4HJEA

Crystal structure of p53 core domain in complex with dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
200
structure length
200
Chain Sequence
b'PLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structure of p53 binding to the BAX response element reveals DNA unwinding and compression to accommodate base-pair insertion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 49
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4hjeA00
4AGOA 2BIOA 4MZIA 3WTXA 2H1LM 2J1YA 4QO1B 2ATAA 3WTVA 4HJEA 1KZYA 1TUPA 5BUAA 5G4MA 5AOKA 5LGYA 3WTWA 2J21A 1GZHC 4MZRA 5LAPA 3US1A 3D0AA 4AGPA 1UOLA 3WTUA 2AHIA 1YCSA 2YBGA 4G83A 1HU8A 2J1ZA 2RMNA 4LOEA 4IBWA 2IOOA 3D07A 5A7BA 2IOMA 4AGLA 3Q06A 4XR8C 5ABAA 1GZHA 3D06A 2IOIA 3EXLA 3WTYA 4AGQA 4A63A 4L0ZA 1HJBC 2BINA 2J1XA 4GUOA 5AOMA 5ECGA 1EAOA 2FEJA 2J1WA 4AGNA 2XWRA 2OCJA 2WGXA 4KVPA 2ADYA 4AGMA 3VD0A 4LO9A 3Q05A 5AOLA 3EXJA 2PCXA 3KMDA 4GUQA 4L18A 1T4WA 2BIPA 2BIQA 2P52A 5G4NA 3KZ8A 1HJCA 3VD1A 4LOFA 3IGLA 3WU1A 2AC0A 3D08A 4IBUA 3WTTA 3VD2A 1EANA 4IBYA 4IBTA 5G4OA 4G82A 4IJTA 5AB9A 3QYNA 2X0VA 2J20A 4IBZA 2VUKA 4IBVA 3IGKA 4IBSA 3ZMEA 2MEJB 2GEQA 3WTSA 1IO4C 2XWCA 1H9DA 2X0UA 3D09A 1E50A 3US0A 1EAQA 3QYMA 5KBDA 4L0YA 3Q01A 2J6WA 1LJMA 3D05A 2BIMA 4IBQA 1CO1A 1CMOA 5AOJA 2X0WA 1TSRA 5AOIA 3TS8A
chains in the Genus database with same CATH superfamily
1L6PA 4AGOA 3FNKA 2WAHA 3ML9A 1KYUA 1OGPA 5FGCB 4DGUA 3QR0A 3O6LL 4IU3A 3G5ZA 5IT2H 2WANA 4N68A 1XAUA 5D71L 2ENPA 3VH8A 2HFEB 4B53A 4YBLB 2CHNA 3OXSA 3FQNA 2AQNA 1KB5B 5T3ZL 5KANI 2B1AH 1JZGA 2Z64C 5L2JA 4OZHE 3FKUS 3K0YA 1IJNA 1EO8L 3JTSA 4DEWA 1HIML 1M71A 3SBWA 4GUCA 4Y16C 4P5MB 2LOEA 2JV6A 4FFYH 3X14A 5CEZE 4KY1H 5GGVL 4JCWA 4I77L 1IGYA 4XX1G 3B43A 2BSRA 2F15A 5C0CE 3VCLA 5JPNC 4KXCA 4HXBL 4K71B 4NO5A 3VYNA 3D7PA 2PPCA 3P11L 2R23A 1CYXA 3KM2A 3SPVA 3EJTA 4KPHL 4MVBD 2GIXA 3ARED 2P5EA 2NR6D 1AFVL 2EIEA 3KPTA 3CIAA 4AQAA 5FA4A 1LO3L 4X6CF 1IEHA 4KUZH 4GYBA 3VFPA 2NLJA 3DECA 4ABWA 5CZKA 4PGDB 1UZ6E 4EIUA 4FG4A 4PJHA 1CBJA 3TPKA 2A7BA 4PRDA 2H4EA 4K94L 1DJHA 4B96A 4J3SA 2FHCA 3GXMA 3A4AA 2CNZA 4Q6IC 1UZGA 1Z5LB 1RMFL 4TSCH 4KZDL 2FD6L 4HJSA 5EUOF 1UCBL 3WJJC 3KPSE 5FM5M 5H37A 3EH5B 2E9BA 3AQYA 5AYTA 4P9HH 3ZTNH 3HR5B 4KDTA 2EDXA 1MFDL 4PJAF 4GW4B 4BRVA 3I75A 2WNGA 1KXTA 3EOAA 1CICD 1G43A 3QJQB 2XWZA 4U7KA 1CLCA 3T6WA 1WWBX 5C08D 3V6OA 5DRXA 1L6ZA 1C7SA 4B5ZA 3B7TA 2R56H 2OZ4A 3SDCB 4JRYE 4IQHA 5IBLD 4YFDB 3HHSB 5FHAL 3AZUA 3DX4A 3GMPB 2X6UA 2NTFA 4G3YH 2WWMC 4ONGL 5D4JA 1Y0LA 2CCWA 4S0SD 3ZTEA 1KB9J 4OZFA 2CHWA 2ZUVA 3G5XB 1OAZL 5F6HJ 3ZL2A 5DJ0B 4EDXA 4PGBB 4JREB 4BZ2A 4IRSA 5GGUA 3MV9A 2CKBH 1HFUA 5JHDE 1V7ML 4LLQA 4WJKB 1CN4A 1MI5B 3ES6A 5F0JB 4K07A 3N40F 3GLAA 1ADQA 1F13A 1U0QA 3QUKA 4WCYL 3T3MF 2WO3B 5AUMB 1MCEA 3M46A 4QF1B 4RDQG 3B1TA 4RNRB 1JPFB 2B08A 3NFSH 5DFWH 3RX8A 4KFMA 3NZHH 5JDSB 4FQJL 1QRNB 5D6CA 5EMYA 1YSOA 2NY5H 3L1OL 3GXTA 5CZVH 5IB2B 5K69A 4CVUA 1NCCH 4PJ7A 4AYID 2WUBH 4U6XA 5EN2B 3MLVH 3D2UD 1BVNP 3ZKSD 2QADC 5CP3A 3G6JA 3SDYH 1KPVB 5KSAB 4IJ3B 3QNFA 1RUML 2P8MA 3DROB 4POUB 4GG8A 4Y5YB 3BAKA 3WXWL 1J1XH 1N6QH 5EIIB 3B1UA 2X87A 4F7PA 1HAUA 4KJQD 4AJWA 2DQJH 4NWUH 2MQ3A 1CLOL 1D5XB 3BH4A 5DJDB 1IFHL 1TFPA 3UABA 4GBXB 5FW6A 4IRJD 3C8KA 5HBBA 4ZD3L 4PJGA 4DP2X 4A7TA 1N3NB 1XR9A 5I73B 1B4TA 5GSRA 3CNKA 4PW3A 5L0QB 3QFGA 3WDJA 5JDJA 3A5VA 5EU3A 3MNVA 1AIFB 2UWEB 4YO0A 4HWEL 4I2XB 4AVIA 4KDTC 1NL0H 5FYLL 1G4MA 3QUMH 3OKKB 4GUQA 3L3OA 1MCPL 1VF5C 3QZBA 2GIMA 1Q0YL 2K3HA 2R0ZL 4NP4H 2B9BA 4GAGL 5A2FA 3GSNA 5HHME 1FGVL 3VFWA 5BVPH 1EHLL 1GYCA 3V6OC 2Z35B 4E68A 4RX4D 4U1JB 3AY4A 3MLYL 3WNPA 4FI6A 1L9RA 2DWSA 2X12A 2DM2A 4JJHA 3QYCA 4V33A 4IIQB 1RSYA 1FZOA 5JHLL 1HXMA 1PD0A 3VXRB 1DBKL 2DIAA 4IU2B 1BGXH 1PNCA 1D5MA 2V3FA 4KO7A 1E4XI 2BVEA 5T1MB 1KTDA 4YBQD 4G5ZH 1KGCE 3ZR5A 4EZJA 3DV4B 1OE3A 3WHE1 1SRDA 1H3XA 4ZO6A 4IRSC 5CSGA 3SO3C 1GHFH 1UWEH 2WTRA 3BPCB 1I9JL 1RHFA 5EA0L 3L4ZA 4HKXB 2VH5H 3RVVC 3UTTD 3V0HA 2WINA 3Q9QA 3SKNA 5D4HA 4XOAA 3CSPA 4QRSB 2F2HA 2CIKB 4L4TB 4H7VA 3ULUC 2J8UE 5M94B 3FTGB 1YC8A 1T1ZB 4PJCE 2DLFL 2F7OA 3B7YA 1IGCL 2SEBA 3SDDD 1KIRA 2JJVA 3MRBB 1EHAA 3UZQA 3I50H 3IKKA 4UI2A 1MCQA 4ZS7H 1A3RH 4EPSA 2WLHA 4W9FC 3PNWA 3BVXA 2H1PH 3DGCR 3IDGA 2EDHA 3DVGB 3QQ4A 4R97C 4KBPA 4TNWK 5FO8A 4AXWB 1A7QH 3P77B 2Z92B 4KO9A 1SXBA 2CKBB 2X88A 1BBJA 2YGQA 2YPVA 3K5SA 2HX9A 3CN0A 3BQVA 5IFJA 1I1YB 3V6BR 2HT4D 4YSCA 2YO3A 3PHOB 1WZMA 4NN5C 5E5UB 2OYPA 1MJUL 2VDLL 3G9VA 5TF1L 3U9PH 1E6JH 1C5BL 4WFFD 5K9KB 3EJCA 5IFAL 3DHUA 2AGJH 4R96A 1PU0A 3UAEA 1F4YL 1CE1H 2ISDA 5HPOA 4ZO9A 5I1CL 2EIMB 3K81A 3L3OC 4X42A 2PP9A 3AT0A 4HSCX 2X10A 1KWGA 4YDIH 5DQ9B 1YN6B 1ZHKB 4HD5A 4NZUL 3SGDH 2UXGA 2VWEE 4K3HA 5E5LA 4L4VB 2F54A 4G7SB 5J9PB 3DXAD 3AY4C 1YMME 4JO8A 3EDDA 2WLLB 4NQDB 1NKOA 4WU7A 1P4IH 2DLTA 3MRKB 1FFQA 4NZ8A 1ZGLM 3CHSA 4KU1A 4R7DB 1HJCA 4XPAL 1JGEA 2H26A 2D7OA 3QHFH 1CR9L 4FFWC 4JANA 3E1F1 2DZEA 2J8HA 4YE0A 2BSEA 5JIPA 2ERJB 3MOQA 1I8AA 4J3TA 3CVIH 3QUZB 3QXAA 3CU7A 1JV5B 2CIIA 2NQDA 4MJ2A 4C56D 5EZJA 5L4MA 4G9FE 