA 1TPXC 5TDPA 2VDLL 3ZDZF 3WIFB 1SEBA 3L5JA 4OD3L 1JPGA 3MYZA 3KXFD 3NAAH 2BJMH 5K9QI 4YIQA 1QSFA 3BHBA 4AL8L 1DN0A 1F8TH 2ZUVA 3I50L 5C0IA 2G60H 3I9GL 2ZUWA 2MCG1 1X7QB 3WIIL 4ODUB 1ZVSB 4U1LB 4NPYA 1Q9KB 1T22B 1EHNA 1A9EB 3MRFA 4V1DD 1BBDH 4NZUH 1QA9A 3IRZA 3VXNA 3BRGC 3C5SB 3DPBA 4MNGA 2GY7B 4E5XB 4C4KT 1A6UH 2EIBA 4CJ0A 1LE9A 5GGVY 1GPOH 1C8PA 4NQVA 1Q8MA 5KTEL 1ACZA 3MCKA 4JDTH 5IR1B 4JJHA 3JSSA 5SWZA 2VN4A 4AQ1B 4JR9H 2AEQL 4WU7A 5LCVL 4GW1A 5GPRA 3TYFB 2CDGB 3UJJL 4U1IA 3WNKA 3LCYA 1IGIH 4NCC2 2DICA 4JKMA 4Y4HD 1BM3H 4HIXL 3O41A 4PJGE 3MCG1 4JY6B 4JO4H 4PRHD 3R1GL 2HKHH 5IFJB 1BIIB 1JGUH 4U2YA 5FA4A 3ZHDA 3U1SL 3VI3F 4JHAH 3P9LA 3ARFC 4QYOA 5KVFH 2YSSA 3BIAX 3SCMD 3V6ZA 3KPPB 5I75C 4NQDE 5EU6D 3OAUL 1NCUA 1X6NA 1D5IL 3IXAB 2HFFA 3QULA 2VZ1A 3V6OC 5GHWL 4JFZH 4FQHA 4XPFH 5I18L 1OAYH 1LMKA 3EYQD 2ADIA 3UP1A 1SMOA 4HUUA 5C07A 2EZ0D 4RSVA 2LU7A 1ZVHA 2XPGA 1BFSA 4MHHI 5HDLA 2J12B 3QUKB 3FB6B 5BS0B 4QGTA 4YK4B 3HG1D 5TQ2L 4QTIH 1G9NL 1KTRL 1NCTA 4YX2L 3VWKA 2F53D 4OLVL 4OZGF 4P3CH 1C7TA 1IEAB 4LLMB 4PB0L 1J0HA 4ESKA 3FT3A 3AU1A 3AMKA 4OUOA 1XGQA 5GRJH 5I17A 5HPMB 4KTDL 4O2EA 4NN5B 3KWWA 4NNPH 5JW4Q 4W6YB 2KKQA 3Q3GB 4JJ5A 3BMVA 3MRCB 4PV9B 3BP5A 1DTUA 4N0YH 3OHXA 4POUB 1A1MA 2JJSC 3BO8B 5DFVD 2W9DH 3H8NA 2ICWI 5C0GB 3U7WL 5BRZD 1GGIL 3CLFH 1A6ZA 5EORH 5I30L 2XKSA 5CIPB 2DKMA 4JFEB 2UUDH 1OSZB 1U93A 1CTNA 2WP3T 3DGCR 3O4LB 5KAQG 3ULVL 1OP5H 1WZKA 3T0AA 3GSXA 3SE3C 3V9FA 1TNNA 1OT1A 3O4OB 1P4IL 3ILQD 4K8RD 2UZIL 1UYWL 4BA8A 4XCFH 2AAVA 1OWWA 2NX5B 2YPLA 2WAHA 5TPWL 5KSBE 4D9QE 3QP3A 4PRAA 3CH8A 1DN2A 1DQDH 1FFRA 1WIPA 2J3SA 3DVGB 2A0LD 2X4RA 5M7QA 3NA4A 3IU3A 4M4PA 3LB6D 1KIPB 4KHTH 2PO6C 4OT1H 3RAJH 4KY1H 4I4WA 3T65B 1MCOL 1NLDL 3OKMB 2Z8WC 4A2MA 4BSVB 1X4YA 4Z0XA 4LFHD 2VITA 1A2YB 4OIAA 1B4RA 5IJKA 2Y6SD 2EE9A 3LQAL 3MLSL 4LARH 1NANI 4MX7A 2V7NA 5T5FH 5C0NC 2NY4B 3OKEA 5FO9B 4N0FB 3S37H 1E4KC 3WFCH 2IBZY 5I6XB 3RVWD 1FC2D 1PQZA 1DBAL 4YBLB 5B4MD 1LK2A 2FX9H 2FATH 3VXPA 4Q2ZB 1DBML 4JPWH 2B4CH 2X1OA 5HI3C 3W5MA 2CIKA 2XZAH 3B2UD 4WI7A 5DEGB 1ITBB 4I0PA 2R4SH 4WV1A 2XKNB 4XNXH 5IG7A 4XWGL 3IS0X 4WNQA 2MPAH 3KPMB 3EYUL 4ZOBA 3RL2B 1MF2H 1K8IA 1T80A 4Y19D 5EU5A 5KAQF 3C2SA 1CFSA 2BFVH 4RQQA 3NGBC 2D0GA 4KK5C 1N6UA 3V4UH 3GUTB 3GSOB 3PQYD 5CEXA 4GUPA 3WFEL 5B38G 3M45A 2G75B 4NRZB 4JDVB 1PVHA 1S9VB 4UB0L 3P4MA 3E3QE 4TPRL 3MRNA 3CFIC 4HKZB 3W0WD 4HF5H 1P7KB 2GT9A 1OPGL 1N0LA 3IU4H 3MUGB 3RKDD 3EO9H 4PRPA 1NMCC 1GSMA 1XGUB 1XGPA 4XC3L 5C0BB 2NW3A 4LP4A 4P5TC 5K33A 2LABA 1TIUA 1UH3A 5IQ7H 1MCEA 4ONFH 1W72A 4JO2H 4BJLA 1WVZA 4OJFL 5EO9A 1FL5B 2XTJC 3RGVA 1MIEL 1NDGB 2A6IB 1MFAL 1T7VA 3MLXH 3EFFA 3N0PB 1S7QA 3U4EB 4OCSL 3L3HB 2VR9A 3KLDA 4E42B 5IW3A 4LRIA 3VH8A 3JTSA 3F8UB 4Q9RL 3L3GA 4XWOD 3T1FB 1B2WH 3OGCA 5DMJB 1KENL 1JPFB 5C6WH 5I8EB 3TBYA 2EDRA 2HT4D 3QI9A 3C09B 3MGOA 2ESVD 4NJAL 3QEQA 3GO1L 3TNMA 1P6AB 2H6PA 1IAIM 4LHUB 4C56E 1ZEAL 1UQSB 4L8BA 1MAMH 2J1KA 4LPCA 3GMRB 1W0WB 1H8NA 1BF2A 4K94C 4XVSL 1FSKC 4FQJH 2O93L 1TJHL 3BGAA 4L8DA 1VFOA 1YMME 2VL5B 3MNWA 5C09B 4U1MA 5FO7B 3HR5B 4XP5H 4D8PB 1FVDA 3HE6B 1PKQE 3UTSB 1PZUB 1F42A 2G2RA 4ZS6D 1W72L 4N5EC 1Q38A 3N1PC 1YNTB 4MA1B 3FQWB 