4HJEA

Crystal structure of p53 core domain in complex with dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
200
structure length
200
Chain Sequence
PLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structure of p53 binding to the BAX response element reveals DNA unwinding and compression to accommodate base-pair insertion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 49
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hjeA00
4IBUA 1CO1A 5ABAA 1CMOA 4IBWA 4IBYA 3IGKA 1HJBC 3WTYA 2FEJA 4IBTA 4IBVA 2J1YA 3WTUA 2YBGA 5ECGA 3IGLA 1EAOA 2J1WA 1GZHA 2VUKA 2WGXA 3D0AA 2J1ZA 3D07A 3D09A 4IBZA 5AOLA 4KVPA 2P52A 5AOIA 5LAPA 1HJCA 3EXJA 2X0UA 5AOKA 4GUOA 3Q01A 4IJTA 1E50A 4MZRA 4AGOA 3KZ8A 4XR8C 1H9DA 2IOMA 2OCJA 4MZIA 4AGQA 2XWRA 2BINA 4GUQA 3D08A 5KBDA 2H1LM 2X0WA 1EAQA 2BIQA 2RMNA 4IBSA 4A63A 2AC0A 4LOFA 1KZYA 2BIPA 3US0A 5LGYA 4AGMA 5G4NA 3WTSA 3D05A 3WTTA 2J20A 1EANA 2AHIA 5AOMA 3VD1A 1HU8A 4LOEA 2ATAA 1IO4C 1UOLA 3WTVA 2PCXA 2IOIA 5AOJA 3Q05A 2BIMA 3US1A 2J21A 3QYNA 4QO1B 5G4OA 4HJEA 2BIOA 2J1XA 3D06A 4AGPA 3Q06A 3VD0A 2GEQA 1YCSA 4LO9A 1T4WA 2J6WA 4IBQA 1LJMA 5A7BA 5G4MA 3QYMA 3KMDA 3EXLA 1TSRA 2IOOA 3VD2A 2X0VA 5BUAA 4L18A 4G82A 4L0ZA 3WTWA 1GZHC 1TUPA 4AGNA 4L0YA 2MEJB 3ZMEA 3WTXA 2ADYA 5AB9A 4AGLA 2XWCA 3TS8A 4G83A 3WU1A
chains in the Genus database with same CATH superfamily
3MRIB 2VSDA 4KHXH 2AQ1A 2VLKB 1DBAL 2NY2B 2PABA 3WO3B 1RK0B 4PG2C 5KVGE 4NO3A 1NMAH 2YBGA 4JFYB 1JDCA 4DP0X 4QCIB 3ULSA 5I6MA 2XXMB 1HSAB 2GB2A 4JO3H 5DQDH 4GBXB 3QJTB 1OHQA 4JDVA 2JNZA 5DVMA 1E90A 3LQAH 5E2TH 3D2UD 5C3TA 1YA5A 4A2GA 2YKKA 2YPLD 1HEHC 4MB4A 2A99A 3MLSL 1JGLL 5IBTL 4PGDB 3QEQD 4CSSA 6FABL 3IRCA 4LHJB 4PJHE 1QOKA 3V52L 2Z93A 1E50A 3PV6A 3V0DA 2XNAB 5JIIA 4A6YH 1NFDF 3OAUH 1W0VA 4RBPH 5F7UA 5AKRA 4AJWA 3QUZB 3VXUB 4XN9A 3RGBA 4HJUA 3FF7A 2YUVA 1DVXA 4TN9A 1ZSHA 5CU5A 3KYKL 2K7PA 1V27A 4MMYA 1AOHA 3MLTB 3CXDH 1DVYA 4XWGH 3ZL4H 3IETB 2FEDD 4V1DE 3VW3L 2YA1A 1JXDA 4LNRA 1OIOA 1FZMA 3WKPA 1NGPH 3DYMA 5C97A 2QMJA 1T5KA 1XZWA 1JNJA 4O9HL 3AGWA 4UIKL 4J3XA 1SZNA 1QSFE 4F57H 3UZEC 2R56L 2BS8A 2WZPA 2HJLB 2DWDB 3NK4A 1M7DB 4LLVB 1UJ3B 1ADQL 4NQEB 1HILB 1HU8A 4GW4A 3ULUD 1C5BH 3ZR5A 4AQ1C 3UTQA 2YUZA 5JOPD 2E7BA 5E7BA 4BQCA 1KCRH 5D70H 4UYPA 5FFGA 3U7WH 3QWNA 2JI2A 2KL6A 1G7LB 4BCXA 5K9OA 4JL1A 4JN2B 3ZHLA 4ALAH 2KHAA 4GFTB 2ZOLB 2Y7QA 2VZ1A 4BBWA 5JUEL 1NCGA 3STBA 4AM0A 3WFHB 5T5FL 2YAHA 2D9QB 5DO8A 3TO4A 3GO1L 1VDGA 4X0KA 3GSWB 2GAZA 2N01B 3TJHC 2F74A 3TJEL 1TZGL 2EJ1A 1DP0A 5FYJE 1FL5B 4A1RA 4YDNA 2X4TA 4GQQA 1D5RA 2OX5A 3K6FA 2VLME 3P9MA 2WXIA 5GSRB 2GSMB 25C8H 3LD8B 2BX5A 3PGDA 5IHZB 3QHZH 5GRUL 4H5SA 4X99B 2Q76A 5DLMH 1OSPH 1B6DA 1QSEB 1QABA 1W8EA 4AJYV 1AE6L 3UO1L 2UZYB 3SPJA 2XZZA 1E7UA 1E40A 4X6EB 4PQXA 4Z3TA 1G5AA 1A6ZA 4WJKB 1I4FB 5SWZE 1R3KA 3V6BR 4JRWA 4N0UE 4PS7A 3CPUA 3SB3A 3QZWG 2O6FA 4YWGL 4AC2A 1J5CA 4AZUA 1DQDL 1U8JB 4QIRA 4XN7A 3RGVA 3VFWA 1ET7A 4LK4A 1USQA 4KKBD 1BLNB 5CZXC 2JXMA 3IDNB 4L9LB 4KRNA 4GI6A 2G3NA 2CRMA 4MJ4A 5E0QA 5EZPA 1XGTA 1YJDC 4Q58C 3VXNA 1U8LA 3WG7B 4BINA 3DXAE 1GZPB 2QSCL 3MREA 2XV3A 4C47A 3MJ9H 3OV6A 1BQHG 1JTOA 4J6RH 2BNQD 3RKDC 2IALA 2LU7A 1ETZA 3DRQB 4G9FB 5A1AA 2XKUA 5KYWB 5JHBA 4YE0A 1CE6A 3ZKSD 5CR1A 1T21A 4ETQA 3F64A 3SCMC 3UG5A 4OCWH 4ES9A 2G75A 3W57A 2YAPA 3TO4C 5I1IL 1CICC 1MFEH 1Z5LB 2BSDA 1EPFA 1FNAA 3CZFA 4P57A 1C12A 3ZYZA 4QWWD 2YC1A 3WIFA 3GUTB 1NTDA 1DQQB 3TT1H 3KWWB 5D7SH 3T1FA 3LIUA 2VR3A 5C0FA 2HKFH 4UILL 1KTDA 1G9HA 4TF4A 4XPAL 1JWSB 3DX2A 3VTTA 5A2LH 5IJVB 4YSTA 2Z7UA 2Z65C 4NQCA 3V4UH 4YE4L 3ZE1E 5BJTB 2OSLB 1FGNH 2MKWA 4Y4KC 2OTWB 4PAZA 1PSKH 1UB5B 5DHMC 2YMTA 1KXQA 3D2UB 3VGAB 2YPLB 1RI8A 4JO2L 3FZUC 3WIIL 1GKEA 5E6RB 3PUCA 1I9RL 3EZ8A 3QEQB 3LX9A 1T22B 2XOTA 4MFHA 2OLDA 3RUGE 5C2UB 2W81C 1UB6A 1DBML 1R5WB 3HG4A 1HSBA 3TIEB 3WNLA 1SHWA 4GEJA 4KO5A 4G6AC 1CXEA 2AKRB 1R19A 4ZOEA 5B4MC 3N40P 4LE8A 1RZGA 4LCYB 5E2UH 4XBEH 2AJUH 3GMLB 3M1BB 5SWSA 4C4UA 4OUOA 3D87B 2O61B 2CGRL 3HI5L 1SJXA 2Y9RT 5F7DA 4Z5RB 4NCC1 4NRXB 4U1MA 2F58L 3IJYA 1S9WA 4JE4B 5BZXA 3LN5A 1IT9H 4QTIL 1FFTB 2EDEA 4LPVA 2CRYA 5GHWL 2FEJA 3DX8A 5KW9L 2JVUA 2D7MA 2Y24A 3NJNA 1OP3H 3C6SA 1C16A 2K45A 3HFML 2GTZB 3GI9L 4FD0A 3N0PB 5F1IB 3RU8H 1ORSB 3LQZB 2AK4D 1AHWB 2GSGB 3BT2H 3FU0A 1JV5A 5DHVB 1XZ0A 4TUUA 1CFBA 3N42B 1DVTA 4JFOA 1BZOA 1OAUL 2IMMA 5D5MF 3ARXA 3ZHDA 1F6FB 1QEWB 4JDZB 5EU6D 1ERNA 1CT8A 4CC4C 3MRPB 4HJJH 4TVPL 2V9RA 4AK1A 1RFDL 3R8QA 1Z3GL 2LOEA 4F2ME 4FADA 4ZODA 4TTGA 5IGXH 2VM9A 3PY9A 4KKRA 3A3YB 2OMXA 4FRWA 3HZKA 5JOFA 4JANB 1I9IL 1KJ2L 1PX8A 3HMXA 4PJ5E 5H94B 2CUAA 4MJ2A 4I87A 3RA7L 1GYVA 3ABMB 3Q8FA 2YAOA 1DR9A 4HQQL 5C2BL 1F11B 2F53E 2ZPKL 5IOPB 4MNQA 5CIPB 3NABL 3KVPA 4ZS7L 5F89A 3MRHB 3NN8A 3HE7A 1EGJL 1S9YB 5DTFB 2OMWB 1U8OA 2Z1KA 3RL1A 2EIZA 2NLJA 4PUBH 4ZPVA 2X7LA 5I8OH 4L37B 2HTLC 1SUHA 1WZAA 1Y1DA 2VRAA 3N55A 1F6LL 4AIZB 5BOZG 3HHSB 3BKMH 1OOWA 2HA1A 4LSVH 4TSCH 3VE0A 5T1KB 2QLVB 4P2QE 3CX2A 2IXQA 3DGGA 4JQIA 4P3CH 1HHGB 1N0LB 3PJNA 1IBBA 2Y2YA 4Y16C 5I6KA 4NAMA 4OD3H 