4HJMA

Crystal structure of glutaredoxin 1 from plasmodium falciparum (pfgrx1) solved by s-sad
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
106
Chain Sequence
EAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin
publication title Atomic resolution crystal structure of glutaredoxin 1 from Plasmodium falciparum and comparison with other glutaredoxins.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 36
structure length 106
sequence length 106
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hjmA00
1PKWA 4G9HA 1GNWA 3U5RE 1PKZA 3KH7A 3TRXA 1YF0A 3IAS2 2DIYA 2MMAA 4ECCA 3C71A 2JZTA 1AIUA 3J7Yk 3EYTA 1A2JA 2B1KA 3H1NA 4I8BA 2YV9A 3GKMA 2C3NA 3QFBC 2AHEA 1V57A 20GSA 1MDJA 4N0VA 4HU7A 4GSTA 2GLRA 4MJEA 3CSHA 4IGJA 3KEBA 4MZBA 2CT6A 1Y6EA 3VFIA 2VD1A 3O76A 4HZ4A 4LA1A 4AJ6A 3EC3A 2GZZA 1PD21 3DGQA 2GSSA 3EVIA 5GAPD 5JWOB 4ACSA 2PPTA 1K3OA 1Z7RA 3GIXA 4NMUA 5J4UA 4Q5RA 4GCIA 3ZITA 5F05A 1X0RA 1A2MA 3QR6A 3KXOA 2IMEA 3FK8A 3GKXA 1HQOA 2KHPA 4RQRA 6GSSA 2N5AA 1XXUA 3FZ5A 3RAZA 5EVOA 3CSIA 2C4JA 1JZDA 4K7IA 1SK1A 3TJKA 2HZFA 3U6VA 4RUVA 1MTCA 3ZFLA 1TU8A 5ECOB 5AGYA 2P31A 2GGTA 2C0GA 1GWCA 4I2TA 2B3SA 1GLQA 1R4WA 1XIYA 2X64A 2B7KA 1FW1A 4WXTA 4YQMA 2OADA 1OC3A 5ECLB 4O7HA 10GSA 3VI7A 2H1AA 3L9VA 5CRGA 3FZ9A 4AJ8A 1SKWB 2KLXA 1V40A 4MPFA 1IYIA 6GSUA 1CQGA 2BJXA 3QPMA 1TK5B 1V2AA 4L0UA 4OWYA 1PN9A 4IVFA 1R5PA 4IELA 3VK9A 1THOA 1ZGNA 4MF5A 5L71A 1ZZYA 1BQ7A 3GKKA 5H5QA 4XS4B 2K8SA 3ED3A 1EEMA 3DD3A 1O8XA 2H6XA 4ECIA 2PVQA 2F8FA 4TOPA 3O3TA 3QCPA 3HD5A 3CRTA 4CHSA 5ECQB 6GSVA 3E3EA 3KIJA 2DJKA 2V41A 2VL2A 4HQSA 5EPFA 4WEYA 5CREA 4PNGA 2OE3A 2IMIA 3F4TA 2JACA 3HY2A 3KGKA 2JSYA 1W4VA 3GSTA 5G1KA 1VF3A 3F4RA 5IO0A 4EC0A 3NOFA 1K3LA 2ES7A 3WGXA 5JWQB 2E7PA 3M9JA 1TU7A 4OFNA 2VLUA 2H6YA 2YV7A 3BCIA 5KN1A 1M99A 4IW9A 1TOFA 3QDNA 3TKSA 1SJZA 2PBJA 3UBKA 2PMTA 1ZOFA 3GL5A 3IRAA 3ZVJA 11GSA 3DVXA 5B7CA 22GSA 1ILOA 3TRPA 3HHVA 1Y25A 2P5RA 1SYXA 1WIKA 1U6TA 4MF6A 4ID0A 1I5GA 5B8BA 1K0CA 2LJKA 5IMAA 3SWLA 4GRFA 2OE0A 1EWXA 3LXZA 1YEPA 3E9JB 1TK8B 1U3AA 1XVWA 2JZRA 4KA0A 1ZCPA 2FCHA 1MD4A 4K8MA 2R2JA 4EF0A 4WR4A 3EMXA 1F9MA 4GWRA 3VWUA 3G9BA 5DVBA 4PNFA 2H6ZA 2KOKA 3G7JA 5CRWA 2H75A 2YZUA 2VCWA 3G7YA 3H79A 2WULA 1DSBA 2FLSA 3TGZA 1JZWA 5J9CA 2HT9A 4KDUA 4QL7A 3IA1A 4ML6A 1G7EA 4HJMA 4YAVA 5D9VA 2ALBA 4LLRA 5D96A 1XBSA 1T3BA 3LYPA 4HJ2A 1IYHA 4IN0A 3VPTA 4KW6A 1XOBA 2IFQB 3UOMA 1XVQA 4MABA 1GNEA 2BMXA 4Q5QA 3GH9A 1A23A 3W8JA 3EWLA 2AB6A 2H66A 1BJXA 1S3DA 2AAWA 1T00A 3FHKA 2IN3A 2CZ3A 2YP6A 3LORA 1OKTA 4OCFA 4FH8A 1GSFA 5ENUA 1YKCA 1I9DA 1T8EB 3MNGA 4PUFC 2WFCA 1X9WB 2FWHA 2HZEB 4KH7A 2VLVA 1X9SB 1ZYQB 1OE7A 2V6KA 4XTSA 3TKPA 3GH6A 6GSYA 2LTKA 3US3A 4PQ1A 4N0ZA 4FYCA 1F3AA 1FB0A 4XRAA 2PUKC 3A2WA 4XS6A 1TTZA 5COHA 5CRDA 4NAXA 2VIMA 3VWVA 4DSSB 4G19A 4ZB6A 3ZRDA 5HR2A 2HI7A 5C04A 3LFLA 1JLVA 3ZYWA 3JCML 1GSDA 2X8HA 3C8EA 5IPGA 5ELGA 1BG5A 1ZL9A 1B9YC 2R37A 4JU5A 4F9ZA 1G0TA 2H73A 4WETA 4PQIA 1V98A 3TJJA 5CYYA 1BYEA 3VWXA 1M2BA 5E59A 4MP4A 3ZTLA 5IO2A 2O89A 1OC9B 2GQKA 5HQPA 2CZ2A 4I2UA 1EV9A 3APQA 4AGSA 1M0UA 5DALB 5A4VA 5EL8A 5GSSA 2MBTA 4KSOA 3QOUA 3CTGA 1X9MB 5DJMA 2IJYA 2DC5A 4K2DA 3P2AA 4HUAA 4LMVA 4WKWA 2O85A 3EURA 4DSRA 3KTLA 1O8WA 1YKAA 2HRFA 5ECNB 3DVWA 4MF7A 4DSQA 2MMOA 2IWTA 3L4NA 5ABRA 2WGRA 3MSZA 4EXJA 2VL2C 2CVKA 4GTUA 4LMWA 2N5BA 4K6XA 4K0GA 2XPDA 1A8YA 5B6MA 5F07A 4P3YB 1A8LA 4IHUA 4I97A 2AJQB 1K0NA 4Z7XA 3UARA 1PL2A 1MEKA 1RW1A 2EIOA 3H4KA 4TR3A 1M7TA 4F03A 4WR5A 3J7Yb 1X5CA 1TI1A 3LQ7A 3HXSA 1EP8A 4N30A 2JSZA 3TCOA 4KAEA 1GULA 1Q98A 5AN1A 4MJAA 3M9KA 1UN2A 3P7XA 3BBYA 3L9SA 1XPVA 2V32A 4GLTA 4K7NA 3ERWA 5D9TA 4YQUA 2R4VA 4XS4A 1HD2A 1X5DA 2DMLA 1W89A 3IR4A 3IBHA 3CBUA 3GRXA 5IMVA 3GTUB 4V2NA 4IJ3A 2RM5A 1S3AA 2MMZA 4OCEA 3EINA 1SD8A 4AF2A 3A2XA 2VLTA 3KTBA 1B4QA 5IMZA 4TR0A 3M8NA 2HXKA 1PRXA 1O7UA 1OC8A 2YCDA 1WPIA 4MLYA 2YOIA 2LNTA 3LGCA 1YEXA 2JU5A 4E8HA 1K0OA 3QAWA 3L78A 5HFKA 3GFKA 1SKRB 1OVNA 1Z5YE 2VCZA 1FG4A 2H19A 1O81A 3APOA 4F0CA 4BL7A 1YZXA 5B8AA 2QSIA 3TDGA 1QFNA 3N5OA 2RUEA 3I69A 3UIWA 1AQVA 1GSSA 