4MAYC 2Y5EA 4MVBD 4U1GC 2YXMA 5GS2H 5D6DA 5E2WH 1KELL 3STLB 4FFZL 3V8OA 3DX9A 4HG4K 3TO2A 1FGVL 5A2JH 3JBG7 1KCVH 2H2SD 1BVLA 2ZJSL 4ZAKC 3TBSB 4LEXH 3RWDB 5J6GB 1EEQA 4JPVH 4OCYH 1JHLH 3CSGA 4C59B 2AJUH 1LGVA 3WFBL 3MROA 3A0OA 5D7JC 2AJVL 1G7QA 3C2AL 1VGKA 4YDJB 3UJTH 4XMPH 5D6CA 5L8LB 4XHJC 1A4KA 1PG7L 4KU1A 4NN7B 3LH2H 4YFLF 4AT6B 4N8VB 1XIWD 5FF6B 1YEIL 4X0KA 2OL3B 1HHGB 4YHPA 2WBWB 3DHMA 2YD2A 4U1SB 2OR9H 4AIOA 4OKVB 3BGFC 1YEKL 2VQ1A 5DD1H 4GAGL 1PDKA 3PP4L 2EDFA 5C8JB 5FECA 2VDQL 4X4YA 4XAKD 1EMTL 2XG5A 4DGIL 2E6JA 4HUVA 4ZYKB 3BW9A 4AM0A 5F7MC 3IXTB 5DJYA 5T5NG 1FHGA 4F2MA 3S96B 4EN3C 5K9OA 4Z7OF 3NAAL 2WIMA 4EZMA 1I7RA 1PZ5A 3T3PE 2G5BA 4P57A 2X4UB 1R5IA 3MGAA 1O5DT 2YD5A 4PBXA 5AZ2H 3QFJB 1FV1B 1JN6A 2YD8A 2G60L 1ZGLA 1WITA 3G6JE 3LN9A 2L7JA 3MZGB 2QL1A 3V7AE 1IGJA 5GRYA 4OFPA 4NZUL 2H8PA 4PG2A 4AIZA 2X4SA 4QHNB 3TO4C 3L5IA 4EDXB 4ZUSA 5E6ZA 1RUMH 4PTUB 1IE5A 1A6UL 4TRPH 4U49A 5JDSA 4BH7A 4RIRB 1GPOL 3WLBA 3QIUA 1N59B 3PDOA 1WWAX 2F54E 4JDTL 5C0CD 4E9LA 4IJ3B 1D5ZB 3B3IA 2FJHA 4OD2B 3ZDYF 2B1AH 4M03A 1HWGB 3DI2B 2VLKB 3U4BH 4H0GA 2JLLA 1LP9F 4LSTH 4ZUVB 2IMNA 5FCSH 3VFUB 1I1FA 2YN3A 1FYTA 2VR5A 1IGIL 1M4KA 5DJ0B 4CMMA 1A7PH 1BM3L 3ARTA 4WHYH 2FEDC 1A1NA 4JO4L 3TN0C 3L5WA 5LVEA 3AFLA 4LNRB 3FQRB 3I3DA 5JW5B 1KCUH 3CXHJ 5KVFL 2HN7A 4HFWB 4XB7A 3GSQB 5T1KD 1IM9D 1RIHH 4PJAF 4QF1A 3STZB 1X5JA 4LSSH 1S5HA 4HFUH 4H8WH 4WUUD 3VXOB 4HIHB 1KFAH 1MHCA 3IFOA 4P46D 4YEEA 2WWMD 1YEEH 4JFZL 4XPFL 1OAYL 1PFCA 2XKUA 1I9IL 3MLVH 2J88H 5B22A 3BUYB 5D4QA 5T5NF 3BZ4B 3IFLH 4EEEA 1AD0A 2NLJB 3C9NA 3IJYB 2QKIA 2W1NA 1QBLH 4FQPA 4PG9A 4WU5B 2FCBA 3PWUA 1T89A 4QTIL 3VFNA 4PJHB 3MV8A 2WBJB 5B3JF 3WS6A 2YPKB 4JFDB 1HXYA 4FTVB 1KF9B 3BPLB 1NH6A 1IGFH 3NZ8B 3OV6A 3RL1A 3D69B 4NUJA 1HXMA 4QRPA 3MLYH 1TTFA 2ZCKL 4N0YL 3ARYA 1R3LB 4Y89A 2DD8H 5I71C 3I6KA 4IEFB 2ILLA 1FVCA 4JFFA 4JZNB 2VR4A 3GEWB 2W9DL 4X6DF 1TJIL 4R96B 3CLFL 2FX7L 5EORL 2W60A 5DWUL 4X5LA 3K1KC 1PLGH 2KQNA 3LKPB 1Q1JL 5BV7B 1D9KB 3JWDC 4JAMA 1Q0YL 1N3NB 1S7WA 3D85B 2DIBA 3GIVA 3FRUB 3U46A 5DD3L 3SDAA 1RY7B 1S7VB 1E0OB 3V4VH 4C58B 4GKSB 5EO1B 2QBWA 3EGSB 4ZFZA 5GSVA 3FOMB 3TBWB 1FG2B 2YA1A 4GG6F 43C9A 3WJJA 4JY4B 1ZLWH 3VMPA 5EC1A 3BSZH 1BX2B 1DQDL 3T0EB 4ONHA 4P2RE 3OJDA 1F4YL 1RZGB 5LQBH 4KPHH 5GZND 3O6KH 3JVGC 4KHTL 5DJ6B 1UZ6F 2GUOB 5ACZA 4OT1L 3RAJL 4KY1L 4TVPH 1AHWA 3OB8A 4L8SC 4QXTB 4WW2F 4PY8J 5D2NA 2NZ9D 4PBVC 4APQB 4AEFA 5ID0B 1I4FB 4M5ZH 4HS3B 3MJ9H 3C60C 4LARL 5J7CC 5HDBF 1YNLH 5T5FL 1JNJA 2YD7A 3S5LA 3S37L 1NFDF 3VJ6A 1SJXA 3WFCL 1CE1H 3QIBB 4YDIH 1JNHB 3D3VB 1UB5B 4Z95H 3T77B 2EDKA 4HKXB 1J8HA 4NO2A 1EBPA 1G7PA 2W38A 4M6OH 4L3ED 3O6FC 2BOBA 2FX9L 3ARGA 2FATL 1QSFE 2W9EL 4JPWL 1PG7W 2XZAL 1IL1B 3UPRB 2DQFB 7CGTA 5J12B 3VWJA 4X7TA 2R4SL 3PWNB 5JLZA 1P69B 3IB4A 2RGSA 3ARVA 3KPNA 4S0SD 4GH7B 4NKIH 2WINB 1X5LA 3OXRA 4IRSA 2BFVL 5JHDD 3DXAD 2R0WH 2H45A 1BVKA 1Z3GH 3E3QC 4X6CF 3O81A 4L4TB 5E2VH 3V4UL 5HHNA 1TTGA 4NYLA 2RIKA 2XZCH 3O6LH 3ARFD 1DLFH 5IROA 5IB5A 1QSEE 3RZCD 5DK2A 1V3MA 4NGHH 3BPOB 4IIQA 3OB0K 5EU7E 2BNRB 4OLYH 3IU4L 3FT4A 3S88H 3MV9B 1Q94A 1YUHB 3UTTA 1UB6A 4UI2A 5F97E 3FHAA 1S7TB 1V8HA 4Y2DC 5FYLH 5DK0A 5IM7B 