2NZ9C 3E6FA 3FTWA 2ZXQA 4TM9A 3K74B 2WYIA 3T0AA 5C0DB 3PWPE 3TFKD 1L6ZA 3IPBA 4H0IA 2WXQA 1YYML 5CLYA 4YHLL 3ARGA 3SDYL 4EEEA 3IT8D 1NCCL 4GQZA 4NFDA 1WBXB 3WNOA 1KWKA 1GSMA 5FM5M 3LSOA 4PY7A 4HA1A 3MV11 4PN6A 5C0GB 2NY3D 1F86A 3MRDA 2EUXA 3FO9A 4RX4A 2LAAA 1PNDA 1Q9KB 5HHPB 3MV8B 1S78D 1E8WA 1BOYA 1KJVA 3BOVA 5KTEH 2WXHA 4FHJA 4OLWH 4KMLB 3G5VA 1DVSA 3ORJA 2X28A 3GMOA 1XH1A 1NGXB 1XB6A 3RZCA 3C8DA 5FAAA 3QUML 1QLEH 3HI6L 1KACB 2AV7A 1Y6KR 3ULVH 1L7IL 2LLLA 4Z7WF 4PY8I 2X1PA 1TU2A 4U31A 4LCUA 3IMVA 5T3ZH 1QFWH 2P7TB 4Z9KB 5JXEC 4HV8A 2XG4A 5ELIA 5MHSD 4GP8B 1TZ8A 3O6FD 4AE0A 2W0KA 1IBGH 1OV8A 5IMMB 4U1KB 1HQRA 2WLKA 2ZCLH 3GJEB 4MGXA 2FO1A 2A74A 5D96B 2IANA 4FI8A 1WIUA 4RGND 4BUHA 3X2QB 4C4KT 5DJ8B 3EAKA 2HJFA 4PHXA 3DX7A 1JZIA 4RZKA 4OZFG 3L95A 4CU7A 5DHYA 5LBVA 5HHOE 2XTLA 1IGFL 1S7UB 1HESA 4NP9A 5LNEA 2FEEI 1UVQB 1IKFH 3VI4B 1MHCA 3D34A 3MLZL 3MU3A 4XPFH 2Z35A 4P05A 2CO7A 1FFPA 1YAIA 2QZ5A 3UGEA 4WWPA 4YSAA 3PHQB 5MEOB 2Q7YA 4GQ9L 3RIAK 1PQZA 4XXCA 1MRCL 1LEKB 1EJFA 4FZEL 3PLYA 4YEEA 3G6AA 2WUBH 3BRFA 4NN7B 4RWHA 5DD6A 3ZYJA 4E9LA 2XPYA 1KFGA 2FJHB 4KJYA 4FAAB 2BMKB 2X1XR 3VCLB 1DQMH 1N6QL 2KQNA 1EXGA 3MRFB 3IGAA 4Y1AD 4POZC 2K9UA 2A3TA 2EIBA 2X2IA 2D0FA 3BPOC 3IN0A 1NSNH 1BFSA 3Q1SL 3C9NA 3EYUL 4GRWH 2OSXA 3U48A 3BWUC 1WAPA 1QQDA 4JFQB 5DS8B 3IPEA 5GJTH 5F9OH 3E1F1 2H32B 5FF6B 4B9JA 3O9WD 4FEMA 3KPNB 5GS0L 3QWOA 4O4YH 2AK4B 4G5AA 2E7LC 1SNRA 2A74C 4MD0B 3DO3A 4Y19D 3L3KA 2C1OA 1KPVA 2A9AA 1GZQB 1PGRB 5EU6B 1BD2D 1ETA1 1NIBA 4OGXL 5I1DA 2ZYHA 1X5MA 4FFTA 1J11A 1AD0B 3RFZB 1LK2A 3UDWA 1H0DA 3PQYE 1NGWB 1PMYA 1G7MA 1XD1A 1ES0B 3IK2A 5DJZB 5JW3H 4GAJH 4KHTH 4MQTB 2X4OA 4HZAA 1W0YT 1GZHC 1LP9F 1SJEB 3OPZL 2JKXA 3MUJA 2E8ZA 5DR5H 1ZLDA 1IM9A 2N0KA 3FUJA 4HGKC 1CU4L 2ZKHL 3QJUB 2CBTA 4XXCC 3ARBA 4ZUUA 2QSQA 3QULB 3FBKA 3FT9A 1ZV9A 4MAUL 4P49A 4PB9H 5AG9A 4W9EC 5L2KA 3L13A 3MLYL 4L1LA 2DI8A 2X6MA 3SODB 5CCJA 2HH0L 4NYLB 5TK2A 1OSZB 2VXTH 2V5SA 1HWHB 1DZBA 4NDMA 4B9GA 4N8VB 4TLUA 5DXWA 3W81A 3HKZA 1MQKL 3OXSB 2J8UB 1J0HA 3L1OL 2WB1A 2J55A 4WFGE 2OA9A 2A9CA 4JFDD 5GGQL 3C6LA 3H3KA 2VAAB 1P5UA 1Z9PA 3SBPA 2CZNA 3WEXB 4FQJL 2DEXX 3T6WA 1KLUA 3LKQB 1JF1A 1M3JA 4XNQB 4M3HA 1MCFA 4JUTA 4W4OC 5BRZA 1MCNA 1JFHA 3O45B 3VRLF 1A7PL 2NY3B 3G6JB 3NESA 1UA3A 3J8F7 4YDIL 4OZGF 4YZWA 3NFNB 2OR8A 4CVXB 4EUPB 2BOCA 1WBZB 2Z64C 3ZT7A 2VMJA 4EVNB 4F2FA 4KQ0A 2X0WA 4NUGH 3W5NA 4GG8B 1HHJA 4H1LB 3SKOB 3GPEA 4XXWC 2D7TH 3UGUA 1XXFC 3G5XA 4A2FA 4D0DA 4ZUSA 1L7TH 3BXNA 3L3IB 4IBSA 4BK5C 3IJHB 4PLJC 2ARJA 1AQDA 2EIJB 4HX1B 3ARBC 2PCFB 5D2NA 5E8NA 1MUJA 4A7SA 4TUOA 4DKFH 2ZNXA 3AG4B 5F21B 2KZKA 3WL9B 4U3XA 4F9PC 3QJSB 5I16B 2OMUB 2ZWSA 3BISA 2Y36H 1BQ5A 2WNGA 1X4XA 3EKCA 2ATAA 1MCHA 4MA8L 3O6FB 2VR5A 3NOIA 5CKAA 3QVAA 2ESVD 3W3BA 2QSTA 4W9CC 1A1MB 2EH8H 1KIUA 2EDNA 3U0PA 4OZHB 2EABA 1KFAH 5ACZB 2AK1H 4TVPE 1RHHA 3FN9A 2Z8RA 3QUHA 4PJAF 4Z0BL 2WTRA 4P5MA 3BVWA 3NH7H 1AXIB 1T0NB 4OUUB 1VGKB 4NGHL 5FXCH 5LWYH 4AENB 2BSEA 3QDME 4FQ2L 1MLCB 1OANA 4TXVB 4F7KA 1TPXB 4OF6A 2AXHA 2UV3A 1YMHB 5LGJB 4PJIE 1BJ1H 4W1TA 3QCTH 4K7PX 4U6XB 3R8BB 4CVWA 2O5NA 1MHHB 4OV5B 1UWFA 3GZPA 4J3TA 4TNGA 1ZANL 3P0VL 1WUNT 3PPSA 4PJDA 4S0SD 4XBPB 1CBVL 1P9MC 2WMPB 1XR9A 1NFAA 4FS0A 4Z7VF 4PJFB 5ES4B 4HHGA 5I0XA 4KI1A 3K2UL 4UZUA 4FG4A 1XEDA 2W0PA 5CSGA 5A2IH 5KZCD 4LPTA 4HCFA 5I1HH 1C5CL 5DHEA 3HG5A 4H44C 3L2MA 1N6VA 1JV2B 4CDGC 3ETSA 4NEHB 1FAKT 2YN3A 1SLXA 2B5IB 3H0TB 3OSVA 5I1EH 5ADPL 3NCMA 5CS7A 5D2NC 4Y1AB 4JKKA 1UTDA 2NPLX 3LZOA 1NKOA 4ZO7A 5F6IB 3TWCL 5JZ7C 3MCKA 4JEGB 2WWKT 5J13C 5L9DH 3B9EA 5CEZE 1C1EH 3ZY7A 1IGYB 2UZIH 2VL4A 2OM5A 1J88A 1WH0A 1NDMA 2G0LA 4ZG1A 4MD4B 3O9WB 3PE9A 2GIMA 3BMVA 2XQYK 1HL4A 4I13B 2LTQB 4ABUA 1HL5A 3MLPA 1YUKB 3TASA 4NQCE 4Y19B 1KSRA 2DV6A 4JO8A 4HS8H 2GT9B 3WFBH 1BD2B 4H8QA 1BM3L 1DDHA 1VLXA 3RVTC 1ULVA 2W94A 4MRBA 4MNHB 4HWNA 1G5GA 4NHCH 1T20A 2V3DA 3X17A 5I0ZA 3UTTE 4GUQA 4Z7NB 1V55B 1HZKA 4GKZA 1PZ3A 2I9LA 2NUTA 1EERB 1DLFH 4FA8A 2V3EA 5HYQA 1ICTA 3O11B 5BQ7A 2VDPL 3T6VA 5C3IA 3AUVA 2NR6C 2RMNA 3UTSA 2DEWX 2CUHA 5I18H 5MEQB 1A47A 4NQQA 4P48A 4MB3A 2CLVA 1RULL 2VDML 2ZCKH 3H9SB 1EO8L 1N0XL 5EUKB 4FERA 3EZJB 5CP3A 3TV3L 4XPHL 4GSUA 4TUKL 5I1LB 4Q74A 4KK9C 3VJ6B 1ZV5A 2CKNA 2Z1PA 5J6SA 2GJ6D 1KNOA 2A9MH 2A9NL 4RRPM 4EAEA 1EBPA 3ELAT 5AOZA 4NKDB 3WV0A 3BUYA 4HCRH 4JCWA 3KEDA 5BVJA 3DX9B 3JWOL 4HUXB 1JVOA 2Z7WA 4JFDB 3RGHA 4WSGA 1U8CB 2AQSA 5EO1B 2CDGB 1A7BA 5DVLA 4LSSL 3K1KC 4BHUI 1YNLH 4PGBA 4CILA 5EF0A 5ANMB 1B4RA 1TCRA 2VDOB 2AJSH 3OJDB 5CZXD 3DMMA 5HHQA 4G72B 5E8PB 3EGXA 3RWCB 1KPUA 2MCMA 3B9KA 5CCKH 4QO1A 4OT1L 4PS4L 3BDBA 1KCVH 1VF5C 2J1KA 3RKDD 5TE4H 3QDGA 1ROCA 4OCSH 4WFHE 3OZ9H 2BSRA 4YC2C 1DBKH 3FQXA 4R7LA 2EDMA 2WXFA 1PKOA 2XN9D 3MPCA 4JFEA 1G9NH 3CH1B 1JWUB 3E3QC 7PAZA 2GC4C 2OPCA 3SCMD 4IDLA 2Y07L 3TO4D 3GMRB 3HZMA 2APXA 1NAKH 1NCAH 4QXTA 3APMA 4LCCB 4ZQTA 4I9WE 2WNKA 5I73B 3GRWA 4NHUA 3CK0H 2PPAA 1IEBA 1KTLA 5FYKH 2WVUA 2Y3NA 4JPQA 1K2DB 4ZYKA 2EDWA 4AYFA 3C8HA 3MGOB 3GLEA 5F8RC 5J6HB 3ZTCC 4G1MA 4BZ1A 1EXUA 2ESVB 2IG2H 2V2WB 