3ME7A 1K0AA 2RM6A 3K8NA 1USBA 2GQMA 4KCEA 3D0ZA 2LJRA 4QL9A 2WRTA 4EDYA 1DE2A 1XWCA 1ST9A 4TR4A 1JZOA 5IIZA 2L57A 2OKAA 3D22A 3VPQA 1HNCA 2P5QA 4AJ7A 3HA9A 2PVOC 4MZWA 4YAPA 2IPAA 2H8LA 5J9BA 3ZIJA 3NIVA 2FD3A 2C1YA 1OYJA 4J2FA 3QFAC 2OBIA 4L5LA 1Z7PA 4BA7A 3A5WA 1EEJA 3APSA 3EU3A 3KM6A 5E4WA 5IPHA 4JR6A 2H72A 5J41A 3BOAA 3Q6OA 3WGEA 1O6JA 12GSA 5CP1A 3BD2A 3SBCA 1LJRA 2VCTA 2L4CA 2VL9A 4WBJA 3UBLA 5ID2B 4K9ZA 3GYKA 4ZL8A 1H4OA 1YF1A 2VM1A 4ZXGA 2P0GA 4F2IA 3UVHA 1GL8A 2X8CA 1FB6A 3EU4A 1QGVA 1VRSD 3WD6A 2IMKA 2PWJA 2GS3A 3M3MA 2LUSA 3F3QA 1U3IA 1M9AA 2H76A 1PX7A 5FT3A 4NHZA 3ME8A 1U88A 2KP2A 4LL4B 2H0HA 3WGDA 2J23A 3F4SA 2YNXA 2C0DA 2HLSA 4MMMA 3KH9A 2GSRA 2CVBA 3IV4A 4JEDA 2VCVA 3HDCA 1MDKA 4GF0A 1Z9HA 1R26A 3NZNA 1SL2B 1WOUA 1F6MC 1VF2A 1LU4A 4DSSA 4ECJA 3DKSA 4N11A 5IMFA 2YWMA 4OO5A 1FOVA 3C1RA 3FR6A 3HJOA 2CAQA 1A24A 1J0FA 5IOWA 3TKRA 3UJ1A 4KE3A 1GSEA 2F8AA 1TRVA 3KMNA 1NSWA 1M9BA 1PQNA 3FYGA 4MA9A 3N9JA 3HVXA 4JZQA 4RQXA 1M2DA 4MDCA 2E0QA 1RQMA 4LL1B 3F6DA 3HCZA 2GQLA 4X1UA 5DALA 4KDYA 2WZ9A 2X8GA 2YWOA 4KGIA 4I6XA 4O32A 1XCCA 4RI7A 1LBKA 1XWBA 4JBBA 3BJ5A 3HVVA 4BWQA 2DLXA 2MBSA 4X43A 3D21A 1BAYA 5D93A 1Q4JA 1AXDA 4GSSA 4IKHA 3I43A 2LQOA 1JZRA 1NHOA 4EDZA 3FW2A 4RI6A 5HR3A 4TRXA 1PL1A 2I3YA 3D4TA 2H0GA 1AW9A 3MDKA 4TKYA 4EE0A 3UAPA 1SK0A 1N2AA 4ZB8A 4NV2A 2YJ7A 5A5KA 4TR1B 3CSJA 2CA8A 4HU9A 1JLWA 5DQYA 1F2EA 4XS1A 1O73A 1JHBA 4GQFA 5GSTA 1T4YA 17GSA 4KB3A 5DJLA 2J9HA 1FAAA 4TW5A 2DJ1A 2F51A 3H8QA 2DJ0A 2B1LA 4ZBAA 3Q18A 1K3YA 3RPPA 3ZMKA 1WWJA 4ZL9A 1NM3A 2C3TA 2WDUA 3LJRA 4PGTA 1TW9A 1ML6A 4BPYA 3GTUA 2OA7A 3VI5A 2VD0A 4PX1A 4MJCA 4ZBBA 3HJPA 3GV1A 4NV5A 3BCKA 4HQZA 2YJHA 3ERGA 3GA4A 3KP9A 2CVDA 3AY8A 3VLNA 2K6VA 1XWKA 1TDIA 5G5FA 2O7KA 4K1FA 3DMLA 2LJAA 2ZNMA 4PQHA 5ECIB 4KSMA 2G0FA 3FZAA 3ZIVA 5DCGA 5INYA 1TKDB 4F82A 2A2RA 2GDRA 3A3TA 1EOHA 4GQCA 4CW9A 4BVXA 4I5QA 5DBQA 4HDEA 1ERWA 5G1LA 2FWGA 1G6YA 1K0MA 1J9BA 2E2GA 1YY7A 3C1SA 9GSSA 1HNAA 2OBKA 2H74A 4TXOB 2B5YA 4POKA 2GTUA 2V1MA 4ZIJA 4OD7A 2IL3A 3ZLPA 1HNBA 5DCHA 1N8JA 2H1GA 4K0NA 3ISOA 2GSTA 2AYTA 4FO5A 2L6DA 1T4ZA 2AUVA 1SYRA 2NDOA 4NPBA 3LG6A 4F0BA 1DUGA 4QQ7A 2FWFA 5JWRB 4L8EA 1T7PB 5G5EA 1O85A 1KTEA 3KP8A 2OJLA 2JL4A 3Q74A 1TRUA 1WJKA 1Z3EA 3PGTA 2TRCP 3UEMA 2LS5A 4OO4A 3IK9A 4ULXA 3I9V2 1EOGA 4DEJA 4IS0A 3GX0A 1XFLA 1B4PA 2VO4A 1TRSA 2RUFA 2EIRA 5ID2A 4V1Ag 2EIQA 3TOUA 6GSXA 4V2MA 5ECPB 5ECKB 1T1VA 1SL1B 3TKQA 3KD0A 3IPZA 4IP1A 2YANA 3P90A 5CAXA 1BX9A 1ACVA 1Z6MA 3Q19A 2LRTA 3GSSA 1OE8A 3FR9A 2LRCA 3ZVJD 5LD0A 3UVTA 5G2ZA 1OAZA 1QUWA 2LKUA 3TKSC 4PUAA 3CRUA 3M1GA 2B5XA 1K0DA 3LWAA 2XC2A 1TRWA 3IDVA 2FY6A 1XW6A 3F8UA 2BTOT 2V2GA 1GTUA 4XHMA 4HEA2 2WJUA 1URMA 1FVJA 5CO3A 1B9XC 3TUEA 14GSA 1SK2A 1F3BA 4NWYA 1FVKA 3A2VA 5FWGA 4ECBA 4KX4A 2NVLA 2GT5A 6GSTA 2F9SA 2HSYA 3WT2A 3QD9A 2I4AA 3DYRA 2CX4A 3ZL5A 5EY6A 4OMVA 1GLPA 4WF5A 2IMFA 2WCIA 1A2LA 3HZ8A 1AAZA 2AV4A 3L9UA 2L5LA 2LRNA 4PURA 4EVMA 2M80A 2GZYA 3C73A 4IQAA 1X5EA 3GL3A 1SJ6A 3TB2A 4V2LA 5GAND 1TXXA 2JADA 5LNKe 4ZB9A 5D9WA 5IMCA 3I6AA 3GN3A 5D8IA 7GSSA 2I9HA 2VM2A 2DBCA 3IOSA 3GMFA 4L5OA 5JCGA 4D73B 1EGOA 2A4VA 2G2QA 4WF4A 4X0XA 1E2YA 2K18A 2ON5A 1NW2A 4G10A 1VF1A 3HVSA 1XZOA 5DAKB 3HZ4A 4V1Ap 3GX8A 2H30A 2LV3A 2H1DA 3PR8A 3F63A 4IQ1A 3LXTA 5IQYA 1MD3A 2I81A 4XCSA 1GP1A 2IIYA 3M0FA 3DXBA 4TR1A 1SD9A 1Z6NA 2R6KA 4N10A 3F3RA 4HS1A 1YQ1A 1UA5A 4JE1A 1NHYA 2LEGA 5IOXA 3KCMA 5KN3A 2H71A 3GNJA 4MJBA 5CNWA 5IM9A 4IBPA 1XW9A 2H0IA 5KEJA 2FGXA 3F0IA 1XW5A 2IFQA 4EO3A 5CRHA 1G6WA 1KEBA 3MWHA 1WMJA 1UVZA 4OFTA 4EKZA 4TVEA 1HYUA 2L6CA 4MZCA 3D6IA 4KDXA 1A0RP 5DDLA 3IC4A 2KP1A 2DSAA 5AIVA 3DIEA 4NXIA 1GTAA 5J5NA 2NBSA 16GSA 2FHEA 2GSQA 2GZPA 3ERFA 3DRNA 1M2AA 1AQWA 2ON7A 1BEDA 3IXRA 3MAKA 2HZEA 3UMAA 2QGVA 3IAM2 1C72A 2VOCA 2EC4A 3D4MA 2N5FA 1GUMA 1DE1A 5G30A 3V1WA 2VCXA 1EP7A 3QAGA 5HR1A 5H5RA 4GSNA 3TJFA 1VGLA 2YWIA 1ERTA 2DJ2A 4POBA 5D73A 3TRQA 3WT1A 4L0WA 5FHIA 1GH2A 1FHEA 4XIHA 2RLIA 2KUCA 2OE1A 1XWGA 2C0EA 2MMNA 5A4WA 1OC9A 3UL3A 4TXOA 4NHWA 5DQSA 2CV4A 2FA4A 3O6TA 4K7OA 2VL3A 3D5JA 1RK4A 3CMIA 3LSZA 4EUYA 