5JMRA 5FUZL 4MA7L 4NRZB 2RACA 1I4FB 5F7UA 2HLFD 1BHGA 3QDGD 3QUMB 4TSBH 1ZLVH 1HSBA 4NZFA 3VDAA 5IGXL 4AM0B 1OL0A 2FYYB 2HH0L 3NGBB 2P80A 5F70A 1JPEA 4G71B 3RAJH 1UUNA 4FMKA 1FLRL 2VDML 1NEZG 5TFSL 4KXBA 4ACPA 1MZZA 1VFBB 2AJUH 4XO8A 1SHXA 2GSIB 3CPLB 4LDLB 1OLLA 1USQA 3H1ZA 4NKIL 1NH6A 3LIZH 2XG5A 3AGVA 3LQMA 1ES0B 5B4MC 2B7DT 1FFOA 4OVVA 4RQQA 5EPMB 1RZ7H 2NSQA 2CK2A 3H9HA 5AOJA 1KCSH 5KJRL 1F02I 4P2RE 1N0XH 1ZV9A 2JF1A 3GMLA 3QUYA 1JDAA 2A9BA 1GZPA 3S3CB 3TA3C 2DQDL 3QIBB 4JY4B 2ZX6A 3PFQA 2K7QA 3CG8A 4N2KA 1ZY9A 1VEMA 1F4AA 3TO4B 3GS0A 2ICEA 4TNFA 2QHRH 4JJ5B 1ZT1A 3OJVC 5GJTL 3GHBH 3O4LB 3N40P 4U1HA 5DR5H 3ZJAA 3RB5A 2XJLA 2ZXEB 4UOZA 1EPFA 2IADB 4FKEA 4MX7B 3GMOA 4TLKA 4BWWA 5A7BA 3VMPA 3H4FA 1BMZA 4L9LB 3CXHK 3NK4A 4BSWA 1J1OH 1JDCA 2FECL 4BZ1A 4DEPC 2EZ0D 4FZ8L 4X4YA 1M7IA 3EO1B 5GGRB 1AR1D 3P4OB 4KXZI 3QWRA 1O6SA 1T03L 1B9ZA 2NMSA 4I18A 2WGNB 3WHE0 3UBHA 4AENB 4ANVA 1T66D 4R90H 4PJIB 4J3OD 3GSXA 5CUSL 3TH4T 5B7MA 2OMYA 3HZVB 1KUMA 5GS1A 1WZ1H 1Q94B 1MREH 1AO7B 1J8HE 3OX8A 4WRLA 4WJ5B 5DS2A 4DVBB 3MRPB 3N42F 2JELL 5MEOA 3HRPA 1YQ2A 4UANA 2E7HA 1GZQA 3IT8D 3K6SB 1CXKA 4LSSH 4LLMB 3KMDA 2YPKB 4OLXL 4Z3FA 4K3GA 1GIGL 3K1DA 1N10A 3BDXA 4DO4A 1Z1WA 4PCYA 3VXQA 4FA8A 2PO6B 4IBUA 3WTTA 3K5RA 4YHZH 3HVNA 1JYWA 1RZIB 5ANMA 1UWXH 4J23A 3GM8A 4AV0A 3H2QA 3JVFC 5AZEL 4M3JA 4MJJA 2NX5D 1P6WA 3NP4A 5I9QB 3VQ1C 5GXBB 1EZVY 3HI1B 4H26B 2XN9B 2X28A 1BBDL 1TTBA 4MA3B 4RGOL 2Y2WA 3KHQA 4R2GC 5BQ7B 4Q7DA 3O9WA 1FZKA 4PJEE 5L6YH 2Q20A 4L1BA 3MN8A 1MFCL 3QUYC 4OVUA 5LVEA 3KWTA 1MCWM 1BOYA 2F7IA 1EZLA 2F6AA 2J6WA 4PMEA 5E8PB 4ABVA 2JI2A 1DQTA 2VLRB 2X9YA 2FBRA 3FB7B 1MRDH 2ICEC 2YK1H 3LEVH 2G4GA 2ODHA 5B1BB 3OHXA 1E5BA 3FB5A 3NJMA 2XKNA 4ODUB 5EBMA 4WVRA 4A2EA 4UT6H 3DDFA 1FVDB 5BUAA 3PL6B 1ZPUA 1J9CT 4LCUB 3IF1B 4NJAL 5E9DA 2XETA 3ESPA 4D8OA 2KQMA 4LGPB 1UOKA 3OLEA 1FV1A 3I84A 1TLMA 1WWCA 1OZUA 2LTQB 1MFBH 3IGUA 1MFEH 2CWRA 2G2NA 4I18C 4G8GB 1OXYA 5C7XH 1IC5H 2HUEA 3OMAB 4KKRA 4Q97A 5DGRA 2XWTB 4HGWB 5GS1C 3CLFL 4MJIE 1ZSDA 2F74A 2OL3H 4E42B 4PRIA 4EN2A 3MOAL 5ID0B 2DWTA 1CBVL 3ZUCA 4OM1H 5IV2B 2DIBA 5LLIC 3F7YA 4XN1A 3P1VA 1S7QA 1U3YA 3QPKA 4XB3A 3TBYB 2XWRA 3LKSA 3BGFB 2WWKT 4K9JA 3B3IB 3FOMA 1TSHA 3C75A 4YFLI 1IM9A 3KLQA 4LFHD 4JFEE 1SYVA 2BH0A 2RD0A 3QHZL 2AJXH 1PX4A 2Y0SA 5DQJA 3LN4B 3KR3H 1G5GA 5DF0A 5DI8B 2PXYA 2E7LA 5EEXA 4U3XA 5IHUL 5AAMA 2G0LA 4QRRD 4IDJH 4UQAA 4FAAB 1A1OB 4UNTA 1PLCA 2QVKA 5JNYA 4K5NA 1XCTB 1TVBB 1JTPA 1XXFC 4ZFFA 5J3HD 2OTPA 5SWZE 5CLZA 1T04B 1ZT4B 4NQSB 4Q0XH 1T6BX 3H85A 5IJVB 1JYVA 1T4KA 1IGTA 2XT1B 1XL6A 4N0FA 3WIIH 3IDIA 1KV3A 1O0VA 4U0RC 3LS5H 1JZFA 3DK2A 4HIEB 2IAMA 1RZGB 5A43C 3JV4A 1I82A 1FCGA 1FBIL 2OR9H 3BUYB 3INUH 2ZX9A 4YE4L 2ZWZA 3Q8FA 5FV2A 3S35X 3STZB 1D6EA 2HG0A 4AE0A 5BW7A 2R4SL 2N1KA 2W0KA 1ODAA 3DHPA 2WKOA 4OCYH 3U46B 2J6EL 2DJ4A 4YDJB 1IAOA 4ZQKA 5E4EB 2Y5QA 3L5XL 3U2SB 4XI5C 3DRTB 4AYDC 4TOYH 5CMAB 3QXWA 4J8RA 4X2UA 1E90A 3OAWA 3QRBA 2UYLA 2Z4TA 4EAEA 1A4KB 1ED3B 2YMXL 1SMDA 3OKEA 3P0VL 5KN5A 1VZIA 3SQOH 3PWPD 1N0LA 1J05A 1I9EA 5D7IF 3POHA 3AU1A 1KGXA 4EI5A 3IU3B 4YQXH 4LFHG 1A4JB 4XN7A 4UQDA 2NR6A 4E9YA 5D4QA 2FGWH 3QQXA 2W65A 1W72L 2LABA 1VFAB 4YHNA 3QUXB 3HW7A 3UO1H 1NFIB 4R3SA 3QQ9C 2VABA 2LAGB 4EEEA 1PJ9A 1CFTB 2X4RB 3E80A 4ES8A 2JNZA 3D6GA 2V5YA 2MPAL 1FI8C 1MQ8A 4R4NC 1YECL 5FA3B 4DGIL 5LGJA 2HPOA 3DSFL 5IB1B 2VLKA 2WP3O 2FT6A 2AKRB 3V2AR 3F7PC 4JM0A 3EIFA 4GSRA 5DHYB 3CDCA 1TDQA 1E28A 2VXQA 5DO2D 3OR6B 1WAEA 4FQQB 3DC0A 5T5FL 4HJGB 5DC0A 2PXYC 2E7LC 4K9EC 4JG1H 4GKNB 1NICA 1XH3B 4H0GA 4Z0XA 5ICYB 2ATKA 1EGJH 2AXFB 3IKCB 4FQ2L 3ZE2B 4O58H 1WAAF 3WUWG 5E8DH 4LO9A 4W6XB 2A6JB 4DH2A 3LSOB 2AK4E 2OL3B 4HKJA 4IEFB 1HEJC 2W59A 2CUAA 1P1VA 2YOAA 4P5RA 3OPUA 2XN2A 1CL7I 3HMXL 3QCTL 3TFKD 5IROD 2IAMC 4TL5A 2ZKXA 3EG9B 3WEXA 4AH2B 5BOJA 5I0WA 2J71A 4DQOH 1CC3A 1I1AA 5E9NA 5F7MC 4YDKH 4CBPA 3E6HA 3LMJH 5BW7C 3SDXF 4LHUD 1SY6H 1A6VH 1AGBB 1G7MA 4FQPA 4ZW5A 4DK6A 5BS0A 3T1WA 4IW4C 2O6DA 1KIPA 4JQIH 3WE6B 3WNLA 5BUGA 2J3SA 1T1WA 4UTAH 1DLFH 2ZG2A 4I3SL 5HHOE 1ERNA 4ENEC 1UWXK 3D33A 4QHKI 4YMPA 3JXAA 4M1CD 1X9LA 4E41E 2V2XA 2N1TE 3QEQE 4P23B 3S3BB 1SLXA 3NIDE 1YJDH 2Y7OA 3MGTA 1W0VB 1R47A 4QTIL 3VI4F 1MAML 2DV6A 2NR6C 2Y1AA 2ZSWA 2XDHA 5ILTH 1AXSA 3BZ4B 4HFWA 2V3DA 4ADJA 1Q9KB 3RWJA 2PNDA 1FWXA 5L2KE 1B4JL 1DR9A 1EDQA 1VADB 1NC2A 4Z7UE 2CDFB 5E00B 5AG8A 3G6AB 5B39B 5SWSE 3SYPA 4DVRH 1A6UH 4FNTA 3M8OH 3CZEA 1DSFL 2WXNA 2PCYA 3IGAA 2R0KL 1ZSHA 4E9WA 2H5UA 5TH2A 3T1FB 1CG9B 5J56B 4CJ0A 5ISZA 3U4AA 1HCFX 1FNSL 2XWJB 3OJ2C 43C9B 5MEQB 3S3JA 1QFUH 2L8AA 1A1MB 1GGBL 4GKSA 1ET5A 4WQOA 2FJGA 4XNXH 3WO4B 1UJTA 2E47A 3V5KB 1NMCB 3EJJX 4HC1L 1YEDB 2D2CC 1CICC 3KPNB 3Q8AA 3I02A 2VDQH 3OF6D 3PLYA 4PM1A 4MJ5B 4U4BA 4L37B 3TZVB 4LHUG 3Q7JA 2JKWA 1JNLL 4GAYA 4PRNA 2N7AA 1NJ9A 3KPRE 2Z3FA 3WS3A 3IFPB 5IBLC 4WDIA 2FEJA 4AMWA 2QTVA 5CU9A 5BUPA 7FABL 5D7JB 2X70B 2ADIA 1OWWA 1NC4B 3IMSA 4NQUA 1NWPA 1ET7A 3B9EA 4X4MA 3VRLE 4ZNCD 1B0GA 4WW1A 4XN5A 2K9FB 3HZMB 2A74A 1FAIH 1YEJL 3ME0B 3RP1A 2OK0H 4JM2F 3BKJL 2BHZA 