4HIXH

Crystal structure of a humanised 3d6 fab bound to amyloid beta peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
VQLLESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVASIRSGGGRTYYSDNVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCVRYDHYSGSSDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein fibril/immune system
molecule keywords Humanized 3D6 Fab heavy chain
publication title Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation.
pubmed doi rcsb
source organism Homo sapiens, mus musculus
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hixH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hixH01
2IG2L 4S0SD 3IAPA 2GJ6D 1JWUB 2SEBB 1RUQL 3MV8D 5TQ2L 4KQ3L 4ZMAT 3CVHB 4LNRB 4H5SA 5IWLC 3K46A 5DLML 4P2OD 5D1XA 3VD3A 2YWYA 5CSBA 2CH8A 4XTRC 2Z92B 2BY1A 3QIWD 5IB2A 1CDIA 1WVZA 3V52H 3UDWA 3BIKB 1FIGH 1A9EA 1ZT1A 4ERSL 1XGUB 5ABDE 5KVEL 4JO2L 4L4TE 4R97B 4OCNC 1MIML 3K80A 4H0IA 1PX4A 4ZFZA 2XN9A 4M6MH 3R8QA 3ULSA 5EOQL 4KVCH 4OT1H 3BSZH 1CXKA 5IHZA 5J8OA 4I8DA 3C6LB 1DR9A 5ALBL 4MA7L 5INCB 5C0AA 4LSVL 3BN3B 4Z7UF 5I16A 5HHNB 4QHNB 3S5LG 4AEHL 5DDHA 4ENEC 1VEPA 4JM2C 1IC5H 1RSFA 1R5WA 4P46D 4E41B 3VXRE 5C09B 4K2UH 1V7MH 4KRPC 1BWMA 4LLWB 5D7LE 2HP4A 2YUXA 3DMMD 3O4OC 3QXVA 5K33A 1N5AB 3C2AL 4NWTL 4QLRA 1S9XB 1I9IH 5CP3H 5E4EC 3V4PL 2KKQA 3I6LD 5CHNB 4YJZL 5MENA 3UO1H 4HGMA 2VISB 3QNXB 1FZMB 5TH2A 3CFEB 1T0NB 2AABH 4XBGB 3BW9A 3I50L 1BD2B 3QUXC 3EDEA 3RKDD 3E2HC 2WBWB 3GNML 1X7QB 5F9OH 5CWSB 4HUWB 4JG1H 4RGND 4DVRH 5B8CC 2P5EA 1CLOH 4DAGL 3Q6GL 4F3FB 3FQTA 4MA3A 3CK0L 3CCHB 5DGQA 5C6TH 5I8EA 3WN5C 1YYLL 4ZNCD 4G8FA 1JK8A 3QUYC 2D7PA 4LSTL 1ZLSL 1F8TL 3EW3B 1M7XA 4HC1A 3O9WD 1ZANL 3C60D 5FGSA 2NY1B 3UTZB 1Z9LA 4G6KH 3MOAL 2ITCA 5BOZG 4JHBA 5JZ7C 5M94B 5MERB 1TVDA 2AI0H 4LRIA 4KK9D 1B6UA 4CADA 2NY4B 4HXAH 1MCHA 2AJSL 5E8PA 1X5IA 2PXYB 1CVRA 4L4VD 4Y16D 4OF7A 5DMKB 1OAZL 4HEPG 1LD9B 1CL7L 3F7VA 2R39A 3MSPA 2B1HL 5KSAC 2X4OB 3TCLB 5JXEA 5C9JB 4DOHE 1WT5A 5K9OA 4HEME 1SBSH 3LQZA 4DN3L 1CFTA 2Z8WC 4LCWA 3ZHDA 4WFGD 5LAXB 5JW3H 1U8QA 2DMBA 4ZDHB 4FQCL 5BO1L 1M71B 3F58L 2D31A 4LRNL 3MUZ1 1BQHB 1U9KA 2FD6H 2B20A 4EDXA 1GPOL 2AVGA 1FDLH 2PNDA 1D5XB 4YXLH 2Y72A 4O00A 2BX5A 3UTPD 3P9WB 3D39D 4R90L 1T5WB 1MWAL 1MAKA 1FG9C 5D70H 3KWWA 2FJGA 3CSPA 2PO6D 4GAYB 4I0CC 2EXWD 5I1GL 5JMOC 4PJDE 1CGSL 1N7ML 3U82B 5EOCH 4GKZB 3LPFA 1F4XL 5I1CL 5C0BD 4YFEA 2BFVH 5BVJA 1GH7A 4FQIH 3U1SH 1HHIB 3SBWC 1QFHA 3P0VL 3MRLA 1KOAA 1E4WH 3T77B 3RA7L 3VWKD 5I9QC 1T21A 4PJHE 2CGRL 4D0BB 1MI5E 5HPMB 4X5XB 3BP4A 1AHWA 3L1OH 5CJXA 1EHLL 4PYHA 1PZ5B 2IPKA 3BDBA 3VDAA 4LP4A 4OFYD 4JE4B 3GBMH 1CE6A 4YHNA 4KFZC 1R6VA 3NBNA 4S2SB 2PYFB 2BJML 2X4RB 2DQCL 4CMMA 3ZT7A 4P5KA 4QHLB 5GRJL 3FAXA 5TE6L 4RWHA 1MPAH 3CPLB 3EOAA 5ISZE 2A6DB 1Q94B 2ZCLL 4Z0BL 4D0DA 1KV3A 1LP9F 3GGWA 4RGMB 3PWPB 2X6MA 3JWNC 5JORB 3QUZD 2HT2D 2EXYC 4TNWF 3NACH 2EE6A 1K4DB 3RZWA 5GS3A 5D1QA 4NQVB 4XVTL 5SV4A 5I8OH 4RCAA 1OAXL 1QFWH 1XCTB 3U9UB 5JW4Q 1JPTL 3KJ6L 5F3BA 2A9MH 3UJJH 5FGCE 4FQQA 4N90D 4X99A 5BVPL 2X1WL 2IALB 2JCCF 3DHJA 3MRFB 5T3XE 5ICZA 1XF1A 4JFDD 4G9FD 4J6RH 1S9WA 1HKLH 3PDDA 2EYRA 4K8RD 5FKAB 2B0SH 2VLKE 2IC2A 5CZXC 4PB0H 5EWIL 5EBLB 1NCDL 1O7SA 3PP4L 4WO4D 2B2XL 5ITFB 5FO7B 3ARDD 4EIGB 4CJ0A 5EPMA 1EUUA 2YWZA 1BVLA 3GEWB 2Y07L 3IDMB 5DO2C 1BZ7A 4V1DE 2AS5M 2DLTA 4W6YB 5I1IL 2ICWJ 3CDGA 4B41A 5IMOB 1ZEAH 1IM9B 3P73A 1ZT7A 5GHWH 3MBEC 5EBGA 4JDZB 4C59B 4J23A 5CFHA 2BOCA 1DUYA 3PIQA 5BV7B 3QQNA 4K94L 1MFEH 4XBEL 5KS9E 1NL0H 4PJFF 3HA0A 2J8HA 5IR1B 1FO0A 4U6HA 1AD0B 1FNEB 1DSFL 4M9OA 1OLLA 4WEMB 5BZWA 1JNJA 1OP3K 5FO9B 4JFED 1X5KA 4HXBL 2AJZA 3MOBL 4L4TD 3VWJD 4ONOA 2EYSB 3BP7B 2I60L 4WI7A 5CD3A 2FDBP 4NHUB 5DSCA 1JPSH 4ZFOA 3CX5K 5KSBB 2AAVA 4PS4H 4NO5A 2YD1A 4YDVB 1UCTA 3TIDA 1WLHA 4HLZH 4P9HH 4EJ1C 1GJIA 3C5ZA 2IMMA 3B5TA 1RUKL 2C4FT 4PRIB 2Y5EA 1PKOA 5F7UA 3MA7A 3RU8H 3VFGH 1Z9OA 3WLBA 4UDUA 4AIXA 3AB0B 3DURA 2X70A 3QNYA 1JGDA 1WITA 2RB8A 4BJLA 4UB0L 4XPGH 4XGZB 5HGAB 3D2UB 4LSPL 3GBNH 1I85A 1P1ZB 3WHXA 2HT4C 5HHOB 2WBJD 1A6VH 4WEBH 3EOBB 4Z95L 3CAFA 3EHBC 2FX9H 4JKWA 4NBXB 4MNQE 1A2YA 4HIIB 5D1ZD 3TA3B 4C56B 4WI6A 3EKCA 5IVXF 4MXWL 3VJ6A 1E28A 4HX1A 2JJTA 3LS5H 3P4MB 1FE8H 1KNOA 1KJMB 2F54B 3HR5A 1G7HB 3TO4C 4J3TA 3TWCH 3NPSB 1W8OA 4Y5YC 4MSWA 4ZOCA 2ZNXA 4Y4HB 3EFFA 1KJ3L 4NQDB 4LLQB 1R3IL 1GZPA 1MHPL 3RDTA 1U8OA 3NAAH 1PY9A 4GRMA 4HQQL 4NZUL 5H37G 3PQYD 3S8WA 3ZKXB 5E5MA 2X1PA 1MHHB 2A9NL 3JWDH 3IDJB 4BSVA 5KANG 2NW2B 3KYOB 2VZ3A 5CMAA 4P23D 2WP3O 4XPHH 3SKOA 2C4XA 1ZAGA 3LB6C 1BGXH 3ARGC 1JGUH 1BF2A 3IF1A 4E5XA 4Q6IC 5ICYA 1D5ZB 4TPRH 3EAKA 5TGBA 4Z7QE 4NUGH 4APQB 4DVBB 4O02L 4HWEH 3BZDA 4QHMA 5GGRA 2BK8A 2CDEB 5BJTA 5D2NB 2QQNH 1QRND 1PFCA 3HE6C 3N85L 3U6RB 4NQSA 4TRPH 1AKJD 5E8DL 5JHDA 3DV4A 1PKQB 5FF6A 4DKEL 1SJXA 3D1MC 1WGOA 3VFPB 4UOJA 3RTQD 2P7TA 1CS6A 1NCNA 2EDHA 4PJAF 1QHOA 1S7TB 5F1IA 5EO9A 5FKPA 4PJIE 3PHQA 3AM8C 1U3HB 3QG7H 1DBBH 1DLFL 2RR3A 5E2JA 4LPCA 3I3BA 43CAA 1F6AA 2FYYA 1DQJA 4F33B 3RWGB 3S96A 3W2DH 3DROB 5I18L 4JR9L 1IFHH 3MRQA 3L5JA 