2YD6A 3L1OH 2DLFH 4Y4FC 5IQ7L 4XAWH 4MA8H 4ONFL 2VRAA 3BQUA 2E9JA 4QXWA 4JO2L 5C0EA 5H35B 1D7FA 3ULVE 2R29H 2XZZA 4P2OA 3MLXL 2E7LA 5BVPH 3GMPA 4LF3A 3C6SB 1FZKA 4MD5A 1BD2A 4PJ5D 2EDBA 3JWOL 3NCBB 4UOW0 3U9PH 1T7WA 2DQUH 2EYRB 5C07E 1UA6H 4Q97A 1DUZA 1B2WL 5I8KH 1JRHI 3MUZ1 1UWXH 5BJTB 2A38A 1R3KA 1YYLH 4YH6A 4RCAA 4G9FA 4HWBA 2PTTB 4U1NB 4TOYL 3WN5C 4G5ZL 4PUBL 1UENA 1DCLA 4H0HB 5EOQH 3SE8L 1MAML 1MCHA 1KPUA 2YOCA 4RGNE 5F1SA 5BZDA 4HHAA 2PYEB 5FB8B 3FQTA 4FQJL 1AXTH 2ARJA 4D0CA 1T04A 1VHPA 2X4TB 3QXWA 3QJFB 4XP5L 2V5RA 4CADA 3H3KA 4WW1A 2P7TA 5CP3H 1JTPA 4U0RC 1EFXA 3NFPB 1XZ0B 5D7SH 4ETQA 1XCTA 3V6BR 2BNQA 1DEEA 3P73B 4G8GE 1CD1A 3X3FH 4UAOC 1FL3B 2Y72A 3D0LB 3MRGA 3BEWB 5E2WL 1JK8B 2PO6D 2X89D 4LVEA 4UDUA 2QQQA 3HZKA 2R69H 4LEXL 3VXQB 1NSNL 3S4SB 2YPLE 4JPVL 3TVMA 1RUAH 2AJUL 4OFVA 4QOKD 5C0JA 2D03H 2VSCA 1MCKA 3DV6B 4XCEA 1JGEB 3BT2H 4HWBL 2YUZA 3UJTL 2JELH 1J1OH 4XMPL 2HT3C 3EYVA 2J8UA 4LCWA 4LPWA 3VFOB 3QUZA 3IT8D 4DQOH 3KS0J 3LH2L 4R7NA 4OZIF 3PXHA 4JQXC 5IKCA 1MVUA 1EEYB 1YN6B 5EPMB 3MC0A 1KUMA 1JHTA 2OTWB 3MREA 5HI3D 4Z7QF 5HD8C 4YBQC 1A6VH 1QHPA 3HMXH 2IAMC 4PY8I 5BQ7A 5DD1L 3OTTA 4H1LB 5EBGA 4M43L 1G7IB 4AZ8A 3TCXA 2IADB 1GGTA 1U8NA 2E9WA 1T83C 2JIXA 2CD0A 4HBCH 1U8PB 4O51A 1G7HB 4KK5D 5L2KB 1IVLA 3IFPB 5IK3A 5IB4A 3SY0B 2R9HD 4WFFD 4M62H 3CSYB 3FT2A 4HUXB 2FGWH 1GGUA 4GRLC 3ARBC 43CAB 4B50A 3BZDA 5IMKB 1JZ3A 3BMWA 3GJFH 4P48A 3S3PA 1E27A 3BD5A 5AZ2L 1I3RB 3EO1B 1AGEA 5FUOH 1DLHB 5K59E 3LEXB 3NACH 4EXPX 1CDJA 3M1BB 3TFKC 3HC0A 4D9RD 4PJBE 2AJ3A 1XGTB 1G6RB 2VXSH 4XGZA 4I2XA 1XCQB 3F7VB 3RDTB 1ZHKB 5LGHH 1RURH 4JFED 3GMLA 2PW2B 4NHCH 1UZ8B 4NT6A 5IVOA 4P5TD 1RUML 1W8OA 4E41A 1CICA 4NNXA 1JV5A 2XTJD 3LKSA 4UNUA 4UT6L 1CZ8L 1EK3A 3ELAT 3X12A 3AAZA 4PRPE 4R3SA 3NCYP 4LSTL 3R8BB 5E94B 3S34H 5IQ9B 1KSRA 4OZFB 1ES0B 3F7QA 1TNMA 3V6FA 3D5OF 4P9HC 3OKOA 3GMQA 1A7PL 5EG6C 4LKXB 5HVFB 5ANMA 4Y4KA 3D25A 5TDPB 5ILTH 1SYSB 2X09A 5DDHA 4N0CD 1JPGB 1BQHA 4XXCC 5BVJB 5TE6H 4LU5H 2R1WB 4YIQB 1RIHL 5CBEA 1A5FL 4LSSL 4MJID 5GGSB 4HFUL 4H8WL 4NKDA 5JO5A 4NPYB 4HSQA 1YEEL 5HGGS 3BP4A 1QA9B 2FIKB 4L4VD 4JCMA 1T21A 3BGMA 4P2YA 3MLVL 2J88L 4MNGB 1F4XH 3V0VB 2FIRT 4FOMA 4X7SH 5ADOH 1BFVH 2LU3A 3IFLL 1LE9B 3ALWA 5CJQL 5TGBB 2WLYA 2BSED 4NQVB 4N5ED 1QBLL 4QCIA 3QEQE 3X13B 2BXZA 5SWZB 2WIIA 4WU7B 2OJZH 3QO1B 4LSPH 1A0QH 3CUPB 1MLBA 2Q6WB 2VXVL 3P9WB 5IEHA 4YDKL 4GG8B 1AO7B 3UTQB 1IGFL 5JW3L 5MEPB 2XI9A 4G43A 4ZAKD 1A6TB 1K5NB 3MLYL 3ARXA 4JHZA 2EECA 1TETL 2GHWB 2GFBA 3ZLQC 4M8QA 3EAKA 4U05A 2DD8L 3MJ9A 3MV7D 4QRUA 1NKRA 1S7SB 2X70B 2Z31C 3Q6GH 1VFMA 4HIEB 1FG9C 3EW3B 3NFNA 2L7UA 4X4MA 4UV4L 2ZCLH 3H9SA 1MEXH 1DVFC 4J4PC 5ALBH 5T3ZD 4QHUA 1Z2KA 1PLGL 4XHJD 3MFGB 5A2FA 2PCPA 3QULB 1HZHL 4M93B 3LV3B 2Z92B 1IAKA 3UCRA 4PD4J 4KROC 4XP9H 3V4VL 5CCKH 4BSJA 4NZJA 3GNML 5I1DB 2VDNL 4GOSA 5HYJA 2NY2B 1YNKH 1IQWH 5DZOA 4EOWL 4Q0XL 2DM7A 3BISA 5DVNA 3JZ7A 2C3GA 2R0ZH 2XN9E 4WHTA 1A21A 5IB1A 3QIWA 3HTLX 1NAKH 4KKBC 4R0LA 1J87A 4I77H 5D7LA 4G42A 1N5YH 2VE6A 4HC1H 5LQBL 4KPHL 4LCUA 2P8PA 3ZYIA 4F37F 1XGQB 1HK6A 4O2EB 1D5BA 3KWWB 4EN3D 3CGTA 4TVPL 2YXFA 3VFWB 3AC0A 4E0RB 3BP5B 1U8HA 2PR4L 3Q1SH 2Z9TA 1NUFA 3OHXB 