1R7HA 1WRYA 3CXGA 5ECHB 2H1BA 18GSA 2A2SA 3CTFA 2H70A 2GT6A 1YJ6A 1KNGA 3TKSE 1H75A 3FZ4A 2M46A 1GTBA 5HFIA 5D9XA 2RIIA 2L5OA 2I1UA 4MPGA 4OFMA 1XWAA 1CQHA 2L4QA 2PGTA 1TJDA 3E0UA 4Q5NA 2LQQA 2R5GA 4ZL7A 1QK8A 2WB9A 4HZ2A 4JR4A 4YH2A 2REMA 1TI3A 4BVYA 3WYWA 1J08A 3TJGA 2HFDA 3LEFA 4EL1A 1GRXA 2CX3A 3GUSA 1ERVA 4G2EA 4MH3A 1A0FA 3ZREA 4MCUA 5G31A 1EGRA 2O8VB 3OR5A 3RPNA 4ILFA 4J57E 2LNSA 4ZBDA 3HYPA 2B5EA 4POLA 2WS2A 3PH9A 8GSSA 1PGTA 4WBRD 2TIRA 1SU9A 5F0GA 1GSQA 1SKSB 1ERUA 2VAFA 2F3MA 1WE0A 1YDKA 2FNOA 2FUG2 3F6FA 5F06A 2HNLA 2XBQA 3R2QA 1QQ2A 4H86A 2K9FA 4PXOA 2C80A 2L59A 2NTOA 1JFUA 3RBTA 1E6BA 3ZMLA 2MZCA 3IK7A 4TN8A 3QAVA 2C8UA 2MYGA 5KN0A 5A4UA 1MDIA 2C3QA 4FYUA 1SENA 2B6MA 2R3XA 5C00A 3FKFA 1V58A 2D2ZA 3RHBA 1EV4A 2M72A 3EE2A 3W8SA 2HYXA 3KJYA 1F37A 1R5AA 3KMOA 4FIWA 2K8VA 3PINA 1VF4A 5ELAA 3RDWA 1UC7A 3CYNA 4IJIA 3IHQA 3FRCA 3C7MA 2ZCTA 4YQVA 5HR0A 1AUCA 2HSHA 2NPBA 2DIZA 1GTIA 1ABAA 4KUNA 4O92A 3DWVA 3GURA 4ISDA 2GVPA 3P8WA 3ZZXA 1TK0B 2O87A 2XPEA 5GZZB 1WP0A 2YZHA 5KN2A 3F9UA 5J3RA 1GSYA 4MK3A 2PU9C 3QMXA 1K0BA 3HJMA 5AISA 2XHFA 5HFGA 2FWEA 4D73A 1QXHA 3ZFBA 2YPMA 3S9FA 4J56E 3H93A 4MH2A 4XRDA 4GXZA 3FY7A 2DJ3A 4IP6A 5AIXA 4DVCA 5DAKA 5LCZA 1DBYA 2TRXA 2DJJA 2PN8A 4E8EA 2DMMA 3HKRA 1V9WA 4O5RA 2ZUPA 3VWWA 2CAIA 2Z9SA 4BWSA 2C0FA 2VUPA 2IMDA 3W6GA 4HOJA 1QMVA 2CQ9A 1SJIA 1ZMAA 4KCAA 3TOTA 1KBNA 1PMTA 3L0HA 4ZILA 3KZQA 5IMDA 5H5SA 1GSUA 1PA3A 6GSWA 1AQXA 1SL0B 3RHCA 4ML1A 5ECSA 3TJBA 1B48A 3FEUA 19GSA 3EMPA 2YN1A 2OACA 1PSQA 4JRRA 1S3CA 1TP9A 2QKEA 1ON4A 4POMA 1THXA 5JCWA 1OKDA 4TXVA 5ECRB 2YWNA 2XBIA 3FR3A 5F8BA 13GSA 5B6NA 1B8XA 1XOAA 2V6OA 2H01A 4Q5FA 2LSTA 4KNDA 2PERA 2E2MA 2HE3A 3DEXA 5ECMB 4CDOA 1GUHA 1FO5A 1AC1A 1G7OA 4FYBA 1U87A 1GUKA 2QC7A 3IE3A 2JZSA 2VCQA 1ZYEA 2FA8A 3GKNA 1PX6A 2HRNA 1EZKA 3G7IA 3VURA 5JCUA 3LYKA 2B7JA 3GHAA 4HI7A 2X99A
chains in the Genus database with same CATH superfamily
1PKWA 4G9HA 1GNWA 3U5RE 1PKZA 3KH7A 3TRXA 1YF0A 3IAS2 4Z2RA 2DIYA 2MMAA 4ECCA 3C71A 2JZTA 1AIUA 3J7Yk 3EYTA 1A2JA 2B1KA 3H1NA 4I8BA 2YV9A 3GKMA 2C3NA 3QFBC 2AHEA 1V57A 20GSA 1MDJA 4MNNA 4N0VA 4HU7A 4GSTA 2GLRA 4MJEA 3CSHA 4IGJA 3KEBA 4MZBA 2CT6A 1Y6EA 3VFIA 2VD1A 3O76A 4HZ4A 4LA1A 4AJ6A 3EC3A 2GZZA 1PD21 3DGQA 2GSSA 3EVIA 5GAPD 5JWOB 4ACSA 2PPTA 1K3OA 1Z7RA 3GIXA 4NMUA 5J4UA 4Q5RA 4GCIA 3ZITA 5F05A 1X0RA 1A2MA 3QR6A 3KXOA 2IMEA 3FK8A 3GKXA 1HQOA 2KHPA 4RQRA 6GSSA 2N5AA 1XXUA 3FZ5A 3RAZA 5EVOA 3CSIA 2C4JA 1JZDA 4K7IA 1SK1A 3TJKA 2HZFA 3U6VA 4RUVA 1MTCA 3ZFLA 1TU8A 5ECOB 5AGYA 2P31A 2GGTA 2C0GA 2X4AA 1GWCA 4I2TA 2B3SA 1GLQA 1R4WA 1XIYA 2X64A 2B7KA 1FW1A 4WXTA 4YQMA 2OADA 1OC3A 5ECLB 4O7HA 4K5SA 10GSA 3VI7A 2H1AA 3L9VA 5CRGA 3FZ9A 4AJ8A 1SKWB 2KLXA 1V40A 4MPFA 1IYIA 6GSUA 1CQGA 2BJXA 3QPMA 1TK5B 1V2AA 4L0UA 4OWYA 1PN9A 4IVFA 1M3JA 1R5PA 4IELA 3VK9A 1THOA 1ZGNA 4MF5A 5L71A 1ZZYA 1BQ7A 3GKKA 5H5QA 4XS4B 2K8SA 3ED3A 1EEMA 3DD3A 1O8XA 2H6XA 4ECIA 2PVQA 2F8FA 4TOPA 3O3TA 3QCPA 3HD5A 3CRTA 4CHSA 5ECQB 6GSVA 3E3EA 3KIJA 2DJKA 2V41A 2VL2A 4YKFA 4HQSA 5EPFA 4WEYA 5CREA 4PNGA 2OE3A 2IMIA 3F4TA 2JACA 3HY2A 3KGKA 2JSYA 1W4VA 3GSTA 5G1KA 1VF3A 3F4RA 5IO0A 4EC0A 3NOFA 1K3LA 2ES7A 3WGXA 5JWQB 2E7PA 3M9JA 1TU7A 4OFNA 4BL7B 2VLUA 2H6YA 2YV7A 3BCIA 5KN1A 1M99A 4IW9A 1TOFA 3QDNA 3TKSA 1SJZA 2PBJA 3UBKA 2PMTA 1ZOFA 3GL5A 3IRAA 2DKIA 3ZVJA 11GSA 3DVXA 5B7CA 22GSA 1ILOA 3TRPA 3HHVA 1Y25A 2P5RA 1SYXA 1WIKA 4O5UA 1U6TA 4MF6A 4ID0A 1I5GA 5B8BA 1K0CA 2LJKA 5IMAA 3SWLA 4GRFA 2OE0A 1EWXA 3LXZA 1YEPA 3E9JB 1TK8B 1U3AA 1XVWA 2JZRA 4KA0A 1ZCPA 2FCHA 1MD4A 4K8MA 2R2JA 2DKHA 4EF0A 4WR4A 3EMXA 1F9MA 4GWRA 3VWUA 3G9BA 5DVBA 4PNFA 2H6ZA 2KOKA 3G7JA 5CRWA 2H75A 2YZUA 2VCWA 3G7YA 3H79A 2WULA 1DSBA 2FLSA 3TGZA 1JZWA 5J9CA 2HT9A 4KDUA 4QL7A 3IA1A 4ML6A 1G7EA 4HJMA 4YAVA 5D9VA 2ALBA 4LLRA 5D96A 1XBSA 1T3BA 3LYPA 2X49A 4HJ2A 1IYHA 4IN0A 3VPTA 4KW6A 1XOBA 2IFQB 3UOMA 1XVQA 4MABA 1GNEA 2BMXA 4Q5QA 3GH9A 1A23A 3W8JA 3EWLA 2AB6A 2H66A 1BJXA 1S3DA 2AAWA 1T00A 3FHKA 2IN3A 2CZ3A 2YP6A 3LORA 1OKTA 4OCFA 4FH8A 1GSFA 5ENUA 1YKCA 1I9DA 1T8EB 3MNGA 4PUFC 2WFCA 1X9WB 