1JGEB 3G5ZA 3O4LA 4NQCA 1XGRB 4OJFH 1UXSB 3H8NA 4HS6A 3M8OL 3BO8A 2OS7A 3IU3A 3OG6B 5EUOA 2Y9RT 4FS0A 4PJBE 3JVGC 4M5YL 3KPMA 3TGXA 3WS6C 2X10A 2R69H 5C70A 1A5FH 1U95B 4R96A 1EO8L 5I1JL 1CR9H 1A64A 3MBXH 1RULH 1M7DA 3MJ7A 1K85A 3C87A 4WNQA 1JNNL 2QKIB 2Z0BA 3SJVB 2DN7A 1UH2A 4XRCA 2EECA 5KTEH 1FFPB 3T09A 1ZS8A 4PUBL 5HYJA 4CVZB 2FBJL 3NABL 2LE9A 3LZFH 4LQFH 4PJ8B 1SYVB 4MS8D 4D9QD 1J8HD 5CJBA 2AXHA 2DYPB 1TCMA 1J88A 3BQUC 2X1OA 3ARFC 4GLRI 2WZPD 3WSQH 4R4BA 3BGFB 4OZIE 4OFKA 3CC5A 3QCUH 2FIKB 5AUMA 3CFCL 4JHWH 1UB5A 1MFBH 2ITDA 3G6AA 5IB1B 1KBGL 2DOCA 2NY7L 2VNCA 2Y1VA 3LDBC 5ILTL 3O3EB 5T1LD 4RQQB 4WVRA 2IGFH 1F02I 4N0YL 4JHAL 1BQLH 1N3NB 4WWKA 5D7SH 1YNLL 4MB5A 3I9GH 3VA2C 3GSRB 2NY2B 4X9FA 2QQKL 4JO3H 5EZJA 5I15H 4MJ4A 1UGNA 4U1JB 3NCBB 3C6SB 2VERN 1D6VH 3H2WA 3LEVH 4L9LC 3RKPA 1W72B 4HJGB 4QF1B 1F58H 3G6JF 3W11C 4P57B 2PCPA 3BP5B 2NXYB 4IRJD 4RRPA 4M48H 3O3BB 5BW7C 5HI5C 3Q6FA 4X9GA 2GEEA 3CFJB 1K8IB 5T3XD 1FN4B 5LBSH 1EXUB 4MLSA 3PNWA 4F9LA 1IAMA 4PJ9A 4YDKL 3BHBA 3UBXG 2C1OA 1O7VA 4UILH 1VACA 2CLVA 1KTLA 5B3JE 2KZWA 2Q1EA 2ARJA 3GMPA 3U7WH 4HF5L 4W6WB 3T0EC 3W81A 35C8L 3BEVA 1JWMB 1KCRH 4YPGB 4LLYB 3LN9A 1U8LB 1F11A 5ESVB 5T1MA 1EEZA 2HT3C 3GSNL 4P2QE 3EYVA 3GI9L 5HHPA 3T3PF 4R4NC 3T4AA 1OB1A 4Z8FH 4OF5A 3W0WB 4CUCA 4L3CB 3WDIA 2BSSB 5E4IA 3OZ9L 1EEYB 3QDMA 5IWLA 5HD8C 1LEIA 2AEPL 1JNLL 4F7PB 2YPKA 3BKJL 4NP4L 5CZVL 5C8JA 4CNIB 4UBDC 1X5AA 4JZJB 4DTGH 1AQKL 5D7JD 2BNQD 2ADFL 2G2RA 4PG2C 2YA2A 1CD9B 2JIXD 2GUOB 4KGJA 1FG2B 4WRLA 3LCYA 4BH8A 4U1NB 5KVFL 3GSUB 4ODVH 3L7FB 3L3KB 4X6DB 2FNBA 3VE0B 3B8YA 2P47B 3X11B 4I4WB 4UDTA 3OB8A 5AYUH 1XH3A 4DGVL 4NJAH 2VN7A 1FSKC 2YD7A 3E0GA 1G7QB 4AQ1B 2WIIB 4AG4H 2ED7A 3V95A 2FEDD 4NT6B 3DXAE 2Z93A 2FR4B 4JM2A 1M7IB 1BOGB 3QULA 1F00I 4EUPG 5BZDA 4GXUM 1NAMB 4OZHB 1QQDB 5DRZA 5EZLB 3D6GA 5KW9H 1QEWB 3UJIL 2BNRD 4EN3B 3NFSL 4I3RL 3RVUC 2AQ3A 1XGPB 3H9HB 1AC0A 2FZ3B 5EG6C 2ZCKL 4ZQKB 3B2VL 4FQJL 4MDIB 4N9OB 4LASL 2VXSH 4JPIB 3QUXA 5DD0L 1FNSH 1KIPB 4X5WB 2LQRA 4PJ5B 5BCAA 5JIPA 1R24A 3EYSH 3D85D 5CJOL 1UQSB 5B8CA 1JGLL 2W0LA 2X44D 4JRYD 1CDJA 4NN6C 4LOUD 1ETZA 2DQUH 4FXLA 4OQTA 3QHFH 1UT9A 4RIRB 4KJWC 3SDAD 1D6EB 3HC0A 3WN5A 3O2WL 3QEUA 1LO2L 1WBXA 5DUPH 4I9WD 4WU7A 1QKZH 2ZCHH 3QUYA 2QSQA 3P4NB 2QADD 3BEWB 4XC3L 3KLAB 4TSCL 3MYJB 3IDXL 3ARSA 6CGTA 5AEAA 3LKPB 5F97E 2F19L 1TQBB 3QEHA 4OBSA 2DQGH 5E9DB 1C7TA 1G6RA 3EZJB 2G5RA 5FUZH 4YDJB 1OAKL 4QWWD 4KDTC 4ZSOE 3RWDB 3QSKB 5D9SB 5K9KB 1YEFL 3STZA 4KTDH 5KSAA 3SKNA 1JUFB 4RFEB 2DM4A 1ACYH 4WIQA 5IJKC 4WTZG 2GT9A 3WD5L 2VR4A 4F7CB 3NZHL 4ELMB 1UWEH 5MEQA 1DQTA 1OCWL 3DHMA 3WKNA 2F53B 3WEXA 3HHRB 4KI5D 1Q9OB 3ARBC 3VG9C 5HHME 1RUPL 3WIIH 4J3WA 3BI9X 3V5DA 2Z8RA 3HN3A 5DI8A 3WUWA 3RVXC 3VI3F 4QOKD 5L2KB 2EDTA 1WFUA 4XMLH 1FNGA 3HC4H 4B5EA 4PV9B 2CMRH 4PREB 2VZUA 1MVUB 1PVHA 5I0ZA 2LTQC 1MFCL 4YE4H 3W9DA 4POUB 3S5LB 1ZA3A 4XX1G 3TT1H 2WM0A 5T3ZL 4HT1L 4JRXA 3EGSB 3V5KB 3MXWH 5IG7A 5GISH 3BWAA 1KT2A 3RVWC 3IFNL 4Y19A 3TJHC 5TDPB 3RHWF 3B83A 1DN2A 3KPLB 3ALXA 1NPUA 4LAJH 3SBWA 3B3IB 4JDVB 1AGDB 4YXKL 4XXDB 3QEQA 15C8L 1G7LB 5EU5A 4LCCC 1OF2A 5C7XL 1QVOA 3M45A 3B9EA 4PJGA 3HAEB 2EH8L 2HFEB 5DK2A 3QQ9D 1WBYB 3VDCA 4U1GC 2OL3H 3JZ7A 3C6LD 3WIHA 4G43A 1MJJA 3TBWB 1EK3A 4PY7A 5E95B 1U8PB 2ZUUA 2I24N 3GJFK 2Z31B 1MSPA 2ZKHH 1ZLWK 3Q5TA 4PJCA 1BREA 4E41D 1ZHLA 4HKXA 5C09D 1U36A 2H32A 4G6MH 4Z76A 3QXAA 4M6OH 5JIKA 3AMLA 3O8XC 1DFBL 2NX5E 1BZ9A 4HC1L 5GGSY 1KPVA 4JFOA 4UAOC 1RJZA 1HXMA 4RDQF 4M7KH 4U1IA 3V6BR 2PR4H 1KIUA 4TOYL 1XZ0A 5B22A 2P5WA 2XQBL 3A6CL 1KACB 5DFVC 4M4PA 1BD2D 1H5BC 4O2CB 3T1WA 1F3JB 4NDMA 3IXTB 3KHOA 4LPYA 5CEYB 5EO1B 4XPBH 5DA0B 1TLKA 3MREA 1FAKT 4MD5B 4W81A 4DGIL 4XPFL 4YGVB 2N7AA 3LRSA 4OD2A 4OCXH 2NY1D 3HG1B 2IBGA 4EQ2A 2HJLA 3MCG1 4Z9KB 3EYUH 4FXKB 1U42A 5F7NC 1W2KT 1LE9B 2NY4D 5F88B 3IDIA 3LMJH 5JHLL 1QUNA 2LAGB 3REVA 5HDQH 2F8OA 2R0WH 1NANI 4OCRL 1PYWA 3MBEA 2MCPL 1UJ3B 2VLLA 4ZTOL 5GJTL 1HWHB 4PLJD 3VXMA 3QFJE 5T1KA 4XP6L 1NC2A 1RY7B 2DQJL 3PHOA 3QWOA 1B2WH 1MH5A 5BXFB 5CEZD 3IU4L 1L0XA 1SEBA 4JLRA 4WHYH 3QRFM 2A77L 3BZFB 3NCCB 1U58B 2FJFA 5FDYA 3RIAK 1A7OH 4WWID 3NA9L 4JFYB 1ONQA 3CLEH 4N8VA 3FZUC 5GGTH 4F57L 2HRLA 1NBZA 4HKBB 3CXDL 5D96C 1E6JH 1T83C 4PYGA 4XVSH 5EIIB 4GO6B 1C5DB 2LU4A 3DX9A 4QHKJ 3C5JA 1NQBA 5IVZB 5I30H 1QR1B 4JVPA 2QSVA 3GM8A 3BMVA 5E2WL 1Q0XL 2DWEA 5CINH 1EDQA 3UEZA 5FYJH 3H9YA 1MRFH 2HVKA 4JFXA 2CIIB 4NFBA 1A7PH 1NCWL 3BUYA 5MEOB 3MTRA 1H15B 3ZE1F 4A6YB 1DLHA 3MV7A 3LN5B 3DUSB 4YC2B 4NKMB 5J13C 4KMTL 2LU7A 2AV7A 5JIHA 4ZTPL 4X9IA 1UKTA 3UTOA 2AJ3A 2VAJA 5GZNC 4NQEA 3OXRA 1I1RA 4PGCA 4X6FB 5D93B 5AD0B 4K23H 5IM7B 1S5HA 3ULUL 5E6YA 2DQDL 5I1EL 3TO4A 1T22A 5F9WB 2QEJA 1JBJA 2ILLA 3TFKD 4HGWB 2YKLL 4Y5YA 4FABL 5IROC 1ZT4A 1BQSA 2XN9E 1V3MA 2ED9A 3UTTA 4CGTA 4IS6A 5T3ZE 1HSAB 4J7RA 4Z0XA 1WBZB 2W9EH 1ZVYA 3PWPD 4OKDA 3T0XA 1RIHL 3MO1B 5C0AE 3AAZA 4HFUL 1NKRA 4OZFH 4FTVA 4D8PB 4P2OC 3RGVB 3NIDE 3ARGA 3MCKA 1KC5L 4Q6IA 1AO7B 4NNYA 1A6ZB 3QIUB 3QIWC 4D94A 3KPOA 2Y7QB 1OAQL 3KS0H 3HE6A 4HH8A 1KELH 3BT2L 4H88L 3EYOA 2AK4E 