1CLVA 3GB7A 3IBEA 4PJ7E 4Y4KD 4Z7UE 3WDJA 4XMTA 5IW6A 3S37L 3F7YA 4K73A 1B0RB 3REVB 2C9SA 5BPPA 3ROLB 1WGVA 5F7EH 3FZUD 3MLUH 3DSNA 2UYLA 4LZKA 3EOTL 2WUCL 2R83A 3IWUA 4I89A 2YSSA 4I1RA 4DETA 3BZEB 4LKCA 4LB8A 3IDJA 4G6AD 2P9RA 5B4MD 3TURA 4ZD3L 2C4XA 1LO4L 1CD1A 3RJOA 5TQ2L 3T4YB 2BCMA 5IMLA 2GFBA 3U4EA 4CSPA 5D7IB 3HS9A 5AZUA 2EIDA 3LIZA 1M57B 4Q6KA 3L5IA 1EAPB 3A67H 5GISH 5BVPH 2YGNA 4LQFH 3VFNA 2RALA 1BGXL 4P2AA 1GVIA 1WE5A 3HUJE 5TJWK 2NMSA 5E1QA 3VFUA 5C0EA 1RZKH 1HWWA 3I6KA 4LL4A 4UAOC 3DI2B 1NLDL 1AGFA 3LKNB 3CXHK 4OCXH 4NO5B 1E6JH 2C3WA 3CZSA 4R5VA 2RAMA 2V9QA 3X1EA 2VSKB 2B1OA 2EILB 2R2CA 4TTDC 1S8DB 4AQ1B 4AKQA 4HF5H 2NY4D 4DVBB 1AGEB 4PJBB 1FL6A 3D9AH 1ZD6A 3VFOA 3QWRD 4U6HA 1A3LH 1PCSA 3ATDA 5EZOL 1RZFL 1IEAA 1KIRB 3VXSD 2A73A 1H19A 4HJ1A 5GSVA 1IAIM 1ZV2A 3WSQH 5IFAH 4ZX6A 4LAQL 3MKGA 32C2B 4MBRA 2EDBA 5D1QE 3GMQB 4XHJC 1YY9C 3T6QC 1DCEA 1CFNA 4F27A 4GG6A 1PLBA 3MHZA 4TMPA 3FULA 3KAAA 5HI5C 1A2YB 3TBTB 5I19H 2X9ZA 3VRJA 1CMOA 1ZVNA 5DEZA 3OAYH 1YC7A 3R0NA 5TE7H 4I0PA 4Y5XA 1HH9B 4Z77B 5SWSD 2ICWB 2ZKMX 5JYLA 4DP9X 4P2CG 2QQQA 3QIUA 4J6IA 3FH7A 2F7OA 2CKBL 3T3MB 1GAFH 3PL6C 2ICCA 2HTLD 2Q86B 3MV9E 4YBHA 4K3GA 5LBSH 1KDJA 1QWHA 1QWNA 2GJ6B 3FB8A 2I07A 1K8IA 1ZVSA 5E8OA 4CGUB 1CDBA 1CZ8L 3IJSA 4PRPA 1R47A 4K94L 2VXQL 3RDTC 4Y16D 2LU5A 5GZOA 4K71C 4WW2A 4IRZH 2DI7A 2NZ9D 1KCLA 3RZWA 2ERJC 5I8EB 3BCDA 3SDXE 1T5XB 4AVJA 4P5RA 5DEGA 4ZTEA 3RPIA 5L7XL 3BKJH 1DANT 4L3EA 5ISZA 4P8QA 2R1WA 4GLRH 2QFRA 1M6OA 2ZD0A 4X5WB 3ISRA 2WC7A 2YD0A 3MNWB 4JFXA 4KTGA 2HG0A 3AWEA 4KKAC 2H8PB 3TNMA 3OC5A 3QUYA 5E56A 4B7IA 3ECBB 5I2IB 4GXFA 5CJXC 4UQ2B 1UA6L 3UBXA 4F7PA 3EGDB 4ODWA 1K6QH 5GS1A 4WEMB 2XN9B 1N4XL 4GXVL 3RVWC 2HVKB 3FCTB 4NZUL 3IVKB 1ZHNA 5EU7C 2G5RA 3SCMB 3S5LB 2JQAA 1W9XA 2IAAC 3BIBX 4KTEH 1HZHL 1CICB 1ED3B 4HEPG 2YBRB 3ZT5A 2CAKA 3MXVL 3AWFA 1DO6A 1JYNA 3KXFB 3OKNA 2XA8L 4Y5XC 3BD3A 1K5NA 1PTZA 5CEXB 4IIQB 2E8YA 1HDMB 2YK1H 3C60C 1PAMA 4UTCA 5LAXB 5FYKU 5JXED 2WBKA 1DVUA 4HWZA 2FJFB 4C8XA 3IF1A 3PAYA 3GSUB 5J1AA 1PU0A 4OFIA 3D0VA 5DJ2B 4Y4KB 3OMAB 1PZAA 1UCBL 4BHUA 4ODXB 4AZ8B 1RIUH 2HJKA 1X6NA 2X6AA 3AUWB 3TJPA 4LCWE 4LO9A 1RUKL 5L8KB 2XVLA 3MROB 1KBGH 3V6FA 4Y2LA 3VXRA 1IBYA 2YS4A 2J25A 3X12A 1KN2H 2XDHA 4BRVA 4HJIA 3AB0C 4FNSA 5J5EA 1Q0XH 3C12A 1FGVL 1KB3A 4LOUC 3WTXA 4C56E 3KPOA 1E4XL 3LNIA 1IBDA 2VDNL 1JPTH 1N5AA 5BRZE 3RNQA 3BH8B 5CBEA 3NZ8A 3MNVB 2MOVA 4E41A 1OT2A 4GAYB 2DKUA 1NDGB 4FFYH 5ITBH 4YHKH 1FYHB 2R4SL 1T80A 2DQIH 3P3TA 4MDJA 3RWHA 5DYOB 4BKSC 4JO1H 3CFDA 1D5ZB 4POZD 5AB1A 1P7QA 3B2PA 5J6GB 3PG2A 5IROC 1CXHA 1MCRA 4N86A 2P24B 3DSFH 3UJIL 3LOWA 2FWOB 3F7RA 3G9VA 1A9VA 3TBVA 4YK4C 4YHIB 3G5YA 4UAHA 3TWYA 4LLAA 2XI9A 3BE1L 1JMXA 1CYXA 1NUFA 4F15C 4J2XA 1E5YA 2R0KH 1NINA 3EADA 2BW5A 1TITA 3NCJH 5IKCB 1HOEA 4JG9A 4M8QB 5ILTH 4BE5A 3U2JA 2GBTA 1U6AH 4PYGA 1U95A 4YZFF 1P6AB 2CR3A 4X9IA 2HFGH 4JLRB 2FTAA 3PWVB 3VXSB 1OLLA 3S3PA 1Z9LA 3QFJB 2DWSA 3G6DH 1T0OA 3V4VB 2A6DA 2BXYA 2VDRB 5C7XH 3I3DA 1F3JA 2AAAA 3CDZB 4XZUB 2AF2A 5FECB 3V6ZA 1XF4A 3S3BB 3RI5K 4KTDL 4MQSB 1ZT4B 2MSPA 3ZDYB 4BSWB 3KW8A 4L5FL 4IKLA 4BFEA 3M1CA 4HK0B 4AGMA 1HE7A 5IESH 1UWXH 2ARJQ 4PMEA 5IK3B 1BBDL 4JAMA 4F7MB 2EQDA 1KLGA 4JZOA 4QRTB 2VCOA 3OKYA 3F7QA 3QQDA 4ZQKB 3CSGA 5CCGE 2AABH 4L4TB 3OB0H 4FXTA 3S36H 4IMKA 1TYJA 2YA2A 4JMNA 2GTWB 4D3CL 3U6RA 1XT5A 5C92A 2XZCL 3PHSA 1O9VA 1UD8A 1TTFA 4Y16B 4X7TA 2CRIA 1HINL 3IFLH 5E6UB 4K15A 3OLEA 4LT7A 2XWBA 1SJMA 4LEOB 3RWFB 1T0MA 3I6GA 5JXAH 2X1WL 4PJGA 5I8CB 1QFWI 4PGCA 2YKLH 1LMKA 2IPTL 1MZYA 5AALA 2EO7A 3BSZL 5I5IA 4H26B 5E6SB 4BIKA 5HYSA 2EKSB 1T2XA 4XI5C 1FF5A 1IEHA 3MUHL 3HMWL 5E9DD 1J9RA 3ZUNC 2Z34A 4ZFFB 1NBCA 2CH8A 4ZZKA 2J5LC 5JPMB 3EFFA 2M2DA 3U4AA 2IWGA 4OLEA 1DUYB 1O7VA 4KXZI 5M95B 5IWLC 1O0VA 2HFEB 2QPFA 4J2QA 4O02A 4PLJD 4IRSC 4Q52A 2QPDB 3RWIA 3NVQA 3ARBD 5FYLH 3ZTJG 1NMAL 4X7DC 3Q3GA 4UBDC 5F7MC 2CBQA 1HNYA 4HUMB 5AW4B 1MI5A 3X13B 1DQJA 2BVQB 2Y7LA 1FH5H 3HAEB 1E43A 1RJCA 5JW4Q 3LQAL 4FFVC 5FS5A 3FXIC 3AW5A 5TDOA 1D6EA 2B39A 3FDWA 3F7VA 4B96A 2X9YA 4K3JH 5BMFH 3MRQA 4F33B 2V7HB 4MJIE 3D51A 3KPSA 4JHZA 2W9LA 2XY1A 4MZIA 5E8DH 1YN6B 2Z9TA 3EHBC 3I9GH 1C5DA 2RJMA 3SGDI 1SBSL 3DGCR 3VSQA 4RWYL 4Q56A 4WFFE 4QI3A 5EC1B 1P2CA 1S3RA 2FT6A 4F93B 5EZIL 2DYSB 3AT9A 1EJOH 4TQEL 3VXOB 2NZIA 4LGRB 2YZ8A 5EBMB 1F2QA 2IO5A 2XPGA 4RBPK 4YNYA 1OCCB 1NAML 1MCPH 4N1CA 5DF0A 1T1WB 3ME0B 3PWNB 3QO1A 4XO9A 1VPOH 5D1ZC 1I8MB 4PFEA 4MVBC 4PJCB 1BZ9B 3FCBA 3JV0A 4GIAA 5CKGA 4TVSa 3KH3A 5JQHC 4XGZB 1TEFA 5AVTB 3M07A 5KANI 3U0WH 4QYOA 2RQ8A 4F57L 1X5AA 3ECVA 4XRCA 2Y1VA 4N2MA 4WI2A 5BO1L 3V2AR 4E5XA 4U4IA 4YHMH 1ZA6B 4B9ZA 1A6TB 4UB0L 2OMZA 5HI3C 5JZ7D 1PX3A 1D2OA 1T6BX 1IAOA 4O2EA 1FSKC 2PYEE 2CO6B 4D2NA 3BIKA 1TOXA 5BZDB 2VMCA 1N10A 3IB4A 5IMOA 3U6XS 2XWTA 5EDXA 4ZOBA 3O6LH 3PFUA 1KYUA 1WFUA 5HYIA 2VJ0A 2EDDA 4WU7A 5CO1A 5LXGH 4D9LL 3AGVA 3UZVA 3N1MC 1A3ZA 1XX9C 2RD0A 3CGTA 3MACH 2OXHB 3QS3A 3K4AA 3RVTD 4M4RB 3S8WA 3HI1A 2BSED 3KPPA 3S35L 5B1JA 2C9VA 2EDRA 2JIXA 5M7QA 4FCAA 4YPJA 1ADQA 3IAQA 3ESUF 4PW4A 3MA9L 