2FWHA 2HZEB 4KH7A 2VLVA 1X9SB 1ZYQB 1OE7A 2V6KA 4XTSA 4G0IA 3TKPA 3GH6A 6GSYA 2LTKA 3US3A 4PQ1A 4N0ZA 4FYCA 1F3AA 1FB0A 4XRAA 2PUKC 3A2WA 4XS6A 1TTZA 5COHA 5CRDA 4NAXA 2VIMA 3VWVA 4DSSB 4G19A 4ZB6A 3ZRDA 5HR2A 2HI7A 5C04A 3LFLA 1JLVA 3ZYWA 3JCML 1GSDA 2X8HA 3C8EA 5IPGA 5ELGA 1BG5A 1ZL9A 1B9YC 2R37A 4JU5A 4F9ZA 1G0TA 2H73A 4WETA 4PQIA 3IC8A 1V98A 3TJJA 5CYYA 1BYEA 3VWXA 1M2BA 5E59A 4MP4A 3ZTLA 5IO2A 2O89A 1OC9B 2GQKA 5HQPA 2CZ2A 4I2UA 1EV9A 3APQA 4AGSA 1M0UA 5DALB 5A4VA 5EL8A 5GSSA 2MBTA 4KSOA 3QOUA 3CTGA 1X9MB 5DJMA 2IJYA 3CQFA 2DC5A 4K2DA 3P2AA 4HUAA 4LMVA 4WKWA 2O85A 3EURA 4DSRA 3KTLA 1O8WA 1YKAA 2HRFA 5ECNB 3DVWA 4MF7A 4DSQA 2MMOA 2UZ8A 2IWTA 3L4NA 5ABRA 2QA1A 2WGRA 3MSZA 4EXJA 4PTSA 4BVYB 2VL2C 2CVKA 4GTUA 4LMWA 2N5BA 4K6XA 4K0GA 2XPDA 1A8YA 5B6MA 5F07A 4P3YB 1A8LA 4IHUA 4I97A 2AJQB 1K0NA 4Z7XA 5KOWA 3UARA 1PL2A 1MEKA 1RW1A 2EIOA 3H4KA 4TR3A 1M7TA 4F03A 4WR5A 3J7Yb 1X5CA 1TI1A 3LQ7A 3HXSA 1EP8A 4N30A 2JSZA 3TCOA 4KAEA 1GULA 1Q98A 5AN1A 4MJAA 3M9KA 1UN2A 3P7XA 3BBYA 3L9SA 1XPVA 2V32A 4GLTA 4K7NA 3ERWA 5D9TA 4YQUA 2R4VA 4XS4A 1HD2A 1X5DA 2DMLA 1W89A 3IR4A 3IBHA 3CBUA 3GRXA 5IMVA 3GTUB 4V2NA 4IJ3A 2RM5A 1S3AA 4YKGA 2MMZA 4OCEA 4X4JA 3EINA 1SD8A 4AF2A 3A2XA 2VLTA 3KTBA 1B4QA 5IMZA 4TR0A 3M8NA 2HXKA 1PRXA 1O7UA 1OC8A 2YCDA 1WPIA 4MLYA 2YOIA 2LNTA 3LGCA 1YEXA 2JU5A 4E8HA 1K0OA 3QAWA 3L78A 5HFKA 3GFKA 1SKRB 1OVNA 5BRTA 1Z5YE 2VCZA 1FG4A 2H19A 1O81A 3APOA 4F0CA 4BL7A 1YZXA 5B8AA 4KF9A 2QSIA 3TDGA 1QFNA 3N5OA 2RUEA 3I69A 4CY6A 3UIWA 1AQVA 1GSSA 3ME7A 1K0AA 2RM6A 3K8NA 1USBA 2GQMA 1PFOA 4KCEA 3D0ZA 4BIKA 2LJRA 4BVXB 4QL9A 2WRTA 4K5RA 4EDYA 1DE2A 1XWCA 1ST9A 4TR4A 1JZOA 5IIZA 2L57A 2OKAA 3D22A 3VPQA 1HNCA 2P5QA 4AJ7A 3HA9A 2PVOC 2QA2A 4MZWA 4YAPA 2IPAA 2H8LA 5J9BA 3ZIJA 3NIVA 2FD3A 2C1YA 1OYJA 2HRAA 4J2FA 3QFAC 2OBIA 4L5LA 1Z7PA 4BA7A 3A5WA 1EEJA 3APSA 3EU3A 3KM6A 5E4WA 5IPHA 4JR6A 2H72A 5J41A 3BOAA 3Q6OA 3WGEA 1O6JA 12GSA 5CP1A 3BD2A 3SBCA 1LJRA 2VCTA 2L4CA 2VL9A 4WBJA 3UBLA 5ID2B 4K9ZA 3GYKA 4ZL8A 1H4OA 1YF1A 2VM1A 4ZXGA 2P0GA 4F2IA 3UVHA 1GL8A 2X8CA 1FB6A 3EU4A 1QGVA 1VRSD 3WD6A 2IMKA 2PWJA 4G0LA 2GS3A 3M3MA 2LUSA 3F3QA 1U3IA 1M9AA 2H76A 4ICYA 1PX7A 5FT3A 4NHZA 3ME8A 1U88A 2KP2A 4LL4B 2H0HA 3WGDA 2J23A 3F4SA 2YNXA 2C0DA 2HLSA 4MMMA 3KH9A 2GSRA 2CVBA 3IV4A 4JEDA 2VCVA 3HDCA 1MDKA 4GF0A 1Z9HA 1R26A 4G0KA 3NZNA 1SL2B 1WOUA 1F6MC 1VF2A 1LU4A 4DSSA 4ECJA 3DKSA 4N11A 5IMFA 2YWMA 4OO5A 1FOVA 3C1RA 3FR6A 3HJOA 2CAQA 1A24A 1J0FA 5IOWA 3TKRA 3UJ1A 4KE3A 1GSEA 2F8AA 1TRVA 3KMNA 1NSWA 1M9BA 1PQNA 3FYGA 4MA9A 3N9JA 3HVXA 4JZQA 4RQXA 1M2DA 4MDCA 2E0QA 1RQMA 4LL1B 3F6DA 3HCZA 2GQLA 4CY8A 4X1UA 5DALA 4KDYA 2WZ9A 2X8GA 2YWOA 4KGIA 4I6XA 4O32A 1XCCA 4RI7A 1LBKA 1XWBA 3A5IA 4JBBA 3BJ5A 3HVVA 4BWQA 2DLXA 1ZYPA 2A4HA 2MBSA 4X43A 3D21A 1BAYA 5D93A 1Q4JA 1AXDA 4GSSA 4IKHA 3I43A 2LQOA 1JZRA 1NHOA 4EDZA 3FW2A 3LW9A 4RI6A 5HR3A 4TRXA 1PL1A 2I3YA 3D4TA 2H0GA 1AW9A 3MDKA 4TKYA 4EE0A 3UAPA 1SK0A 1N2AA 4USSA 4ZB8A 4NV2A 2YJ7A 5A5KA 4TR1B 3CSJA 2CA8A 4HU9A 1JLWA 5DQYA 1F2EA 4XS1A 1O73A 1JHBA 4GQFA 5GSTA 1T4YA 17GSA 4KB3A 5DJLA 2J9HA 1FAAA 4TW5A 2DJ1A 2F51A 5BMUA 3H8QA 2DJ0A 2B1LA 4ZBAA 3Q18A 1K3YA 3RPPA 3ZMKA 1WWJA 4ZL9A 1NM3A 2C3TA 2WDUA 3LJRA 4PGTA 1TW9A 1ML6A 4BPYA 3GTUA 2OA7A 3VI5A 2VD0A 4PX1A 4MJCA 4ZBBA 3HJPA 3GV1A 4NV5A 3BCKA 4HQZA 2YJHA 3ERGA 3GA4A 3KP9A 1FOHA 2CVDA 3AY8A 3VLNA 2K6VA 1XWKA 4EIQA 1TDIA 5G5FA 2O7KA 4K1FA 3DMLA 2LJAA 2ZNMA 4PQHA 5ECIB 4KSMA 2G0FA 3FZAA 3ZIVA 5DCGA 5INYA 1TKDB 1PN0A 4F82A 1ZYNA 2A2RA 2GDRA 3A3TA 5KOXA 4Z2UA 1EOHA 4GQCA 4CW9A 4BVXA 4I5QA 5DBQA 4HDEA 1ERWA 5G1LA 2FWGA 1G6YA 1K0MA 1J9BA 2E2GA 1YY7A 3C1SA 9GSSA 1HNAA 2OBKA 2H74A 4TXOB 2B5YA 4POKA 2GTUA 2V1MA 4ZIJA 4OD7A 2IL3A 3ZLPA 1HNBA 5DCHA 4Z2TA 1N8JA 2H1GA 4K0NA 3ISOA 2GSTA 2AYTA 4FO5A 2L6DA 1T4ZA 2AUVA 1SYRA 2NDOA 4NPBA 3LG6A 4F0BA 1DUGA 4QQ7A 2FWFA 5JWRB 4L8EA 1T7PB 5G5EA 1O85A 1KTEA 3KP8A 2OJLA 2JL4A 3Q74A 2R0CA 1TRUA 1WJKA 1Z3EA 3PGTA 2TRCP 3UEMA 2LS5A 4OO4A 3IK9A 4ULXA 3I9V2 1EOGA 4DEJA 4IS0A 3GX0A 1XFLA 1B4PA 2VO4A 1TRSA 2RUFA 2EIRA 5ID2A 4A5PA 4V1Ag 2EIQA 