4YL4A 4KROC 4FL4C 2VSDA 1NCTA 1PX8A 5E51A 3U0PB 3WBDA 3QZWG 3UTTA 5JOFB 4ATWA 5GHWL 4Z78B 3US9A 3PDOA 4JHWL 3V4PH 1F56A 4HUKB 2FLMA 5I1EL 3PXHA 3V8OA 1MW1A 3O2DH 3ZZLA 3LPWA 2COVD 2LFEA 4XCEA 4DZBA 1RULL 4CU6A 3I9PA 2A77L 1WH0A 3WLBA 3PQYE 1EAPA 4I1PA 5M7QA 3LNIA 2Y5EA 3UXFA 2AJSL 4BDVA 3SDDA 3PDGA 4A2FA 2ZP0T 4Y2NA 1LK3L 5D6DA 4FJZA 4J2QA 4D8PB 3KAAA 2DQ6A 5ETUA 3UTQB 3WXVL 3FW6A 4K2UH 3ZDYE 3EDEA 5HGAA 1JPST 1JVOA 4N8CH 4EQ2A 4JKKA 1I8IA 1E5YA 1TQWA 3Q5TA 1DJGA 3P3YA 4RZCB 2KERA 1TZGL 4ODHL 2E6PA 3OJMB 1NEZA 2HKHL 3EDJA 3MLSH 4JO1L 3S3DB 4BHUA 2BVUA 1SOQA 5MERB 4ODXA 1IFRA 3IAPA 4PJ5B 4JFQB 4DFIA 3B7SA 3ZMNA 2O6PA 1PBYA 3B2PA 4JMXA 2ZSVA 4M5TA 1CGSH 4ABUA 3HS0B 4ONOA 3HZ3A 1S5IH 3F12A 2D0HA 2V17L 4OAWB 3WTWA 3PJSA 3UC0H 4CVZB 3C60B 3L3KA 2IH8A 4OCSH 2P44B 3UTPE 3RWEB 1YAIA 2AEWA 4JKPL 1HHGA 3B4NA 1RPUA 2JCCE 5CEYB 5J57B 2VR3A 1UA6H 4MMYB 2Y7QB 3BFQG 3A24A 3W81A 4ETQB 2VDRH 4D9QD 4NHUB 3MXVH 1WV7T 3QJTB 4HIHA 4OJFL 4WEEA 4X99A 1MCOH 5E6SB 1X5KA 3TOPA 4ZUVA 4A2MA 1TIUA 4GKZA 4U31A 2A74C 4HEMA 1IZJA 3MA7B 4FTDA 4JO2H 4XX5A 3SE8L 3TJHC 1ZDSA 2EIJB 5ITFB 5D7KE 5E5MA 1QBAA 5FDWA 4LP4A 1EDHA 5I1JH 4PN6A 2DRUA 1SHWA 2YKLH 3H9SE 1QG3A 5C09D 1HE7A 1SFHA 2AJZB 4U6TA 4GI6A 1IILE 2IG2L 2ESVD 3NAAH 4YDNA 1J0ZA 1L9OA 4NS0A 2VDQB 2WMPA 1I3GH 1PLGL 3LXAA 2QQKL 3JWDL 3O0RL 3FQRA 4Q9RL 4KK9D 1KTKE 4N6RB 1G0YR 4GSDH 1QW8A 3P0YH 4NQVA 3LHAA 3W39B 4BH7A 1CGYA 3SDDC 1J18A 3WFHA 2MQGA 4ODTL 4P05A 1M7XA 5D6DC 3SJVD 1K5NB 4HOMA 3CHXA 2F53E 4NM4H 1MH5A 1UB6B 12E8H 4O02A 5HVWA 2APVA 1KFGA 1O5PA 4G82A 3RTLA 1OK8A 5D7LD 5KJ7E 3TJPA 1HCVA 2JKLA 4ILDA 3SPIA 3OZKA 2BP8B 2WOBA 2EE9A 2G60H 3ETBJ 4L5FL 1FPTL 3PHQB 1FDLL 2LHAA 4QRUA 1VACB 4K7PL 3BIAX 3V4PB 4OGXL 1HSAB 2XQYG 1CYGA 2P5WE 3K4ZA 4QOKB 4H0HB 1KWKA 4N8VG 3LN9A 2PTTB 3L9EA 2BY0A 3CFJB 1PJWA 3BWAA 1B2WH 3FT2B 4N0YL 5F7LB 4JFPA 1KCUH 4CDGC 3ZHNA 4RRPG 2J8OA 3SCMB 3OAUL 5ID1B 4HPYL 1KULA 3BVWA 4XMXA 2X3AA 2KT6A 1LD9B 4NC1C 2N0MA 3QO0B 3ARDB 1C8PA 5HI3C 5IMOB 1MNUL 1KXHA 2YD9A 3GXFA 3FXIC 2ZUWA 3I9GH 3MQIA 3CFDA 1LQBC 2IBBA 3LNFA 3QULB 4HMEA 4HOXA 1OAUH 2QV2A 3JV5A 2WIIB 1MCFA 1S4IA 1IKFH 1PZ5A 3JWOC 3TYFB 1DVUA 4OZGF 3HZYB 5TTRA 4RZKA 3U7AA 1D9KA 1KIQB 1XGQA 5HGHA 3R06A 3T04D 3VG9B 4HU8A 4L8SB 1NCWL 3OKNB 3UG5A 1PZSA 3ZSSA 1JS4A 4E9TA 4NC2B 4QXWA 4WY7H 5I5MA 1LE9A 3OXRA 2MNJB 5GS0C 1UTDA 3I6KB 3QXDB 3MRDA 2WXJA 4WWNA 5EBWA 3DIDA 3VTTA 3DURA 3MJ7B 5I6XB 2A5UA 5HHPB 4HWUA 1ONQB 3AW5A 1CFVH 3BUBA 2GAZA 5DD1L 4EI6A 1TVHA 4Y9CA 1F4XH 1UB5B 1D7BA 1KPUB 4Q9QH 5LBSH 1AHWA 4PBDA 4CDHA 2MQCA 4X8CA 4UQ3B 1RUKL 2VDRB 2Z34A 2P7TB 1LM8V 3IETB 4NM8L 4KNQA 3QG7L 4XCFH 4LLWA 4ZUSB 3S97C 1NBZB 1DJWA 2R83A 3SGDI 5C07E 5JW5B 3UTZA 3SE6A 1SXZA 2C1OB 1GS7A 3D18B 5F88B 1LWJA 1VFUA 4Q89A 1VAHA 2I60H 1KEGH 3BAEL 5D5ME 3GSOA 4L3EE 3JTBA 4WSJA 4W9EC 5AW9B 4NGHL 4CRPA 1NCDL 1GC1C 2GSGB 1H15A 4OI9A 4D9RE 1KN4L 2Z7WA 2UX7A 2CKNA 2K3TA 3WYRA 3L6FA 3PGFH 1MIEL 2ALAA 4TLSA 1RZKL 1TQUA 3RGVA 4XNMB 3CZFA 5D72L 3VXNB 1YPZB 4Z7QB 3FBQA 5KVFL 1MHEB 3RKDC 5FM5O 2XVGA 1XF3B 4JPWL 3FH8A 1ZTXE 3CQFA 1AJ7L 5I26A 2EZ0C 2XWCA 1B90A 2ADFL 5EC1A 4TKWA 4OGYH 1AR1C 1VFOA 2FWUA 3UZEA 4GJTB 3NSYA 4TVUA 3FONA 2AQ3A 3MCLL 4LMQE 3TN0B 2BSSB 3P4MB 3A4FA 1T0PB 1JGLL 4Y2OB 4BFBD 2EDOA 4YHIA 5ESVB 4XOEA 1A02N 1DL7H 1CK0H 3O8XA 4RGMB 1D9KC 1JNHA 1R3LB 2XXFA 4JO3H 2KKQA 5E2VH 5E6UB 3GSUB 2ALWA 4KAQL 1XCWA 4ZTOH 4NB7A 2BP3A 1IAII 2ZXCA 4YZWA 2IC2A 3VMOA 4P04A 3HNVL 2DQTH 1NPNA 2GC7C 5I66B 2DQFB 1BZ9B 4YDZA 4PGEA 1F90L 2DBLL 3IFNH 3ML8A 2EIZB 2APBA 2NT0A 1B0RA 3FUEA 4IOSA 4GXVL 4MDJA 1Z0MA 4YHKL 3SDCD 1AHWC 3SOTA 4KTEL 3S4SB 1Y07A 3O11A 5IR1A 4Z7VE 2FQEA 3V6ZA 2MPVA 3VWJA 4XMZA 3STLA 3Q5OA 5KS9E 3BAYA 4JDEA 3D39A 2G5BA 4JAMB 4Z5RA 4F1ZA 1AQHA 1OTUC 4JGNA 5F9JA 3VXME 1QFWI 1T89C 5I0VA 1CFNA 5HVHC 2VLJA 1GGIL 1Z6JT 1EFXB 2EYRB 1NAKH 2OULB 5F9WC 1OIOA 5F97E 1MI5D 4PY7B 3ZE0B 5AVRB 1A4CA 3BEWB 5AALA 5INCB 5D1XA 4AMKL 2VR9A 4BUHA 3HNSH 2R69H 25C8H 3FU9A 5T3ZE 1HHJA 4IKNA 5CHNA 4N0CD 3GMMB 3K2KA 3LQAC 5DT1L 1M53A 4W4NA 3U6XS 1JWSB 1OM9A 1OAXH 3WUWA 4OCXL 5ICZB 1QRND 3LZPA 5FB8B 4J3OF 5FYKH 1HNGA 4OFKA 1NDGB 1VPOL 4FG2A 4PJFF 4UIKL 2C5DC 5IJBC 5EBGA 5KSAD 2AK1L 4R26H 4YGAB 3RNQB 1GYAA 2RFXA 3EF7A 1JD9A 3MRLA 1A7OH 2X89D 3QPXL 4HKBB 4MSWB 1TQVA 3UZEC 3QRFM 4KXDA 5DUBA 4FXGA 3PGCA 4URKA 3VXSA 2CUIA 4GBXD 1YNLL 2OA9A 4PB0L 1U92A 4NPKA 5E1AB 1SYSB 4IGBA 4LCWB 4AZ8B 5IJCC 3O8XC 1BJMA 3F6JA 4RMRA 2VT0A 4WNSA 4BJLA 4ZNEE 4ZXBB 3OAZH 1O7DE 3NJLA 2DYPA 1JHKH 4U6VL 1EAJA 3O3EA 5IEKA 2XYBA 2JVUA 1S7UB 1VENA 4TULL 3T8XB 3EDKA 1GGUA 2XACC 4UT7L 5HY9A 2WQUA 4LSQH 3W56A 3L3IA 4PQXA 2W07A 4EN3B 3IVKA 4E0RA 4M5YL 3WI9A 4FCAA 3GNMH 4ZODA 2E0PA 4D0CA 1V3LA 4FEMA 4XCCH 3PWVA 2Y22A 3TV3L 1HH9B 2WK2A 3KBHE 3K8LA 5ESQA 1FNFA 1LILA 3ZYIA 2YGNA 4BQCA 1S9KC 1FNGA 3ILQC 3VXRD 3UJJL 5AD0A 1ZXQA 2NNAB 4N85A 5J3HC 3O3DA 2AV1B 3ARXA 4RFOH 1G7PA 2I5YL 2VDKL 3LH2L 3DSNB 4WI7A 3VFRB 4A7UA 1QFOA 4E2OA 5E2TH 1NCIA 2DJSA 3IMWA 3D0LB 2C9QA 4XNZC 3VUAA 2Y24A 3IJ7A 1LEIA 3D34A 3F85A 4IBLT 4RWYH 3FSVA 