5E23A 2HRHA 5ALBL 3U9UB 3I02A 4IBUA 2DQDL 3FB5B 3OSKA 2W65B 4P0DA 4YHPB 3LB6C 1U8QB 4HIQA 1U4EA 1KGYE 2FJUB 2NR6D 1EDQA 3M7FB 3ZDWA 5I1CL 4H8WL 4Z3JA 1V05A 1UXWB 4HZLB 5KYNA 2OK0H 5E00A 4LSTH 1RH8A 3GXMA 5T5FA 4AY0A 3SOTA 5F9AC 1F4XH 4ZDHA 1R1CA 4KK9D 5DHDA 5H37A 1UM6H 1OEZW 2HAZA 4QT5B 1OOAA 3RAJL 3FQUB 4ODVL 1AC6A 5LB1A 2H3NA 5I1JL 5DZLA 5FA4A 5JW4N 3BVXA 3PRZA 4OI8A 2DQUH 5EEXA 4KQ3H 3S7GA 2WINA 3P4NB 5AVXB 4BFIA 2HT2C 5DUBB 4BD4A 3STZB 5EEWA 1QTPA 1YEGL 4OCWL 1MOEA 1PG7H 1MW0A 1GR7A 3AS3A 3Q6FA 4LLYA 4PYHA 1WA0X 5DJCA 5FV2A 3PDOA 5HYJD 1VFAA 5B1JC 5HDRA 3D85D 5E9DB 1LYQA 4JUSA 1P84K 5L2JB 2XTJC 4L1SA 1VGEL 1OD9A 4X8JA 2O5YH 4XC3H 3CFCL 4UV7H 4WO4A 1ZLWK 5FC9A 1P1ZA 2A6IA 3UEZA 3DVNA 2FH6A 4KH9A 4LRIA 3PAZA 2FH8A 1NGYB 3FHEA 1PSKL 4W9KC 1N3NA 5IEKB 3SJVD 1BX2B 4ONGL 4U1NB 2R69A 2FIKA 1DLHA 3BHBA 4MYWB 2BSCA 3EDEA 5GRXG 4ELME 3WS6C 5T3XE 3MODH 4QRQA 3N9GL 1TQWA 2C3GA 2FL5A 4L8CA 3RBSA 3AABA 3LZPA 3DGDA 3LNGA 3L6FB 1MCOH 4PV8A 1H15B 1OGPA 4DEUA 5C07D 3MV7B 4E0RA 4DOHB 3BWUF 3IE4A 4AW4A 2DQGH 3UJTL 1QSZA 2NT1A 1CE1H 5JPNA 2FBJH 3MBEA 3H3PH 4A68A 1LO0H 4LSRH 5EOTA 5FA3B 4XN5A 3IDGA 1ET8A 4ONHA 5KSBE 3KPQB 4UUJA 1ZAGA 3NIDF 1I85A 1QO3A 3UTZA 2AMUA 1KN4H 5D7JA 1R5VA 1SXSA 1RUPL 3WAJA 2B2XL 3AG3B 3O6MH 4V11A 5FKPA 4OJAA 2EDXA 3DV4B 1JZDC 4P9HL 2ARJB 1FFNB 5D72H 5GJSL 3RU8L 1FA4A 4S1RL 4P06A 3EJCA 1AQHA 1TR7A 3KPMB 4W9HC 3AY4A 4NNXB 4KI5C 5J13B 3B2VL 4DGUA 5A40E 1J5IA 4M1DL 4F8LA 3RTQC 1FAIL 2XY2A 1E4HA 2K6WA 4XP4H 2V3FA 1JFQL 4AITA 3C09C 4HJJL 4UCFA 4OCNC 2H26B 2DBLH 4TTDD 2WLHA 3EYSH 1FVDB 3IWVA 1KIUB 3JV6A 3KS0J 4XNAA 1O5DT 3LKOA 5D7LD 1CL7L 2VRKA 2V9UA 3HZ3A 1EVTC 4LEXH 4U1JB 4CADB 3PIQA 3Q43A 3RHWF 1KBBA 4M6ML 3NCYP 2HLAB 2YAFA 3WY2A 3CIQA 1BAFL 5K39A 3CFTA 3KPLA 3MCYA 1YEFH 2R4RH 4RMBA 1TENA 2ZAHA 4I77H 3LNDA 3UYRL 1WK0A 1JWMA 1QFUH 15C8H 2F5BH 1DVFC 4L3FA 3BD4A 3AROA 4R4NC 3WKQA 5CD3B 4XHJD 1YY9D 5E08H 4O51B 3JTTB 2NNCA 5HXMA 4YSRA 4L3CB 5I8OL 3FOLB 4JE0A 5HI5D 3QO0B 5DZVA 5D1XB 4X6CA 1J1OH 2XUWA 1I85C 4X9HA 4P3CL 5FO9B 1YSOA 3FF8A 4D9QD 2PWFA 4E9VA 1TQSA 4U6YB 1CQYA 5FX3A 5IV2B 4PGEA 3OGCA 5CGTA 3PL6D 1S5HA 5K5YA 1QKZH 3JWDH 1TCMA 2X4QA 2BFVH 4XH2B 4KO9A 4OTXL 3U83A 3OMZA 4XNUL 1XAUA 1NDTA 3QIBA 3QJFA 3SPVB 1TETL 3DWTA 4WDIA 3RDTD 4JY6B 3X1GA 3ZPDA 3NIFE 1LK3H 4XAKE 2VLRE 3TF4A 1UQSA 5HI4C 4ZUTB 1EGJA 4XMKH 5EA0H 4EIGB 3GBMH 2WZAA 2V5TA 1R33A 4GS7C 4DGYH 2EDOA 4QUOA 1A8JH 5KTEL 2VLJD 2ZXAA 4AGNA 5IB3B 3HCVA 4KKAD 4Q0XH 1U92A 4PRAA 3TBYB 4G6JL 4NT6A 1NPJA 1FV1A 3QBTB 3BC9A 5HYJB 5IM7B 2YO3A 4YC2B 3D85B 4WENB 4Y8AA 1U8IA 1QZNA 4OM0H 2QV4A 4Y4FC 3RVWD 1E9OA 3JWNG 4JY4B 3VX1A 4J1UB 3D69A 4R3SA 1I7UA 5DFAA 2XX1A 3GBDA 1EEYB 4QHUA 2K3HA 4K5OA 2DWEA 3BP4A 2D8KA 3EYOA 4MXQC 3WNKA 4Z7OB 4NQVB 4KX9A 3ZDXF 4POUB 3QDJE 2OXGA 2DDQL 3IJ7A 3GQFA 5JOEA 1PZUB 3C60D 4K2UH 2MCAA 4JKPL 4UT7H 1U9KA 3R06A 4ADGA 2O6CA 1I82A 4AT6B 1XGUA 1XCTB 2BC4A 3N2JA 4KNUA 5BRPA 3S8GB 1R0AL 1OGAE 4Q14A 3QUMA 1YEIL 4FLHA 2DWXA 4NN5C 5HYSG 5ESAA 3VYPA 2VIRB 4NQDA 4XPFL 5ETUA 3FB6B 4N0CC 4NENB 4J8RB 2TRHA 3AY2A 1ZRUA 4PJXE 2W9DH 1LWJA 1EFQA 1GGTA 4PV1C 2W1NA 3WEBA 4V1DD 1R3LA 1Q0YL 3FCSA 4P2OA 5C07B 2QR0B 3DPBB 1I9EA 2B1HL 3NEEA 4PRIA 4WY7L 3ZJAA 2X4PA 3RBGA 3EG9B 5GGTH 2NQCA 4LOUD 1PJ9A 5KVEH 4LVEA 3FH8A 3NAAH 1QSFD 2OMYB 3HNSH 1CFTB 1FO0B 1M1XA 2NRDA 4U4BA 2C1PA 3G5ZA 3P9LB 4W6WB 4ANUA 1MFCH 3RY6A 1NUGA 2W60A 1PKQA 3QUKB 1NSNL 5J12C 2BNUA 4LSPH 3V0VA 1MFDH 3A6BH 3O0RH 4HGWA 3VDCA 3LHPH 5DRZB 2XQBH 5HDBE 2VR8A 1F90H 4KVCL 3ROOB 3FRPB 4C4KO 5F9OL 4ODHH 5ICXB 1E9QA 3CVHB 3L17A 1JNHB 2K78A 5IROD 1DVQA 1X5JA 4GSDL 3QG7H 3ZRCC 8PAZA 4IM8A 4P99A 1S7TA 1IU1A 4U1IB 2Z4QA 3QNZB 5DJXA 3SPGA 4PJDF 4UAOB 5C0AA 4DKEH 1CLYL 1U91B 2DIAA 5IB1B 3BEVA 4ZYKB 3QEGH 1LEIB 2NOYA 5JDSB 3HPLB 2HZHA 2O5ZL 2QVIA 1MI5E 2QDWA 1OF2B 4GAGL 2CM5A 1RK1B 5GGUA 3I84A 3O8XC 5D7LB 5JW3L 1WIOA 4GAJL 4TOYL 5FGCB 2PTTB 2OW6A 2DYPD 3ZMEA 4PI2A 2VLMD 4DN4L 4UANA 2G60H 5AFAA 1LMIA 3VXRD 4L0PB 5DR5L 4X4YB 1MCWW 1E2WA 4BSJA 3CHRA 5A2JH 4FFZL 3QI9A 1R6VA 1RURH 2YSSB 1G6RB 3OG4B 1NCDL 3MAWA 4GO6B 4ICXA 4L4VD 1GY2A 4PRDB 4Z7AA 4G7YH 1MJUH 1M05A 2QPUA 4RQQA 1L5GA 3MLXH 4YHOH 3PV7A 2VXTL 3FAWA 5LCVL 3N44B 2J1WA 4PSPA 4UM8B 3BEWB 3OBAA 4JRYE 3TYFB 2ADGA 3QQ3B 4GJTB 1M2OA 2IH9A 2PR4H 4G7VL 1DBJH 3QQ9C 2KT6A 2A0LC 4IKJA 3VFMA 1ZTXH 4UDTA 1J10A 5SX5H 3G08A 3PL6B 3DXAD 3Q9PA 5ALCL 1OB1B 1P7QD 5EU3A 2R1YB 1WCBA 1ZS8B 4GI9A 1N26A 5LJYH 4YHNB 5CFAA 3EO0A 3RDTB 4LSQH 4K71B 4XVJH 5E6IC 1YMMA 2ERJB 3B2UC 4XNMB 4Z3FA 5F3FA 2OR9L 4Z7OF 5JO5A 2EDLA 3OXRB 2GSIB 4FQXA 1I8LC 1Q90A 4N9GB 1PZ5A 1Y1UA 1P4BH 5DJYA 2VLJB 5IVXA 1UH2A 2WANA 2I85A 3D3VE 3HKFA 4HC1L 3PU7A 1TKWB 3EH2A 1VADB 4I4WB 5KVFH 5DC9B 4XI5D 3O41A 1S3KL 2JE8A 2DMKA 4OSUH 4A63A 2HSIA 4RGMC 1YUHA 1UOWA 2BVOB 3UIYA 3BN3B 3EDDA 1J9CT 4KBPA 5H37G 1JK9A 1O9WA 3WEOA 5AB0A 4NXKA 1IAIH 2OMVB 2VC2L 4YDKH 3ZDZF 5HGHB 2XCMC 3QA3A 2R2HA 4WHTB 1NBZA 2FR4A 4IRSD 2WOBA 3RX9A 2DTML 5I8KH 4QF1A 1NIAA 3JVGC 3AQYA 2KMWA 4NC0B 4H0LC 3WMPA 4UBDD 5C09E 3SKNB 5DWUL 2KQMA 4NFBA 