3TOUA 6GSXA 4V2MA 5ECPB 5ECKB 1T1VA 4FQUA 1SL1B 3TKQA 3KD0A 3IPZA 4IP1A 2YANA 3P90A 5CAXA 1BX9A 1ACVA 1Z6MA 3Q19A 2LRTA 3GSSA 1OE8A 3FR9A 2LRCA 3ZVJD 5LD0A 3UVTA 5G2ZA 1OAZA 1QUWA 2LKUA 3TKSC 4PUAA 3CRUA 3M1GA 2B5XA 1K0DA 3LWAA 2XC2A 1TRWA 3IDVA 2FY6A 1XW6A 3F8UA 2BTOT 2V2GA 1GTUA 4XHMA 4HEA2 2WJUA 1URMA 1FVJA 5CO3A 1B9XC 3TUEA 14GSA 1SK2A 1F3BA 3EPTA 4NWYA 1FVKA 3A2VA 5FWGA 4ECBA 4KX4A 2NVLA 2GT5A 6GSTA 2F9SA 2HSYA 3WT2A 3QD9A 2I4AA 3DYRA 2CX4A 3ZL5A 5EY6A 4OMVA 1GLPA 4WF5A 2IMFA 2WCIA 1A2LA 3HZ8A 1AAZA 2AV4A 3L9UA 2L5LA 2LRNA 4PURA 4EVMA 2M80A 2GZYA 3C73A 4IQAA 2HRKA 1X5EA 3GL3A 1XG8A 1SJ6A 3TB2A 4V2LA 5GAND 1TXXA 2JADA 5LNKe 3HVNA 4ZB9A 5D9WA 5IMCA 3I6AA 3GN3A 5D8IA 7GSSA 2I9HA 2VM2A 2DBCA 3IOSA 3GMFA 4L5OA 5JCGA 4D73B 1EGOA 2A4VA 2G2QA 4WF4A 4X0XA 1E2YA 2K18A 2ON5A 1NW2A 4G10A 1VF1A 3HVSA 1XZOA 5DAKB 3R3EA 3HZ4A 4V1Ap 3GX8A 2H30A 2LV3A 2H1DA 4EIPA 3PR8A 3F63A 4IQ1A 3LXTA 5IQYA 1MD3A 2I81A 4XCSA 1GP1A 2IIYA 3M0FA 3DXBA 4TR1A 1SD9A 1Z6NA 2R6KA 4N10A 3F3RA 4HS1A 1YQ1A 1UA5A 4JE1A 1NHYA 2LEGA 5IOXA 3KCMA 5KN3A 2H71A 3GNJA 4MJBA 5CNWA 5IM9A 4IBPA 1XW9A 2H0IA 5KEJA 2FGXA 3F0IA 1XW5A 2IFQA 4EO3A 5CRHA 1G6WA 1KEBA 3MWHA 1WMJA 1UVZA 4OFTA 4EKZA 4TVEA 1HYUA 2L6CA 4MZCA 2HSMA 3D6IA 4KDXA 1A0RP 5DDLA 3IC4A 2KP1A 2DSAA 5AIVA 3DIEA 4NXIA 1GTAA 5J5NA 2NBSA 16GSA 2FHEA 2GSQA 2GZPA 3ERFA 3DRNA 1M2AA 1AQWA 2ON7A 1BEDA 3IXRA 3MAKA 2HZEA 3UMAA 2QGVA 3IAM2 1C72A 2R0GA 2VOCA 2EC4A 3D4MA 2N5FA 1GUMA 1DE1A 5G30A 3V1WA 2VCXA 1EP7A 3QAGA 5HR1A 5H5RA 4GSNA 3TJFA 1VGLA 2YWIA 1ERTA 2DJ2A 4POBA 5D73A 3TRQA 3WT1A 4L0WA 5FHIA 1GH2A 1FHEA 4XIHA 2RLIA 2KUCA 2OE1A 1XWGA 2C0EA 2MMNA 5A4WA 1OC9A 3UL3A 4TXOA 4NHWA 5DQSA 2CV4A 2FA4A 3O6TA 4K7OA 2R0PA 2VL3A 3D5JA 1RK4A 3CMIA 3LSZA 4EUYA 1R7HA 1WRYA 3CXGA 2H1BA 18GSA 2A2SA 5ECHB 3CTFA 2H70A 2GT6A 1YJ6A 1KNGA 3TKSE 1H75A 3FZ4A 2M46A 3IHGA 1GTBA 5HFIA 5D9XA 2RIIA 2L5OA 2I1UA 4MPGA 4OFMA 1XWAA 1CQHA 4O5QA 2L4QA 3FMWA 2PGTA 1TJDA 3E0UA 4Q5NA 2LQQA 2R5GA 4ZL7A 1QK8A 2WB9A 4HZ2A 4JR4A 4YH2A 2REMA 1TI3A 4BVYA 3WYWA 1J08A 3TJGA 2HFDA 3LEFA 4EL1A 1GRXA 2CX3A 3GUSA 1ERVA 4G2EA 4MH3A 1A0FA 3ZREA 4MCUA 5G31A 1EGRA 2O8VB 3OR5A 3RPNA 4ILFA 4J57E 2LNSA 4ZBDA 3HYPA 2B5EA 4POLA 2WS2A 3PH9A 8GSSA 1PGTA 4WBRD 2TIRA 1SU9A 5F0GA 1GSQA 1SKSB 1ERUA 2VAFA 2F3MA 1WE0A 1YDKA 2FNOA 2FUG2 3F6FA 5F06A 2HNLA 2A2PA 2XBQA 3R2QA 1QQ2A 4H86A 2K9FA 4PXOA 2C80A 2L59A 2NTOA 1JFUA 3RBTA 1E6BA 3ZMLA 2MZCA 3IK7A 4TN8A 3QAVA 2C8UA 2MYGA 5KN0A 5A4UA 1MDIA 2C3QA 4FYUA 1SENA 2B6MA 2R3XA 5C00A 3FKFA 1V58A 2D2ZA 1M3IA 3RHBA 1EV4A 2M72A 3EE2A 3W8SA 2HYXA 3KJYA 1F37A 1R5AA 3KMOA 4FIWA 2K8VA 3PINA 1VF4A 5ELAA 3RDWA 1UC7A 3CYNA 4IJIA 3IHQA 3FRCA 3C7MA 2ZCTA 3PPUA 4YQVA 5HR0A 1AUCA 2HSHA 2NPBA 2DIZA 1GTIA 1ABAA 4KUNA 4O92A 3DWVA 3GURA 4ISDA 2GVPA 3P8WA 3ZZXA 1TK0B 2O87A 2XPEA 5GZZB 1WP0A 2YZHA 5KN2A 3F9UA 5J3RA 1GSYA 4MK3A 2PU9C 3QMXA 1K0BA 3HJMA 5AISA 2XHFA 5HFGA 2FWEA 4D73A 1QXHA 3ZFBA 2YPMA 3S9FA 4J56E 3H93A 1S3RA 4MH2A 4XRDA 4GXZA 3FY7A 2DJ3A 4K2XA 4IP6A 5AIXA 4DVCA 5DAKA 5LCZA 1DBYA 2TRXA 4HSCX 2DJJA 2PN8A 4E8EA 2DMMA 3HKRA 1V9WA 4O5RA 2ZUPA 3MYDA 3VWWA 2CAIA 2Z9SA 4BWSA 2C0FA 2VUPA 2IMDA 3W6GA 4HOJA 1QMVA 3MIXA 2CQ9A 1SJIA 1ZMAA 4KCAA 3TOTA 1KBNA 1PMTA 3L0HA 4ZILA 3KZQA 5IMDA 5H5SA 1GSUA 1PA3A 6GSWA 1AQXA 1SL0B 3RHCA 4ML1A 5ECSA 3TJBA 1B48A 3FEUA 19GSA 3EMPA 2YN1A 2OACA 1PSQA 4JRRA 1S3CA 1TP9A 2QKEA 1ON4A 4POMA 1THXA 5JCWA 1OKDA 4TXVA 5ECRB 2YWNA 2XBIA 3FR3A 5F8BA 13GSA 5B6NA 1B8XA 1XOAA 2V6OA 2H01A 4Q5FA 2LSTA 4KNDA 2PERA 2E2MA 2HE3A 3DEXA 5ECMB 4CDOA 1GUHA 1FO5A 1AC1A 1G7OA 4FYBA 1U87A 1GUKA 2QC7A 3IE3A 2JZSA 2VCQA 1ZYEA 2FA8A 3GKNA 1PX6A 2HRNA 1EZKA 3G7IA 3VURA 5JCUA 3LYKA 2B7JA 3GHAA 4HI7A 2X99A
chains in the Genus database with same CATH topology