3MZTA 4PBWD 4RMRA 3M17A 5MENE 3U30C 1QSFB 4GW5B 2AJVH 1C16B 2BDNH 3AM8A 1L9NA 5BS0B 2HG5A 4QTHB 4K55A 1FO0L 1XFPA 4R26H 1KLUA 4YHZH 5TF0A 2BY2A 2GKIA 1NLDH 4YR6B 2ZSWA 3FKUS 5HHMD 1TDQA 2R2HA 3UTSB 4OLVL 4OLXH 5B39G 3S34H 2XQYK 3UPCA 4P46C 3WXVL 4CVXA 5I71B 2EE3A 4JJ5A 4ZFOL 1IM9D 1YMHB 2O26U 4Y7MA 4TTGA 3JVGA 2CDGB 1IGYB 3WS6A 3IFLL 2C26A 4MAYD 5I74C 4IIQB 3V8CA 3L3GA 3LKOA 1S7XA 2VMFA 2F58H 5DEGA 3DWTA 4IBLT 2VL5A 1T3FB 4PJEB 5DRNB 1NGYB 2A1WL 4I2XB 4MJIB 4HUVB 3RKDC 1FVEA 2E8YA 4LLMA 5B21A 1A3QA 4CU8A 3DVIA 5L2JA 1LO4L 4XP1L 2R2BB 1Q72L 3DX6A 4X6DE 3BQUA 2EYTB 3ARFA 2GK0B 4DQOL 4LCWE 5GS0H 1TVBB 3S36H 4G3YH 1OP3H 3O9WC 1KN4L 2O5ZL 2VC2L 3C60C 3BDYL 4PRID 4M6NL 3ZKMD 4CMHB 2GQHA 1NEZB 4QGYA 5BQ7B 3B9KB 1GOFA 1AGEA 4KK9C 5I17B 3HLAB 1KUMA 1U3YA 3PGDA 4KZEL 4F58L 4QCIA 3V0AC 2IH3B 4KXZI 1BJMA 4Y16C 2C7UA 4PRHB 2R29L 3SDYL 1NGXA 2OJEA 4ZUTA 3D2UD 4POZD 2HKFH 2UWEB 4GW4B 2GHWB 3MACH 4L9LA 5DJ8A 4GMSL 5HHOD 3QR2A 4GG6B 3IETB 1G9NC 5FUCC 5DJCA 2DDQH 4XMPH 1F42A 2AXFB 2FCBA 3TA3D 4L3EE 4C56D 5C07A 3NA4A 5BW7A 3O6LH 4Z78B 2XKNA 5C0ND 4P59H 3O2DA 2CPCA 3CNKA 2E9BA 2F54D 2VAAB 5DD1H 1MQKH 4X6CB 3W9EA 4NQDD 4O4YL 2Y5TA 2VH5H 3RWFA 3OKYA 5KVDH 2E7CA 1MHEA 2VLRB 3WL9A 5IT2H 4XXCA 4RAVA 5GRWA 5FYKE 3GKWL 2IEPA 1K4CA 1DCLA 5DWUH 4P2RA 2V2XB 5GRVL 2PO6C 3SDDD 5F1NB 2EXWC 1RZKL 1YEJH 3MLZL 3T0EA 4Z77B 4OLYL 3CSYB 2E9JA 2DLHA 2VZSA 3CSGA 5F8QC 3WDHA 4APQD 4BKLB 1YPZA 3IJSA 1U8MB 3QZWG 4TVPL 5EFIA 2YUVA 1NFIA 1UM5H 5KAQF 5CGMA 4K3EL 4EEEA 3VWKC 2V5MA 1T7VA 1YYML 2WANA 4YBQD 4PJDF 4U6YA 3QXUA 4L8CB 5J7CC 4DFIA 1YUHB 1LK3L 1LO5B 2J7LA 1U3JA 1IT9L 1IGML 1HHGB 1UH4A 2G60L 4W68A 1U3HD 3ULUE 3KPSE 4HLJA 5I73B 3GIVB 1IM3A 1HI6B 5SWQA 3BZ4B 4K71B 1JYXA 2GSIA 3FFDB 2Q76A 5KN5A 4PJHF 2BP3A 4PJXA 3SE3A 1JI1A 4PG2A 3D3VB 3G5XB 3MGTB 3GHBH 5ESAB 4CL7A 1GZQB 2XRAL 3RY4A 4ETQB 4Y2OA 3BRDA 4U6XA 2JTDA 1FAIL 1TQCB 4LHUG 4YHYC 3V7AG 4XNMA 5GSRA 4LCYA 4TSAH 2MHAB 3OGCB 2DJSA 3VGAC 3HC3H 3CUPA 2HT2C 4O2FB 2FL5A 2R56H 4L1HA 1LEKA 1A3LL 5E94B 3O6FB 2V7NB 3DTXA 1BECA 1L0QA 2GW5A 1QLRB 5IQ7H 3BKYH 5EH1A 3SJVD 1ADQH 1TVHA 3SGEI 4IDJH 1DBJL 2R2EA 1L4IA 3PJSB 2VR5A 2Z91A 4YFLF 2BRRH 3AY4C 1KJVA 4OTXL 3RWJB 4PJ8D 4WW2F 5JNYB 5E8NB 5D6DC 2DYPD 3PDOA 4K8RC 3U36A 3FT4A 4BQ8A 1FL6A 4MA1C 4PLOB 1HILA 1RZ8A 4PRBA 1I9EA 2EKJA 3WE6B 5ITBL 3DECA 3X3GL 4WO4C 2DS4A 5DD6A 1JCKA 1RZJL 5JQHC 5KG9A 1A47A 1IC4H 4X9BA 5CBAA 4RMUA 1EGJH 4M3KB 1GGIL 3ARZA 2HJKA 1TITA 3TYFB 4PJ7A 4M1CD 4S1QH 4P9MH 2PW2A 4MJ6B 4OB5H 4FXGB 2NY2D 4ZUWB 3MJ8B 1NJ9A 4OLUH 2VUYA 4O58L 3ZHLA 3LS4L 3JSSA 5J12B 1G7MA 4LEXL 5DRWB 2WSKA 1FVDB 4U7KA 4FZ8L 2FSEA 2OJZL 2NXYD 4J4PC 4R0LC 4PGJA 4PJAA 2ADGA 3QDGE 4NO0B 5KSVA 2GY5A 4KDTA 3EYFA 3BXNB 4AIZA 1IAOA 2IANB 2DMCA 3NFNB 1M6OA 3VWJC 5CJQH 4HK3J 2OQJB 1FYHB 2DQTH 1U8NB 4TUKL 5KS9F 2H26A 3DYOA 5IJKA 2AK4D 2YD3A 4WI3A 4DK6A 1R5IA 2XXCB 3U0TA 5ETUA 2KL6A 1U92B 2FB4H 4GQ9H 2O5YL 5DJAB 2AJUL 4LU5H 1XR9B 1ODAA 3ZL4L 3MUY1 3ARBA 1YEEL 1J0YA 3GBLA 4ZUVB 1MCPL 1J10A 1UEYA 1VFOA 4QRSB 3OWEA 2HAZA 4MD4B 5IK3B 4QRPA 2WBJC 1WWWX 2FLRT 1J1XL 3O3UN 1CI5A 4JPKH 1ORSA 5JQ6H 2GTZA 5L88H 4LIQE 5D1ZC 2CLZA 5IW1A 5J0BA 3P0YH 1NFDA 3WO3B 3ZDXE 3Q5OA 3CFDA 2EDJA 5HDLA 5JHDE 3FONB 3FTGA 1NUFA 3FCTA 1RUQH 5LGJB 5FYJU 4RNRB 3A67L 4KQ3H 2BHUA 5E08L 4W70A 4U1MB 2MJWA 4KUZL 4HKZA 3UJTH 1CGYA 3OXSB 5DLMH 2EDLA 3WO4C 2HLAB 3QEGH 4LCCA 1YNKH 4MNHA 4OF3A 3G5VA 3E8UL 4HIXL 1WCBB 3O45A 1MRCH 2BMKA 3C8HA 1C12A 4D3CL 4ERSH 2EZ0C 5KVEH 4JO2H 1A4JB 2Y23A 4Q2ZB 4P23C 1OQOA 3OKDA 2E6JA 4QO1A 1FYTB 4MQTB 1MIMH 3O4LE 4R3SA 4NQCE 3QZWA 1ZLVK 3GK8L 1AGBB 4TVPE 1G84A 3C08L 5EUOE 4C83A 3KPQA 4Y1AA 4ZODA 4NKIH 2AEWA 4GKNB 1NDGB 3EJYD 4MCYB 5LGKA 4OQTL 4YFDB 4NRYA 5C0JA 4HPOL 5ALBH 1RURL 4MA7H 4OCWH 4PTUB 4LSVH 1MLCB 1U8IB 3O8XA 5CS7A 4EN3D 2NYYC 1JN6A 4AEHH 4Z7QF 5KVGL 2EDRA 3K8LA 2R0KL 2NTFA 3BPOB 1JIBA 3VMNA 4WHCA 1IMHC 1NMBL 5ESQB 4P5TB 3WUZA 5IQ9B 4YHPA 4AZ8A 1M1SA 1ACZA 5HYJE 4O2EB 1KB5A 2APBA 2QQQA 4NYLB 1H5BA 4HAFA 3N0PB 3KPNA 4LHUA 2Z8SA 3HPJA 3C2AH 5AAWA 1ZTXL 4JN2B 1IJ9A 1KGCE 1KXVC 4PJIF 1C8PA 3PWLB 2UY6A 1FZOB 3RNQB 3DGGB 3V4PH 3MLWL 5HVGB 3NGBB 1J87A 3U7AA 3I50H 2B4CC 3IS0X 1UM6L 3DRQA 5FYKD 3RJQB 1YN7B 3GNMH 5I6XB 4MX7A 3AS3A 4U7MA 5HHXH 3GSNB 5E00B 3WFHB 5ACZB 4DAGH 3Q6GH 4FFZL 4OV6F 4PJBF 5E9DD 4IRSB 1VGKB 1YYLH 2A6JA 3SQOL 5LKNA 1ZLSH 1TJGH 1F8TH 2C4FU 5IF0A 1YC8A 1K2DB 2AGJH 4MS8C 3MYZA 2HN7B 1SJEA 2N7BA 2BC4A 2ESVE 2AQ2A 2HJFA 4UTBH 1OOAA 2AJSH 3CXHK 4JZNB 1ZHNB 2XTJB 4M6ML 2F53D 1EHNA 3MRRA 2VLMD 4KJPD 3QDJA 5DMGD 2UVFA 4X7EC 5F7DB 2B1HH 3I02A 1KF9B 3GIZL 4NNXA 2VXQH 3VFTA 3MUGA 1VFBB 1FL5A 4OZIF 5L2KD 3EO1B 1TFHA 1K3ZA 4DN3H 1T83A 5SWSE 2B8OT 2Y36L 4QXTA 3KPRB 1N2RA 2P1YA 1RJYB 3SO3C 5J6HB 4JPWH 4O51A 1FCCA 5BO1H 3ZYZA 3WIHL 3CX5J 1RJCA 4LRNH 4FFVD 5IB5A 1CFNA 3VD7A 3OQ3B 1MREL 3PABA 5MI0C 1I9IL 4IRJC 3KXFA 1GPOH 5DMIL 3SE4C 2OL3A 1RK0B 5DA4A 4N8PA 1CG9A 1AC6A 3OJMB 5TDNA 1XT5A 3HI6L 2MNUA 4G7VL 2EDBA 5LXGL 2AABL 1W0WA 3QNZB 1CLCA 1UM4L 4R90H 2XWJA 1MWAH 1W0VB 2VZ1A 2KUTA 1QR4A 1CLOL 3PWVB 3QDME 5I1GH 3I6GA 