4JNXA 4P9MH 3T0EC 3VXQB 5B1AB 3C60B 5J56B 3UGXA 3MRLB 5BZWB 1SVZA 1PL3A 2AK1L 2P45B 2X9WA 4FFVD 4PJHB 1V54B 3OKLA 4QRPA 1ORQA 2ZZUT 3FB8B 5GZNA 4ENZA 4LHQB 3FCGA 5LWYL 3P77A 1RMFH 2KERA 4GRLA 3N0AA 3IJEA 1KJMB 2Y7SA 1U42A 2IDSA 4MSWB 4ACPA 1S7VB 3QJHB 1J1XL 1R5IA 5I15H 1QLRA 1DBBH 4HKZA 1RUQH 4NPYA 4LU5L 1JUFA 3EHBD 4FL4C 4KV5F 4HAGA 4P3DA 4CKQA 5JHLL 2NQ3A 4XC1H 3PWJA 4V1DB 3DJRA 4FABL 4M02A 3AB0B 2WZ5A 2EYTB 3D52A 4G1EB 4L8SC 4YEFA 4U1LA 3F5WB 3MRCB 2WVVB 3PUUA 1NEZA 1AXSB 3MJ8A 1J9TA 1PEZA 3BP5A 5AVSB 1QSFB 2GIYA 2FX7L 4MA3A 3VMOA 5I1EL 5D1ZD 3KR3H 3VD5A 4MVBD 1GC1L 4TL4A 2IQ9L 5BV7H 3QC6X 2EVHA 3CCHB 1FVEA 3QZLA 3SIKA 3ZQ9A 1XCQA 3LRKA 2VDKH 4RFNC 4XAWL 3ECUA 5L9DL 3U25A 1UD3A 1R3HB 4HWUA 3QJXA 1JP5A 1AS6A 1XL4A 4J3BA 5D6DA 1JGUH 2Z8WC 1SLUA 2B59A 4QOKD 3MRNB 4DESA 3D4CA 1HYSC 1H8OA 5HI3D 5F9JB 5JORA 1ETB1 1U93A 4X4XA 3N44F 4YK4B 2BP8B 2SEBA 5D1QC 4PJ5D 4B50A 2WBJA 5CJOH 3BAEH 4ZO8A 3KPRE 3WFBL 4DQAA 3PNWA 1KB5B 3MGTA 4WRLA 4F15B 5LNDA 1KEGH 4NHCL 5C9JA 1IIKA 3MBWB 1K8DB 3MUGA 5KWYC 1XF5A 2F53D 1MREH 3HC0A 4WV1A 1DLFL 5FHBL 4DT2A 3QQ4A 4CVZB 3CVDA 2QHRH 3KPSD 3MN8A 5HHNA 2DYPB 4N20A 3HJ0A 3SKJL 2EDFA 4UI2A 5DHVH 3Q2VA 3PJLA 1E6OL 2XJLA 3H53A 1H3PH 3ULVE 5T5NF 4G8IA 5I18L 4ZW5A 5EFIB 1OCRB 5T3ZE 3FW6A 3HW7A 4L4VB 1EV2E 2AMGA 4KTYA 1ZXKA 2WWKO 5SWZB 2G5UA 2VERA 3LB6D 2MTAA 4N0UB 3FQTB 3A6CH 4Q9CA 2Q8AH 2XBDA 3PWPD 4HWEL 5KSVA 1UM5H 5E6ZA 1A1NB 3KL0A 2RH0A 3P73B 4HCRL 2MIZA 1AKJA 4MBOA 5HYEA 1KBKA 3DVFA 5L4FA 3MLWH 4HVBA 2NXZC 3QORC 2GJZB 3IDMA 2X3AA 4CMHC 4D7BA 2HFFB 1GOFA 3DXAB 5CIPH 4JHWL 5HHVH 4RIRA 5D2LA 4Z78A 5GPRA 2YD9A 5EUOB 1WO2A 4BUGA 4OLZL 4KNQA 1JPGB 2EIEA 5IG7B 5DRWA 2ZX5A 1FG2B 4GG6F 4TSBL 1FH2A 3VD2A 2N7AA 1TSRA 1LEGB 2ORBH 5TF1L 1S7QA 5CCKL 1GCYA 1K9TA 2RA1A 3OTTA 3K6SA 1CDJA 1CG9B 3NP3A 4NBYB 4G82A 5KS9A 3CSBA 2HLEB 1NL0L 3P3UA 3QZWB 5TE4L 1M7IB 3SQRA 5K9JH 2YXWA 1V7NH 2HT2D 3OZ9L 2X53A 1DBKL 3B7UX 5LBSA 4TL5A 3S3DB 3OQRA 1YPZA 4DGIH 2G9HB 4KJWC 2FZ3A 1BEXA 4R4BA 4TLTA 4Z95H 3SBQA 5KANG 4WU5A 3RY4A 1CXLA 1HYRC 1HKFA 3K7UA 5DD1H 3B3IA 3V0FA 1FZJB 4NOBA 1LDPL 3U2SB 4F3FA 5EIIA 1FNEA 3QEHA 4I3RL 2JIXD 1T66C 2OL3B 5G5DA 4EZJA 1NC4D 4IBVA 4L2YA 4WW2F 2BNRA 1JRHH 4JPKL 4CSZA 2J5LB 4GRWE 2XHNA 2XTJD 3ZE1B 4PJEE 3CK0L 5F9DC 3L3OA 1YVLA 3OM3B 2ITDB 5KYYA 2OJEB 2J6EL 4G7RB 5FYKL 4TNEA 1G6VK 1QMUA 4IRSB 4WI0B 2XWJA 3NSXA 3FC8A 4OQTL 4U3SA 1D5BA 4FC3E 3S5YA 4OBRA 5AVUB 3IS0X 4X4ZA 2L8AA 1IX2A 1MFAH 3ARDC 2H4EA 5HHOD 2IG2L 4U7SA 2GI0A 2B9AA 3OF6A 2EUVA 4B53A 2P8MA 4FZ8H 4BH8A 2WXNA 1W72H 2X4NB 4X7SH 3RUGB 4FNPA 5F7EL 2Z7YA 4AMWA 1IM3B 3O2VL 3MLUL 2AEQL 5CN1A 1DDTA 1RZIA 2ENSA 3LEYH 4Z3EA 7FABH 1ZLSL 1RZ8A 2O26U 4G43A 1QUNA 1EZUA 3DLQR 3U1SH 4FNUA 4DP7X 5AAPA 1LO5A 1KULA 2OW7A 1GYCA 3AS1A 3GJFH 4HDIB 3QXWA 5LG1A 4N2HA 4G3YH 2GY5A 5DMGC 2DQJH 4JRXE 1A6PA 3KDMB 1T0MB 2J2ZB 4MX7B 2X88A 2WLIA 1NCNA 4KKPA 3B9AA 4Y5VA 1JHLH 2NY7H 3KWTA 1DFBH 4WHDA 3JWOC 4CC1A 4JGNA 3SJVE 3T5WA 5EF3A 2R23B 5D1ZB 1PLCA 3F00A 4K5MA 5ENWB 3AG2B 1MJ7L 4AMXA 3IDYC 3ZTNH 2UY7B 3LRSA 4Y1TA 2DBJA 3BFWA 1ZY9A 2BIMA 3OKOA 1K4CB 4LRNH 4LF3B 1KGUA 2YOAA 4MWFB 2ICEA 1E6JL 4FOMA 4Y5YA 4QOKB 5L0QC 4HJEA 3CSYA 1GGIH 5F0JB 1E4WH 2FK9A 2VXUH 4KI5D 1WICA 3OKDB 4H25B 4HF5L 5FHAH 1FSKB 3PQYD 4F2MB 3RTQD 3W37A 4IOIB 2NNAB 2ZUYA 4P5SA 1A3LL 4PJ5B 2EYSA 1WCQA 2R9HC 4GI8A 4DZ8A 1FFOA 4XMLH 3GXPA 2HUHA 4RDQF 3Q8EA 1JXJA 2AJ3A 4N2GA 2JI3A 2F53B 4DKDC 4BQ6A 2XFXB 4UF7C 5DU7A 1M9SA 2P80A 4N87A 5EUOF 3B37A 1Y18A 4I7ZC 1RKRA 3T8XB 4APXB 2O6DA 4ELKA 5E94A 3VRIA 1GGBL 3QXAB 3KW7A 4IBTA 3S2CA 3OGOE 1YN7B 2BRRL 1NPUA 2F7QA 4R4ND 4P2QB 2C3VB 3GWJA 3OAYK 5IB5A 3FQYA 4EDWH 2RGSA 3ZRSA 5F1KC 2JKJA 2PP8A 4HFUH 3KLKA 4A7QA 1GCFA 2UVFA 3PWPB 2FSEA 2IDTA 4PTTA 4K9EH 1G1KA 4NUJA 4MA1C 4KVPA 1E9PA 4IRZL 4RVBA 3HPJB 4L23A 2IFFL 3NJVA 2QDVA 4M1GH 4ODSL 1WRFA 1T1YA 2CDFA 3P4LA 1RP9A 3S5ZA 3TA4D 4QRSB 3CE1A 2IBGA 5LKNA 2CE6A 4E9WA 2CGZA 3DO7B 5J8OA 1CDIA 1WPCA 2R0ZL 1IAKA 1L3WA 3CDYA 1X4ZA 3BUDA 2CKBA 4OJDH 1ASOA 2WB7A 1DTUA 1S46A 3H7BB 1K6QL 1J1PL 5C0AE 3KCWA 4OFPA 2Q1EA 5EN2A 1OW0A 1L0PA 3OMNB 5LUMA 1TQBC 5D71L 5ESQB 1U30A 4O2FB 4P5KB 1H8NA 1FNLA 3NMEA 2UXGA 1ZK5A 3ELQA 4JREC 4KTEL 2FJSA 2KDYA 5E9NA 4YSQA 4M48H 1GJUA 1UT2A 3BH9A 3D05A 1NC4B 1SYVA 3GIZH 4HUWB 5DCCA 4Y4FD 3RX5A 2Y5TA 1KYOK 1A6VH 2XTJB 2DMHA 2YK1L 5J4MA 3Q8CA 4DW2L 2HRGA 3X3FL 1I7ZA 4I3SH 1PD1A 1T1XB 4GW5B 4FG6C 4PJGF 4TVPD 4H1LH 3WMSA 4MXQD 2QV2A 3FUKA 4IRJA 3VWJC 2Y25A 2VQ1A 2CUIA 3QDMD 5HHOB 2X42A 1MCWM 4HIEB 4AOFA 1WISA 3UC0L 4QRRA 1TTBA 2P5EA 1E27A 4RAVA 2C9AA 4A2DA 1A7RH 1T4KB 1CDGA 1I1YA 5AG8A 1KBGL 3QUXA 1R3JA 1Z5YD 2XIIA 5HVWA 1AMXA 3QPXL 3QIBD 5DK2A 4I9XA 4HPOL 5HPOA 1RP8A 3C75A 4Z0XB 1IGIL 1U3YA 4NQXB 4R90L 2OTUB 3LV3B 4N0CD 4XMVA 3O3DB 1MRFL 2YEVB 5CCHE 3SGKA 4LEEA 3L4UA 1CFSB 5CJ5A 3MCLH 1JPTL 2A6JA 3FU6A 1YMME 4OZ4B 4UWQB 2AV1B 4K94C 1EO5A 5CWSB 5HPMA 2IPKA 3C5ZC 4EIBA 5A6MA 4NSKB 2A4EA 4MD5B 5F70A 3TZVC 4GXUM 5KN5A 2ZF8A 3RG1C 2BM3A 4Q7DA 2CBOA 5ERWA 2XKNA 5IVXE 3U4KA 4DCQA 4RDBA 3U2IA 3JYBA 5CZVH 1ML0A 