1PKWA 4G9HA 1GNWA 3U5RE 1PKZA 3KH7A 3TRXA 1YF0A 3IAS2 4Z2RA 2DIYA 2MMAA 4ECCA 3C71A 2JZTA 1AIUA 3J7Yk 3EYTA 1A2JA 2B1KA 3H1NA 4I8BA 2YV9A 3GKMA 2C3NA 3QFBC 2AHEA 1V57A 20GSA 1MDJA 4MNNA 4N0VA 4HU7A 4GSTA 2GLRA 4MJEA 3CSHA 4IGJA 3KEBA 4MZBA 2CT6A 1Y6EA 3VFIA 2VD1A 3O76A 4HZ4A 4LA1A 4AJ6A 3EC3A 2GZZA 1PD21 3DGQA 2GSSA 3EVIA 5GAPD 5JWOB 4ACSA 2PPTA 1K3OA 1Z7RA 3GIXA 4NMUA 5J4UA 4Q5RA 4GCIA 3ZITA 5F05A 1X0RA 1A2MA 3QR6A 3KXOA 2IMEA 3FK8A 3GKXA 1HQOA 2KHPA 4RQRA 6GSSA 2N5AA 1XXUA 3FZ5A 3RAZA 5EVOA 3CSIA 2C4JA 1JZDA 4K7IA 1SK1A 3TJKA 2HZFA 3U6VA 4RUVA 1MTCA 3ZFLA 1TU8A 5ECOB 5AGYA 2P31A 2GGTA 2C0GA 2X4AA 1GWCA 4I2TA 2B3SA 1GLQA 1R4WA 1XIYA 2X64A 2B7KA 1FW1A 4WXTA 4YQMA 2OADA 1OC3A 5ECLB 4O7HA 4K5SA 10GSA 3VI7A 2H1AA 3L9VA 5CRGA 3FZ9A 4AJ8A 1SKWB 2KLXA 1V40A 4MPFA 1IYIA 6GSUA 1CQGA 2BJXA 3QPMA 1TK5B 1V2AA 4L0UA 4OWYA 1PN9A 4IVFA 1R5PA 4IELA 3VK9A 1THOA 1ZGNA 4MF5A 5L71A 1ZZYA 1BQ7A 3GKKA 5H5QA 4XS4B 2K8SA 3ED3A 1EEMA 3DD3A 1O8XA 2H6XA 4ECIA 2PVQA 2F8FA 4TOPA 3O3TA 3QCPA 3HD5A 3CRTA 4CHSA 5ECQB 6GSVA 3E3EA 3KIJA 2DJKA 2V41A 2VL2A 4YKFA 4HQSA 5EPFA 4WEYA 5CREA 4PNGA 2OE3A 2IMIA 3F4TA 2JACA 3HY2A 3KGKA 2JSYA 1W4VA 3GSTA 5G1KA 1VF3A 3F4RA 5IO0A 4EC0A 3NOFA 1K3LA 2ES7A 3WGXA 5JWQB 2E7PA 3M9JA 1TU7A 4OFNA 4BL7B 2VLUA 2H6YA 2YV7A 3BCIA 5KN1A 1M99A 4IW9A 1TOFA 3QDNA 3TKSA 1SJZA 2PBJA 3UBKA 2PMTA 1ZOFA 3GL5A 3IRAA 2DKIA 3ZVJA 11GSA 3DVXA 5B7CA 22GSA 1ILOA 3TRPA 3HHVA 1Y25A 2P5RA 1SYXA 1WIKA 4O5UA 1U6TA 4MF6A 4ID0A 1I5GA 5B8BA 1K0CA 2LJKA 5IMAA 3SWLA 4GRFA 2OE0A 1EWXA 3LXZA 1YEPA 3E9JB 1TK8B 1U3AA 1XVWA 2JZRA 4KA0A 1ZCPA 2FCHA 1MD4A 4K8MA 2R2JA 2DKHA 4EF0A 4WR4A 3EMXA 1F9MA 4GWRA 3VWUA 3G9BA 5DVBA 4PNFA 2H6ZA 2KOKA 3G7JA 5CRWA 2H75A 2YZUA 2VCWA 3G7YA 3H79A 2WULA 1DSBA 2FLSA 3TGZA 1JZWA 5J9CA 2HT9A 4KDUA 4QL7A 3IA1A 4ML6A 1G7EA 4HJMA 4YAVA 5D9VA 2ALBA 4LLRA 5D96A 1XBSA 1T3BA 3LYPA 2X49A 4HJ2A 1IYHA 4IN0A 3VPTA 4KW6A 1XOBA 2IFQB 3UOMA 1XVQA 4MABA 1GNEA 2BMXA 4Q5QA 3GH9A 1A23A 3W8JA 3EWLA 2AB6A 2H66A 1BJXA 1S3DA 2AAWA 1T00A 3FHKA 2IN3A 2CZ3A 2YP6A 3LORA 1OKTA 4OCFA 4FH8A 1GSFA 5ENUA 1YKCA 1I9DA 1T8EB 3MNGA 4PUFC 2WFCA 1X9WB 2FWHA 2HZEB 4KH7A 2VLVA 1X9SB 1ZYQB 1OE7A 2V6KA 4XTSA 4G0IA 3TKPA 3GH6A 6GSYA 2LTKA 3US3A 4PQ1A 4N0ZA 4FYCA 1F3AA 1FB0A 4XRAA 2PUKC 3A2WA 4XS6A 1TTZA 5COHA 5CRDA 4NAXA 2VIMA 3VWVA 4DSSB 4G19A 4ZB6A 3ZRDA 5HR2A 2HI7A 5C04A 3LFLA 1JLVA 3ZYWA 3JCML 1GSDA 2X8HA 3C8EA 5IPGA 5ELGA 1BG5A 1ZL9A 1B9YC 2R37A 4JU5A 4F9ZA 1G0TA 2H73A 4WETA 4PQIA 3IC8A 1V98A 3TJJA 5CYYA 1BYEA 3VWXA 1M2BA 5E59A 4MP4A 3ZTLA 5IO2A 2O89A 1OC9B 2GQKA 5HQPA 2CZ2A 4I2UA 1EV9A 3APQA 4AGSA 1M0UA 5DALB 5A4VA 5EL8A 5GSSA 2MBTA 4KSOA 3QOUA 3CTGA 1X9MB 5DJMA 2IJYA 2DC5A 4K2DA 3P2AA 4HUAA 4LMVA 4WKWA 2O85A 3EURA 4DSRA 3KTLA 1O8WA 1YKAA 2HRFA 5ECNB 3DVWA 4MF7A 4DSQA 2MMOA 2UZ8A 2IWTA 3L4NA 5ABRA 2QA1A 2WGRA 3MSZA 4EXJA 4PTSA 4BVYB 2VL2C 2CVKA 4GTUA 4LMWA 2N5BA 4K6XA 4K0GA 2XPDA 1A8YA 5B6MA 5F07A 4P3YB 1A8LA 4IHUA 4I97A 2AJQB 1K0NA 4Z7XA 5KOWA 3UARA 1PL2A 1MEKA 1RW1A 2EIOA 3H4KA 4TR3A 1M7TA 4F03A 4WR5A 3J7Yb 1X5CA 1TI1A 3LQ7A 3HXSA 1EP8A 4N30A 2JSZA 3TCOA 4KAEA 1GULA 1Q98A 5AN1A 4MJAA 3M9KA 1UN2A 3P7XA 3BBYA 3L9SA 1XPVA 2V32A 4GLTA 4K7NA 3ERWA 5D9TA 4YQUA 2R4VA 4XS4A 1HD2A 1X5DA 2DMLA 1W89A 3IR4A 3IBHA 3CBUA 3GRXA 5IMVA 3GTUB 4V2NA 4IJ3A 2RM5A 1S3AA 4YKGA 2MMZA 4OCEA 4X4JA 3EINA 1SD8A 4AF2A 3A2XA 2VLTA 3KTBA 1B4QA 5IMZA 4TR0A 3M8NA 2HXKA 1PRXA 1O7UA 1OC8A 2YCDA 1WPIA 4MLYA 2YOIA 2LNTA 3LGCA 1YEXA 2JU5A 4E8HA 1K0OA 3QAWA 3L78A 5HFKA 3GFKA 1SKRB 1OVNA 5BRTA 1Z5YE 2VCZA 1FG4A 2H19A 1O81A 3APOA 4F0CA 4BL7A 1YZXA 5B8AA 4KF9A 2QSIA 3TDGA 1QFNA 3N5OA 2RUEA 3I69A 4CY6A 3UIWA 1AQVA 1GSSA 3ME7A 1K0AA 2RM6A 3K8NA 1USBA 2GQMA 4KCEA 3D0ZA 2LJRA 4BVXB 4QL9A 2WRTA 4K5RA 4EDYA 1DE2A 1XWCA 1ST9A 4TR4A 1JZOA 5IIZA 2L57A 2OKAA 3D22A 3VPQA 1HNCA 2P5QA 4AJ7A 3HA9A 2PVOC 2QA2A 4MZWA 4YAPA 2IPAA 2H8LA 5J9BA 3ZIJA 3NIVA 2FD3A 2C1YA 1OYJA 2HRAA 4J2FA 3QFAC 2OBIA 4L5LA 1Z7PA 4BA7A 3A5WA 1EEJA 3APSA 3EU3A 3KM6A 5E4WA 5IPHA 4JR6A 2H72A 5J41A 3BOAA 3Q6OA 3WGEA 1O6JA 12GSA 5CP1A 3BD2A 3SBCA 1LJRA 2VCTA 2L4CA 2VL9A 4WBJA 3UBLA 5ID2B 4K9ZA 3GYKA 4ZL8A 1H4OA 1YF1A 2VM1A 4ZXGA 2P0GA 4F2IA 3UVHA 1GL8A 2X8CA 1FB6A 3EU4A 1QGVA 1VRSD 3WD6A 2IMKA 2PWJA 4G0LA 2GS3A 3M3MA 2LUSA 3F3QA 1U3IA 1M9AA 2H76A 4ICYA 1PX7A 5FT3A 4NHZA 3ME8A 1U88A 2KP2A 4LL4B 2H0HA 3WGDA 2J23A 3F4SA 2YNXA 2C0DA 2HLSA 4MMMA 3KH9A 2GSRA 