4Y2LA 2AW2A 2NZIA 4GUOA 1OARH 2KZ1B 2XIDA 4L4TD 4M62H 4J3UA 3T0EB 4KZEH 1LP9F 1S7VA 1ZEAH 3QIUA 5HD8C 2P3YA 3U6XA 3U6RA 5CGYD 3VGBA 3NFNA 4ZFZB 1DCLA 4X6CE 3T8MA 4EZMA 2GJPA 5DRZB 5AB2A 5IW6A 4ZMLA 1QTYT 3JZYA 4K3EL 4K7FA 5LQBH 5F3BA 5A2AA 2BHUA 2E59A 4JFDB 4KO5A 4WHTB 1DQVA 3WJMA 3TURA 1PTZA 2CJ3A 1X7SA 2AERT 4ZMAT 1E4HA 3L2MA 3ERXA 4RMVA 4TPRL 1K6QH 1OAQL 4MQTB 3IJHB 4RLDA 5EUOE 2ZOTA 1HTYA 3NZ8A 4OLUL 1W0YT 2VLLB 3ESMA 3OLDA 2OJEA 1QO3A 1BFSA 1LO5B 5AVVB 4ZW7A 4IGBC 5FK9A 4MS6A 2R29L 1U95A 5HJ3B 2BOBB 2IQ9L 4P3DA 4PJAE 2Z7YA 3BSGA 1RZ8B 1UVQA 1DP0A 2AXWA 3VWKA 1TYJA 4PGCB 3OMZA 2XPYA 3MMEA 3LQZB 1RUPH 4Z3GA 4NUQA 3OAYH 2H9GB 5JOPD 4JDZB 4I0PA 1LWHA 4BIKA 3B9KA 3FB6A 3VAEA 5FYLE 2QMJA 1J1PL 3TWCL 1VEPA 1J5IA 5DO2C 1MHHB 1ETA1 1OAKL 2XUWA 4L4VD 1NBVL 4MS8D 1V7NH 1OSZA 2MCPH 3RU8H 3VRIA 4YGVA 2M8XA 3BSZH 2R7EB 4NQDD 4QPEA 2BMKB 3CMOL 3C08L 3V5DA 3ZDXB 1AMXA 3U30B 4KHXH 1MXDA 3KYKL 3GPSA 3PGDB 4UQ9A 5C0FB 3OF6A 1L9QA 4NJ9H 1KJ2A 3MUZ1 3WFCL 3T3ME 3P9LA 1IARB 2H6PB 2GCYB 2X53A 4ZT1A 5HGBA 3QUZD 3BIKA 3FFCE 4APXB 3FN0L 5BVJA 3WCYA 2WXKA 3SN6N 4UAOC 3E1ZA 3CSYB 4PJXB 4FXKA 2UZPA 3EUDA 4DF9A 1AIZA 1XGYL 4JFXB 4X6DE 3VA6A 1PYWA 2ENJA 3QZNA 1PZAA 3QIUC 1CDJA 5J1AA 2Q5BA 4QXTA 4HT1L 3MRIA 4GEJA 3QWOA 3B5TA 3WN5B 3I6GA 2BJMH 2AEIT 3BSHA 1JGUH 1RY7B 1W80A 3D4YA 3QCVL 4NP9A 5E1GA 4WI0A 3KYMB 5L8KB 3RFZA 4QHLB 3N91A 4IRZL 4AW7A 1BWWA 4MZ2A 4A7SA 5MENB 3WG7B 3WTYA 4OSUL 5KVDH 2PKDA 1ZLWH 1XTMA 5HYJB 4LCCA 1AVAA 1H5BC 5I16A 1VDGA 4NZTH 3JTTB 4M6ML 1H3TA 1I1FB 1W16A 4IIZA 1G7IB 2KPWA 3QQDB 3RI5F 4OTXH 4AGMA 5E8OB 3TT3L 4DGVH 1JGVL 1KJVB 3QIBD 4Z77A 1C08A 1RK7A 1XDTT 2DMKA 4X4KA 4CC4A 3BPNB 3DKHA 3VWKC 1IBFA 2HT2D 3TO4D 3CJJA 4YBHA 2ZXDA 2YQ2A 2ZX7A 1SJEA 1R33A 1M56B 3MV7A 2AEPH 2HVJA 4M8RA 3O4LD 1KB9K 5A6IA 1INQB 2ZP8A 4YHLH 2BNQA 4I0PC 3UAJA 4YDLB 5CBAB 2FR4A 1KV7A 3B9KC 4P57B 4GPVA 4A6YL 3MBEB 2YPLE 3BPLB 4HPOH 4PUBH 2ITEA 5KW9L 1HHKB 3TIDA 5H35A 4XAKD 1AC6A 4UQEA 4MD5A 2O61A 2ZCZA 3ELQA 3QDME 3AXHA 1PX3A 1QA9A 3FRPB 1PCXA 1EJ8A 1UD6A 2IDSA 4WSGA 2X2UA 1S5HA 2FATL 1BCIA 4M56A 1UCTA 1A4BA 5GGQH 3DNKA 3EDFA 1EAQA 2JXMA 1AO7D 4ELMA 1KG0A 3KYNA 3QFJA 3ZKMD 2XQYA 4ZPVA 1YEHL 5L4IA 4BGLA 1CXFA 4QJ4B 3NABL 3GJEA 1IQWL 1JWUA 3ZGIA 1RLWA 4JN1H 4FXKC 1YUHB 1F2QA 2AXJA 2QSTA 4RRPA 1N9PA 1LO0H 1LDPL 1UUSA 3TBTB 1KZYA 3VDCA 3ECBA 2ZYIA 2UUDH 4QJ5B 2ZUUA 3CFCH 4TUUA 2PO6D 1XIWB 1N6UA 1X5LA 2E3VA 4XXWA 3OKYA 3BLPX 2V0AA 4FMVA 4XAWH 3EW3B 4N86A 1CYWA 1ZIBA 2MOQA 5I75B 1OQOA 5BJTA 3FUNA 4X0NA 1EK3A 2KLRA 3BH8A 3ZOAA 3ZYZA 1S6NA 2KZKA 3IJSB 1E4XL 3IXTB 4UV7L 3NACH 3NJIA 4XZ4A 1A7NL 1E4JA 2QR0B 2X1XR 4LCCC 2XN9D 4NBYB 4WW2B 1JI1A 2AANA 1NCGA 5D8JH 1COBA 1L3WA 1JXDA 2DQGL 2ADJA 3REWA 4RDBA 4XP9L 1G7HB 2D31A 4BFJA 2H8PA 2PETA 4GRMA 5DDHB 4LKXB 2OXGA 3SJVA 1HH6B 4L3CA 2HTKD 3VFMA 4I7ZC 4X9HA 4L1SA 4CC4C 1UQSB 2OSLB 2VLRD 3F5WA 4LLVB 4W6WB 4ZFOB 2H32H 4PRAB 5D7LA 3SKMB 3E0GA 5JZ7C 3WE1A 4WUUE 5KYXA 4JZJC 1TQCC 4TXVB 5H4ZA 2H0JA 3DJZA 3RLSA 3CDYA 3UAJC 5FW8A 3SZ6A 2OYLA 3PL6D 5CKAA 1EUTA 5KZCB 1AGDA 3FTXA 1FL6A 4XB8A 2AZUA 4LLUB 1VLXA 4DERA 3QB7C 1ZA3B 4NUPA 3L9YA 5IG7B 2BVPB 1QUNB 2B4CC 2ZPKL 5I76B 1S7TA 5JLZB 3WY4A 4DWHA 1WEJL 2WLZA 4UTBL 4G8GD 3OTTA 2G2RB 1O6VA 3EH1A 2LR4A 4G43A 2C9RA 4PJ7E 4UU9A 1G7LA 1UKQA 5GGSA 4YR6A 3PDDA 4G6ML 4HUWB 4JW3A 2OMUB 5CIPA 1VZGA 2CDGB 3U4EB 4CU8A 3U7YL 2GJ6B 3EYOB 3KPOB 1MOEA 5LWYH 2MCMA 1M7DB 2WN3A 5C3TA 4RGNC 2J72A 1USZA 2BS71 4YH6A 3TBWA 5IQLA 1DQDH 1AD9A 4JFOB 2ETWA 4OM0L 5KYUA 2DDQL 4Z7WF 4EJ1C 4EI0A 2YAHA 1RIVH 3OBAA 2PMZA 4NQCE 4XXWC 2Z7ZA 4OT1L 2ZWNA 4C83A 2ZOKB 2DB8A 2NDFA 5FKPB 3VNZA 2F9BT 3ZRSA 2E6JA 3IDJA 3N9GL 5CSZA 5GZOA 5H37H 2VDPL 2JQZA 2Y36L 5LXVA 1RJYA 3X13A 3JSSA 4I88A 4QLRA 3QUHA 3QHTC 1F1AA 2CM6A 4S10A 2QT6A 1A65A 2XFGB 3F58H 3MRMB 5TDPA 3ZTJH 1B9KA 5GPRA 4N1EA 4MAUH 3P2DA 4G83A 2XWBB 2JI3A 3ETTA 2OZ4H 2HJKA 2EJ1A 1EHXA 1OY3B 3EYUL 4QRPE 5LBVA 4U0QB 4QHPA 2BFVL 4F58L 1C5DB 1C8QA 5DCCA 4MNHB 3UEZA 2YD4A 4WEBH 4X6DB 2W60A 1A5FH 4P2CG 1WFOA 1TZIA 3ZDZE 1KB5A 2J2ZB 3K80A 1U8QB 4Q6IB 3MFGB 1ITCA 2W9EL 4BZ2H 1T1XB 1LQSR 2J57A 2XQ0A 4BQ8A 2D9QB 3BP7B 1KELH 1ADQH 3AXLA 1BMGA 3KLKA 4MCZB 1WC7B 4CU7A 3VQMA 1ZLWK 3W0WE 4QHNA 4U6YA 3RJOA 3Q44A 3ULUH 9CGTA 5DC4B 5AAWC 3FU3A 5DMKA 3UTSA 1INEL 3KW7A 5CCJA 5CCKH 5I1KH 3S3SA 2XV0A 4OFYA 1A7BA 1BF2A 3FN3A 1YMHA 2O72A 2OP4H 2H32B 5C0JA 3NJKA 4I3RL 1IX2A 5CP3H 2EC9T 4ZMWA 2DQHH 3F62A 5LGHL 3QUXD 3ULVC 3WU1A 1CDBA 2ARJQ 1TEGA 2BNUA 4F7TA 3WLWC 3BEVA 4IU3B 3ARTA 2VCOA 3G5ZB 1YHPA 2FLRT 1X5MA 4KK6D 3VH8B 1H3PL 3OXSB 5F93C 3FQNB 3OGCA 4V1DA 5IBTH 1MWAL 4Z18A 5IQ9A 2A1WL 4X7TA 1HYSD 3ARVA 1RPQA 4PJDF 5L2JB 3TONA 1KCLA 2CRYA 3BDYH 3JV0A 3HR5A 3JTSB 1M71B 1F45A 2XBTA 1ZV5A 4K3JL 3QI9A 5J13C 4FG6C 3X14B 4N0UB 4QXVA 2PN5A 1OGAA 4FD0A 2Q8BL 4HS3A 4IKJA 1IGYB 2Z0BA 3VCLB 2BSRB 2BIMA 2Z8VC 4NO5B 3KXFE 2F54E 2R23B 3BAXA 3GSNH 4XMLH 5A3ID 3HHSA 1R24A 3SPVB 4M7JL 2XKSA 2H2PD 2P5EB 1DVXA 1P69B 2B0SL 4AQAB 1KBPA 1KSRA 5C3IA 2HMIC 2C4FT 5C0AE 3VFPB 2IBZY 2NLJB 2P43B 3ZQ9A 5BMFL 1RURH 