1A1MB 1A1OA 4M5ZL 5EUOB 1MHPH 3MJ9L 3GM0A 3IETA 3TIEA 1I3VA 5H2BA 4YLQT 1A6ZB 3ZKSD 2CDEA 1CE1L 2NY6D 3TO4D 4Z95L 1L0YA 3BYYA 3O8XB 1T1YA 4M6OL 5MHSD 3DURA 1N2RA 1LE5B 4L8CA 4OCXH 1K3IA 4OSUL 1GXEA 2YPVH 3FAXA 4CVUA 1P9MA 2ADFH 4YHKH 4ODXB 1ZKAA 4J3XA 1YEJH 1G9NC 3EOBB 3RIAK 5I73C 3L7EA 4J3WA 4OZGA 2GJZA 3SEPA 4NKIL 4YWGH 3VXSE 2YHGA 4XXDB 2X42A 2F8OA 2FEDD 2R0WL 4NQDD 1Z3GL 3IKCA 3E6FA 1A47A 5E2VL 4I4WB 5EU7C 5L6YH 4XBEH 4Z77B 1MI5A 5HHOA 1VFBB 1CL7I 2XZCL 3O6LL 1DLFL 4Z0XB 2VITB 4QRTA 2YD1A 4NBXB 1U3HC 1CGYA 3OG4B 4NGHL 4I9WE 3SDCA 1CGVA 4S2SA 1MNUH 4ZDHA 4NWTH 4FQLH 5HY9B 3QFDA 4KMLB 4OLYL 4AEIH 5E9DA 3CFEA 3OKEB 3S88L 1WBXB 3CXHK 1HDMA 3N85H 1RK0A 4DFHA 5GSRA 5LWYH 2NY1B 1I1AC 2ENYA 2R4RL 3F7YB 4U6XA 4PJFE 5FYLL 2N4IA 3ULVC 4H0IA 1PQZB 5E8EB 2DLFL 4XAWL 4MA8L 5CP3A 1EEZA 2I26N 4WIQA 3HPJB 4N90E 4RZCA 2C4XA 4LAQH 3JV5A 5HI4C 3NIDF 2CIKB 5M94B 1CFQA 1OAUH 4JFOA 1NBZA 4IOIB 4KI5F 4JQIL 1BFTA 5BVPL 4WV1B 3KYNA 1Y6NR 3MRBA 5KOMC 4WNQB 1MQKH 3EYSL 5CJBA 1MQ8A 3IFNL 4YE4H 5SX5K 3U9PL 2DQUL 5EU5B 3VWKC 3FTGA 2NY0B 1CFSB 4F7PA 4RQQB 1SBBA 5HHXH 5I8KL 4Z7NF 3RVXC 4RGNC 3AROA 1YYLL 1SVCP 3X17A 4XPTH 1X9QA 3LN5A 5CEXB 4F7TA 3MV8E 4PJIF 3Q6FA 3E6HA 1MWAH 4I8DA 4C57C 4K9EL 4PP2B 5JIPA 3CFCH 4GXVH 5HVGB 4LHUG 5JW4N 5EOQL 1WIOA 1LEKA 5LGKA 2CRIA 3DGGA 3M17A 5DD0L 1YN7A 4UIMB 4XCCL 4D9QD 2E7BA 4HAFA 1RUQH 1AXTL 4QRPE 4I18A 1T0MA 5HVHB 4WTXA 3WL9A 3MLRH 2FSEA 3NCJL 1N4XH 1YMHA 4JFFE 4S1QH 4NFBA 1H0DA 1DBJH 2G9HA 4JREC 3QNYA 1BZ7B 5C7XH 2DQEH 1UG9A 5E2JA 5EO9B 3RGVB 3X3FL 2GQHA 2GY5A 4JFPA 3EFFB 4MA7H 2FLBT 5E5UB 3IVKA 5GS1A 4X9BA 1BEYH 3O45A 2CJUH 1BF8A 3S35H 5FHAH 2FNBA 1P84J 3HMWH 4I48B 4XBGA 3L3JA 3L3GB 4TUKH 3GJFA 3CU1A 5FA3A 2UWEA 4U1JB 1RUAL 2IBBA 4YXHH 3TBYB 1EPFA 3C60D 1K6QH 3BUTA 1TLKA 3O2DH 2MHAA 3QI9B 4HD9A 4NQSA 4DKEH 5CEZH 2GSGA 2YEZB 3MGOB 4BQ9A 3BT2L 3TNMB 1U91A 1WFUA 1WEJL 4CMHC 3NFSL 2QADB 2JELL 2OTUA 5IJKC 1F6AA 5IJVA 1C5BL 4F7MB 3GGWB 3O6FD 3A6BH 4L8DB 3JUZA 5D2NE 1Q9WB 1Q72H 4U1MB 15C8H 1MRFL 3SJVD 3G6AA 1A6VL 2P5EA 3HNSH 2Y23A 3LKOA 4XPHH 3C5JA 2O5XH 4QHMA 4QXGH 1XGRA 2EYSB 2WBJD 3DX9B 1J8HE 4HBCL 3TO2B 4JRXE 2ZCHH 1GC1C 1IAOA 4I0PC 3REVA 5EBWA 2BXYA 1IC5H 5GS3A 5AD0B 3QUMB 4YZFE 3IDYC 3DYPA 4P23A 3H7LA 4PBWD 2OXGA 1QPXA 1BVLB 2FGWL 1ZGLM 3G04A 4IMLA 5KANG 4KQ4H 4UT7H 5TF1H 4WCYH 3BRFA 4UOW1 5FUOL 3NACL 1QBBA 3K2UH 1KJ3L 5JUEL 2XWBB 2AV7A 1FFOA 4KZEH 2VABA 2YRPA 2V2XA 5IT2H 5I1JH 5D6CB 2CO6B 4Y2DD 1A4KB 2VMFA 4NHCL 4Y4FD 4DW2H 5KBNC 1B90A 4WI5A 2I9LB 3VMNA 4YDLB 4KTEH 4X0KB 3KR3L 3D39A 3ZZ1A 1HIMH 4TTDC 4UTAH 5IWLC 4P4RA 2VQ1B 5CJ8A 2V5MA 4R4BA 5I1KH 5B38A 1JYNA 1RJLA 1LD9A 4WO4A 5TDOA 2IG2L 3EHBC 4YHIB 1NC2B 3K8LA 4X4YB 5I16A 3MRPB 3T0ED 3WKMH 1MFDH 4O2FA 4QNPE 4HUVB 3BW9B 3VGAB 4AM0B 2WNGA 2P24A 4TN9A 4MAYB 5DJYB 2R1XA 1Y18A 2X4OA 1KOAA 1XEDA 4F2MB 4JPKL 5ILTL 5AG8A 4LRIC 5K9OB 4LLVA 4DTGL 3P77A 1H5BA 1VFUA 5TE6L 3HFMH 4LU5L 1YMMD 1JN6B 1SBSH 3L3OA 5EC2B 5HHME 1F13A 1ZGLB 1Q9OA 1BD2E 5ESAA 5LBSH 4RGOL 1EXUA 1G0DA 4KUCF 5ETUA 1IGJB 4IRZH 5D7JB 1NGZA 2H8PB 2H9GB 3JV6B 1WCBB 4Q58C 4AIZB 3DNKA 1F4XL 2P5WE 5E1AA 4PGDA 5ADOL 4BH7B 2VDKL 2BMKA 4OD1L 2CLRA 5L8JB 3WLBB 5D9SB 