2X05A 1CGSH 1N7MH 3RIAF 3VFNA 1F4XH 5I1CH 3P4OA 4M1DL 3F7QA 3RUGA 4P3DB 4X8JA 3JBG7 3T65A 3RA7H 2PYEA 2I25N 2CGRH 4XAWL 1OWWA 3L3OA 1HNFA 3GMMA 1MCJA 2Z31D 1WV7T 1A1MB 2N56A 2APXA 3DARA 3FQUB 5IROA 4Z7WA 1EHLH 5F7MC 3DLQR 5B3JF 2XYCA 2BVOA 2K7QA 4JJHA 2ICEA 3T2PA 1REIA 2GJ6A 1WFNA 5DYOA 1FZKB 3MV8A 2GJJA 1GIGL 1RQ5A 3GJFH 2P8PA 4JY6B 4H20H 1NLBL 1ZLWH 3GMOA 2Q8AH 1IL1A 4P2OA 3VXQA 5GRJH 2WINA 3IDYC 3VW3L 3QIWA 1ZSDA 5D7JC 2DKSA 3MROA 1KJ2H 3VFUA 5JW3L 1L6ZA 2EDWA 4H5SB 1CXEA 3ZLQC 3PWNB 1D5BA 5DQJB 4H26A 1OAXH 2GJZB 3VXSB 5DQ9B 3UYOD 1JPTH 3KJ6H 2AXJA 2W9DH 4CVUA 3B5GA 1ZT1B 5HDBE 4H1LG 3IT8D 3MRGB 3U4AA 2BVQB 2J5LC 4YXLL 1NGQL 1JF6A 3HG1D 1T1ZA 4NRXB 2EC8A 2D03L 4WFEE 3U7YH 3FT3B 5L8LB 2FEDC 4UQ3A 1XF2B 4LSUH 2H3NA 1FNFA 4P46A 5EWIH 2DWDB 1NCDH 5EOCL 3BPLC 4QHUA 1Q38A 3PP4H 2BFVL 2B2XH 4PRPB 2HFGL 2MKWA 2YUWA 5GS2D 1VSCA 3JV4B 3DMMA 2Y6SD 5I16B 4E42A 3GSOB 2Y07H 3TV3L 5DJZA 4M43L 4MD0B 1KG0A 1GSMA 1R5WB 1T20A 1T03L 4M6AA 4PGBA 3ZYIA 5I1IH 5C0FB 3QQ3B 3L1OL 1DP0A 3K3QA 3GMRA 5DHYA 1EX0A 1QFUL 2YEZB 4DZBB 1OT2A 2XG5A 5DVKA 3HZKB 5E5UB 4K94H 4LOUC 4XBEH 3ULVD 2ZSVA 4Z7VA 1P7HL 1T7XA 1WAAA 3HI1A 3P9MB 3SDAC 4XBPB 1ZV5A 1XEDA 3WBDA 3BN9D 4OD3H 1DSFH 1MPAL 4JKMA 4WI4A 3K2MC 3VH8A 3O9WA 4HXBH 5F7LB 5FOBA 3C60A 4UNVA 5C0CB 3MOBH 2P5EB 4CU6A 5C6PB 2I60H 3T0AA 3DO7A 3QXDB 4GG8B 1B0GB 2R15A 4IHOB 4QWWC 4MNGA 1RZIB 2IH1B 3P77A 4L4VA 1N4XL 4Y16A 3UC0L 4Q9CA 3G5YA 4HMCA 1D9KC 3PG2A 2V5YA 3MLPA 4JRXE 4J6RL 5ADOL 1WIOA 4MQ7A 3RNKB 3HI5L 5E8PB 4EXKA 1G9MC 1IC7H 3FQRA 4Y19E 2FO1A 4Z5RB 1OTUD 1HXYA 4H25B 4F15C 1MJ7L 4UB0H 1MLBA 4KI5C 3UAJD 2OXHA 5JPMA 4LSPH 1FC2D 1HH9A 4HWBH 3QEQE 5H8DA 2VR9A 3QO0B 5J06A 4Z95H 3T4YB 3WJJC 2HA1A 3QA3B 1BPVA 3PXHA 2CKBA 5CIPB 4ZS6D 4PJGE 3WIFA 1T4KA 2MCG1 1ZEAL 4X6EB 5DVMA 5IMLA 4MXWH 4X83A 4I18C 5IEKA 4QRUB 3QHZL 5DURB 1R3KB 1I7RA 4KY1H 3DETD 5GHWL 4P2YA 3D39A 4HBQA 5B39B 5CD5C 3ARRA 3B6SA 5GRVK 2JF1A 4LAQL 2PO6A 3HE7B 1SMOA 1KJ3H 1V7NL 3RGVD 1JHLL 1MHPH 1R3IH 2F5AL 4PJCE 4LSQH 1T5XA 3S35X 4HQQH 4PD4K 1AO7D 1K6QH 4NZUH 3QIUD 1JTPA 5C0BA 2A9NH 3VXNB 2NY5C 4R97C 3HRPA 3VWKA 1NDMB 3NFPB 4LVNC 3ECBB 4LKCA 3U46A 4QRTB 4MZ3A 3FO9A 1QSFD 3QQ9C 4O02H 1MUJA 3TO2B 5BS0D 3H0TA 3QWRD 3C6LC 5DC4B 5GJSL 3N85H 2GFBA 4OFYA 1JMXA 4DKEH 1WUNT 1FGVH 1M05B 1EH9A 1PY4A 4HKJA 3UTSD 1OPGL 3VFGL 2A74B 3PGCA 3GSWB 2IPKB 4FQHB 1ND0A 3TH3T 2V2WA 3IDGB 1DLFH 5SWSD 8FABA 5HGHB 1UEMA 2KPNA 3VFWA 1RJLB 1CE6B 3T2OA 4XPGL 1TMCB 3L3HB 4U05A 5J1TC 5I18H 1W0YT 2XZCL 2YD8A 2A83B 3M8OH 1X4XA 3EOAB 4D0DB 3DIFA 3GGWB 4M5YH 3QJFA 2XTLA 4MJID 4JANB 3AY4A 1EO8H 3LS5L 3RFZC 5I1JH 4JFDA 4YQXL 1HHHB 1ORQA 4G9FA 4CVWA 3MQIA 4BQ6A 2MMXA 3TWCL 3VXME 4PTTB 5D6DA 2JJVA 1JNNH 3OAYK 5A16A 5F3BB 2AQ1A 5C0IA 3H42H 4H1LA 5D2LA 3I3DA 3AC0A 4KMQA 2P4AB 4RMSA 5TE7H 1MRDL 3OAZH 4P4KB 5D7IA 4WO4A 5ICZB 2VLJB 2FBJH 3NABH 5TF1H 1S9WB 1SJVA 3ARDA 5IVNA 2NY1C 2EYRB 1EAPB 3O2DL 1H3GA 1I8IB 1OGTB 3B9KD 1IILE 2GCYB 4HZLA 1Y0LA 1HINH 3VFSA 1HQ4A 3MJ6A 2NY4C 1HQRB 1S7UB 4TPRL 1UXWB 3GM0A 4AT6B 3NCFB 4EI5B 4PRHD 1BVKB 1UYWL 4G6FB 1BVLB 4PLJC 1G7IB 4I48A 5ILTH 2P24B 3UTQB 2EKSA 4LLVA 5I1KH 5FYLL 4R0LA 1YNLH 2YPVL 5J1AA 4Z18A 2QQKH 1MELA 2R1WA 5EBWA 4JFEA 1WQVT 2V17L 3GZKA 3OR7A 5H35B 3RX5A 3MV7E 4L4TA 3VWJA 5EO0B 4K7PX 1IGJB 1FO0B 4OJFL 4OSUH 1HYSD 1ZGLM 2XA3A 4NQEE 1A0QL 2VLRD 4EI6A 4Q0XL 2A6KA 2X2YA 4BZ1L 4R6UA 1INQA 3LKSA 3DI2B 4HPYH 5CD3B 1CR9L 3SGJC 5FB8A 4S1DD 4WU5B 3LKRB 4M93B 3MBXL 4PBVC 5JW5A 1ZGLB 2G75A 3TEUA 1X4ZA 4XCYA 3DX8A 1D5MA 4YDKH 1MEXL 4XNUL 4YUEH 1RMFL 2C3HA 4LQFL 3ROLB 2VQ1B 4GOSA 4HF5H 4KC3B 4G80A 2WBJA 35C8H 3IJHA 3HCVB 5D4QA 3QNYB 4AENA 3JXAA 5D1ZA 4HLZG 4YAQA 1TPXB 4NWUL 3GI9H 32C2B 3K4ZA 5I66B 3MA9H 4LLDA 1I1FB 3MLVH 2Q3ZA 3D3VD 3TFKC 1VKXA 3HNVL 3OZ9H 5TDOA 1MHCB 1CGVA 1XF3B 4HS8L 2AEPH 3PXJA 3VJ6B 1JNLH 2YD4A 5FHAH 2H8PA 5LVEA 5CZVH 2ENSA 3QAZB 3PQYA 4QYOA 5GGQL 1KNOB 4HK3N 3WXWL 1FNAA 3EJZC 1AQKH 4J3OC 4RGMC 1JHTB 5CUSH 1YMME 3D0VB 4FNLL 1OGAB 2PETA 3O6FD 4P23A 3LEVL 5MHSD 5C71A 2UV3A 1F58L 5KVFH 4GRMB 4AEIL 2X4UA 3BWUC 1G7JB 4JGUA 3MPCA 1RIVL 2DMKA 3HUJA 3GMNA 2BOBB 3C5SB 3V0VA 2DI8A 4DGVH 1QRNA 2X9XA 4IM8A 2R1XA 1AKJA 3JV6B 1ZHBA 2DD8H 1K9TA 1DANU 4PGZA 3NIDF 5ICYB 3IF1B 3RTQA 4NM4H 2Q86B 5BJTB 2HVJB 1T0PB 4IOSD 4HG4J 5DS8A 4Y4FB 4TUJA 2WQRA 4K3GA 1ZA6A 5DK0A 3PWJB 1LEGB 1HDMB 1SM3L 4I3RH 1OSPL 3L95B 4PV8A 1H3XA 1IGFL 2ZCKH 3NTCL 1RHHA 3L9RA 2BNUB 43CAB 3B2VH 3DSNA 4FQJH 2F8VA 4MAYC 1QSVA 1DQJB 3S96B 3S36X 5BRZB 3BYTA 3WNKA 4UIMA 5DD0H 3MRQB 5C86A 5I2IB 1CFQB 3CDCA 1CD1A 5BV7C 3DO3A 1N8ZA 4F7EA 3DX7A 5CJOH 3IU3B 1JGLH 3ETBF 3IGAA 4PP2B 5DT1H 3WS3B 2FHFA 4PJDA 1DTUA 4F7TA 4D9RD 4NO0D 1GC1C 1LO2H 4PRNA 3WYRA 4TUOA 1M7DB 4XC3H 3MJ7B 2IAND 4O5LL 2NY6B 2RAMA 5E8OA 4TSCH 3B2UD 1J8HA 2ARWA 3NZ8A 1ES0B 2Q20A 3DJ9A 5F1KC 5F6HI 5CAYB 1JMZA 5D5MA 1FC1A 3DV6A 2Q7YB 4ODVL 4MJ2A 4RAUA 1OAKH 2GITB 5C07E 3O6KH 3IVKB 4MA8L 3TNNB 4KJYA 2V2TA 3TNMB 5AYUL 4LBEA 1YEFH 4ZPVB 1S9YB 2WP3T 4KV5E 2BSRB 1T0MA 1ITBB 5C3LD 3ZKMC 4X80L 4YHKL 4X6DF 4QGTA 4R4BB 3SDXB 5T1LA 4ONFH 2ZWLT 3ILPB 