4PJHB 4QNPF 5BZWA 4HIQA 4PRDB 1E65A 1HHIA 2EDFA 2BVQA 4MYPA 4M5SA 5KVEL 3X3GL 4PVLA 4OGAD 1Z2KA 4OFQA 1PQZB 1S2EA 4OBRA 3WHXA 1LWRA 1HS6A 5LO7A 3MC0A 4YFLF 1MFUA 4N90E 2Z31B 4XCYA 3W9EA 1XXDC 5FGRA 3BZEA 4ALAC 3NPZB 4ECNA 1JNNL 3TGXA 4APQA 4M7KH 3S96A 4L05A 2GIYA 3ARFA 3I75B 4DGYH 4B95C 3D48R 2PF6A 2Q8AL 3T2NH 3EOAB 2JTYA 4HYTB 2DW5A 5TPWL 1CXEA 3T6VA 3HNTH 4P23D 5AZUA 2Q2EB 1KPVA 1SN0A 5DRXB 3V4VA 5KSAA 3MACL 1ZANL 2YD7A 2EABA 1IAMA 3FB8A 4Z9KB 4LOUD 5TQ2L 3FTSA 1BQKA 5DZNA 2NTFB 1C7TA 4J5VA 1Y0LB 1L7TL 5ALBL 3MV8E 2WOYA 1A6WL 4K7PX 2B2XL 4EDXB 3SPJA 2EH8H 4IRSB 4N5ED 3MV9B 5GGUB 1WGOA 2YPVH 2EYTA 3SO3B 4LLQB 3CBJB 4W68A 3ES6B 3ZU8A 3DTUB 2TSAA 2APTA 2YD6A 3IJ8A 5AB1A 2BLFA 4WGWB 4Z0BH 3ZHFA 1IT9L 5DO8A 4POZD 2IVFC 2OBGA 2DQEL 2AMUA 2QJDA 3QI9C 4MD0A 2IANE 4FADA 2LU3A 2WCGA 2GY7B 1QBLH 4IK6A 1SBBA 5D6CB 4NO3B 4OFPA 3PS6A 3TZVD 2O1AA 5EWIL 1N18A 4PJ7B 4Z8FL 4U6XB 4AYGA 2O5ZH 3G6JB 2O4EA 4LVEA 1YYLL 1SLUA 2P8MB 4GG8B 3H3PH 5D7JD 4R97B 1NC4D 4F7PB 2E76C 3PRZA 1L9NA 3P9MA 3DRQA 3NA4A 5T1MA 3UJIL 5CN3A 3GMRA 1AGEA 4JREC 3MZGB 5E8EA 1DQMH 3BPCA 3C8KB 1EVTC 4NN5B 4PJGB 5T33L 1QYGL 1AMYA 2I07B 2J43A 4HKXA 4JNXA 5DJZA 5GSRB 2Y6TE 1XR8A 2KDGA 3CXDL 5IREA 5EU3B 3MNVB 1AXTH 1NTDA 4N0CC 4WGKA 1PG7L 1PD1A 5JXED 2UY7B 2NY1C 4APQC 3FTGA 1GTFA 2XZCH 1G94A 5DMIL 3ARFC 3BVDB 3LNDA 4NKDA 4MYWB 2DJMA 5T8IA 5B39G 2APFA 4N26A 3GSNB 3QJXA 3OKMA 5DD0H 3GT6A 5JO5A 1BD2A 2ZCLH 2X1WL 3VFWB 4LSVL 4PJBA 3B8YA 1NCBH 5KSAC 2Y23A 4IJ3C 3NUKA 4Q6YA 3QR2A 4P4RA 2IOMA 3OR7B 1T5WB 4WI6A 4ISVA 2X6AA 1YEEL 4J1UA 2DI8A 2ZXQA 4N9OB 1FZOB 3V7AE 2I7OA 3HC0A 1D5MB 3DX8A 1FVEA 2QSCL 1KTDB 3Q2WA 4LXFA 3PHOA 1UD8A 4MDIB 1MWOA 4PJ5D 1BZ7B 5SV4A 5I73C 1PKQE 1MG3C 1RJLA 2WTRB 2XV2A 4G6KL 1GMIA 4B9KC 1QFHA 2VQUA 1UXSB 1N4XL 2KL6A 5IFHL 4RVBA 1FFTB 4FZEH 4XBEL 5D1QA 1OANA 2WINB 1WAAE 3GDBA 3SKNB 2XG4A 5T1LA 4R4FL 4GS7C 4PI2A 4YSEA 2OCFD 4HBCL 2F5AH 4UDTA 4JM2A 3C60D 1ZE3C 2ZD0A 1HN1A 5E9DE 1QR4A 3MSPA 2SEBB 2L7UA 3ATEA 1KIRB 4G42A 3GF8A 1OTSC 4CSTA 3GSWB 3UZQB 4BM7A 4UV4L 4BZ1H 3MRKA 3QDJE 4X9GA 3FBKA 3PNWB 4MASA 5KSUA 2Q3AA 4RMUA 3IDGB 3SDXE 3QQ4B 3QYNA 2ZKHL 3Q6GL 4N87A 2VQ1A 5FO8B 2EICA 2ZYSA 4LSUH 4PJ6A 1YEFL 4FP8H 5I0ZA 4I4WA 1QWNA 4OZIB 3S5ZA 5LAXA 2AAAA 1BBJB 3UAAA 1DCEA 3TVMA 5IFJB 4NN6B 4NQEE 3D30A 4YSDA 1IGMH 35C8L 3CSBA 1A6ZB 3RYMA 4JB9H 3HCVA 4PS8A 8CGTA 4GRWH 3KBPA 4P9HC 1E8ZA 5CN2A 1I4FA 1D2OA 3MUGA 3ECVA 5J6GB 3HG4A 1B3JA 4XX1E 2FYYA 4AM0A 4R96B 2WCSA 5D2LA 1C12A 1U8IA 2JFCA 2KHAA 5DJCA 2G9KA 1EJFA 1MFAL 4HKZA 3VI4E 1CO1A 4U7SA 2F61A 2RIKA 3D3VA 2EE3A 4OB5H 1NSNL 1UD3A 4UILH 1WLHA 1Z3GH 4M6OH 3T5WA 4DEPB 4HK3N 4XVJH 2F54B 3P30L 5CJ8A 4OLEA 5FM4A 2XA3A 2C3GA 5TE4H 1RKRA 3VI3B 1A64A 4WU7B 5C0BA 4UNIA 1V3KA 3RA7L 3RBGA 2UWEF 1MG2C 1FHGA 2EDEA 2QSQA 1G6RA 5HYQA 1TCMA 4U6HA 5F3HA 2L7EA 1JGEB 2H26B 5HHNA 1KLFA 4B9FA 4XE5B 3B2XA 4JANB 1ZJBA 3VFOB 4GQZA 4BE5A 3IMUA 5KUMA 4HF5L 3B6SA 3QXAB 1IC4L 4QOKD 4BZYA 4IHBA 5EZJB 1T3FA 4U2ZA 4M9PA 5D1QC 5FLVA 5IVXB 1LNUA 5E23A 3SKJL 5I6KA 1HSBB 2ARWA 2CGZA 4I89A 2K4WA 3AUWB 1E42A 2CHXA 4JM2C 4OFVA 5D96C 1N5AA 5ICXA 3SCMD 4WO4A 1I8UA 2CU9A 1B6DA 2AP2A 3FUFA 2IALA 3KJ6L 2XQBL 5DJXA 3RVWD 2WJ5A 1OKEA 3HFMH 1T80A 3ARDD 4F8QA 4PS4H 2G9HB 2XG5B 4KOBA 5AENA 4Q2ZA 4NLHA 3RURA 4RQQB 3QRGH 2IH9A 2F5BH 2EO9A 1P9MA 4OD1H 3H9HB 4R2GB 5CP7A 4JUSA 2PLTA 2WQSA 1YNTA 2X6VA 1DHKA 3GMLB 2XIIA 3QUYB 3TVMC 4XHQA 4ZSOE 2JKTM 4JHAH 1GZPB 2Y1ZA 2PYEA 5HJBA 2X1PA 3EJUA 3V0WH 4MA1C 3OM3B 3CE1A 4CAGA 1E4WH 4OQTA 3H54A 1QQDA 2B1AL 3N85H 3QXUA 3NIFB 1UADC 3K71A 3IPFA 5EOCJ 1B6UA 1UM5H 3O2WH 4JPVH 3TO2B 1Q0EA 2PO6A 4FJ6A 4U1HB 1QI4A 2YWZA 3M7OA 4FFYL 1JF1A 4LRNL 3L1FA 4FN0A 5JIMA 1TJIH 3GMOB 1KB3A 5JW4M 1OLZA 2BPBA 3HI5H 1SOSA 4XMUA 4BSWB 1U3NA 3IFOA 4OCMC 1I7TA 1CTNA 2FSDA 4X4YB 1SVZA 1DQLH 2OMTA 1J0IA 1GCFA 3FSOA 1JCKA 3ALXA 1I31A 1O6SB 2FBJH 4I18B 4K9EH 4OZHF 1QMUA 5A2BA 4LCVA 2CO7A 1I7RA 5C08E 2WN2A 3BD4A 3GSXB 4JMNA 1OCOB 1DBJL 3HVDA 3NRFA 2OMYB 2IDUA 3II3A 5GS1B 1WBXA 3OX8B 3KPMA 4GRWB 1KCRH 4JPKH 4F15C 1I3RA 3LZOA 1QLEH 3HS8A 5MEOB 4HGMA 4L5FE 2BRRL 4TSCL 4MZRA 3NQKA 3IDMA 3RUGA 1FZJA 5SX4I 2VW4A 1AI1H 4ODUA 3ZTNL 1MIMH 3EOYG 4I9WD 3NJVA 5IHZA 2G3NA 3PL6A 3ZBMA 3VXQB 3T0VA 4WO4C 3AABA 3S5LA 4HCRA 4AG4H 2QFPA 1UZ6F 2SODB 3FHEA 2VDOH 3CVHA 3HI6H 4FCHA 4G80A 5ANMB 1E8WA 4H4NA 4P59H 4RMWA 4Y1AA 2R56L 4H8WC 3WNOA 2HXAA 2DQIH 2HRLA 4AL8H 3TN0D 3L16A 3ARBA 2YXMA 2R0WL 2X1QA 4I9XA 1QABA 1P9MC 2A38A 4G3YL 4U7MA 3GIVA 1IUZA 3QDAA 2J55A 1FZKB 3O9WB 3TBVA 5AVTB 4F3FA 4URTB 1CDIA 3GZKA 1UWGH 1QSVA 5KSBA 1DLHA 2WSDA 5C0ND 2GI7A 1A7PH 2AFNA 2CKBL 3E8UH 4YXKH 3Q48A 4JO4H 4PRHA 4U0RB 1JG9A 5EU7E 3WFBL 3NTCH 1U91A 3UCQA 4MAYA 1GL4B 5A6MA 5T1DH 1D5ZB 3H2PA 4UCFA 2P46B 4ELDA 4HJUA 3CN1A 3OHXB 3FB5B 1UC6A 2XKNB 2XPGA 2PO6C 5EBMB 3NFSL 1M1SA 3A6BH 3NZHL 4NCC2 4AYEC 1AQMA 3O3AA 4UT9A 4AVJA 3H55A 3BGAA 2NY5L 5CZVL 5IESH 2YQBA 2GK2A 1NCCL 2WUBL 3MYJA 1FV1B 5AW7B 3MLVL 5JIHA 3ZSTA 4WFHD 3AQXA 3LD8C 3SDYL 5HDOA 5HSFA 4WUKH 5DK0B 1N6QL 4F5CE 2DEWX 4WIQA 4CMHC 1J1XL 3VGFA 