2CVBA 3IV4A 4JEDA 2VCVA 3HDCA 1MDKA 4GF0A 1Z9HA 1R26A 4G0KA 3NZNA 1SL2B 1WOUA 1F6MC 1VF2A 1LU4A 4DSSA 4ECJA 3DKSA 4N11A 5IMFA 2YWMA 4OO5A 1FOVA 3C1RA 3FR6A 3HJOA 2CAQA 1A24A 1J0FA 5IOWA 3TKRA 3UJ1A 4KE3A 1GSEA 2F8AA 1TRVA 3KMNA 1NSWA 1M9BA 1PQNA 3FYGA 4MA9A 3N9JA 3HVXA 4JZQA 4RQXA 1M2DA 4MDCA 2E0QA 1RQMA 4LL1B 3F6DA 3HCZA 2GQLA 4CY8A 4X1UA 5DALA 4KDYA 2WZ9A 2X8GA 2YWOA 4KGIA 4I6XA 4O32A 1XCCA 4RI7A 1LBKA 1XWBA 3A5IA 4JBBA 3BJ5A 3HVVA 4BWQA 2DLXA 1ZYPA 2A4HA 2MBSA 4X43A 3D21A 1BAYA 5D93A 1Q4JA 1AXDA 4GSSA 4IKHA 3I43A 2LQOA 1JZRA 1NHOA 4EDZA 3FW2A 3LW9A 4RI6A 5HR3A 4TRXA 1PL1A 2I3YA 3D4TA 2H0GA 1AW9A 3MDKA 4TKYA 4EE0A 3UAPA 1SK0A 1N2AA 4USSA 4ZB8A 4NV2A 2YJ7A 5A5KA 4TR1B 3CSJA 2CA8A 4HU9A 1JLWA 5DQYA 1F2EA 4XS1A 1O73A 1JHBA 4GQFA 5GSTA 1T4YA 17GSA 4KB3A 5DJLA 2J9HA 1FAAA 4TW5A 2DJ1A 2F51A 5BMUA 3H8QA 2DJ0A 2B1LA 4ZBAA 3Q18A 1K3YA 3RPPA 3ZMKA 1WWJA 4ZL9A 1NM3A 2C3TA 2WDUA 3LJRA 4PGTA 1TW9A 1ML6A 4BPYA 3GTUA 2OA7A 3VI5A 2VD0A 4PX1A 4MJCA 4ZBBA 3HJPA 3GV1A 4NV5A 3BCKA 4HQZA 2YJHA 3ERGA 3GA4A 3KP9A 1FOHA 2CVDA 3AY8A 3VLNA 2K6VA 1XWKA 4EIQA 1TDIA 5G5FA 2O7KA 4K1FA 3DMLA 2LJAA 2ZNMA 4PQHA 5ECIB 4KSMA 2G0FA 3FZAA 3ZIVA 5DCGA 5INYA 1TKDB 1PN0A 4F82A 1ZYNA 2A2RA 2GDRA 3A3TA 5KOXA 4Z2UA 1EOHA 4GQCA 4CW9A 4BVXA 4I5QA 5DBQA 4HDEA 1ERWA 5G1LA 2FWGA 1G6YA 1K0MA 1J9BA 2E2GA 1YY7A 3C1SA 9GSSA 1HNAA 2OBKA 2H74A 4TXOB 2B5YA 4POKA 2GTUA 2V1MA 4ZIJA 4OD7A 2IL3A 3ZLPA 1HNBA 5DCHA 4Z2TA 1N8JA 2H1GA 4K0NA 3ISOA 2GSTA 2AYTA 4FO5A 2L6DA 1T4ZA 2AUVA 1SYRA 2NDOA 4NPBA 3LG6A 4F0BA 1DUGA 4QQ7A 2FWFA 5JWRB 4L8EA 1T7PB 5G5EA 1O85A 1KTEA 3KP8A 2OJLA 2JL4A 3Q74A 2R0CA 1TRUA 1WJKA 1Z3EA 3PGTA 2TRCP 3UEMA 2LS5A 4OO4A 3IK9A 4ULXA 3I9V2 1EOGA 4DEJA 4IS0A 3GX0A 1XFLA 1B4PA 2VO4A 1TRSA 2RUFA 2EIRA 5ID2A 4A5PA 4V1Ag 2EIQA 3TOUA 6GSXA 4V2MA 5ECPB 5ECKB 1T1VA 4FQUA 1SL1B 3TKQA 3KD0A 3IPZA 4IP1A 2YANA 3P90A 5CAXA 1BX9A 1ACVA 1Z6MA 3Q19A 2LRTA 3GSSA 1OE8A 3FR9A 2LRCA 3ZVJD 5LD0A 3UVTA 5G2ZA 1OAZA 1QUWA 2LKUA 3TKSC 4PUAA 3CRUA 3M1GA 2B5XA 1K0DA 3LWAA 2XC2A 1TRWA 3IDVA 2FY6A 1XW6A 3F8UA 2BTOT 2V2GA 1GTUA 4XHMA 4HEA2 2WJUA 1URMA 1FVJA 5CO3A 1B9XC 3TUEA 14GSA 1SK2A 1F3BA 3EPTA 4NWYA 1FVKA 3A2VA 5FWGA 4ECBA 4KX4A 2NVLA 2GT5A 6GSTA 2F9SA 2HSYA 3WT2A 3QD9A 2I4AA 3DYRA 2CX4A 3ZL5A 5EY6A 4OMVA 1GLPA 4WF5A 2IMFA 2WCIA 1A2LA 3HZ8A 1AAZA 2AV4A 3L9UA 2L5LA 2LRNA 4PURA 4EVMA 2M80A 2GZYA 3C73A 4IQAA 2HRKA 1X5EA 3GL3A 1SJ6A 3TB2A 4V2LA 5GAND 1TXXA 2JADA 5LNKe 4ZB9A 5D9WA 5IMCA 3I6AA 3GN3A 5D8IA 7GSSA 2I9HA 2VM2A 2DBCA 3IOSA 3GMFA 4L5OA 5JCGA 4D73B 1EGOA 2A4VA 2G2QA 4WF4A 4X0XA 1E2YA 2K18A 2ON5A 1NW2A 4G10A 1VF1A 3HVSA 1XZOA 5DAKB 3R3EA 3HZ4A 4V1Ap 3GX8A 2H30A 2LV3A 2H1DA 4EIPA 3PR8A 3F63A 4IQ1A 3LXTA 5IQYA 1MD3A 2I81A 4XCSA 1GP1A 2IIYA 3M0FA 3DXBA 4TR1A 1SD9A 1Z6NA 2R6KA 4N10A 3F3RA 4HS1A 1YQ1A 1UA5A 4JE1A 1NHYA 2LEGA 5IOXA 3KCMA 5KN3A 2H71A 3GNJA 4MJBA 5CNWA 5IM9A 4IBPA 1XW9A 2H0IA 5KEJA 2FGXA 3F0IA 1XW5A 2IFQA 4EO3A 5CRHA 1G6WA 1KEBA 3MWHA 1WMJA 1UVZA 4OFTA 4EKZA 4TVEA 1HYUA 2L6CA 4MZCA 2HSMA 3D6IA 4KDXA 1A0RP 5DDLA 3IC4A 2KP1A 2DSAA 5AIVA 3DIEA 4NXIA 1GTAA 5J5NA 2NBSA 16GSA 2FHEA 2GSQA 2GZPA 3ERFA 3DRNA 1M2AA 1AQWA 2ON7A 1BEDA 3IXRA 3MAKA 2HZEA 3UMAA 2QGVA 3IAM2 1C72A 2R0GA 2VOCA 2EC4A 3D4MA 2N5FA 1GUMA 1DE1A 5G30A 3V1WA 2VCXA 1EP7A 3QAGA 5HR1A 5H5RA 4GSNA 3TJFA 1VGLA 2YWIA 1ERTA 2DJ2A 4POBA 5D73A 3TRQA 3WT1A 4L0WA 5FHIA 1GH2A 1FHEA 4XIHA 2RLIA 2KUCA 2OE1A 1XWGA 2C0EA 2MMNA 5A4WA 1OC9A 3UL3A 4TXOA 4NHWA 5DQSA 2CV4A 2FA4A 3O6TA 4K7OA 2R0PA 2VL3A 3D5JA 1RK4A 3CMIA 3LSZA 4EUYA 1R7HA 1WRYA 3CXGA 2H1BA 18GSA 2A2SA 5ECHB 3CTFA 2H70A 2GT6A 1YJ6A 1KNGA 3TKSE 1H75A 3FZ4A 2M46A 3IHGA 1GTBA 5HFIA 5D9XA 2RIIA 2L5OA 2I1UA 4MPGA 4OFMA 1XWAA 1CQHA 4O5QA 2L4QA 3FMWA 2PGTA 1TJDA 3E0UA 4Q5NA 2LQQA 2R5GA 4ZL7A 1QK8A 2WB9A 4HZ2A 4JR4A 4YH2A 2REMA 1TI3A 4BVYA 3WYWA 1J08A 3TJGA 2HFDA 3LEFA 4EL1A 1GRXA 2CX3A 3GUSA 1ERVA 4G2EA 4MH3A 1A0FA 3ZREA 4MCUA 5G31A 1EGRA 2O8VB 3OR5A 3RPNA 4ILFA 4J57E 2LNSA 4ZBDA 3HYPA 2B5EA 4POLA 2WS2A 3PH9A 8GSSA 1PGTA 4WBRD 2TIRA 1SU9A 5F0GA 1GSQA 1SKSB 1ERUA 2VAFA 2F3MA 