3KPTA 3NZHH 3D0LA 5SWZB 1OCWH 3QRGL 3GUTB 5AUMB 2OX5A 3KPPB 5JPNB 4POZC 4P0DA 4DKDC 3CIQA 5E6ZA 1VHPA 1XAUA 3MFFA 1QLFA 1RUPH 3TBYB 1TZHB 2DM2A 4QY8A 5DJ0B 5FYLE 2YSSA 3T0EE 2W92A 4Q58C 4LLUB 3TA3C 4IRJA 5DR5H 1YPZE 4WHTA 3SE4A 2HMID 4YK4B 4K07A 5C0NC 2GTWB 1MFCH 3U0PB 2VWEC 2VXSL 3OJDA 5T3ZH 4HT1H 1J12A 5IHUH 4FMKA 4ALAL 2K3TA 3NPSC 4KROB 4UT7H 2PCPB 3FB8B 2OTWB 3QG6A 2DQUL 4KUCD 2ZOLA 4IOFD 3MV9B 4OKVA 1E27A 3ZKXC 3ISWA 2ZCHL 4PJXE 4DFHA 5ICXA 2WWKO 1MCOL 3SDDC 1KB5L 4PY8J 4IMKC 4YXKH 4UOW0 1FYTD 1FH5L 15C8H 1T1WA 2MPAL 2Z8VC 1QBAA 4V1DA 3LEXB 3HNTL 4XWGL 5C7XH 5DUBB 1VACB 1BBJB 4Q74A 5D2NC 4DJMA 4OGXL 3MGAA 3GMPB 2APFA 3T0VA 5E2TL 4KTDL 4YBQC 1JTTA 4LKXB 3RWCB 1ACYL 5T1MB 1LDSA 4OCMC 1U3HC 5KS9A 4P5TD 3T4AB 2YXFA 5JDSA 1I7UA 4Y5XB 1RIUL 4AH2B 5D7JA 3W82A 2BNQA 5HTSA 1YEDB 4OGAD 1E4XH 1DFBH 1FZJA 4GW1B 2JIXA 2I07A 4HC1H 4I3SL 4XP5L 4C54A 5C0GB 4X5LA 2ICWB 3FRUB 3ULUF 2NZ9D 3AU1B 4XMLL 3F6LA 4R9HA 1A1OB 2XQBH 3A6CH 1VGEH 3GRWA 1QO3A 2AJXH 2W91A 1CDBA 3R4DA 4HCRA 1J18A 4QRRB 3TT1L 3VRJA 5IEHA 3LV3A 4AM0B 1CD8A 1FVCA 3MXWL 1Q9WB 4XNQA 2X42A 5GISL 1PBYA 5J6GA 1KEMH 4PJ7E 1KPUA 1HNGA 2BY0A 4X7CC 4IRSD 2NTSP 4PB9L 1P4LA 1KCLA 3ARVA 1FFNA 2VITB 3LKQA 4DGIH 4XP4H 1NCAL 4XB8A 4PJ8C 4Z7NE 5C0RL 4GRWE 4U1SB 3JTSA 1OLZA 2BNRA 3O3AA 3QXWA 4LARH 2XA8L 3PWUB 5D72L 3G08B 2I26N 2B7DT 2PW1A 2J8OA 3T1FB 4R2GB 1XGYL 3BGFC 2DKUA 4X4ME 3QULB 4GXUN 5CGTA 5JHLH 2XTJD 1F45A 5HVHB 2OL3L 1QFOA 1SQ2N 4OCRH 3S6CA 4F7MB 5IBLD 3O4OB 2DQHL 2IPUG 2MCPH 4ZTOH 5GJTH 5LJYH 5DJDA 4KKBD 3D85A 3H9SB 3QUMB 4XP6H 4LCUA 2G9HA 4JRYA 4M1CC 3UCRA 3DVGA 2DQJH 3S35L 3G04B 3K74B 2O61B 3SDAA 4OZGA 1BQHG 1CD0A 2Z35B 2NY2C 1P53A 3IU4H 3KPRD 4NNPL 2L4OA 3MUJA 1YMMD 4FZEL 3WCYA 4K9EC 3DVNA 4M03A 1AJ7L 3NA9H 5JO5A 5DVNA 5CSZA 2NXYC 5J9PA 4ODWA 3WN5B 4M7KL 3RWIB 5T5FL 1X3DA 4ELKB 4E0RA 4ZXBB 1D9KA 3IXAA 2VN4A 4Y4KD 4J1UB 1HHKA 4JEGB 4IJ3B 5E2WH 4X7TB 4QRPE 3CFBA 3L3IA 4JFZL 4OM1H 4PGDA 3L7EB 2C5DC 5GRXG 1Q0XH 2WWMD 4ORGA 4XPBL 3TZVD 3UP1A 2EO9A 1CN4A 4PJIA 2ED8A 1NFDE 1T2JA 5DFWH 1NCWH 2CQVA 1C5CH 2RFXA 4WJ5B 1N6UA 1AQDB 1Q0YH 1UZ6E 4N1HB 5DEZA 2YPLE 3VXTA 3ZT6A 2ADIA 1HSBB 4ZTPH 3WJJA 3OKLA 1AFVL 4QOKA 5ENWA 3MLRL 4JHZA 4OI9A 3TIEB 1MF2L 1U93A 5HYQA 5JOFB 1KJ2A 3KAAA 3KYMA 3O41B 4F8QA 5FUOL 4I18A 3ULUH 2DQDH 4KHXL 1JWUA 3BRGC 3S37H 1SEQL 2LFGA 2X4TB 1CT8B 1Q9KB 2YKLH 4HFWB 4LNRA 1FNGB 4FABH 4U2YA 5A43C 4NUJA 5T33L 4Y1AE 4G8EB 2Z92A 4N0UE 1ZA3B 4OV5B 1ZVSB 3BIKA 3L5IA 1RIHH 5CJ8A 3MX0A 1XGUA 2OXGA 2P45B 1PAMA 3FN9A 5GGRY 4HFUH 1RD6A 4DCQB 3VXSD 4RFNB 1KC5H 1Z6JT 3ZDXF 3D18B 3V6OC 2YHGA 4XVSL 2NPLX 1E0OB 1YEGL 4LVOB 5JW4N 3C6LA 1OAQH 3EO9L 1WISA 5I9QB 3CH8A 5INCA 4JGMA 4H88H 2V9QA 1WWBX 4LF3B 5HHNA 1MCLA 4QHNA 3JWOC 3HZYB 3KYNB 5DK2B 5FYJL 3EJYC 4E41A 1MRFL 4KTYA 4BSJA 4X4YB 5C09A 4UQ2B 4G43B 1YY8A 2C3WA 4PRPD 3CZJA 3O0RL 4LLWA 4LEOB 1N6QH 1ZE3C 5FK9A 3T3PE 4NN5B 4EN3C 3ET9F 1LO3L 1YECL 4NBYB 1N5AA 5JOEA 4K7PL 3MLTB 4OLVH 4WY7H 5EUOF 1MCIA 1S9XA 4HKXB 2W38A 4MAUH 5CHNA 3I3EA 4NZTL 3QXAB 4TNWK 4YBLB 3QNXA 1FZMA 4XWOC 2M26A 3CFEA 3IFLH 3NIGE 3OMZA 1BD2A 1B4RA 1X7QA 5CWSA 3IFOB 3P30L 1V05A 4HUWA 2COQA 4A2MA 4F3FA 3CCHA 4MHHI 2P5WB 1HOCB 1G9NL 1H9VA 2FHCA 3QDJE 4S0TD 1L6XA 1RI8A 1C7SA 1KLGB 1YEIL 3HZMA 4WFHD 5C0CD 3UTZA 1LO4H 1DVFB 4XP1H 1TQBC 2CXGA 3TH2T 1Q72H 3MRHB 4FA8A 2NY3B 4U49A 4DQOH 2CKBL 2YBRA 5AWNL 3LRSB 5DMKA 2EDDA 1LD9A 1BVZA 1KN4H 2VC2H 3BDYH 2X4OA 4GBXC 1DBML 3TCLA 4HWBA 1V3JA 1MCQA 4LCIH 4M6NH 4WUUB 5C9JA 1YN6A 1AR1D 2H6PB 2HTLD 2XZZA 3IDIB 4CJ1A 4M7LL 2C9AA 5EBMA 3TJEH 4KZEH 4F58H 4RZCA 4LSSL 3BDXA 5DXWA 2AJVL 2OR8A 4KJPC 1KB9K 2BDNL 5DMGC 3X3FL 3SDYH 3VCLB 2EDQA 1BJ8A 4ZDHA 2VDML 1KCSL 2Y06L 1M71A 5ALCH 1GXEA 5MP6L 1BQHA 1O5DT 3PP3K 5EC2B 5C3TA 2ENYA 3V6FB 1D5XA 4X4XA 4LIQH 1XGQB 3RUGE 5DURD 1IZJA 5DGRA 1H3WM 3F7YB 2PYEE 5H94B 3SGJA 4FFVC 3HE7D 5CGYD 4Z7UB 2F58L 2UYLB 4O4YH 1K3IA 4Z7WE 3FN3A 2P8LB 4GKZA 1MVFA 1CQKA 4ESKA 4WHYG 4OM0L 1HHIA 3GKWH 2GJ6E 4UI2A 3T77A 1R3HB 5HPMA 3TH4T 3MLZH 5HBBA 1U8HB 1GGYA 4OLYH 4I1NB 2HVKB 4WV1B 4YBHA 4X5XA 2AXGB 2D7TL 4L1DA 3HPLB 4TVPH 4UMGA 3MLXL 3FFCB 3P2TA 4M5ZL 4K3EH 1DLHB 5ELIA 2CSPA 5H2BB 1YYMH 2J8UE 5KOVC 1QFWM 2Z31C 5TE4L 1CFSB 3GJEA 1CICB 2PYFA 2X4RA 1UZ8B 3UPRA 1LK3H 4Q9BA 2DIJA 1IT9H 1IGMH 1C08B 2G60H 3DRTB 4K8RL 4QHLA 4ZO7A 3CPLA 1LDPL 2A6DA 1Q94A 3PWPA 1I9JL 3BKML 5JORA 1UFUA 2FJHB 3X14B 3KYAA 2DLIA 2UVEA 1K4DA 2XRAH 3U83A 3MJ9A 4NQVA 2DKMA 5LCVL 4OF0A 3UTTB 1F2QA 4IS6B 5JUEL 3U9UA 1A3RL 4N9GB 1NBVL 3CJJA 2UWEF 3SPVB 2IALA 3PV7A 4ZUSB 1A3LH 4FTVB 3B4NA 3ARGB 3BGMA 3MCKB 3HZVB 5DD1L 1MQKL 4JG0L 1FJ1B 5FKAA 4JM2F 3I6LE 3IS1X 1I3RB 4RMVA 5EBLA 4OCLC 3AS0A 4P4KD 3FQXA 5TFSL 2NCMA 5IT2L 5ITFA 2VLJD 3AFLA 3EYOB 1R3JB 5F7WC 5DWUL 4OZFG 4RGNE 2XIDA 3IDMA 3OAYH 3X13A 3P11L 4P2CG 3DSFL 1R5VB 1UWXK 4Z7VE 5HDBF 1WAAE 2QV2A 5ITBH 4S1SL 5DJ2B 1IM9A 4EI5D 1UM5L 1BMGA 1IVLA 4MAYA 4G6FD 2QHRL 4JDZA 5GS1B 2Y6SC 1UJ3C 2O93L 2J4WL 3EOTH 1S7QB 1QHPA 2YD5A 4ZFFA 3ESUF 5DTFB 4LHJB 1A6UH 4XZUA 3GO1L 4U31A 5I1AB 1XMWA 4L4VE 1AD0A 2APWA 2JE8A 1FNEA 4TSBL 