4ANXA 4OW6A 2DQJL 1Z32X 1P7HL 1FNLA 2YOCA 1EFXD 2VSCA 3IJYA 4U1SA 2E27H 1ZSDB 1MFVA 1OD9A 3RVXC 3K2UL 2F74B 4XMVA 1GA2A 4PRIB 2QKIA 1NGZB 3BHBA 2VO5A 4XPBL 4QY8A 1U6AL 3V6FA 3F7YB 1S7QB 3STZA 3PF2A 1OGTB 4J27A 1SLVA 3LKSB 2FEEL 2VZVA 1NL0L 4UDUA 4PJIF 1U4FA 2HJFA 3PL6C 3FOMB 4YDJA 1IM9B 4QTFA 3UTTE 5JW4N 1SYVB 2PR4H 2YAEA 3RIAK 1DVFA 3CZLA 5GISH 1XCXA 1JOIA 3U7WH 5A2CA 4A7QA 1CTOA 3QZOA 5DQJB 1ACZA 4HIJA 1X5IA 1KBWA 2GTZB 3RY5A 5BVPL 4OZGE 4M7LH 3NT0A 4BK4A 5E2JA 1IIKA 2QKSA 3ARBC 1N12A 1TLKA 5JNYB 5F89A 3SQRA 4ZFFB 4LCWD 1BGXL 5HJGA 1QLEB 4G5ZL 4ZXBD 2HRPH 4QXUL 3ENEA 1T4KB 1IGTB 1KN2L 4N0FB 3S4SG 4OF3A 3IDIB 3D85A 1ZOXA 1GHFL 1UWEL 1JPSL 2X4RA 2VH5L 1PIGA 2IAMB 1WD8A 3BMVA 3Q2LA 4CA4A 1D6EB 4BFEA 2VMCA 4EN3D 5IIEA 3EH2A 4P9MH 2VDOB 4KJPC 4WFFE 4F37K 4BSJA 2ZKYA 1AKPA 1TZHA 4ZQKB 4NBZB 5J6SA 4H8HA 4GOSA 4GUPA 4HS8H 3VE0B 4J8RB 5IJKA 5BO0D 2WSKA 3ARSA 1XH3A 3I50L 3WO3B 3BN9D 4ZS7L 2UYLB 3V5HA 5KN5B 4DSYA 3OKEB 2H1PL 3RDTA 3WFDH 1F6AA 5DRWA 1N0LB 1J05B 4PWJA 1WO2A 2A6JA 1MCBA 3AU1B 1A7QL 4EI5B 2XFXA 3DXAE 3R1GH 4PJFA 2J8UF 4LZKA 1ZIAA 2XBZA 2IWGA 1OE2A 3W5MA 2OM5A 4XC3H 3PUUA 3VXUB 1ASPA 4MCYB 1IC7H 3V95A 2QKIC 1QSZA 3N41B 4YHNB 4R3SB 3U9PL 3GUTA 1E6JL 2VABB 3WTSA 1T1YA 3T0ED 1TO5A 5K1NA 2ZNWA 5LGJB 2AGJL 5DYOA 1CE1L 2VLKB 3DX9A 3L5WA 3OKOA 1JI2A 4C56E 4L8CA 2I69A 3CH1A 1E28B 3UBXB 5IVNA 4YDIL 1DVFC 4HUXA 5FC9A 1FSKC 1Y1UA 3QDGE 4OIIL 4Z7NB 4JFDD 4R7VA 2FX8L 1MJJA 3HUJA 1NKGA 1KCVH 2R51A 5KVGH 4YVUA 2GHZA 3W1ZA 1VESA 4Z0XB 1OAJA 2ATKB 4DOHE 1P4IL 3INOA 4DP5X 1J8RA 2PABA 2XNAA 2R2CA 1MUJA 3T3PE 4HKJB 3QHFL 1N7MH 1QI3A 3IE9A 5E03A 3NCEB 5ABZA 1CIDA 4CUCA 4OZ4A 3CVIL 1MVUA 3FL7A 3DETC 3H6JA 3BWUF 1HK6A 1VADA 3WEXB 5IMMA 5DD6A 1I1AB 5FYKD 5T3XH 4TSBL 1A9EA 3E6HB 4ERSH 3CXHJ 4KROB 1FO0L 1LMKA 4FL4B 4LPYA 1QWUA 3RAJL 2GK0A 2EVHA 1I1RA 5BS0B 4XPGH 2XWJA 4Y5XA 2CGRH 2WC7A 2J1XA 2V9TA 1BSIA 4Q58C 1A3LH 4WKXA 1KIPB 3OD3A 2YEZA 3ZKND 4L1HA 2AJUL 5JYMA 4DFHA 1H19A 3BJLA 3UFIA 5IJKC 3LIZL 2CAKA 3BP6A 3J2PA 3QK0A 3KPNA 4XO5A 1QPPA 3CZGA 5HI5C 5FOBA 4ZAKA 3RDTC 4MJ5A 5DA4A 5B1JA 1RZ7L 3QH3A 3SOBH 2G5UA 4JM4H 1CVSC 2LLNA 3U1SH 2CO1A 2QGEA 2CJUH 2V2XB 2WXIA 1KCSL 5TK4A 5IQ7H 4WNJA 1U8KA 4MD4A 3MGTB 1U41A 1N0XL 3ZE1B 3KBEA 3VSVA 1TQTA 2BRQA 5D7JA 5C86A 1P7QA 4BFGA 4HMCA 2LAAA 2ZSWB 1AXSB 1JZ8A 4HFWB 1BPLB 1VGEL 3FQTA 3BUPA 1NIEA 3BQUA 3C6LA 3RWJB 3T4YA 4F93B 4ZMZA 1NC2B 5CEXA 5HVFB 4GI8A 3I6LD 3JWOH 2X38A 4MNGA 3C5ZA 2R0LH 1VJSA 3GHBL 5DR5L 3IGAB 4ZOAA 4B9IA 3IAGC 1F58H 5TH2B 5K59F 3ETSA 3HG1B 5MEND 4KRNA 1IMHC 5ISZB 4FNLH 3SYCA 4B9YA 1J1OL 5HYJD 4GKSB 2FJGB 2F68X 5JQHC 4GP4B 3RWGA 4FHJA 3ARYA 5GS0H 1AS7A 2ORBH 3HZKB 4JE4B 5IZ7A 2BDNH 1E6OH 1CD8A 2VB5A 3I02B 3LZLA 1ZHBA 3JT2A 3WIHA 4R90L 5FF6A 1IM3B 4PRNB 4EZKA 3UAFA 4YC2C 3WS3B 2NX5E 3QNXA 3EZ8A 4WDIB 3RL2A 1KXQA 1WZ1L 1MREL 5AW0B 1DANU 5C2UB 2CO4A 1IVLA 3GI9H 2ADIB 3MLXH 5DHDA 1TMQA 4O02H 4LSSL 1OHZA 2KQNA 2OR7A 4PLNC 3T6QC 3MKKA 1B0GB 4N6QA 1OT4A 4PBXA 4WW1B 1WWWX 1TO4A 3ZE2F 3NK3A 2E9WA 3MBED 4KI5D 4DP9X 1HILA 1N6VA 1T2QL 4TQPA 5F7DA 2XI9A 1MY7A 3L08A 4UTAA 1UOLA 2G75A 1BP3B 4Y5XC 2YD0A 1QSEA 1IEAA 3PDOB 4M1GH 3ZL1A 4YHZL 3WO4C 2BIHA 2CUHA 2FCBA 3BI9X 1AQ8A 4E9VA 1GC1H 1I8KA 4JY5H 4XCEB 4DZBB 1S78C 4XVOA 5E2UH 3TESA 4DO5A 2D4FA 3POCA 4KHTH 3AWFA 5DFTA 4ZAKC 5B1JC 3WLBB 4BSVB 1R6VA 1L3NA 4JFFA 4BDVB 1M05A 3EKCA 2ZG3A 2A2QT 5E99L 5FO2A 5L6YL 2H45A 4EZLA 4MMYA 2Y7QA 2GITA 1LP9E 5C2BH 1W8NA 5D7JC 1RL1A 4OLVH 5HGAB 2ROXA 4ACTA 4ODVH 1I8IB 2ZQKA 3BQUC 5G55A 5C3LD 3LEVL 1MRDL 2YK1L 1XGRB 2M1KA 4BFIA 1NEZB 4GT7A 1XIWD 4MNQA 1A6AA 2HTLC 4ODXB 1B0IA 4QI3A 3C5ZC 2OCCB 1QZNA 3LEXA 4PJEF 4X8XA 3D5OF 4FKKA 4UT6L 3IU4H 4H20H 2ZSVB 7CGTA 2AJZA 2F1EA 3ZZQA 4OLWH 5GRVK 1H8SA 5DMGD 4FGMA 3SPGA 2MTPA 2HFFA 2Q76A 3BPOB 3KWVA 4HJJH 1MFBL 3F12B 4N6RA 5LNEA 2H3KA 3PJSB 1Z9NA 3II1A 4DETA 2Z91A 1KJ3H 4NZJA 4U1NA 3WFZA 5AVXB 4HH9A 4OFDA 4XNUH 5C7XL 2JTDA 1IC5L 5B1KA 3FPYA 1HHGB 3TH2T 5EU4A 1K5NA 3RY6C 4ZZFA 5FDYA 2GBTA 1UB6A 1BXXA 5K93A 1JZ6A 2OL3L 3F6IA 4HIHB 4X99B 4AWJC 3L4CA 1JFQH 1SNRA 4ESKA 3N44B 4BA8A 4ZUVB 1HHHB 1HXKA 4GKZB 3AM8A 3V0JA 4ZW3A 4PP2B 4JY6B 4PD4K 4KKCC 3E7JA 5KZCD 1T20A 5DGQA 2H6UA 1BFVH 3AQDA 3T0WA 5J7CC 3WKML 5FDWB 1XO8A 1AZNA 2NTSP 4ZUUA 2AJXL 1AXIB 2VDNH 3CFJA 3AXIA 3QZLA 1N59A 3MZTA 3KR3L 3UIZA 3LRKA 4AEHH 3PV6A 2WMPB 3LQAH 3FQRB 2XWDA 4IDJL 1EJOH 1YJDC 4Y19A 4NQVB 5DVMA 4BH7B 1I8MA 3HAEA 2FJHA 2GJ6D 4KJWC 3WFHB 3VX0A 1JWMB 3DO4A 4G8FA 2UY6A 5IMOA 1WAPA 3HEIB 3SGEI 4Q0XL 2WBJA 3L1GA 1MH5B 5I1AB 4O02B 3PWPE 3WIIL 4HLZG 1GZHA 1NMAL 3LS5L 4V2CB 3OV6A 5T5NF 5CLYA 3KDPB 1J86A 4RETB 1QWHA 1HZLA 1RMFH 1S7WA 3HLAA 2OR9L 3FTVA 3INUL 1UCBH 4AC4A 3EJRA 4L29A 4QRUB 1PZCA 4TQEH 1PSKH 4OCYL 4K8RC 4FNUA 4AQ1A 3K6IA 1BXVA 3NH7H 3IEAA 4N28A 1NLBH 4TOYL 1ZLUH 3BWAB 3QCUL 1EZUA 2V9RA 4JFPB 4G11A 4JVPA 2BZ7A 4N2IA 3WDHA 4P2OA 3SQOL 2A4ZA 3OB0H 1IKNA 4YQXL 1YY8A 2D0FA 4LCYA 3V7MA 3LJ3A 2H3XC 2LW3A 3CFDB 2ZUQB 2FGWL 4LOVA 3MNMA 1YVLA 4CADB 1MNNA 4P5KA 1Q72H 1THAA 1PZ5B 3D18A 3HBPA 4NT6A 5D2NA 1HEZA 4X5PA 3AM8C 