4AK1A 2R0KH 3SKJH 2O26U 4LKCB 2VLLA 3IDNA 4UTBL 3K80A 5CZXD 2OJZL 4HT1H 1HHIA 4PJXB 4ZOEA 3RWJB 3SDDA 1A0QL 3ARUA 5KSAB 3L3IB 1FFNA 4NCC1 3TBVA 4Z78B 1FYTB 1V7MH 5DVMA 4MDJA 1U8MA 3DHJA 4CMMB 4S1SL 1A1NB 2VUOA 3L5WB 3TA3B 1RJZB 3H2WA 4QO1A 5CJOL 5B39B 2E5EA 3Q6GL 4JRYB 4L1HA 2OI9C 4UU9B 2ZCLL 3KPLA 2HN7B 1QVOA 4PGCB 1G7LB 2HT3D 4QF1B 3CMOL 4LOUC 2O61A 1S5HB 4KKCC 1YEDA 1MHCB 3IFOB 2R23B 1CR9H 2D7TH 5J06A 2YD4A 4XP9L 3TJEH 5CCKL 3I3EA 2OP4H 5DTFB 5HD8D 4YBQD 3IF1A 2EH8H 4OBSA 4DFIA 1KT2B 4JPIA 1AD0B 1IQWL 1MJ7H 1KPRA 3O11A 4DUVA 3UPAA 4XCYA 5J3HC 2R0ZL 1MCFA 3PWUB 3VFNB 1NAKL 2J8UE 4LCWE 3FZUC 3OXSA 4I77L 3WDJA 1N5YL 2VL4A 5H8DA 1UH4A 4PLKC 5F7LB 2YZ1A 1LP9A 3CX5J 2GK0A 4NO3A 1HXYB 2DMKA 5SV3A 1XF4B 2HVKB 3U30C 3RPIA 3RL1B 1KB5B 4GRLD 3ARBD 3Q1SL 5DURD 3VXUA 1FPTH 3BAEH 4U1HB 4WTZG 3TFKD 1NBYA 3TN0B 2CKBH 4M1CC 4PJHF 4PJAA 4U7MA 2WMPA 1F4WH 1L0XA 4JZOA 2UYLA 3EOAB 2F54D 3PNWA 5HSFA 1QSZA 5J4MA 4UV7H 4JAMB 3DRTA 4OTXH 1X4ZA 3GIVB 3PHOB 4O02L 2BHUA 2B7DT 3SDAB 3VFGH 5D70H 3MGTB 3NCMA 2DRUA 2MOVA 3H9YA 3VXMA 3QUYC 5BCAA 4PG2C 2LTQB 2DQHH 2MCPH 5GSVB 4Z7WB 3O3DA 1FCGA 2ADFL 5AYUH 4DAGH 1AE6H 1JTTA 2R2BA 5GIRA 1YEJL 2ZUQC 3QIUC 3RVUC 2X5PA 4ONHB 4JFHE 1SMAA 2C3XA 5DVLA 4XMKH 2FL5A 3MXVL 4YWGL 2HWZH 1MHEB 1RJYA 3RWIA 5D1XC 4XBEL 1DDHB 4BUGA 2FDBP 3EUUA 1A7QH 1MWAA 4DJMA 2FEEL 2VDRH 1T2QH 2QSQA 4LQ1A 4X6DA 4RAVA 2AEIT 1MNUL 4NWTL 4FQLL 4AEIL 5DUMH 1VDGA 1CGSH 5I1LA 3N85L 5CKAA 3BKCH 5LWYL 4RFNB 1N0XL 5ANME 1FO0H 1ZA6A 4XZUB 4LCCC 1A6PA 4BFIB 1G7PB 5DF0A 4ZD3L 1AQKH 1QLRA 1X44A 4NCDA 3BIKA 3RUGB 3V7MA 2YR3A 5GS0D 1OAUL 4LPUA 3GJEA 2Q76B 4GAJH 4LPXA 2A74B 4X7TB 2EXWC 5JLZB 4PLJC 4G8IA 4U6VH 3TGXA 1LNUA 2ED8A 2FJGA 3AREB 1T89C 25C8H 4D3CL 4BQ8A 5C2UB 3GRWH 3OXRB 4IRSB 5D1QA 1U8QA 4PR5A 3WS6C 3NCCB 3WDIA 1FNEB 2H32B 2HJLA 3H9HB 2Z31D 5CGMA 4OB5H 4XPTL 5L9DH 3PJSB 5ISZB 1DVFD 2HJKA 4J4PD 5CFHA 1MWAL 1SM3H 4U6HB 3PGCA 2A1WL 5EZIH 5HHVH 4ZFGH 1OCWH 4FNLH 4L8SB 4GXVL 4QRSB 4TVPE 1NFDA 1NFIB 4L9DA 1CGUA 3MOBL 1RUQL 1HKFA 1TENA 1Q94B 2DYPD 4N68A 3RU8L 3UTTB 3VXRB 2AXHA 4KROD 3X14B 1G84A 1UB6B 4HS8L 2W91A 1SY6H 4P2RD 4CVXA 3MLRL 3ZDZE 4Z6AT 5B8CC 4S1QL 2LVCA 3B9KB 2W0LA 4X4ME 4ZPTB 4PJ9A 2MQ3A 4IOFC 5C7XL 2NW2B 2B4CC 4KRLB 2DQEL 4PD4K 3Q5OA 1NL0H 4FQQA 4NSKA 4MA7L 3QT2A 4Z7UB 1FORL 3WJJC 1YDPA 2IPKB 4LF3B 2D7PA 4LSVH 3RHWK 1FZKB 2CJUL 3S35L 5FHAL 1EZVY 1T20B 2PW1A 2WW8A 4TUKL 5DMIL 4X6CA 5HYJE 1BOYA 3S4SG 3ILPA 5IUSA 4YXHL 1WAAF 5DMYA 1R3KB 2HG5A 1NC4A 1K6QL 2IANA 3LD8B 1M71B 3ME0A 4P0DA 4G9FB 1AHWC 5FKAA 2Q8BH 5JORA 4TSCH 4P4KA 4XRCA 5C2BH 4X6FB 5D2NC 1QSFD 4PJDB 1WWCA 3MR9A 2XYCA 1IMHC 3NA9L 2BRQA 5FM4A 1B6DA 1KJ2B 3FQTB 4JANA 2VUYA 3A6BL 4HXAH 4D0CB 4NKOA 1T04B 3ZHLA 1Q72L 2GAZA 2DWEB 1RZ7H 1RK1B 3VI3E 1F2QA 2AQ1A 4CADB 3FCTB 3FFCB 2HYMA 4S11A 4MNHA 4H1LG 3AB0B 4ETQB 3ARGC 1KJVB 1XCTB 2BNQB 5FYLE 2QR0B 4JFYB 2NY3C 3ZT5A 4QXGL 4UUJA 1QSED 5JHLH 4R9HA 1BJMA 2VZUA 3VWJC 3DROB 1YJDL 2IALA 5CUSH 4UDUB 5JOFA 5CIPH 1OP3H 4Y5YC 5INCA 1B4JH 1TZIA 3LQZB 3D2UD 1U3HD 4KQ4L 4UT7L 4WCYL 1MPAH 5E6IA 4KTYA 3EDJA 4LCYB 1FLRL 5D5MB 3K2UL 4WFEE 4ZXBB 4OZGE 2KL6A 4D94A 3MRHA 4D0BA 1FYHB 4OIIH 3QO0A 4PJEF 1DQMH 