2EDFA 5FO9A 1K8DB 4NGHH 1S7XB 3TT3H 3MRIB 1GCFA 2VL5B 2EYSA 3BP7A 3AXLB 4LEXH 4NHUA 4FZ8H 3ULVC 2OJZH 1ZVHA 1FP5A 1YEHL 4M1GL 4OD1L 5FUCE 5KSBA 5C08B 3BN9C 2I9LB 4YDVA 3QFDB 4WFGE 4YO0B 1WZ1L 2OMBA 4PRIA 5FIEA 3I75A 4TUKH 3OJ2C 2D0HA 5BMFH 1VCAA 1WZMA 3Q1SL 4HDIB 3BKYL 4G5ZH 3L5WB 1P6FA 5F7EL 2XY2A 3FRPA 3CVIH 1AD9B 2O5YH 2AJUH 1LP9B 3ZL4H 4XGZA 3D39E 3D2UA 5HGAA 1SBBA 4PRDB 3VFOB 3R06A 2NX5A 4YC2C 1V8HA 5HHOA 3PGDB 3EOBA 3R0NA 4QCIB 3O2VL 1T66D 1MIEL 4HIIA 4P99A 5IFAL 1A21A 5D93C 1MCPH 1OTUC 3TA3A 2D7OA 1NGXB 3A0OA 4AL8L 1AY1L 5DZOA 1T2QH 5D6CB 3P4MA 1A7QL 2YC1A 2JCCB 1KJMA 2F54A 4JVWA 1G7HA 5F9WC 3T0WA 3EO0B 1WEJL 4JY5L 1UB6B 5DJ6B 1KLFA 4NQDA 2OYPA 4ZS6C 4HW6A 2BSED 1MY7A 4UT9L 5FYKU 4N0CD 4OB5L 3QH3B 4R7NB 4FQPA 4U3CA 3DETC 3GB7A 3BE1H 3D9AL 4OAWA 2NW2A 3A67H 3KYOA 1OGAD 3LRGA 5E08H 3SDDA 3UYPA 4KUZH 1YNTB 4IMKA 4OUUA 3RGVC 4PJGF 3RWFB 1MHEB 4BQCA 3E8UH 3FHAA 3QIUC 4HIXH 4DVBA 5I75C 2E7HA 12E8L 3DYPA 2CDEA 4D3CH 5D2NA 4P2RB 5GGVL 3U6RA 1PKQA 5GGUB 4WCYH 2B4CL 4HK0B 2V9TA 2DQTL 4PJCF 4WFFD 3AREB 3VFPA 3GK8H 3T04D 2FGWL 3C08H 4PJFB 1U3HA 5F8RC 1WZLA 4OQTH 4N90E 3NN8B 4HPOH 4L8DB 4M8VA 4Y4FD 4GQ9L 1RURH 4JFDE 4F33A 3RWGA 4G9FE 2I5YL 4FQ1L 4JZOB 4RGOL 3TBTB 2A73B 4K7FA 5KVGH 1XGRA 1UXSA 5D2LE 2R0KH 1YQVL 5I71C 3T2NH 3BX7C 3RRQA 1NMBH 3SGEH 5D7IE 5I8KL 4YX2L 1G6RH 5KN5B 5DUMH 3NCEB 1U95A 5BRZD 1WCQA 5DRXB 4M8QB 2RCSL 1CU4H 1ZTXH 2QKIA 4LCYB 1BHGA 4XVUD 3MLWH 3OV6A 3SJVA 1JVKA 1P4IL 5IB3B 1FFPA 5IBTL 1UM6H 4CVZA 1FSKB 4NQTA 4PJ8A 1SYVA 2NY6D 1MY5A 3G6DH 2DYPA 1J86A 1KIQA 1NGZB 1RUML 3UJTL 5IJVB 4FFZH 4GUPA 4NKOB 3MRJB 2CRYA 3W39B 1OT1A 3QEGL 1HWGB 1YNKL 3SQOH 5CKAA 2EIZB 3DUUB 1MRCL 5IVXB 5FV2A 5EOTA 2FIKA 4JFEE 5CLTA 5IB1A 3PDOB 4QRQB 4BUHA 4CMHC 1A02N 3B9KC 1DE4B 5T3XL 1KTDB 3O3EA 4KUCF 5GRZA 4IDLA 4XCNB 1EFQA 4L8BA 5DD6B 5SWZD 3P3YA 3MNVB 1N3NA 2P46B 4QEGA 1HCVA 1Q8MA 3C09B 4NKIL 2PKDA 2ZUYA 3GSRA 1JZ4A 1K5NB 1T7ZA 3GIZH 3KYKH 4U1JA 3C6SA 4OCWL 1H0DB 4LSDA 4HJGA 4QF1A 4KU1A 3RZCD 4PR5B 4P57A 2P43B 3RX7A 5HGBA 1EERB 1JZ6A 3K8MA 3O3BA 2Y36H 4QHKI 3QP3A 1DQDL 1FRGL 3CFJA 1K8IA 1FN4A 3K0WA 4KROD 3UXFA 3WIHH 4GAJL 1Z9MA 1MREH 2AK4A 4PJAB 2P48B 2E9WA 2FX7L 1YY9D 1HYSC 1JRHL 3QIBD 5DMIH 3ARWA 3EYFB 3V6ZB 3MV9D 4AIZB 3HI6H 4G7VH 5LXGH 2GSGB 3S4SG 3SCMB 1UM4H 3OL2A 3N1FC 3HAEG 1RZGB 2H32H 4G8GB 1F4WL 4S1DC 5HHXL 1MOEA 1R5IB 1JWMA 3FT2A 3U0TB 4YPGA 1U8LA 5ESVA 1HEZB 4M1DH 3PQYE 2VB5A 3V79C 3CMOH 2Q6WB 1TJGL 4Q6YA 1INEL 1QTYT 2AGJL 3NCJL 4PP1D 3GRWL 4HJ0D 4XAWH 1EEYA 1BQUA 5GZOD 5HHQB 7FABH 4UTBL 1CTNA 4L4JA 4I0PB 1RK1B 3HUJE 3OKEB 2XWTB 4BZ2L 1QRNE 4K71C 3WNLA 1GIGH 3MR9B 1CDGA 2VXQL 2GUOA 5L8JB 3RHWK 4MWFA 1FG2A 4G6AD 3PDGA 1NLBH 4PD4J 3ZDYE 1U3ZA 2JLLA 4U1NA 1TQCC 3GSUA 3D87B 3VRIA 3L7FA 3L3KA 4UU9B 4X6DA 3ZE2E 3EYQD 3VW3H 3V6OA 3FTGB 1SY6A 4EUPH 3R0MA 4DN4L 4DW2L 5E2VL 5J4MA 1KFAL 4GSDH 4QRRD 4JPWL 3O6FC 1NBQA 3X17A 2CK0H 5FDWB 1G7QA 3GSXB 2WIIA 5EZOL 4U33A 2OSLB 3O45B 4HJJL 2BMKB 5AZ2L 2OLDA 2FR4A 1M7IA 1BOGA 3WKML 5ID0B 2OK0H 1NAMA 4OZHA 1NGQH 1QQDA 1QEWA 1Z0NA 4EN3A 2D03H 3G6JB 3CD4A 4C83B 1XGPA 5INDA 1WC7B 3LH2L 1MCRA 3H9HA 4R2GD 4MZ2A 3CH1A 4ZQKA 1X5ZA 4NRYB 4L3EA 4MDIA 1X5XA 1KENL 2HFGH 5A2JH 4N0RA 4LDLB 5K9QG 4D9QE 1J8HE 4X5WA 3TV3H 3T2QA 3BPCB 4JQVC 4M43H 1UQSA 3H9SD 1T03H 5D5ME 3INUL 4MJ5B 4JKLA 1D7FA 4RIRA 2W60B 1D6EA 1G9ML 3WV0A 4IEFB 4WI5A 5IFHL 4MDJB 3P4NA 3BRFA 1QFUH 3HPJB 2N4IA 2R1YB 5J12C 3KLAA 5DHVA 5GSVB 4UTAL 3MYJA 3LKPA 1KCVL 4H20L 4RMQA 2Q8AL 4BK4A 1LQSR 5E9DA 2ZUTA 4YDJA 1TJHH 3VU2A 3N1QC 2X9WA 3WFCH 2KH2B 3RWDA 5C9KA 4ZXBD 5SX4I 1ZWIB 5D9SA 5K9KA 1KJ2L 3B2UC 1JUFA 4GBXA 4RFEA 4WW1B 3OKMA 2A6JB 3VGGA 2B1AL 4F7CA 3MJGX 4ELMA 3ZYOA 2W9DL 1N4XH 2F53A 3KPSA 3UC0H 3L6FB 4F8TA 1IAII 1JWSB 3IYLW 1Q9OA 5D8JL 3W5NA 5ADOH 2VO5A 3HI5H 2NY5L 1RUAL 3U7YL 5L2KA 5IMMB 4PV9A 5C2BL 4PREA 4LSUL 3LQMA 1MJ7H 4KV5F 1VFAB 3S5LA 3WNNA 3LOWA 4AYFA 1E4KC 1TZGH 3EGSA 3V5KA 1AH1A 3N1GC 3VGDA 1VESA 5EU3B 3FQWB 5HHVL 4L5FL 5TDPA 3SDCB 3QHZH 3B3IA 4JDVA 1Z5LB 4NC2B 1AGDA 4LAQH 1V7NH 1G7LA 1JHLH 4RISL 1YPZF 2F5AH 2OL3B 3JUYA 4BFBD 4ZUUB 2FHBA 3HAEA 2HFEA 4IOFC 1WBYA 2XWJB 4OD3L 4PLNC 1NUDA 3FO1B 2BNQE 1BLNB 3BP6B 3WFZA 1XGTB 2NY0B 3MRDA 5EU7C 3VFNB 2R4SL 2RJMA 2Z31A 2MWCA 3TPUB 5IHBA 5IMKB 3P4OB 4X8JB 1KEGL 3LSOB 4PJXF 3T65B 5CEXA 5GJSH 2A0LD 1UADC 3GMMB 3CLFH 1OPGH 2XXMB 1HE7A 3TF7C 1YEKL 3FB7B 3BPOC 4WI2A 2GK2A 1IC7L 2BVOB 5HGGS 4P5TC 1I1AB 5ANMB 3QDGA 3MNZB 3MV8B 4OGAC 4NN7B 4FN0A 4O2CA 2BNRE 3BZEB 3GMOB 2XZCH 3IXTA 5CEYA 4HWBL 4YHOH 2WINB 2NZ9C 4H8WC 1KPRA 3NGBC 3PL6B 4ZAKC 3VFMB 3UMTA 4MD5A 5HSFA 3VFUB 1CZ8L 3LIZL 4N1CA 4YGVA 3WNMA 5CEZL 4KY1L 4YQXH 3HG1A 4EBQL 2DJUA 3DGCR 1DVFD 3C8DA 3HS0B 4FXKA 3FO2B 4JRYE 2X9YA 5I1DA 4HIHB 2VYRE 4IRSC 3OJVC 4X7DC 3Q5YA 1IEBB 4G6JL 4LSQL 2NY3D 5F88A 1MRDH 1NEZG 5CJ5A 2I27N 1K6QL 4OIBA 4OZGE 1OQXA 4I9WE 4KQ4L 5FA3B 5C6WH 4JQIL 3VXUB 1AGCB 1S7RB 1UJ3A 3O2DH 4WUUD 3EDJA 5F3HB 4PJ7F 5FO8B 3CGTA 2H3NB 3H3PH 4LPTA 4RWYH 1GGUA 4JAMB 2XTJC 4WUKL 43C9B 3ALPA 4Z7NF 5BXFA 4GRWF 3FB5B 3BH8B 4E42B 1UYWH 3BZFA 1U58A 1LILA 