3BT0A 4GO9A 3VFVA 1D9KB 2R4RH 1XGQB 2FUQA 5IOPA 5HGHB 3R06B 1FZMA 3QJUB 3RWCB 2FX9H 2V7NA 1PG7X 3FCSA 2EVFA 3BO8A 2E4FA 3W11D 1E5AA 2QELA 1LE9B 3OXRB 3R8BB 4XOBA 2AQQA 3MRDB 5EBWB 2FWSA 3OKDB 1WJ3A 3DURB 3OKLA 3SCMC 2GJRA 4JG1L 3W38A 1MHEA 1BIIA 2GAZB 4EI6B 5CN1A 2FSEA 1EGJL 4NN7C 3RVWC 5JIKA 4O58L 3CZSA 5FW7A 5IHWA 2XN1A 5E6RB 1CDYA 5DHVA 1AHWB 1FNHA 4JFSA 3RTQA 3OC5A 1SMOA 4JHZA 2ZIDA 2OSWA 1BG9A 2WBJC 2X05A 1S3KH 4MTMA 2WWMD 2BSSA 4GKLA 4EXPX 2FJUB 1IFHH 4LLWB 5FIEA 2NRDA 1GZHC 1KOAA 1PY0A 1R1CA 1UM6H 3UTZB 2FH8A 2F7QA 4AIXA 2H3NA 3LPOA 3MRNB 2AHIA 1HCZA 3DPDA 4YDKL 5F9WB 3GSOB 3VG9C 3LMJL 2J4WH 4DW2L 1SY6L 3L9RA 1A6VL 2VDNB 1PF3A 2IBGA 4Q14A 3KWXA 3RZCA 4UNUA 2Y2YA 1BEYH 4AQ1C 5JYLA 3GJFA 4R7XA 1MCPH 1H15B 4JQIL 1JAEA 2WB7A 2ZONA 4DP7X 2R0ZH 4J4PA 1DLFL 3L6FB 1F4WL 3HB3B 5I6LA 3RGVB 2BWIA 3FZUD 4FLOA 3CZFB 4NNYA 3PG2A 2BW4A 1N67A 1Q8MA 4P2OC 2C3WA 2VLMD 2BNRA 3NSCA 1Q1JH 4F8PA 4DTGH 1IKNC 3CFTA 3U9WA 4G8EB 2P5ED 1YJDL 3RWIA 3SGKA 4F9PA 2DLHA 3FONB 4YSQA 4D0DA 1MJ8H 5ILTL 1ESOA 5DHMC 2VR7A 3TCLA 5IB3A 5HHQB 4YHIB 5MP6H 2AQRA 2YSSA 4QD2E 1KJMA 3AB0C 3O8XB 1KIUA 4DKEH 4C55A 1JNHB 5INCA 3GHPA 2YEVB 1UENA 4DVRL 1A6UL 1J9RA 3M8OL 3LAFA 4JRXA 3BWZA 2ILLA 4F33B 2Z31D 3Q5YA 4BQ6A 1VCAA 3EH4B 3GMMA 4BKTC 4OCNC 4X7FC 2XX0A 2OYMA 5IUCA 1SGKA 2WVVA 5B8CA 4DKFH 3ATDA 2DS4A 1QFUL 4XNXL 5LBSA 4PGEB 2AMGA 3MFFA 1UYWH 3AG3B 4Z7UF 1B0RB 2VDQL 5E2WH 4MDJB 4PJDA 1QP1A 5DC2A 3RTQC 2DKMA 2E74C 3O11B 5IR1B 4Z7WE 4HKBA 3V6ZB 4TTDC 2IGLA 3VWJB 5K1JA 3STLB 1ZMYA 2I27N 3T6ZA 4JDEB 3D39B 1JGDA 1IAIM 3LV3A 4OUUA 4U33A 4Z5RB 5CJQH 3TF7C 4ZUTA 5F9JB 2EYSA 1QKZH 2ZYRA 5JOEA 3ARGA 5GRZA 2VLJB 2A9NH 4IRSD 3MV9D 3UP1A 3BRGC 1FAIL 5ITBL 2FAUA 3HC4H 5AVSB 2OK0L 1CI5A 4O2FA 5D1XB 4XNZB 1VZHA 4TVSa 4A2GA 1F4YH 1HHJB 1MY5A 2VW6A 3RZCC 5CHNB 3REVA 2CK0H 3FQWA 3T8XA 4X98A 5F7NC 2NY4C 1WISA 4FI8A 2QVFB 4Z95H 3ULUD 3V4PL 3UOAB 1IU1A 1J87A 4YUEH 5C9JA 1WP6A 2BP0A 3WEMA 4J4PC 2X9XA 3WUWB 3O2DL 4M7LT 4EN3A 4S2SB 2VN3A 2ZKMX 1RPKA 5IMLA 2XN0A 1QFWM 3EYQC 4TNVF 3MA9H 5CU5A 4AGLA 5EIVA 3MGOA 5EO0A 2RFXB 5H37G 2CM5A 3MRLB 3OG4B 3SGKC 4F9PC 5KSVA 5DUBB 1SUJA 4L0ZA 4K73A 4XPAH 1U8CA 4FXGB 3ABMB 4RFNC 4K2UL 3VXSB 4N8CL 6PCYA 5FYJU 1OSEA 2AV1A 1U92B 4IGBB 2XCMC 1KJ2H 4NENA 1YPZF 3F64A 1UT1A 3HG5A 1ASQA 3MLSL 4D9QE 1WHOA 5KVEE 3GIZL 2DYPB 1A0QH 3GI8H 2DQCH 3HBZA 5IEKB 3O3EB 4X80L 4NHCH 3HN3A 1TTCA 1CGSL 2EECA 2Q7NA 2RQEA 3FUMA 3GZPA 5B8CC 4P3WA 5LHDA 3UO8B 4NDMA 3ZDYF 4ELKA 2CPCA 3L3IB 2WJ7A 3BVNA 5ADPH 5HY9B 2W07B 32C2B 1ZLUK 3KG5A 4E0RB 3IVKB 1S5IL 2X7LB 4FI7A 3Q43A 5DEGA 2BS9A 1JUFA 3CBRA 5C09E 3UC0L 2RCSH 5LDUA 4OCSL 1WE5A 1S46A 4CGUB 3PWVB 5GGTL 2ESVE 3KEHA 4J3VA 4U49A 3LRHA 1ODUA 4Y4KA 5ESQB 1IGIH 5T1KA 2J20A 1GS6X 1UA6L 3M45A 5D93C 1HEHC 1XGTA 2DMBA 5EOTA 2QHLA 1DVYA 2VDRL 5AD0B 4OGZA 2LFGA 3AWEA 3MXVL 4LT7A 1MCOL 2OMBA 4EBQH 4XPHL 5L7XH 3O3DB 3GS4A 4FFWD 3ARGC 2BS8A 1G7PB 3SJVE 1E4KA 5DZVA 1QI5A 3LN5A 1S7XA 1UG9A 1A2YA 4IS6A 1HKLH 1KGIA 4JO2L 4UAOB 4L9DA 5D7LE 4C4UA 5BV7C 2XA8H 5I1JL 3OZ9H 3ZIYA 1NFDA 3D0VA 2YKLL 3KVQA 2EUXA 3VXTB 2F1BA 2WO4A 3DX0A 3VFGH 4HX1A 1CMOA 4AQOA 1S7VB 3QIUB 1UH2A 1WTGT 4EN3C 3NAAL 4TLTA 5I71C 3U6RB 3F7LA 1BMWA 2Y6SC 1I3GL 4MB5A 3NFNB 3F04A 1DVQA 4Z7OB 4GSDL 1Q9LA 2PTUA 4U3CA 5EOQH 5IW6B 3P0YL 4EUPG 4K7FB 4JG9A 4PTTA 3ZE0F 4GSUA 2BMKA 3FHAA 2V7HA 4LL9A 5F3BB 3DMMA 3WJMB 2ITCA 9PCYA 1J10A 1U8NA 3US1A 5IEHA 4MWFA 2B4CH 5KBKA 3WKPA 3B2MA 12E8L 2WBKA 4AE1A 1THCA 3NZ8B 1W9XA 1OTTC 2OJEB 1QO3B 3D07A 2BY3A 5FK9B 1DUZA 1G9MC 1U95B 4APXA 4C58B 2ZX5A 2FVNA 3QS2A 4P3DB 2G60L 1UVQB 4QYOA 1KY6A 4H44C 3VWKB 2QQQA 3UYRL 1IGFH 3MMEB 5AKTA 4Q56A 2X42A 4NQXA 2X6CA 2IDQA 1U8PA 3EBHA 3FSAA 2OZNA 4CW1A 1ZJAA 4CNIA 3N06B 2Q7AA 2ZWLT 2ROYA 4X7CC 4I0PB 1B2WL 3B9KB 4ZMQA 2MCG1 3FB6B 2V4LA 1KCUL 1GRWA 1EFQA 2Q7YA 3L5IA 4JHUA 4QHLA 4QGYA 3BUDA 2EDBA 2QTEA 1BZDA 1TJGH 3EFOA 1KMGA 4P06A 2F54D 3G6DH 1FL3A 3VD0A 1OSZB 4YNYA 3VRIB 4YGVB 4HV8A 2WBWB 2RH0A 3KCPB 4YIQA 4Y4KC 3FT4A 1NGWA 4FTVB 3ARWA 2ZOOA 1A4AA 3V5DB 2Y7NA 2GHWB 3I9GL 1CZ8H 2BERA 4PAZA 1OAUL 4J3XA 4FLQA 1T0MA 3P9LB 1IKFL 1BOGA 1VFMA 1F00I 4XN8A 2BSED 3PWUA 4HQQH 5E8NA 5HGBB 3BIKB 5BVJB 1KNOA 4RMTA 3D4ZA 4TVPH 5FGCE 5I6NA 1DQIA 3GGWA 3K2IA 3CVBA 1FQ9C 2XX1A 4FXKB 3U4BH 3WY3A 3FMGH 4X0KA 5I5RA 1BAFH 1FF5A 2VSMB 5E4AA 2CLRA 1PYWB 3FT3A 4KX8A 4WY7L 2P80D 4YSRA 3V8CA 5J1AB 4KMTH 4QXTB 3MRIB 4P57A 5LUMA 3QWOB 4HLJA 3ZTDC 3I6GB 5DQDH 1IBBA 3ULAB 5IQNA 1FORH 4WI0B 2W95A 3RFZB 1CFVL 2N7SA 4FFVD 2IDFA 4WK4B 5I0DA 1F4XL 1BAWA 2BCKA 3ZX1A 4Q9QL 2EEAA 4W93A 5E1QA 4AKQA 1Q9OA 5JIIA 2ITFA 1NGPH 4J3WA 1F18A 1FYTB 3DO7A 4LCCB 1CB4A 4JVWA 2WKLA 3NDZE 1V05A 4R2GD 2IO5A 1FC1A 2G3XA 4XGZA 4XCFL 1PZ2A 1YQVH 3NPSC 4UINH 3QUYD 2GABA 5AFAA 1NQBA 3MLRH 3T77A 1CFSA 5LGYA 1KEGL 2I60L 1C08B 3VX1A 5I24A 3FU0A 3Q3GA 1JZHA 3EH3B 1YUHA 3VJ6A 3KPPA 3ULVH 4P46A 3MV7B 1SJEB 2BOCA 3CQPA 1BQUA 2HVJB 2IIJA 3KL3A 1QAWA 2G3MA 1TQCB 1OM3H 4M3HA 5KYWA 3EYSL 2WQRA 2BNQB 1ACYH 3WMQA 2FR4B 4ZRGA 5IOKA 3NJXA 3PGFL 3BFOA 3WNIA 1ZK5A 3GMNB 3WDIA 2NY0B 