1F4AA 2NXYB 5J9PA 1HNGA 3NBNA 2OR8A 1I1AD 5DJ2B 4BM7A 3DX6A 4P9ML 3ULVD 2NY7L 5EZJA 1U8IB 4JQVA 4ORGB 5T33H 3SGDH 4R7NB 4DW2L 2DI8A 5IKCB 1S3KH 3KPSA 1MVUB 4KTEL 5HHOE 4GKZA 1UWEH 1TCRA 1HN1A 4QRRA 4XBPB 1JHTB 3MREB 3ET9F 5F7NC 1HIML 5HI4D 1I8MA 5C07D 4UTAL 5KS9B 3IAPA 1T3FA 3F62A 2ZPKH 2AXGA 5E9DE 3BQUC 5HI5C 4LIQE 3MBEB 3PWPB 1ZS8B 1U8NB 3WKML 3VWKD 3VG0H 4P2OC 2JIXB 4O51B 3QHZH 1B0RB 4HIJA 5IB4B 4JM2A 3G08B 2FYYB 4RGND 3RWFB 3RVXD 1OLLA 5DEFA 4A6YA 1CDGA 3IGAB 2VZVA 2VJXA 3WO4C 4NC1E 1FDLL 3HFML 4R26L 4IBLT 5L0QB 3CVHB 3EO0A 4IRJC 1ORQB 3HC0B 5LBSL 1T7YA 3QNXA 4NQCB 1E6JL 5DMGD 4I2XB 1I9EA 5DXWA 3SBWA 1AFVH 1N7MH 4G8GD 5J57B 1VACA 3LSOA 4OZIA 2F19L 4ZTOH 4NBZB 3HKFA 4MWFA 4X7CC 4OUUA 5T1LA 4E41B 1CICB 4LBEA 1XR9B 2R0KL 3SKJL 3VDBA 1MREL 4NNXB 4U1KA 1I7ZB 3LKSB 1LWRA 1OGTA 2YS4A 3DARA 2YPLD 1BBJA 2M2DA 1QBMH 1EAJA 4ORZC 3AAZB 4R3SB 2LFGA 4XT1C 4TUOA 4RMVA 4JDZA 4RGMC 3FO9B 5CEYA 1V7ML 1L9MA 1VA9A 3D9AH 2VSDA 5CILL 5GGRB 3BXNB 1OP9A 2AK4B 3GMQB 1S9KC 4AEHH 1NCAH 4Y4KB 1NDMB 4GSDH 2MWCA 1BQHB 4A6YL 2CKBA 1P84K 2Q3ZA 2PXYC 3WNOA 4Y7MA 1HHJA 3TVMC 5CBEB 3OSKA 1T5XB 1HI6B 4NKDB 2J8HA 4QEGA 1CR9L 4LLDA 1S7RB 3TJEL 3BGMB 4YGVA 2OP4L 3QUZC 4KGLA 3AY4A 4M7KH 3B2VL 2EH8L 4X7EC 2PYFB 1MJ7L 3CAFA 3EOTH 4QCIB 4R6UA 3WFZA 3MYJA 1ZT7B 4WWKC 5DSCA 3HR6A 2WIIB 4WHCA 3PHQA 2GI7A 2CR6A 5C9JB 4I0PD 3SGJA 5E03A 4KRPC 2J4WH 4DGYL 3RNKA 4WTWA 5H37G 4P3DB 1CFVH 3LVEA 4HUWB 3OKLA 2P5EE 2GFBB 1KLFA 5FYJH 3BAEL 1JL8A 2NR6C 4QRUB 4XVTH 3QQNA 1CBVH 3L3KA 1EH9A 1B0WA 1G7JB 3H9SB 2CKBL 5GGVH 1C7SA 1AGFA 3WLWC 3P4NB 4M61A 1RJCA 4H8WC 3S8WA 5HDQH 2SEBA 5D93C 4PRPD 4CVZA 4Y2OA 4J7RA 5FOBB 1JFQH 2MCPL 2BVUA 4JZJB 4DAGL 4MJ5B 4Y5VA 1AE6L 5BXFA 4TQEH 3EHBD 2Z93B 3LIZH 3IDXL 4R0LB 3GRWA 3MSPA 1F3JB 4G42B 5D7LB 4XMKL 5GRWA 3RGVD 4G80A 5JPMA 3T09A 2HWZL 4ODUA 1ZVSA 4U1LA 4HGWB 1Q9KA 4DOHE 1A9EA 1IQDB 1D5BB 2ZUXA 3WFHB 4FA8A 5DD5H 1INDH 3C5SA 2ZOKB 1U58A 4E5XA 2Y5TB 2VDRL 1T2QL 1JTOA 3DO7B 4OF7A 3TIEB 2OL3H 5H2BB 5IR1A 1T03H 1EO8H 3NPSB 1OL0A 5DUML 4BFBD 4EI5A 3QEQD 4F3FB 3BKCL 1SY6A 1JP5A 3U7YH 3CDCA 2LAAA 2WWKT 3TYFA 4U3CA 2CDGA 1T1YB 3ZE0F 4YHLH 5C08B 1AQKL 2HH0H 2KH2B 4L8CB 5DI8A 4JY6A 1MRCL 2P42B 1JF5A 5F7EH 5HJ3B 1RV6X 5IFJA 2J5LC 2JE8A 4JHBA 1BIIA 1JWUB 4O5LH 3RY6A 4GAJL 2BHZA 4U0QB 5EUOF 5EU3B 3L7EB 2GJZB 25C8L 4J3SA 1PY9A 1WBYB 3GRWL 3ECBA 5FHBH 2CR3A 2X4PA 2RBLA 3REWA 3IKCB 3E6FB 3GI9L 5JIKA 4XP6L 1T2XA 1IC1A 4HLJA 2CRYA 5F9JB 1VEMA 4OB5L 1AIFB 1MI5B 3EOYG 5E8PA 5C1MB 4QRTB 1EEUA 1H3PH 1U92B 3S98A 4JVWA 3QUKA 5HHVL 4ZFGL 1OCWL 4FNLL 3SDCB 3UZVB 4A2LA 1NEZG 4LOUD 4LNVA 1ZLSL 5GXBB 1MCJA 4JRWA 4MD0A 2BY1A 1ZSDB 3CFEB 3FMGH 5SWSA 2XN9D 1HDMB 5KW9L 5ECJE 1IEAA 4K3JH 4LLMA 2XIDA 4W4NA 3CFBB 5E4EB 1SY6L 1KIQB 3ZYOA 3U0TB 1T5WB 3PL6C 5JIIA 4YFLI 1EEZB 3MRCA 3W2DH 4RZCB 4GT7A 2F5AH 1F4HA 1P7HL 1RSFA 4BZ1H 3FZUD 1NL0L 4JFOB 4PLKD 3ARDA 1T6VN 5C0GA 5C3TA 5CIPA 4O00A 3QIWC 1RU9L 3V0WH 1AGBB 4OZ4A 3FTGB 3MRJB 1PBYA 1DZBA 4F7PB 5T3XH 3U2SB 2HTKC 4JCLA 2CPCA 1EJ6A 4LCIL 4GLRI 4K3DH 4OM0H 5KVGL 2MKWA 1RZFH 3MRKA 3Q6FB 4YAQA 5C2BL 4M1CD 2BVPB 5JR1H 2R1YB 2NX5A 2AI0H 3FN3A 4HMEA 3RTQB 3DGGB 3M17B 2F9BT 3W9EB 1YN7B 4OFYA 3MFFA 