3K2MC 1M71B 1ZT1A 3DSFL 1OALA 3TV8A 1Q9WB 4ODTH 2NUPA 3WUZA 1FYTA 1J9SA 3IAPA 4NNPH 4NP4H 5AOIA 2CBPA 5IZ7A 5J1TC 2ZG3A 2IH3B 4UTBH 2F6AA 2X0UA 4GQRA 2NW2A 4DN3L 5I1AA 2BVPB 4MYPA 4HKXA 1ACYL 3A21A 1KTRL 4QHMB 1AO7E 2F54E 2BSBA 4FYRA 1F4YL 1JI1A 1OLZA 2C3HA 1T3FA 4L05A 1FZKA 4QHKI 4TV3A 3UTTD 4AXWB 3BVNA 3PQYB 3RTQB 1U6AL 1N70A 3LRGA 3RJDA 3RWJA 3IXTB 4MCYA 3SD2A 4I0KA 4APQC 3C8KA 3QUXC 4LVNB 3C09B 2D03H 2HFGL 4UNUA 4BWTA 2UWEA 1KCUL 1A8ZA 2DMBA 1MCSA 3MRRB 1NEZG 3P69A 3G6DL 4DK5A 5JQ6H 3O8XD 2BIQA 3GSOA 5C7XL 4LLUA 1CLCA 5FLVA 4EN3C 1WZ1L 1JNLH 3CLFL 2VJ8A 3ILQC 3MRGA 1X7SA 3GSQB 2C7UB 2B4CL 4H2CA 3SGKC 4FG2A 1NA8A 4HSCX 4LSDA 4DP4X 2KLRA 3REWA 1J8HA 3FTUA 4K8RH 5LGYA 1NKRA 4PRID 5KBKA 5IESL 4PJ9A 1VCBC 1DVFB 1HC1A 2QGDA 1MHEB 1W0WA 4KDTC 5FYKE 1WBYA 2AEOA 4UIMB 2OP4H 1T5WB 4FQLH 3CZLA 3V4PB 3STLA 1QFHA 3HRZA 3G04A 2ID5A 1GHFL 4MNGB 4UNIA 1JHKL 2YXMA 4HJ0C 4HMDA 3S36L 1UWXK 1NWPA 1EWHA 2CDEB 2GJPA 3V0HA 3FO2B 2MCPL 4U6TA 1BBJB 3QQ9D 3FFCD 2A0LD 5IB4A 1COBA 1JPST 5DJ6B 2DPKA 3IKCB 4L29B 4RFOH 1GRWA 3LXBA 3OB0K 4WJG3 4AGPA 4HXAH 5CBAA 4H8UA 2X4SA 1EMTH 2F19H 4JHAH 1BV8A 3VH8A 2V2TB 5F7NC 2HX8A 4AV0A 5CUSH 1OAQL 3X11A 2ENJA 4K3HA 5JXAL 3DUUA 4L18A 4NI3A 4WFHD 4NZRL 2YKLL 4FKKA 5E6ID 3IGFA 3B2UD 4U1HA 1EK3A 2QKSA 2ALAA 2VN4A 3BGFC 4KKNA 5I76A 4HEMA 2VKWA 3ZE0F 3WY1A 4R5TA 3H2WA 2DLGA 2MPVA 3FQNB 2UVEA 4GS7B 4ECNA 2XBTA 5E1GA 3B1TA 5FUCE 5GGRY 4BQBA 3MOBH 4ZMWA 3RWDA 4XO4A 5T33H 1P4LA 1CR9H 4I9WD 5EBLB 2F2HA 3SY0B 2VDOH 5B38B 3IFNH 1B6UA 2ZXBA 1XWVA 4XP6H 3PDGA 3QI9D 2GUOA 4LSUH 4Y4FB 1TYEB 1I7TB 1QLFB 3BSZA 2XYBA 3GZKA 3L1GA 1IKNC 1QYGH 4NIYE 1ZEAH 1AZVA 1F2XK 5I24A 1P6FA 3OKEB 3QDMB 4R7VA 3T0ED 4PJ8C 5IQLA 1KCKA 2ZOTA 3FCUB 3H55A 4YGVA 4LIQL 1KJ2B 4PJIB 4AYMC 4NZDA 4MTMA 4NN5B 4OCYH 5EU5B 5DURD 5CLZA 5AL8A 1JHTB 1KXTA 4Y89A 2X4UA 5EIIG 3PABA 3VXTB 3VNYA 1MCPL 2YD3A 1QWUA 2XLLA 4FULA 5A16A 4IW4C 4J23A 3DX1A 1MWAH 1VHPA 4KI5F 2APBA 3VFGL 4E42A 4NC2B 4JM4H 43CAA 4GSXA 3L08A 3FOMA 1OM9A 4G8GA 4WWKB 4TQ8A 4PHZA 3FNKA 3U0WL 4AV5A 1YEEL 4K3EH 3NSDA 5B3NA 1S7SB 1A7NH 5KUMA 3BUQA 1BIHA 3BP7A 5GRJH 3ETBJ 4RAUB 4XBMA 4KMTL 5J12B 2GCYB 4D8OA 4Y88A 3U79A 3DBXA 3KBPA 5JYMA 2R0WL 4N0YH 2BNRE 4JZNA 5AAWC 3GHBH 4OZFH 1I1FA 2NY0C 4JFFD 5ITFB 3WIHL 2BP0B 4YBLC 1HYSD 1UD5A 3SE4C 4QHLB 1PDKA 5E1IA 3TX4A 4J3OC 1BVLA 1N19A 4Y9FA 3UTTB 4FF9A 4GFXA 1F13A 4WTQA 2FB4H 5D1QD 3VMNA 3LXUX 1MXGA 2E9BA 2Y4SA 3DARA 5KJ4A 4LNVA 3M17B 3A24A 2D31A 1NJ9B 1EJ8A 3QEUA 1FVCA 2GK2A 3T3PE 5FWQA 3V0WH 2BWQA 1Q94B 3NRQA 3O8XB 4OIIH 1ZHLB 12E8L 3W9DA 5B1BB 3KBHE 2CPUA 3KJ6L 3WGVB 3LQAC 2L7UA 5I28A 3FT2A 2AI0H 5GRWA 3MV9D 5E9AA 5F7LB 4MDIA 2EEXA 2Q2LA 3FN0H 1JCKA 5DDHB 3CN1A 1T04A 2NTFA 3UZQA 5HJ3A 4LSTL 3P4MA 1IE5A 2ITCA 2VITA 3BPCB 4XBGA 1UM6L 3TFBA 1QPPA 3V4VL 5HDQL 3TPUB 2VDRL 3GSXA 3S4SB 1BA9A 3BW9B 3HHRB 4JQVA 1I7RA 8FABA 1IRAY 3FFCB 4H4NA 2MTPA 1MEXH 1NZRA 3QORD 4E36A 4YR6A 4G8FB 5I17B 3IU3A 3DRTB 4NKMA 5H2BB 1IJNA 1RIHL 5KYUA 3T0BA 2VM3A 4AEHH 1V10A 3AQXA 2G30A 5F7FA 1DJHA 5AW7B 4KFMA 5E6IB 3PWLB 2JJTC 4X6CF 1PG7L 1UGKA 4MRCA 4BKLB 4HU8A 2GHZA 3QNYB 1TJIH 3SOBL 3UPRA 4Y2OB 3N91A 3VXMA 1VESA 3Q6GH 5KYXA 1JVKA 4KJWD 3C2SA 5F0MB 4KFZC 3MLRH 1BFOB 4HIXL 1KMGA 4FA6A 2LV4A 2JJWA 1J5OL 4LLWB 1JCVA 1NFIA 3LPGA 2O5YL 4XC3L 2ED9A 1YJDH 4MQ7B 4RGMB 3WCYA 1T66D 4A37A 1G84A 2PW2A 5HDOA 4ALAC 3ECWA 3HZYB 1J9QA 3K3QA 3ZK0A 2PCXA 4ZMXA 4LLMB 4PJ7B 3ABZA 4Z7UB 4EE2A 1IGTB 3CZGA 3FUHA 2WLLB 4X5PA 3EFOB 5GRYA 4LCWD 4XCEA 2PLTA 4MMXC 4OFVA 4DUWA 3VXPA 2VMEA 3Q06A 5E5LA 3MODL 3ARDD 4M5SA 3CU7A 1AKJD 3O4LA 4YSOA 1LWRA 3T0EB 3QYMA 1DEEB 4S1QH 3UYPB 2V17H 2HN7A 4XP5H 1IE4A 4Y2NA 4V33A 1JMZA 4FKHA 4G42A 3S88H 3F6IA 2AJYH 2Q10A 3GSNB 5FO8B 1MCOL 4H8WC 4I85A 4KRPC 1RZPA 1DQVA 2PPCA 1OAYH 3O2WH 2FSDA 1BQLL 4F7TB 5IB2B 2QKIC 2Z0UA 5AYUL 2FBJL 5TK4A 3CMOH 1MH5B 4I88A 4ZW8A 1HJBC 3H3PL 3NRFA 1LO0L 4FL4B 5DMGD 4K23H 1IILE 2YEZA 2GC7C 2YRLA 3MBXH 4HUKB 2ADJA 4JHBA 1H8SA 3MRIA 1NUNB 1JZHA 3PHAA 5EO9B 5I74C 4JQXA 4N2OA 5B7FA 1UYWH 2FECI 2VLKA 4L8SB 4MCMA 1ODAA 1MY7A 3HUJB 3L3GB 3O6ML 4AQEB 1RK0A 4DJMA 3S35X 1INDL 3ALWA 4TPRH 4JFYA 1E8YA 3W9EB 4FKEA 3CVIH 4QCIA 4MLIA 1HSAA 1V8HA 4GBXA 1WITA 3O2DA 3BN9C 4HLZG 5ESVB 2WYZA 1ZIAA 4XP4L 1JNNL 3AS2A 2BOBB 2IWFA 3EJYC 3MZGB 4PGDA 2W59A 4JFFB 3QCVL 1SN2A 4BCYA 1ZE3H 2N7SA 5EN3A 1UKTA 2EXWC 5F9WC 3CC5B 1J8RA 3EYSL 3RJQB 1WFTA 2ZICA 5EOCJ 5DUML 2XNAA 2I60L 2JCCE 1Z7JA 3VA6A 4Q2ZB 3SDCC 3QUZA 4KUCD 2XIDA 3VXUA 4KO7A 4NQSB 5D1QB 2CHZA 2R9HD 4TUJB 4EIZC 4OKVB 2ZJSH 3FUIA 3NPSC 1H3GA 2EIKB 4I77L 4QRRE 3QZNA 1SXBA 4FTVE 2F5BL 1A4JB 3MLTA 1XEUA 1MCBA 2RCSH 3U0TB 2OZNA 2XG5B 3IETA 4GXUN 4H0GA 2W5PA 1UZ6E 3ESOA 3WEMA 1CGUA 5FYLE 2DRUA 4KY1H 1NEUA 5AKVA 4UQ3B 3HB3C 1B3IA 5FFOA 3AWGA 5AD0B 1MCCA 3MV9B 3D8MA 3H1ZA 4AVKA 4LMQI 4X6DE 4YDMA 3WE6B 2AQPA 4NO2B 4P2RE 4MJ5B 3ABKB 2HJLA 2DWDA 4YSDA 2KS0A 1M7DA 4LLVA 1UJ3A 3EW3B 4X7CC 4NQEA 1HILA 3JWDL 2Q6WB 3SDXB 3EO1B 3V0IA 4WKXA 4RFEB 2IBBA 2NW3B 4GBXC 1EA9C 3HBZA 2CXGA 4NIKB 1G7LA 2AQRA 2BVYA 1EIBA 3CZKA 4ORZC 2NXZB 