3MLPA 3ROOA 4NIYE 3UMNA 1BF8A 2ZJSH 3EFDH 3TIDB 2ZWSA 5H35B 2RR3A 3ARRA 1TU2A 4MD5B 5D5MF 2O61B 3SDAA 2HWZL 4WW2A 3QWRD 5EOCH 1JTTA 2E7MA 1X9UA 4OGYL 3CHRA 3DBXA 1K2DA 4LSTH 4W9CC 1B3IA 5MHSD 1S5HB 2CLZA 1XSJA 3APMA 4MFHA 1BVNT 1ACCA 1WBZA 3LH8A 2JXMB 3UYPB 4CBZA 4ELMB 1OHQA 4ADIA 1JYXA 1KG0B 3QFJB 4UBDC 1SDAB 1DL7L 4ZPVB 1C16A 1CK0L 4RGNB 5F1IA 4JO3L 5E2VL 2E4TA 1A9VA 1P4BH 4PRAA 4M9OA 4NUMA 3GJEB 3LX9A 3EJZD 2BVYA 1JWUB 1TF4A 4LVHC 1CPUA 3HTLX 3HOGA 2XKUA 4ZTOL 5DHEA 2XVKA 1UD4A 3CD4A 3ZDXF 3QDHA 5GS2H 4Q74A 3ECBB 4D3CH 2DQTL 3CFBA 1MI5E 4M6NH 3L2NA 1CLYH 2BVTA 4GG6A 1YDPA 5CM1A 3A47A 3GK8H 2MIZA 2CE6A 2YQ3A 5BJTB 4QHMA 3MODH 3BH8B 1QR1A 4YXLH 4HULB 2CQVA 4NI3A 3EJYC 5I1LB 1JXGA 1QRNE 4DGWC 5GSVA 4ALAH 3OB8A 2O6CA 2ADJB 2KBGA 3GXPA 3REWB 3O9WD 2X3BA 1QACA 3M17A 2D31B 4A67A 1BIHA 2H8PB 3GFUA 5CS7A 2AQ1A 3O2VH 4GRMB 1L9MA 2OXGB 1G9HA 4L3CB 5ACMA 4J8QA 4A7GA 4WTZG 3VFMB 2ZOWA 1NAKL 2B39A 2VMEA 4Q8BA 3F5WB 2AVFA 1HCYA 3K8MA 3KHOA 3O6FA 4OZHA 2R69L 25C8L 4GI9A 4P46C 4E9QA 2HRHA 4Z7VF 5KYXB 4N2NA 2EO1A 5KYNA 1WWAX 2QL1A 1OF2A 2GT9A 3PU7A 1SJXA 1OAXL 4AV4A 2DKUA 1WFJA 1WK0A 2EDDA 1AGDB 5C0CA 1FL6B 1MKFA 5FYKL 2UWEE 4XI5D 4I2XE 5DZOA 1AS8A 1EEUA 5DMGC 3H4HA 3SDAC 2J1ZA 4FYQA 4R26L 3H9YA 4WW2C 4E36A 4KNSA 2E7CA 1NZRA 1A7OL 2BFGA 1NA8A 3Q1SH 1NUGA 4G43B 4UU9B 2AI0H 1G7LB 5GGSB 3ULSA 4YR6B 1B4RA 3V0DA 2VZTA 2DTSA 4KI5F 4JUTA 1WCBA 3SE9H 5KVMC 1HL9A 3JYCA 5C6TH 3RJQB 3FT9A 2WLIA 1M42A 4CL7A 4PRID 3VXRE 3TBWB 2FUTA 4LSPL 4HCFA 3QQ9D 4OJCA 3KPSA 1JHKL 1AD9B 1M4KA 2NQCA 4X5WA 5KYUB 1J12A 1FG2A 2X6BA 3EYVB 2JJWA 1XZWA 4OF8A 2VXUH 1FAKT 1U8QA 4JJOA 1IM9D 4LSQL 2P8PA 4B6ZA 3EXJA 2DD8L 5I8OH 3FO9A 4FYTA 2YD3A 4C83B 4QDGA 3TP4A 3GNML 1MCHA 4L4TE 3CQQA 3K2MC 1JE6A 1H6EA 3IDJB 4G7VH 5CSZB 4JRYA 4XCCL 2DN7A 5J13B 1N5YH 3BGMA 1RJYB 2AC0A 3X13B 4L1DA 4GINA 1E8XA 2LU5A 3NEOA 3G5VA 3MREB 5BRZA 5GIRA 1WS7A 5TDPB 1MAMH 1S7SA 4R6UA 3CVCA 4XNQA 2Y06H 4H0LC 3VO0A 1BW8A 2AJVH 3CN4A 3NP3A 4RFOL 4O00A 5JHDA 3V4VH 4N2DA 2N0KA 2HJKB 3LNHA 1B4JH 4X6FA 3TNMA 2IAMD 4MKMA 3LPPA 4RWYL 3PWJA 3O41A 3O0LA 5AVQB 1OARL 4M62L 4Y4FA 2W60B 4EE2A 4KZEL 1TZIB 1ZEAL 3KGRA 3QS3A 1CDHA 2YFOA 3Q01A 4GW1A 3FO2A 4NEHB 1JPGA 5AG9A 3LPFA 1VA9A 2PTVA 1F41A 3MUHL 4KKZA 4PV1C 3CSFA 3UX9B 1RVFH 2V2TB 5JOPE 3AXLB 5LQBL 4N8UA 2IPKA 4N0UA 4ENED 1E67A 3SBQA 4QHNB 2EE2A 1AGCA 4U6YB 4PWEA 4MMXA 3VD9A 3S3PA 4L4VE 4EI5D 4R5XA 3B2VH 5FUOH 5DMKB 3UTSB 3GEWB 1ZE3H 1A9BA 4NQDE 4OGQC 3DUUA 5AKVA 1YMHB 1SF5A 1U3ZA 4AQ8A 4E9XA 3VXUD 5C0JB 3K3QA 4N25A 2A9MH 3BVUA 3O45A 4YEEA 2IOOA 2I24N 5AL8A 2BNUB 4IHOA 4F7TB 4ZG1A 1SJVA 5ANHA 2X2JA 3BEVB 2UVFA 5PCYA 1KTLB 4TYUA 1RUPL 1CUOA 1URIA 4OJEH 2V8MA 2VLKD 4ZMNA 1H8LA 1PQZA 3FTZA 3OGCB 2PPEA 4V1DB 5IK3A 5IQ9B 4X7TB 1K3IA 1UXLA 5EU5A 2Z31A 4ZJ9A 3W11C 1ZGLP 1QNZH 1J5HA 3PV7A 1RJZA 1V7NL 2O5YH 2MCPL 3RU8L 5D7SH 3BSZL 3QI9B 4LASH 2OSYA 1SJHA 4YHOH 2IPTH 4CC0A 1WQVT 1GTNA 3DV6A 1WDAA 4AC2A 1OGAB 1ETB1 2D7NA 4HS3B 1YYMH 1HINH 3Q6FB 4KHXL 4B9PA 4NJ9L 3Q0HA 2WWKO 1VRSA 1NLDH 1R24B 3OWEA 3Q9PA 1IBDA 5C0BE 2RGSA 3VACA 4HMDA 2IFGA 2ZUYA 4C4KT 4FFTA 3SYQA 3DOHA 1MCKA 5L8LB 4Y4HB 1I1AD 5D7IB 4KVNH 5MEPA 1EEZA 2VITA 3QP3A 2J8UA 5BZWB 1HHIB 1QVOA 2BVQB 4KROD 1X5ZA 2WLYA 1BVZA 1E9OA 3LKOB 4FF9A 1ECZA 2ZZUT 4PJCA 4XMKH 3P69A 3V9FA 5BS0D 2BJML 3WHXB 4BKLA 3P4NA 2WYIA 3L9BA 4XCYB 5FFGA 5B7EA 3SBWC 3W9EB 3O4LE 3BZEB 2NY1B 1MCDA 4APQB 1W6LA 3JT0A 1BVOA 3S96B 2X40A 3ARFB 5KJ4A 3FO1A 3FZUC 4NO3A 5F21B 5GRUL 5BZZA 2X1OA 1OWRM 2NNCA 5H2BA 4MMXC 2ZYHA 4UQ2A 2N3JA 4X6DF 4XAKE 4KKLC 4QCIA 3OZLA 1JRHH 3UBXG 3V4VB 1JXKA 4OTXL 3PAUA 4MXVF 2GQHA 4DAGL 4AQ8C 3FB8B 2P5PA 1WZLA 3BVVA 4PJIE 2EDNA 5DUJA 4DT2A 3I3EA 3ET9F 3ISWA 5SWQA 1ZLDA 4QHUA 2JK5A 1NC2D 1RQ5A 3Q8CA 1AO7E 4X7EC 2V9QA 5A1AA 5DS8B 4AEFA 2CRIA 3DVNA 1CDCA 3GRWA 2I07A 4EUPA 2IFFH 2OV0A 2EYTB 1DN0A 3WTUA 2EXSA 3HG1D 4GAFB 1NINA 1XB3A 2ADGB 5ISZD 1UACH 1NDMA 2Z31C 3TLRA 1KTBA 2NY7H 4HPOL 4PUBL 3LH9A 4LGRB 3ISRA 4XN4A 3T0XA 2UY7A 1PLGH 1YMMA 1EXUA 2C9VA 3GDCA 4GS7B 4PCSA 2ZOLA 1DFXA 4MD0B 3L95B 3RE0A 3X1BA 4PS7A 1SXCA 1O9ZA 1LYQA 4BXVA 4ODTH 1V3MA 5I6PA 1IM3D 1E7UA 4WFGD 5GGQL 4JG0H 4PW4A 1TZAA 3OR7A 3QIWB 4WWID 1WF5A 1T5WA 3QJFA 2XN9E 1CGWA 4QRTA 2VXTH 1OCCB 3TBSA 5F1SA 2B3IA 3UH8A 4G9FA 4GMSH 3P9MB 3DRQB 1ZLEA 2V3EA 4JN1L 3GMRB 4MDIA 1AGEB 2WTPA 1BZ7A 2FLBT 3K6NA 1LO0L 5E8EB 1G6RH 1E0OB 1H0DA 3TJHD 3CFCL 1UXSA 2VLRE 4NPJA 1R46A 3S34H 1XQ4A 5DJZB 1XR8B 4XAWL 5EORH 1XH0A 1M57B 2EDKA 5EN3A 2NNFA 1MPAH 3FUDA 3GXIA 2GVYA 5TK2A 3GLZA 5KG9A 3MJ8A 1EBAA 1IEBB 3AUVA 3OAUH 3NACL 3KBFA 4G1MA 4OF0A 4X4ZA 1U2HA 1NAMA 4NKDB 5DVNA 1BVLB 2EXYC 2X4UB 4PJHF 5D8JL 1A7RH 3OKMB 4X8JA 4GB9A 4P2RA 3F7QA 1BD2B 3HHMA 3IXAA 3GSWA 5JO5B 3LEYH 4PJBB 5EBLA 4Q9BA 4BRJA 4MHHG 4P4RB 1MW2A 4DN4L 1BYOA 2VISA 4G8GE 5F1NB 1YEGH 4ISVB 3FF7A 3CUPA 3L7FA 4H8WH 4HIXH 4J1UB 3FQXA 5T3XD 3HC0B 2C4XA 3FC8A 4OZIA 3GKWH 3FOLA 3DX8B 3M1CA 1FVEB 3OMNB 4DP8X 3MR9A 1GJIA 2Z8RA 1EXHA 2ZAIA 1TG8A 3X11B 1A6ZA 5CR1A 1E5CA 3FQUA 4PJ9A 4ZOEA 4HEPA 1ZS8A 1RJLB 4JPIA 3FH5A 3NSJA