3DVGA 4G8FB 1JPTH 4HXAL 1J7VR 1QFPA 3QUYD 4I18B 4P2QB 2ZG1A 2IQAB 5CLWA 3VXUE 5IIEB 4X7DC 3DYMA 1C1EH 1RZ7L 3VXSD 2RCSH 1G9MC 2IQ9H 1NCBH 5CZKA 3T65A 3EYFA 3OKMA 3QNYB 1V3KA 4BSVA 4PJAE 3QIUD 3MUHL 1MFEH 1A2YA 4J3TA 2VKWA 5DUBB 3QAZC 3QPQC 3N1QC 3IVKB 2P49B 3AXLA 4I9WD 4FRWA 5I8OH 5GS1B 3O45B 2DBLH 4KFZC 1QTYT 1MCPL 5CUSL 3VXME 1N8ZB 1T7ZA 5D1XD 1I9JH 4XBGB 3L3JB 2P47B 2AJXH 3GJFB 5FA3B 2UWEB 4YC2B 5IBTH 5BV7H 2AJZB 2R39A 4PJ8B 4R97B 1S8DB 1MPAL 5D96C 2FEEI 3KPTA 1F11A 4PJIA 4Q2ZA 3O9WB 4OLZL 5HVWA 2GSGB 3HI6H 5B3JE 4DK6A 4OIIL 1U91B 1DQML 3ULUL 1OTUC 3RWEB 5DEGA 4N90D 3MA7B 2XKNA 2Y25A 1S9WA 1BMGA 1F6AB 5BMFH 4JB9H 3AGVA 5T33L 3LKNB 3RL2A 1OWRM 3MJ6A 2F5BH 1UWEL 1NMBH 3QDGE 4Y16A 5EWIL 3TT1H 4XTRC 4NNYB 4ZODA 3QXAB 4ACPA 3KJ4B 3STBA 3GUTA 3GSOA 4X6DE 3S97C 2ZPKL 2EXWD 3LKOB 3BRDA 4PLJD 1K4DB 5GGUA 4OF8A 4OM1H 2HFTA 2G75A 4JDVA 5IVNA 1S9VA 3HE7C 1QRNA 4JFXB 4CN4A 3MV8D 4NC1C 1JWMB 3GSWA 4HKZA 5A16A 2VXTH 3WBDA 1M1SA 2CXGA 3QHZL 1XGUA 4X6BA 4P23B 3VFRB 5C0BA 1CVSC 4JKLA 5IVXB 4GG6E 3G04B 4QRPD 5EFIA 3IAGC 2VAJA 5TE4H 5HYIA 2P43B 1AGDA 4JFFD 3MOAL 3VFTB 1HKLH 3ESVF 4YXKL 5FYJU 4OF0A 1FFOB 3V52H 5IHUH 1FL5A 3QEHB 1VSCA 3E8UH 1NDGA 4WUKH 5I1EH 1JI1A 2A6IA 5K9QG 1UZ6E 4ZO7A 3L3HA 1AFVL 1N7ML 3L95B 4ZTOL 5CEZE 2A73A 5TDNB 3U9UB 1NUGA 3T1FA 4HGMA 4IOFD 3C6LC 3D39B 3FB5A 5T1MB 3HUJB 1AY1H 1IGMH 1JPFA 5FYKH 4LDEB 5DFWH 5HDBE 3SKNB 5IB2B 3SDXE 5MERA 3F58H 5B38B 1QBML 4XAKE 1NFDE 1RJLB 1LD9B 4KXZH 5TDOB 1BJ1J 3K46A 1CXIA 4P2CG 2FZ3A 1CFNB 3SO5A 5IHLB 2X4QA 2VLRE 1WFOA 1UQSA 1WT5A 2P24B 4S1DC 3GMRA 4ODVL 1KBGL 2R1XB 4GSDL 4HCRA 4MZ2A 3BP7B 3HPLA 1H3VA 5C09A 1I7UB 5FKPB 3T2NL 4W70A 32C2A 5B39G 4ELMF 5FO7A 1H5BB 1HSAB 3HR5A 5EH1A 5JQHC 4D8PA 1D3CA 5ENWB 4AH2B 1FZMA 3HE6A 1P7QD 3A6CH 3L3OB 1XMWA 4OZHE 1VERA 1A3RH 5BO1H 1NGZB 5JTWA 3STLA 4X6CE 4QT5B 1A7OH 4ISVA 4M7KL 5E1AB 1RZIB 4NQXA 4PGDB 5A43C 4B41A 1J8HD 2BMKB 4JRXD 5C0CE 4RBPK 3EOTL 4U7KA 3TBSA 2V2WB 3RWDA 2K1MA 1IGCH 3ARGD 3CMGA 5FUZL 1C12A 1RQ5A 3LS4L 1MLCB 4HXBH 1HHIB 5MI0C 4ALAH 1TITA 5F8QC 5DT1H 1LO0H 3GBNL 3VWJD 4PRIA 5KVEL 5HYSG 4M1DH 2FWOB 1FFNB 4KRMB 2QQNH 1CFVL 5HYQB 3BX7C 3KXFA 1J86A 3PGDB 3U82B 1G7MB 2VLJE 4D9LH 6CGTA 1NGQH 5FYJL 3CSPA 1FGNH 3K8MA 3NTCH 4MCYB 3RWHA 4MB5A 3VD5A 2OL3A 4HCRL 1HHGA 1MCQA 1O7VA 2EZ0C 4ODTL 4CAGA 1QVOB 4V1DA 5GGVL 4MS8C 1MVFA 1XGYH 4PJXF 2O61B 4TYUA 3K2MC 3HI5H 2XACC 2EIZA 1OM3H 4HK0B 2ZKHH 4ZYKA 3BESR 3BP6A 3A67L 1JFQL 1BQSA 5CZVL 1U2HA 3S96A 4TSAH 3O11B 3RKPA 3BQUD 5HI5D 1T1ZB 2NXZB 4NKQB 4TQEL 4XCYB 1J05B 3LIZL 5GRVL 4EI6A 3QFJA 1X6LA 1HCFX 5GS2D 2HLAB 1WTGT 2YUXA 3WNNA 3HNTH 4P2OD 1LP9B 5CSZB 1F3RB 1I7TA 1A7BA 3BH9B 4NO3B 2HVJB 3KPSE 5HHMD 4WO4C 5EOCL 4LVNC 1BD2D 4QRRE 1TZGH 3WV0A 1JF1B 5DD5L 1INDL 4TNVK 1R3HB 1ODAA 4QHNA 5TFSH 4EDXA 4ZMAT 2FJFA 4PTUA 4IRJD 3TM6A 5GJSL 2P5WD 5TQ0H 2XXMB 2IPUK 3ZHKA 4FFWC 3HCVA 1NBYB 1T03L 5CJ5A 1EO8L 1MAKA 5EU4B 4LASH 3PWVA 5F7YC 4UDTA 4FG6C 3PNWB 3U7YL 3K1DA 2VLKA 2M26A 2ORBH 5GZOC 4Y1AB 4H1LH 3UJIH 1IT9H 2A0LC 3VFUA 1VKXB 4YHLL 4G6FD 2HH0L 5DJ0A 4EUPB 2Q20A 3OR7A 4QHKJ 3NABL 5F7EL 5JXAH 2GJJA 1NGPH 2HFGH 4LNRA 5BOPA 3FQRA 4OCWH 4XP4L 3WXVL 4O5LL 5JW5A 3BEVB 