4KZDL 3RX8A 2JB6B 5FHBL 5DJZB 4KKBC 1FGVL 4JFYA 3QQ4B 4WEUD 1EPFA 4TNVK 4X6BB 4WTWA 5FYLH 2LVEA 2CLRB 2YPVH 1CBVL 4XB7A 1J0KA 5EIIA 4ODUB 1C5DA 2QL1A 3IJYA 5IVZA 3H7BB 4JFFB 4KI5E 1QR1A 2V17H 1X5JA 2J1KA 3TVMD 1IAIL 3LY6A 4P4RA 1F4AA 3WNPA 2ZSVB 3OG4B 1G0DA 2DBLL 2NZIA 3PP3H 3HI1B 4I5BB 1N26A 2DI7A 5F7FA 4QOKE 1GYAA 4M3JA 1A0QH 3PV6B 1EJ6A 2CIIA 2CKNA 3JTTB 2QHLA 4Q0XH 4AEFA 5E56A 3C60B 4NCDA 3UZVB 4BZ1H 4Y4KC 5MEOA 3HB3D 2WUCL 4S10A 1H15A 1MNUL 3TC9A 4A6YA 3S37X 3LN5A 3QDHA 3DUSA 4JCLA 3FB6B 2WWMC 1JE6A 4NKMA 4MNGB 3WFBL 3TZVC 3H42L 3MJ9L 4JN1L 1MEXH 5GGSB 5TE7L 5J11C 2WLYA 4XNUH 1RMFH 5AD0A 3FFCD 2Z4QB 5IM7A 2CJUL 5TF1L 2YD6A 2OP4H 4UT6L 1DUZB 4XH2B 5CLWA 1AE6L 3FQRB 1FNHA 1CICD 1OARL 1J1OL 1NFDF 1HINL 4NWUH 3Q0HA 3D25B 5JPMB 1HSAA 5D71L 3IB4A 2DM7A 1WBZA 1UZ6F 3VFVB 4OZFB 4PRAA 4NPYB 1CE1H 1HH9B 3MO1A 2JK5B 4ZD3L 2GAZB 3HNVH 4XNXL 4D8PA 3RGVA 3LAFA 1L7TL 3UTTD 4HS8H 1DQML 3MRMB 5I1KL 4E41E 1AO7A 5C09E 1A6ZA 3QIUA 5GGQH 3WXWH 3BD3A 1HCFX 4FNLH 3RP1A 4K3HA 4FTVD 4AQOA 4FQ2L 4GRLD 4NRZB 3CFIC 1T5XB 3SOBH 2DBJA 2ESVA 3E6HA 4AEIH 2AV1A 4GT7A 5C0BB 4OSUL 5BV7L 1QSFA 4GW5A 1RIVH 1C16A 3SGDI 5L7XL 1G7PB 5FECB 4S11A 4BUGA 5BS0A 4QTHA 3KDMB 3QWRA 1BD2E 2CUHA 1GC1L 5DJYA 2WQ8A 4HPYL 4YR6A 3GI8L 4GRWH 3MLYL 1SJHB 3UTSA 3K1KC 2IQAB 1MUJB 4BELD 2ZP0T 4F2MB 4XXCC 4R7DB 5SWSA 1YMHA 4YUEL 2GFBB 1IGYA 1F6LL 4YHLL 3RIFF 2M8XA 4DUXA 3OR6B 1SM3H 4HS3A 4D9LL 1OSPH 2YA1A 5F1SA 2PTUA 1UWXH 1BP3B 1IGFH 2PUQT 4JDTL 3NTCH 5DRNA 1NGYA 4BFGA 4MJIA 4I2XA 2BHZA 2NW3B 4WDIA 2CK2A 3MA9L 2IAMB 1JP5A 4EDWL 3MLVL 4XHJD 3ES6B 2E9IA 1I3UA 2R2BA 3ELAT 5EOCJ 3QJFB 1QSEB 3VA6A 2EYTA 5C08D 2XPGB 2R0ZH 2GK0A 2YK1L 3NIGF 5FHAL 3DVFA 5EU6B 5CEZE 3CFKA 1TVBA 2ZPKL 1ORQB 5HYSG 5CUSL 5EN2B 2X5PA 4O5LH 4LVHC 4PGEB 3SE3C 4HIJA 4IMLA 1NEZA 5BQ7A 4LLAA 3B9KA 2XQYG 5I17A 5CCKL 1P2CB 3HLAA 4FFWD 5ADPL 2IH3A 1RFDL 3C8KB 4HWZB 4MA8H 1XF4B 4PRHA 2QSTA 1QLEL 2R9HD 4UUJB 5C1MB 1E4XI 1DN0B 1T7WA 3IDUA 2UWEA 4GW4A 3CDFA 2DD8L 4X80H 4HZLB 4YHKH 2OTUB 1S78D 2HTLC 4MMXC 4NM4L 2BRQA 3IETA 4M9PA 1J0JA 1LHZA 2AXFA 3QRGH 1KULA 3F12A 4Z78A 1S9VB 1FV1B 3KGRA 4I48B 2OR7A 2BCKB 1D3CA 4C4KO 1IBGH 3S3JA 5L0QC 4LLVB 3E3QE 4MCZA 4JVUA 5HJ3B 2R4RL 5J1AB 4D0CA 5HI5D 2VLRA 2R1WB 4Q9RH 3J7HA 4L4TB 3EOYG 3ARQA 4ALAH 2V2XA 3VXPB 2OR9H 3HE7C 5CGYC 5F1NA 4XCCH 1P4BL 4UV4L 4Z77A 1EVTC 1JL8A 5DT1L 2ZJSL 25C8H 3CSYA 3RUGF 2VQTA 3QT2A 1L7IL 1U8MA 3HTLX 4OF8A 3WLWD 2VZTA 1S9KC 3LKSB 1PG7H 3RPKA 3R1GH 4P2RD 5FB8B 3PWPE 3O3DB 1MCOH 4L8SB 2HRPL 3T8XB 1KB5H 4XCEB 4Z7WF 1LE5B 1FH5H 3ARED 2OMNA 2MPAH 4KKAD 1YUHA 4FQLL 1NBYB 3VXRB 3HNTH 4XWGH 1P6AB 1HHGA 3GIVA 1HI6A 3O6KL 4DUWA 3BZ4A 5D7LB 2E7LC 4OGXH 1F4YL 2CO6B 3FFDA 4YDIL 1BFVL 3MV11 5F44A 3V4VH 5E2TH 3IJHB 1DEEB 5LWYH 3D3VA 3G5XA 3MGTA 5ESAA 1GZQA 5E6IB 3LPGA 4ETQA 1UVQB 3KLHD 4ONFL 2VXTL 4ZPTB 4HV8B 2MHAA 3OGCA 1RIUH 4XC1H 1TCRB 3VGHA 2J8UF 4O2FA 5B38G 1JPST 2W1NA 2VKWA 5BOPA 5E94A 3O6FA 4I3SH 4XP5H 1I9RL 5A3IC 2H8PB 4MVBD 4PG9A 1KIRB 5DR5L 3PJSA 3ARYA 3RVVD 4U1KB 4CW1A 3RWJA 1VEMA 2W0FB 2OI9B 4Y0GA 5EIQA 5IHUL 5JNYA 5E8NA 3D48R 4UT7L 4K9EL 2ATPB 2XFXA 1I1YA 2DICA 5KSUB 4D2NA 1AXTL 1M4KA 1U2CA 2VIRB 4NC1E 3V0VB 3L3DB 2AP2A 4P4KC 4Z7OE 4PB9H 1ERNA 2R1XB 1BOYA 1NCAH 5I76B 4KDVA 5C0RH 7CGTA 3MXVL 1BBDH 4OLEA 4DOHB 5D72H 2XA8H 4TN9A 1P7QB 5FA4B 1EVUA 1YDPB 1P84J 4JQVA 3HRZB 4KRNA 3TYFA 4FQXB 1XF5A 3UBXA 1XGYH 3IFPB 5KSBE 3RL1B 3S4SB 2CXKA 4MJ6A 3QPXL 2YRZA 4EI5C 4L29B 4ZUWA 3MJ8A 1L0YA 4HUUA 2DQHH 2MQ3A 3Q3GB 4BFIB 4PRIE 2HH0L 4Z7VF 5DRWA 1WAAF 1FVDA 4K7PY 1CXFA 5F96L 3S35H 1B88A 1TJIH 3O6ML 2XI9A 1IKFH 6FABL 4HWNA 4NO0A 3GSQB 4NNPH 1N59B 2H9GB 4FZEH 2BVUA 3BXNA 2IANA 1N8ZB 3NFNA 1AJ7H 3QDAA 1E4XL 5C0EB 5HHOE 1U8NA 4PJDB 3TN0B 2R8SL 4C56E 1F6FB 5T5NG 5T5FH 2LAAA 1U92A 1VGEL 3SCMD 5DJAA 3SE9H 3NZ8B 1XR9A 2VWEE 2AJXL 2F54E 2NNAB 4G8GD 4TQEH 4PJHB 1MI5B 4JFZH 3VD4A 4HIEB 5EB9A 1B0RA 4HUMB 1BIIB 4NQDE 1KB9J 4NO3B 1KEML 5F7HA 2V2TB 4ZUVA 1A4KA 5E1AB 4DKFL 4QRSA 4XP4L 1SY6L 4NZDA 3E6FB 3L5HA 4MD4A 5IK3A 2C3GA 2DL9A 4XPAL 4R8WL 1E4KA 4LARL 3QO1B 4OFDA 3BVNB 5F72S 2EEBA 1EO5A 4UIKH 1AFVH 1C1EL 1TXKA 1IAKB 3MLRH 4I0PD 4EUPA 2C3XA 5ISZB 1TPXC 1MF2H 3JWOL 4M7ZC 2PXYD 2ADJB 5FUOH 5D2NE 3SO3B 4C57C 4QXWA 1KCKA 3MFFB 4KHXH 1H8SA 1PKQE 5LGJA 2PTTB 4ORZC 1SEQH 4FRWA 3ZDZE 4WW2B 1NAML 2E6QA 4U1MA 4ETYA 3N1MC 1Y6NR 1NCBL 5EC1B 3OXSA 2VZVA 1OSZB 3SY0B 3TJHD 2X09A 5T33H 1IARB 2HLAA 1S8DB 3QAZC 5FGCB 4N0CC 1WCBA 2VDQL 3OJDB 3RBGA 4NSKB 1TNNA 1I7TA 3QXTA 3UROR 1U91B 3CSBA 4Q2ZA 3UZQA 4B50A 1KN2H 1FYTA 2VLKB 2X4SB 1AGBA 3LHPH 1AGFB 2LVCA 1LVEA 4GKNA 4ODTL 4YWGL 5FM5O 1YEGH 5JA9A 5HI4D 3EO9H 2VXUH 1OD9A 5M95B 1T6VN 4PTUA 5F6IB 1MLCA 1U8IA 5E2UL 4UOW1 5FYKL 4V1DB 1EO7A 2CDFB 4OM1L 5IB4B 3SJVE 4NFDA 4NZJA 4KKCD 5ESQA 4P5TA 3O0RH 1C5CL 3NCMA 4O2EA 2X4QA 1Q0YL 1BM3L 4NYLA 4JQXC 4WTZA 1LO3H 1YECH 5F7KC 4K7PH 4JN2A 5KS9B 1PQZB 4X0KB 3PWLA 3RNQA 3DGGA 4NO2B 4NZTH 1CGUA 1CVSC 3GKZA 4ZAKA 3G9AB 5I19L 5DD5H 2BHYA 3GHEL 4NQXB 3P30H 3S37L 2DJ4A 3ESVF 5D2LF 1JZ8A 3O11A 3F7PC 5E00A 2X41A 3WFHA 5ACZA 5AG9A 5IOPA 