1AS8A 3QORB 3L3DB 4JN2A 4CMHB 2JJSA 2ZOLA 3GBML 5DJ0B 1FP5A 2BDNH 4DGYL 3QHFL 3F58H 4QTHB 4L0YA 3KM1A 3WFHA 2VR7A 2WCSA 1U0QA 3GSWA 2D9CA 4EOWH 2F7RA 2MMXA 3LN4B 4TSAH 1ITBB 2QJDA 4NB7A 5DFWH 4P9HC 2H7WA 2YPVL 1GGYA 1KY6A 1UG9A 2ZOKB 3HNTL 1SRDA 4BK8A 3TONA 4OM0L 1F6AB 5GSRA 1KT2B 5ANHA 1T83C 2FWSA 1AQKH 5IHZA 3KNBB 4R96B 4X99A 1QSEA 1NMCC 2AEWA 3S48A 2UZYA 2XACC 2P5WE 4X6EA 1JZ6A 3RVVC 4EI5C 2JMRA 1ET5A 1I4FA 1SMOA 4JM0A 1U2YA 3IRPX 3SDAC 3KLQA 3VH8G 4M6OH 2EZ0C 4Y7MA 4YXHH 1U8JA 4K2UL 4WI9A 3THMH 2ZOOA 1F18A 4IQHA 3IDXL 1IC5H 1BLNA 4FG6D 1FUNA 3IDNA 4LCWB 4L9LA 3HMXH 3T0VA 3VWJD 2E9WA 3ARDB 3UACA 4RMSA 2VZTA 1GZPA 4WFFD 1YYLH 2EE2A 3HBPA 3PF2A 2YLKA 3QNXB 3GNMH 4QMEA 1F4WH 3CN2A 5EHFA 2R51A 4YSSA 3DRQA 3HBGA 4G9FA 2H1PL 3FQRB 1EHKB 1GS8A 2IAMC 5KYWA 4P59H 4C56B 1SDYA 3O6KH 2OJ1A 3IU4H 5SX4H 3VG0H 4KAQH 4H20L 5DGQA 4G8AC 4PRHE 2LR4A 5T1DL 3TYGH 3T9WA 2DL9A 2Q3ZA 5CLXA 1A64A 1AZUA 5KVEL 1Z5LA 3CX5J 4JQIH 5FOBB 3NAAL 1PNCA 3GUTA 1UFGA 4ZT1A 1DQQA 3KWWA 3LPWA 2FNBA 3OLDA 1JD9A 3UTOA 2VN5A 2P5PA 4Y2DC 3HE6C 5GGVH 5G55A 3LD8C 3MNMA 1JWSA 1T89A 5IJVA 3A6BL 3O0RL 3TZVD 3UBHA 1Z9NA 5MI0C 1F90L 1JZ5A 5A6IA 1BWMA 2PXYC 4GRMB 5BJTA 1H3TA 2OSLA 2QL1A 4ODHL 1CDYA 2Y22A 3IDYB 2OTWA 2PN5A 3MKKA 3QG7L 1UB5A 2HKHH 3L45A 5CMAB 3D2UA 1CD9B 4X98B 1M53A 3ABGA 2YPLA 5ADOL 2OQJB 3AM8C 4HKJB 4X8GA 4DKEL 1GTNA 3IFOB 1IC4L 3S96B 5CF3A 4LBEB 1TVHB 3QEQA 1DO5A 2UY6B 2F0CA 5L0QB 1T22A 3BJ91 5IEHB 3ULVC 5CHNB 5JNYB 5D7EA 3TA3B 1B0GB 1R5WA 2ROXA 1U21A 2JELH 3TIEA 4UOQA 2EDKA 2ADYA 3QYCA 1F58L 2AKRA 4APQD 2EINB 3QUXD 3L4WA 3RB5A 2FX8H 3F6LA 3T04D 4LCYA 4DK6A 4ZMTA 4F5CA 5KBPA 5F7WC 3GMLA 3M1BA 3PDDA 4HUUB 4WFED 2O61A 2XV6B 4BFKA 4O58L 3JYCA 3TP4A 4Z5RA 1DJXA 3GMNB 4NRXA 4AYDC 3FU7B 2DD8H 4G7YL 4EN3D 1D7CA 3ILQD 2DQFB 3IJ9A 4FHBD 3DJZA 3GS4A 3SE8H 5MP6L 4OZIE 3JVFC 4X4ME 4LHUD 1FIEA 4EZLA 1L9SA 2B7DT 4HMEA 5IIEB 2PR4L 2JI1A 2VDLH 2XV2A 1ZTXL 3BP6B 4LLQB 4W9IC 2GTZA 1BJ1J 1AOZA 5F1IA 1ORSA 5C0BA 3LQZA 2GSGA 1AHWA 1B3JA 3MZTA 5DHVA 1QSVA 1AZBA 2ZXGA 3QSKB 2NY5H 4Q9RL 1W8NA 2D7PA 4FFZA 1ACCA 1RUMH 4GNKB 4XVTH 4Y9EA 9PCYA 2E7MA 5SX5K 4MA1B 3WUWB 4PLNC 2DJMA 2X89D 1QEWA 2IADB 2J71A 4JDZA 5L6YL 3GD1C 4OU3A 3MRPA 4EDXB 5FDWB 5LCVA 3QDHA 4YXLL 4GKOA 1FCGA 4JANA 3CQFA 2XV0A 1FNGB 5H94A 5B7EA 3ZN6A 2MKLC 2AJZB 2C34A 2G9KA 3GTNA 1F11A 3AACA 3ZHNA 5IOPA 3HN3A 5CIPA 2D3VA 3ZTDC 3NIGF 1DQLH 3MRHA 3LH2H 3BVDB 1S9YA 5DTFA 2OMWA 4BSVB 2JV6A 1IAIL 5BO0D 4L37A 4EZMA 5FPIA 3GFUA 3MYJB 4YDKL 5D2LF 4IU3B 3S2AA 3L1FA 3KWVA 2VNCA 3OAZH 4AIZA 3J2PA 3HHSA 4FG0A 4JREB 5T1KA 3DROB 1KXVC 1HHGA 3SQBB 1N0LA 1MFNA 1S9XB 2ZWNA 1HQ4B 4B3EA 4O5LL 4P9ML 5KS9F 5C0DA 5EPMB 5G4OA 4HC1A 2Z92B 3Q2WA 3SZ6A 4MJIB 3L7FB 1DSFH 1X5HA 1YPZF 1A6UH 1WBXA 3DVGB 4IK6A 1HN1A 3VWJB 1T6WA 2H5UA 4K7PH 1WV7T 1NFDE 4PJ8D 4LPUA 1XQ4A 3RDJA 1E0OB 5C0GA 1L0XA 3QG6B 2CDFB 5FCSH 4IOFC 1RUQL 1Q9KA 4AVHA 3MV8A 1WF5A 5HHPA 4FXGC 1NBVL 4NLAA 2WW8A 2O93L 4XC1L 4FHKA 1NGXA 2XBZA 1DL7L 1LGVA 4M7ZC 4TS6A 5I30H 5JHDE 1A6WH 4OM1H 5DSCB 3A22A 1PX4A 3WD5L 1THCA 4LP4A 1YLBB 2RTTA 3V9FA 1QFWM 4F9LA 5EB9A 2OCFD 3SYQA 5BV7L 4ZUWB 4OI9A 2AXFB 3C5ZB 3GIVB 1U3JA 2P7TA 4OKDA 4XNXH 4HUVB 2VDQH 1QPXA 1BHGA 5BS0E 1CDHA 3TZVB 2MWCA 4JDTL 4RNRB 3MUY1 3WFCL 5J11C 5D6CB 4OD1L 5IMMA 2OMTB 1X4YA 3FSOA 3GJEA 4U1KA 5JHLA 1HKLL 4M62H 4UOW0 5DZPA 2KH2B 3R1GH 5DJ8A 1EHNA 3GMMB 4G9DB 2CNZA 1FO0L 1KELH 4HXBL 2P8LB 1L0YA 2GJRA 3RURA 1SEBB 3PGFL 2NY0D 5IVZB 4F37F 5CJOL 1S7UA 4ZFOL 2X3CA 1UVQA 3VI4A 4CSTA 3R18A 3BWAB 3HZVB 4J3OD 1SN5A 4U2YA 2WJ7A 5I6LA 3CUPB 5DZAA 3PHQA 4AUJA 5MEOA 1MIMH 5D7HA 3CVHL 3BVVA 4APQB 1EJ6A 2V5RA 3DX6B 4M8RA 1WC7B 1KC5H 5EZLB 1LEKA 3ATAA 3MJGX 2PPFA 5GIRB 3SE9H 2FJHA 3IE9A 4TVUA 2BMKA 5AW5B 5IJKA 1DJZA 1SXZA 3VCLA 4EN3B 1J86A 3PP4L 3OC8A 3MRFA 2K8MA 3GBNL 4BDVB 4JN1H 1AQMA 4CRPA 2Q8AL 4F9LC 3FAXA 3FH5A 1UM5L 4LHUB 1OM3H 1E30A 5A2KH 4D94A 1KTBA 4JFQA 5DS8A 4DQOH 2HVBA 4OF8A 3MLWL 3EUDA 1OHZA 2H32A 5FF6A 4XAKD 2VLRD 3KPNA 1N18A 3MI6A 2OYLA 2AK4A 3BFQG 2FBOJ 1G6RL 3EO9H 1VIWA 3VGFA 2R8SH 4MD0A 2PMZA 4XX5A 3SE3A 4QY8B 2GPZA 1ZPLA 2YD6A 1GZQA 3UOAB 2N56A 5EU6A 2ORBL 2YUXA 5KAQG 3WTWA 4OJYA 2ZCHH 1AD0A 5M94B 5KVDL 5E1HB 3RFZA 3LDBB 3SKMB 3FTZA 2VDNB 1NGWA 2E9GA 2MH4A 5DJZA 1ES0A 1GC1C 1MELA 1KJ3H 2RBLA 4ZSOE 4ZNEE 1SJEA 2B3RA 1RZ7H 1OY3B 4MA7L 4Z95L 3UJJH 4LASL 5CEYB 4DIXA 3WKMH 4RGOL 5DD1L 1N7ML 3QULA 4WZ9A 2HWZH 4W93A 3IGLA 4NN7C 4EBQH 2O4EA 3VXUE 4B9IA 4PBXA 1CXFA 4NYLA 4R2GC 4WO0A 2ZONA 1SF3A 1OSZA 3QDJD 5H4ZA 2WXPA 3M45A 2H9GB 4N8VA 1WTLA 2WXLA 3OXSA 2AERT 3Q5YA 1TJMA 4CKVX 2J8UA 1T1ZB 3ZMRA 3NG5A 1JF5A 3F65A 1RAMA 3BKCL 1MFAL 3TO2B 4BRJA 4ELMB 2GK0B 3VFSB 4AYID 3OR6B 4D9RE 1NCHA 4LCIH 1WT5A 1OE2A 2VAAA 5I1GL 4M5ZH 4IDJH 4LFHD 3WEXA 4B95C 1A5FL 1CBJA 3FT0A 3AQDA 5KVGL 4FNLH 3FTXA 3LKQA 2F15A 2XWRA 5E4EC 1KBPA 4XPGH 2D3NA 3LEYL 4RMWA 4XNQA 7FABL 3U7YH 1OQOA 2CCLA 5F7HA 3R7RA 4PJ8B 3O45A 4OV6F 4W9FC 5KJRH 3P2BA 2B20A 4PS8A 1KGCD 2Y69B 3G6JA 4ERSH 2W0LA 5DJDB 1DSYA 3NFNA 4ZUVB 4CVXA 5KOVC 4EUPA 1A1OB 1WBZA 3NQKA 2A2QT 4EVNA 