3OR6B 3NCFB 2YD9A 2Y1VA 4FXLA 1EFXD 4Q6IA 4HW6A 3GSQA 3SE4A 2BNQD 2FR4A 3STZA 4OZIE 1WCQA 3I9GH 3MJ7B 5FHBL 3CSBA 4JKWA 2VISA 3SDDC 3VXOA 4HIHA 1RJYB 2KDGA 4LDLB 3LRHA 1ZGLP 2Z0BA 1G6RH 4Z7QE 5ADPH 1QP1A 5F96L 1R0AH 1L4IA 3AS3A 2W0FB 3TVMD 4Z7WF 2NLJA 3HZMB 1LEGB 5KTEH 3QXDA 4PJHA 1Z0MA 4JN1H 4GBXB 2EDXA 2YPKA 1W0VA 4JFDA 4LCWD 3RX5A 3QNZA 3QUZD 1ZA6B 1NGXB 4FTVA 4L3EE 3NZ8A 4NP4L 1DE4A 3G9AB 2ATPA 2XWJA 5E4IA 1QLRB 3OAZK 3W2DL 4YUEH 1HEZB 3VMOA 2F5AL 4JGMA 3QQ3A 2ICEA 1R3LA 5DLMH 3GJEB 2QSVA 3FQXB 4JZNA 3BH8B 4OV6F 3VU2A 1EGJH 4MGXA 1YA5A 1YC8A 4KRPD 4R96A 2FJGB 2DOCA 4NRXB 1KGCE 3V0WL 3DXAE 2CIIB 3ALXA 3OAUH 1D9KA 5D1QB 3P40A 1T66D 2GTWA 1L6XA 4XNZB 5C0AB 2JIXD 2W0KA 5T3XL 3D85A 3TNNB 1DANU 1FIGH 3FRUA 2NR6D 3E2HB 2HJLB 4OM0L 5I18H 3KG5A 3PG2A 4GKSA 1EDQA 5EO1A 3U36B 5JR1L 3RUGF 2P44B 2AI0L 4R2GB 9CGTA 4N0UA 3V79C 3WLWD 4JY4A 1U8LA 1BX2A 1DQTA 5EOTA 1AR1C 1RZGA 4OLVH 5DUPH 1CDIA 2VYRE 2E6PA 2OX5A 5DHYA 1QOKA 4JFHD 4NN6B 4CVXB 5DJ6A 2Y07L 4K8RL 4KTDH 1C1EL 4ODHL 5F7HA 3TZVB 2RCSL 2IQ9L 1NCBL 1MY5A 2IH3A 3RX8A 3H0TA 1OGAB 1FE8H 4QXTA 1CICD 4TNWK 3SQOH 4APQA 3UZQA 1FRGL 5F1KC 4WTZA 3FQUB 2EICA 4NSKB 4D2NA 5I0DA 4HS3A 1V7NL 5F7WC 3ARQA 3IDJA 5I8OL 1YDPB 3MV11 4OLEA 4W68A 3BIBX 2VZTA 5FYKU 5I30H 2DBLL 5DA0B 1T1WA 3WUWB 5INDB 2PW1B 4PJ7B 1I9JL 3QUXA 3QIBA 1CLZH 3D3VA 5IBTL 3RVVC 5BV7L 4HK3J 4HKXA 4F58H 4HUMB 1VGEH 3WFDL 1P4IH 1KV3A 1NC4B 2IANB 2JTDA 2VDPH 5FKAB 4XRCB 4JVUA 1UYWH 4B0MM 5AG9A 5DC4B 5TPWH 5AAWA 5E2TL 4ZS6C 4BZ2H 1U8JB 1OLZA 2IH1B 3SGKA 5ELIA 4Z7UF 5BMFL 3GMMB 1W2KT 4JB9L 4KGJA 1FFQA 4MVBC 4KKLD 5FK9B 2WINA 4BYHA 1NMBL 3D1MC 5ICZA 4KDTA 1F58L 4U6YB 4L4TA 2R2EB 4IDJH 4OGXH 5H37H 1NLDH 5LXGH 2DKUA 3VGGA 5CHNB 5J13B 3FOLB 2OQJB 4YHOH 3LQAH 4PJDF 3T0WA 4HX1A 3MLSH 4Z0BH 3H9ZA 1NLBL 2BNRA 4OCRH 1I85A 1BZQK 3I75B 4MB4A 3MV9A 3VDCA 1AC6A 5E99L 1YUHA 4TVPD 1CCZA 2DI9A 5JOFB 1JYXA 3C8KB 1S7TA 5FGBC 3UYPA 5IM7A 4G6ML 1Z5LA 1WAAA 4QHKI 1MIML 1R6VA 2AK1H 3QCTL 5TE4L 2B2XL 3DTXA 4Y8DC 5DRNA 4WW2C 4FQIH 1EA9C 1R5WA 2D7QA 2MQ0A 3R06B 1HKLL 5H35A 1WTLA 4LPTA 4D0BB 5IHUL 4F33A 2CDFA 3E8UL 4WUKL 2ATKB 4W4OC 3DX6B 4OLXH 5EZJB 1R24B 3F65A 2W9LA 1TXKA 5DR5H 5J11C 4NZDA 3PL6D 2F8XC 1HH6A 2GJ6B 1TCRB 4JFQB 1IGML 4LVHC 4WI2A 3TPUA 5BS0E 3GMOA 3SGEI 5BJTA 5FYKL 1N6QH 3W82A 2B0SH 5HYJD 3SO3C 3F58L 3MJ8B 2V7HB 2HT2C 5EBLB 3SKUD 5D5MF 3WFEH 3WKNA 4U1NA 4PJ9C 4IHOB 4UB0H 2DQJL 3QIWD 4L9LB 3GHBH 2JJWA 2CKNA 1OARH 2HTKD 2JCCB 2B8OT 2PYEA 5FB8A 4JM2B 5DEFB 3BPNB 4A6YB 3LY6A 4XC3H 2X4TA 1LK3H 1H3TA 3T0DA 3LEYL 3QJFA 2HRPH 4G8EA 1NCDH 5KS9F 3EO0B 4D9RE 2HMIC 4RMUA 3A6CL 4F9PA 4LDOB 4QLRA 4AJ0A 5FM5O 1FNFA 2HTLC 4CKVX 4PJEA 4FZEH 1IKFH 4JFEE 4OJFH 5HHQA 1XIWA 3VG9C 1MIEH 5BW7A 1FL3A 3D0LA 3O4LE 1KACB 3PWLB 4XPAH 5FYLD 2VNCA 1JK8A 2P4AB 4B5EA 1VACB 1A7OL 3LSOB 1KIUA 1WZ1H 4OUUB 2BNUB 1UJ3B 5TH2A 4HS6A 3PV6A 2GK2A 3B83A 1IGCL 2YWYA 2NX5E 3S4SA 1KENH 2NTSP 4UNVA 3QPQD 3P11L 4HXBL 1BBJB 4MNQB 3VGDA 4ALAL 2I9TB 5DT1L 1LO0L 1L0QA 5EULV 4PS4H 2FX8H 1JGEA 4TUOB 4CBPA 1FH5H 4M1DL 4WFED 2DQTH 5CEYB 4MXQC 2YK1H 2QQNL 5I15L 2BY2A 3OKDB 4D9LL 1NGQL 1FGNL 1EEYA 5FDYA 4KI1A 1TJHH 5EPMA 3NIDE 3B6SB 4P5KA 1UWGH 2CKBB </