4XVUC 5D7IF 4FOMA 2H45A 4IRSA 3UZEA 1I8KB 1ED3B 3T0BA 3UX9B 1G9NH 1FL3B 3BESR 2W9LA 3TBSA 3VRJB 1K2DA 5B4MD 2NY6C 1YEIH 2HN7A 4JM4H 1DQLL 1DDHB 4ODSL 1QYGL 3QJHA 4OLWH 3QI9B 5EUKB 4JZNA 1FFNB 1SHMA 3LKQB 1P7KB 4XP9L 1MCDA 1ZHNA 2CKBH 5DEFB 5AWNH 3ZO0A 4BYHA 5JMRA 2WWKT 1NC4A 4P5MB 3QPQD 5F7DA 3IKCA 1DBMH 4M62L 3EJJX 4TULL 1AP2A 3QBTB 3LKNB 4MNQB 4M7LH 3EO1A 4LSSH 2FLBT 4U6VL 2IF7A 1XCQB 1RHFA 3X3FH 3KPRA 2BVPB 1YMMA 1JFQH 5J6HA 1N6QL 1ZLUK 2VDMH 1KCSH 2WUBH 2Y06H 3FZUD 2G9HB 3RZCC 2QR0B 3K2UH 5MP6H 2NLJB 4WY7L 2R0LL 4MAUL 4ONGL 1MWAB 1RK0A 3SDCD 4BSWB 4YK4C 4KK5D 3RY6A 1E6OH 3F65A 3QNZA 1CXLA 3DMMC 3M1BB 1LK2B 4Y4KA 4KROC 2EIEA 3W0WE 1I8MB 4UNUA 1W0VA 5CSZB 4HZAA 5J9PB 3MFGB 1CCZA 3QIBC 3TZVA 3UYRL 2D2OA 3B9AA 1IQDA 4EVNB 4P49A 1D9KB 4OM0H 3OAZK 1A6AB 4P3DA 4TNVF 3CFBB 1JTOA 2H41A 2NY0D 1BFOB 2DLEA 4RGNC 1T1YB 3RL2B 2Q3AA 4UNTA 1A1MA 4PJIB 2LABA 2FGZA 3FQUA 2D7TH 3V6OE 4F15B 3MLXH 3I85A 3GJFB 4M5ZH 3U4EA 4PP1C 1J1PL 4HJ0C 1FZKA 4LCIL 1U8KB 5TE4H 4JY6A 2W0PA 5GZOC 4B53A 4PJBB 4K8RH 3TJEL 1KJ2B 3KYMB 2X4NB 5LQBL 4H1LH 1I1AD 1LDPH 3ARTA 2JJSC 4Y5XC 5MEPB 1I9JH 4OZHE 3BKMH 1J05B 4U4BA 1FGNH 1G0YR 4G6AC 3PWNA 3X12A 5LCVH 5DQJA 4NUJB 5ALCL 2GJZA 1WTGT 3VXSA 3HUJF 2V7HB 5DQ9A 5JUEH 4DK3A 1H3UA 3EYQC 1A3RH 3PL6D 5AAMA 4EQ3A 1NBVH 3BIAX 5K93A 3H6JA 1XR8B 1X44A 3VMOA 5L9DL 4LIQL 3MRGA 2BVQA 3F5WB 4Y89A 2YA0A 4AJ0A 3RWEA 4JO1L 3ZDYF 4PJ5E 4NRXA 3N9GL 4YNYB 5F89B 4LVNB 5FOJA 4ZO6A 4JG0H 2F74A 1VDGA 4Y4HD 3ZE2F 3FT3A 1S7SA 4OZIB 4U1LB 1XF2A 2DWDA 1GHFL 3S88L 5TFSH 3ULVL 1MCSA 4PRPA 3VXUD 5KANI 4RBPH 3JV4A 5GGVY 1T1XB 3GSOA 4ODXB 3P11H 3DSFH 1OD7A 4MD0A 4R2GC 1B9ZA 2AW2A 5E9DE 3GMLB 1PLGL 1RPQA 2F15A 5C0FA 1YY8B 4S1SH 3QQ3A 5DJXA 2MOVA 5HVHC 5FK9B 3SE8L 4DZ8B 2QHRH 5FCUH 5IIEB 5JR1L 4YEFA 2J4WH 2YEZA 4DZBA 3TBVA 5F9JB 1CDUA 4LGRB 3HZKA 4KDWA 4A6YL 1WJ3A 4LMQE 4ELME 2LU3A 3P9MA 2PF6A 3GO1H 4XBPA 2EC9T 2F53E 4YHML 2VLME 2PTVA 4M61A 4TSBH 3IRPX 4JFFD 3GMQB 5C0CA 4GAFB 1UACH 5FYJD 5D5MF 3QXDA 3S9DB 4GG8A 1YEHH 4M1GH 4OD1H 5L2KE 4O9HL 3L3JB 5ERWB 1B0GA 4IHOA 3MRNB 1RZIA 2IH1A 2CRZA 3HZMB 2XNAA 2G5BB 4ZXBC 4X9HA 1WZ1H 3QUZC 2A6IB 4IJ3C 2ZUQB 3BAEL 3QCTH 5F6HJ 1NMAL 3RNKA 4BQBA 3Q1SH 1HZHL 1I1CA 2YBRB 1IGIL 3P9LB 4Z5RA 4P2QB 5F7EH 5FCSH 4H25A 2P8MA 5HVFB 3TYGL 3WHE1 2QQLL 1YN6B 3HMXA 5GQBA 2Q87A 5EBMB 2X40A 1CXHA 3QO0A 5E7FA 4RZCB 3V2AR 3T4YA 1ZHKA 3O2VH 1MIEH 3QA3A 2X7LB 5CIPA 1TZIB 5IFAH 1WK0A 3SGKC 5A40E 4X6EA 1S7VB 4AL8H 1AY1H 2APVA 4QRUA 4DEPB 1A7QH 1R3KA 3ARDC 5FFLA 5B39A 1JPGA 2DTML 3KLSA 5D7KE 3EOTL 2XOTA 1WEJH 3HE7A 4JY5H 2YRPA 1CLYL 4R4FL 4X4XB 1FIEA 4UT9H 2F9BT 1A6UL 2VSCA 4OUOA 2AJYL 3V5HB 3OHXA 4HUXB 3VXNA 3D9AH 1TIUA 4NGHL 2XT1B 3TT3L 4PY8I 1NDMA 3NFPA 1J5OL 4GAGH 5CKGA 3DXAB 4RFNC 3QUKB 3ECBA 4GS7B 1BFTA 2W65B 2BY3A 3ZE0E 4QRTA 4TTDD 4X4MA 12E8H 3TO2A 2DF3A 1IAIM 4ZYKB 4LVOC 5GGVH 4HWUA 4QT5A 2E7LA 1S3KL 1NGWB 4J8RB 3SQBA 4XNZB 2EE2A 1M05A 5EZIL 2B4CH 3GSVB 4LGSB 5I1LB 4N5ED 1HH6B 2A74A 5BMFL 2FGWH 4KPHL 5JLZB 3WFEH 3GSWA 1TTFA 4AIOA 4FQHA 4NKDA 4G5ZL 3UBXI 5HYSB 2ZOKA 3IDGA 5HGHA 1S5IL 3BOVA 1RJLA 3CVIL 2A0LC 4IOIB 3L3HA 3OKOB 4NN5C 1SYSB 3GJEB 3HG1E 1NCCL 2I5YH 4FQ1H 4RGOH 3UPRB 1UKQA 1AI1L 2OZ4H 3U9PL 1S7WA 3BH9B 3NCYP 2A83A 1YQVH 1QFPA 3MRBB 3KHQA 1D5IL 4YBLC 5I8KH 4YX2H 1A1NB 1U8JB 4JANA 1BX2B 2EDNA 3SKJL 2WNGA 1T2QL 2EO1A 4XMKH 2RCSH 2IJ0C 2IAMD 2R23B 1DQQB 1V3LA 2HFFB 1HHHA 1N64L 3W0WD 1XIWB 3SHSA 4Y2DB 1UCBL 4PTTA 5GS0D 5IKCB 4ISVB 2NR6D 1QSED 1CQYA 3B8SA 3IDNB 1P4IH 4ZSOB 4FHBD 1WTLA 2EDXA 4P4KA 5EU6D 3VGBA 4JY4A 5IBTH 2VLJA 4BH7B 3BGMB 1A7NL 3BE1L 1EAPA 1DVFC 2KZ1B 1I8IA 1OGTA 2YPLA 2GCYA 1RUMH 5HGDB 3ULVE 3CZFB 2K7PA 1HQRA 1S7UA 3FQXB 2NY3C 1HKFA 4YHIB 1H3TA 1UXWA 3QCVL 2NMSA 4AT6A 5KVMC 1EHXA 3MMEB 4EI5A 3DBXB 2HLFD 1BVKA 1FQ9C 4GMTL 1U6AL 2IQ9L 2XICA 1GGTA 5HHMB 5JA8B 3X13B 4WCYL 2HYMA 3AMKA 4OCSL 2CUIA 1G7IA 5T3XH 3VXOB 5CP7B 3MGOA 1FPTL 4X98B 2P24A 2IADB 5SX5H 5EU4B 3UTQA 4OZGF 4J2XA 4MAYB 4UINL 4N0UA 4U1HB 4NM8L 2RQ8A 5DVOA 1EFXB 4ZFFB 5H35A 1JF1B 5C92A 5EO0A 3RTQC 3IAGC 2Q8BL 1IGJA 4XZUB 4J4PD 4YIQB 1JNHB 3ALWA 4XI5D 3T2NL 5J3HD 1N5YL 4RRPG 1HHJB 1SVCP 1G6RL 2GI7A 3KS0J 1T04B 1DQDH 4M7LT 5DUML 3TVMC 1FRGH 1NH6A 1JV5B 2BXZA 1QA9B 4G8IB 4KWUA 4WU5A 3KJ4C 1CU4L 3FN0H 3LKRA 4PJ5D 4H0GA 4GAJH 1MAJA 1ZGLA 4XCFL 2FX7H 4KKNA 2I9TB 1OTTD 1LNUB 1JRHH 2VXVH 2GY7B 5KZCB 5B38B 4KI5F 1AIFB 3C9NB 4TYUA 3HB3C 1F4WH 3I75B 3ZKND 1JZ2A 1QPXA 4AEEA 3ROLA 1U2HA 2VQ1A 3J8F7 4HH9B 3G6DL 3V0WH 4WV1C 1EJOL 3HCVA 3OKNB 3VXRD 2HWZL 3FQNA 1AO7E 2FX8L 2DM3A 1VFMA 3REWB 5D7LD 2FATL 1DJSA 32C2A 1INEH 3NCJH 3R06B 5I66A 2NX5B 5CBEA 3GRWH 5IW6B 1I1FA 5AYQA 5JDJA 3TPKA 4HCRH 2EH7L 3OB0K 2VE6A 1OWRM 4YGAB 3VFRB 1CICC 1MHCA 5E6ID 1XF3A 4JFQB 4JFPB 4N0FB 1QSFE 5ID1B 4U0QB 4BZ2H 2YC1B 5BS0E 5HY9B 2V5SA 1JHTA 3MV01 4AY0A 4EXPX 1A9BB 3D0VA 4CN4A 4DWHA 3KYKL 1OGAA 3UTSE 1PJ9A 8CGTA 1G7JA 2BOBA 5ECJE 3GB7B 3C5SA 4OZ4B 4DN4H 2VUOA 1IRAY 4OAWB 1AXSB 4DW2H 5IFJB 2EZ0D 5E2VH 1QG3A 3SDDB 1KFAH 5HDOA 3JV6A 4AMKH 3ROOB 3S98A 4OUUB 4GRLC 3F62A 5EZOH 2BSTB 2Q86A 4HJJH 3U2SB