1ZWIB 2W07B 3L4TA 1PLGL 1TMQA 4KRPD 4OQTA 4U1SB 4GG8A 4H1LA 3O4OC 3SKOA 5HGBB 5KSBB 4Y9BA 3TN0C 2HUEA 1TSHA 3CFQA 3L3IA 3X3GL 2IBZY 1LM8V 3IJHA 3LZFH 4HX1A 4NJ9H 2LLGA 4M8UA 2PCFA 4NC1E 2CCVA 1EBAA 1BJ8A 4HBCH 1P5VB 3ZTJH 3VXMD 4G5ZH 2F9BT 1ZTXE 3RWDB 1A14H 5B8CC 4HIHB 3WL9A 4ENEC 2W80C 3EH4B 1CLZH 4I3GA 1GL4B 2YUWA 1OSYA 2OMUA 3V6OC 5I16A 5E2VL 4JM2C 4Y4HC 5E2WH 3U9PH 5DZNA 3O6FA 4LRNL 3SKUD 3QAQA 4KX7A 1BZ7B 5D5ME 2A5UA 1A1MA 1TVBB 2IJ0C 4OZHA 3FQ4A 4UYQA 5ACZA 1G9NC 4IYKA 2WCGA 3BN9D 5FHAL 4GAFB 4XP9L 4JS7A 1WT5C 4YDZA 4OUUA 1T0NA 3NA9L 1VGKA 3VU1A 3OWRA 4AENA 1RPKA 3IMWA 3EJYD 2H3KA 1MLCA 2N4IA 4FQPA 1Z2KA 1YMHA 2EDJA 5LGJA 2OMNA 4FQ1H 2I26N 2QTVA 3NCEB 4IEFB 3O4LD 5FIEA 4U6XA 2C9QA 3VSTA 1OP9A 2AJXH 5AW6B 4OV5A 1MHHA 5KVFE 3GPSA 3SDCD 5A2CA 4O2CB 3CFBB 3GRWH 4XBPA 5B3JF 4OJFH 2WMPA 4TNFA 4PJFA 4WGWB 1X5XA 3JV5A 1PS3A 4JR9H 3VI3E 1JV2A 2V33A 3BQUC 2ICWI 1DN2A 1QRKA 4AWJC 1IVTA 1IARB 1T7WA 1AXTH 3H0TA 4BZ1H 3APCA 4Y1AA 2LT9A 3HB3D 3W0WD 3K91A 5FYJL 4GKSB 1HHHB 4K9EL 1FHNA 1VZGA 1IGYA 3SO3C 1J18A 4L9DA 3NIFB 4MD4A 3O9WA 2UWEF 2VLRB 4A6YB 4ZNCD 4UTAL 2HRPH 4CAGA 1A22B 3ZE2F 4HIIB 1THAA 4GBXD 4ELDA 4Y19A 2D7OA 2H1LM 2GT9A 4NKOB 1BD2A 3B83A 1NAMB 3I2CH 4W6XB 2HMIC 3D3VD 5DRXB 4MNHA 1IMHC 4XWOC 5EWIL 2XWXA 5F1NB 2NDFA 1EHXA 1X5KA 2YPLE 3N43F 1RIVH 3LIZH 1PEWA 5IR1B 3O11A 2A4ZA 4FQCH 1FBIH 1RZKC 1U8HB 4XMPL 4UU9B 4WTZA 4Z7WE 3RI5F 5MEQA 3QHTC 3CFJB 2NX5D 3BAXA 5E95B 3H9SA 2EE3A 4N3UA 3DUSB 1A6VL 5EUKA 4XT1C 1LQBC 1QFOA 3MX0B 2IPUG 5LO7A 3QDJB 4YXKH 5C09D 5I1LA 3CDGB 3VJ6A 4CN4A 3ARFC 4PV9B 5J3HC 3WNPA 1ASQA 3RVVD 4EI5D 2V8LA 4NKDA 3KD4A 3L5HA 3BD5A 1OGAB 3SDAD 3EJJX 3K71B 3JZ7A 2EZ0D 4HUXA 3VD0A 2IV9A 2WV3A 3H2QA 4HHAB 4F58H 5ABZA 4JFDA 5DT1H 1U8CA 5EO1A 1UASA 4ZO6A 35C8H 5CZRA 3OX8B 3ZOAA 1A7RL 5ANMA 4B0MM 3OJDA 3GTVA 1U8KB 1UATA 3P11H 1INQB 2LTQC 3BKYH 4MMXB 4L0ZA 4PJXB 3SPCA 3WN5C 3UROR 1PFOA 5E8PA 5KJ7E 1T7YA 3VGDA 3FUDA 4P46C 1MAMH 2NSMA 1NFKA 2J88L 1JXKA 4GIPD 1OWWA 2IAMD 3L3JB 1X9LA 3CH1A 1JWUA 4KRPB 4OB5L 4KXAA 4FYTA 2YAQA 2VUKA 2N3JA 3GMRA 2QKIB 3QXDB 4HH8A 3CHPA 4LCCA 5HDBB 3RNKB 2WAHA 5F0LB 3P3SA 5BQDA 5CD5C 4J3OF 4Z6AT 1SJHB 5I74B 5CZVL 4Y2DD 3HE6D 3LQMA 2ZT9C 1LE9B 3DYOA 2ROYA 1K2DA 1JS4A 4Q9QL 4B3VA 4PG2A 3P4OB 1UOVA 3I50L 3MGOA 2PXYD 4N8PA 5J6HA 4M03A 3DHJA 4WWID 3SQOL 2ESVA 2V2WA 3DVIA 3PJSB 4M61B 5HD8C 3KPRD 1AYRA 2B77A 1B0RA 1W6LA 1AHKA 3LPFA 4IGBC 3REVA 3ROLA 1A02N 4OGYH 5DD3L 3IDIB 2DB8A 3WXVH 3WXWH 5LQBH 3NTCH 4ZFZB 4AX3A 1GS6X 4PVLA 1YG9A 5F9WB 1A4KB 1LP9E 3IEAA 2E5EA 3A5VA 1QP1A 2MNUA 2J4WH 5FUZH 3BZEA 2IF7A 4JG1L 3CG8A 3ESVF 3CXFA 3E8UH 4RETB 3BAIA 1I8KB 3SDCB 5T3ZD 1JNLL 4X50A 1AFVH 4HJGA 2R0LH 3NPSB 3WTSA 2O6EA 3T4YA 2BNQE 3GXUB 3N50A 4JRYB 5D7IA 4JW3A 1ZGLM 5I75C 2XWDA 4Q6YA 4FQLL 5PCYA 1EAPA 1KCWA 4FDWA 3HB3B 1IGMH 5DD5L 2BK8A 1FNHA 3T71A 3W0WB 1LO3L 4PVNA 2F7IA 4G6KH 1NCBL 3UZEA 4WEEA 1X5YA 2UXFA 4PIBA 5B39B 3LKNA 1ZDSA 2X38A 4NO5A 2WSDA 2KC0A 2F19L 2CK0L 3GHPA 4JHAL 4MJJA 3MRBB 2HT3C 2NCEA 1S8DA 3NACL 4N9OB 5CUSL 4AQ1A 2E86A 4JL2A 4DVBA 4WJ5B 3VRLE 5I5RA 4P23C 1KIQB 1AHMA 2EDHA 1EX0A 1FIGL 2I69A 1AGEA 1SJVA 4PJBA 4HAFA 1YQVH 1B0WA 2K70A 4OZGE 4D0CB 4F7CB 4BGDA 3MDJA 2PO6C 5E2JA 1NCWL 1KIRA 3D3VB 3GI8H 3VMPA 1HHKB 1KCBA 5CGBA 3MO1B 3CFMA 1USZA 32C2A 1TJGH 1TQVA 3MOBL 4F7EB 2K8QA 1YEWA 3GMQA 3QB7C 2V8MA 2KLTA 2TSAA 3H85A 4KZ0A 1A2YA 3TBTA 1UEYA 3KLLA 2PCPB 4E68A 4TULH 1O6SB 1HH9A 4HPYH 4Z77A 4F80A 4YGAB 2ICWA 2NX5B 1G7QB 5FKAB 3O3UN 3RVXC 2OBGA 4J3VA 2VAJA 4FLQA 2X12A 2VH5H 1S5IL 1HCYA 1ZTMA 2Q86A 5C09B 3S98A 2P8PB 1NMCB 2H0EA 1VEPA 2GJ6A 1OPGL 4J28A 1I1AB 3L9RB 5CZKA 1R3IH 5SX4I 4FNQA 4EI5B 2O5XL 1KXHA 4ZTPH 3EJPA 3VFTB 3UEQA 1AG0A 1KGXA 3B1UA 5TE6H 3SDAB 3V5HB 4PJAE 5I8EA 1JD7A 4N2BA 1T5XA 1H9DA 2BSTB 1MDTA 5C0BD 4Q6IC 2ZWYA 2B4CC 5C08E 1RZJH 4X5WA 2JK5B 3MNWA 4C83A 1G7HB 2CSPA 2H8PA 3D18B 2AK4E 3ECBA 1XCXA 2PWEA 5I2IA 2H0FA 5AZ2H 4UQ2A 4ODBD 4Z7VE 4IOFD 5DA0B 2JH2A 3EGDA 1YNKL 1VCAA 4L8BB 2IAMB 2XN9A 2EACA 2HVKA 2YJLA 3FCTA 3POHA 4OFKA 5B21A 1NCTA 4N8VG 4NWTL 4JKNA 4JM4L 3IVKA 3SCMA 3S5LA 3JWNH 1CK0H 1IC0A 5DFTA 3E6HB 4H88H 3NCWA 4LOVA 5F3BB 1CICA 1ED3A 2YBRA 3QDAA 3BAJA 4K3EL 1Z0MA 4QXVA 2HT4C 1GXEA 3KXFA 3B5TA 3ALPA 1SEQH 2H0JA 1QR1B 1A7NL 1EZVY 5CEXA 4IIQA 4I2XE 4YSUA 1J5HA 3N04A 5F3HB 1HDMA 4Z76B 4Y2DB 3HE6B 2WQSA 4PVBA 2MPAL 4JY5L 5LAXA 5KSAC 2ZUXA 3ARRA 1MW2A 4N8CH 3P2DA 2FJFA 2A9DA 5MI0B 2BIOA 3MOAL 1PY4A 5T1KD 3GSUA 2D0GA 2PXYB 4N4YB 5TQ0L 5DJ2A 2ZUQC 1ZMYA 2VW4A 4Y4KA 2VSMB 3JZYA 3KPRB 3MRMB 4ODXA 4AZ8A 3QGVA 4AYBA 2IGFL 2J73A 3LS5H 2NCMA 2Y7NA 1XR8B 4HJSA 3WNNA 4XCFH 4XODA 3MROA 3VYNA 1FORL 4MAYC 4E9TA 2ATPB 4H1LG 2MEJB 1I1RA 4X7FC 1MPAH 1QLEB 1YDPB 4DSYA 3JTSB 1BZEA 1AGCB 2IH1B 4PP2B 4OR1A 4ZBJA 4O02H 3V0WL 5DLLA 1CFVL 3DDFA 2YN5A 4OIIL 1EUTA 2EEDA 2QLYA 3HN8A 4OF3A 5D9SB 4ZTOL 1OP4A 3E9TA 4XVOA 3MV8D 4JPWL 4WUUE 4BK4A 1ASPA 2OZ4L 3L8QA 3LAFA 1NBQA 1TZHB 4R26L 1MRDH 5ECGA 5AW9B 1M3IA 2D73A 3BH8A 3R0MA 3S3JA 4IHOB 4HS3B 3MNVA 3BZFB 2PNDA 3V95A 3WIHA 1PZSA 4HETA 4F8TA 2BPBA 1F56A