1WE0A 1YDKA 2FNOA 2FUG2 3F6FA 5F06A 2HNLA 2A2PA 2XBQA 3R2QA 1QQ2A 4H86A 2K9FA 4PXOA 2C80A 2L59A 2NTOA 1JFUA 3RBTA 1E6BA 3ZMLA 2MZCA 3IK7A 4TN8A 3QAVA 2C8UA 2MYGA 5KN0A 5A4UA 1MDIA 2C3QA 4FYUA 1SENA 2B6MA 2R3XA 5C00A 3FKFA 1V58A 2D2ZA 3RHBA 1EV4A 2M72A 3EE2A 3W8SA 2HYXA 3KJYA 1F37A 1R5AA 3KMOA 4FIWA 2K8VA 3PINA 1VF4A 5ELAA 3RDWA 1UC7A 3CYNA 4IJIA 3IHQA 3FRCA 3C7MA 2ZCTA 3PPUA 4YQVA 5HR0A 1AUCA 2HSHA 2NPBA 2DIZA 1GTIA 1ABAA 4KUNA 4O92A 3DWVA 3GURA 4ISDA 2GVPA 3P8WA 3ZZXA 1TK0B 2O87A 2XPEA 5GZZB 1WP0A 2YZHA 5KN2A 3F9UA 5J3RA 1GSYA 4MK3A 2PU9C 3QMXA 1K0BA 3HJMA 5AISA 2XHFA 5HFGA 2FWEA 4D73A 1QXHA 3ZFBA 2YPMA 3S9FA 4J56E 3H93A 4MH2A 4XRDA 4GXZA 3FY7A 2DJ3A 4K2XA 4IP6A 5AIXA 4DVCA 5DAKA 5LCZA 1DBYA 2TRXA 2DJJA 2PN8A 4E8EA 2DMMA 3HKRA 1V9WA 4O5RA 2ZUPA 3MYDA 3VWWA 2CAIA 2Z9SA 4BWSA 2C0FA 2VUPA 2IMDA 3W6GA 4HOJA 1QMVA 3MIXA 2CQ9A 1SJIA 1ZMAA 4KCAA 3TOTA 1KBNA 1PMTA 3L0HA 4ZILA 3KZQA 5IMDA 5H5SA 1GSUA 1PA3A 6GSWA 1AQXA 1SL0B 3RHCA 4ML1A 5ECSA 3TJBA 1B48A 3FEUA 19GSA 3EMPA 2YN1A 2OACA 1PSQA 4JRRA 1S3CA 1TP9A 2QKEA 1ON4A 4POMA 1THXA 5JCWA 1OKDA 4TXVA 5ECRB 2YWNA 2XBIA 3FR3A 5F8BA 13GSA 5B6NA 1B8XA 1XOAA 2V6OA 2H01A 4Q5FA 2LSTA 4KNDA 2PERA 2E2MA 2HE3A 3DEXA 5ECMB 4CDOA 1GUHA 1FO5A 1AC1A 1G7OA 4FYBA 1U87A 1GUKA 2QC7A 3IE3A 2JZSA 2VCQA 1ZYEA 2FA8A 3GKNA 1PX6A 2HRNA 1EZKA 3G7IA 3VURA 5JCUA 3LYKA 2B7JA 3GHAA 4HI7A 2X99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKW A;  4G9H A;  1GNW A;  3U5R E;  1PKZ A;  3KH7 A;  3TRX A;  1YF0 A;  3IAS 2;  2DIY A;  2MMA A;  4ECC A;  3C71 A;  2JZT A;  1AIU A;  3J7Y k;  3EYT A;  1A2J A;  2B1K A;  3H1N A;  4I8B A;  2YV9 A;  3GKM A;  2C3N A;  3QFB C;  2AHE A;  1V57 A;  20GS A;  1MDJ A;  4N0V A;  4HU7 A;  4GST A;  2GLR A;  4MJE A;  3CSH A;  4IGJ A;  3KEB A;  4MZB A;  2CT6 A;  1Y6E A;  3VFI A;  2VD1 A;  3O76 A;  4HZ4 A;  4LA1 A;  4AJ6 A;  3EC3 A;  2GZZ A;  1PD2 1;  3DGQ A;  2GSS A;  3EVI A;  5GAP D;  5JWO B;  4ACS A;  2PPT A;  1K3O A;  1Z7R A;  3GIX A;  4NMU A;  5J4U A;  4Q5R A;  4GCI A;  3ZIT A;  5F05 A;  1X0R A;  1A2M A;  3QR6 A;  3KXO A;  2IME A;  3FK8 A;  3GKX A;  1HQO A;  2KHP A;  4RQR A;  6GSS A;  2N5A A;  1XXU A;  3FZ5 A;  3RAZ A;  5EVO A;  3CSI A;  2C4J A;  1JZD A;  4K7I A;  1SK1 A;  3TJK A;  2HZF A;  3U6V A;  4RUV A;  1MTC A;  3ZFL A;  1TU8 A;  5ECO B;  5AGY A;  2P31 A;  2GGT A;  2C0G A;  1GWC A;  4I2T A;  2B3S A;  1GLQ A;  1R4W A;  1XIY A;  2X64 A;  2B7K A;  1FW1 A;  4WXT A;  4YQM A;  2OAD A;  1OC3 A;  5ECL B;  4O7H A;  10GS A;  3VI7 A;  2H1A A;  3L9V A;  5CRG A;  3FZ9 A;  4AJ8 A;  1SKW B;  2KLX A;  1V40 A;  4MPF A;  1IYI A;  6GSU A;  1CQG A;  2BJX A;  3QPM A;  1TK5 B;  1V2A A;  4L0U A;  4OWY A;  1PN9 A;  4IVF A;  1R5P A;  4IEL A;  3VK9 A;  1THO A;  1ZGN A;  4MF5 A;  5L71 A;  1ZZY A;  1BQ7 A;  3GKK A;  5H5Q A;  4XS4 B;  2K8S A;  3ED3 A;  1EEM A;  3DD3 A;  1O8X A;  2H6X A;  4ECI A;  2PVQ A;  2F8F A;  4TOP A;  3O3T A;  3QCP A;  3HD5 A;  3CRT A;  4CHS A;  5ECQ B;  6GSV A;  3E3E A;  3KIJ A;  2DJK A;  2V41 A;  2VL2 A;  4HQS A;  5EPF A;  4WEY A;  5CRE A;  4PNG A;  2OE3 A;  2IMI A;  3F4T A;  2JAC A;  3HY2 A;  3KGK A;  2JSY A;  1W4V A;  3GST A;  5G1K A;  1VF3 A;  3F4R A;  5IO0 A;  4EC0 A;  3NOF A;  1K3L A;  2ES7 A;  3WGX A;  5JWQ B;  2E7P A;  3M9J A;  1TU7 A;  4OFN A;  2VLU A;  2H6Y A;  2YV7 A;  3BCI A;  5KN1 A;  1M99 A;  4IW9 A;  1TOF A;  3QDN A;  3TKS A;  1SJZ A;  2PBJ A;  3UBK A;  2PMT A;  1ZOF A;  3GL5 A;  3IRA A;  3ZVJ A;  11GS A;  3DVX A;  5B7C A;  22GS A;  1ILO A;  3TRP A;  3HHV A;  1Y25 A;  2P5R A;  1SYX A;  1WIK A;  1U6T A;  4MF6 A;  4ID0 A;  1I5G A;  5B8B A;  1K0C A;  2LJK A;  5IMA A;  3SWL A;  4GRF A;  2OE0 A;  1EWX A;  3LXZ A;  1YEP A;  3E9J B;  1TK8 B;  1U3A A;  1XVW A;  2JZR A;  4KA0 A;  1ZCP A;  2FCH A;  1MD4 A;  4K8M A;  2R2J A;  4EF0 A;  4WR4 A;  3EMX A;  1F9M A;  4GWR A;  3VWU A;  3G9B A;  5DVB A;  4PNF A;  2H6Z A;  2KOK A;  3G7J A;  5CRW A;  2H75 A;  2YZU A;  2VCW A;  3G7Y A;  3H79 A;  2WUL A;  1DSB A;  2FLS A;  3TGZ A;  1JZW A;  5J9C A;  2HT9 A;  4KDU A;  4QL7 A;  3IA1 A;  4ML6 A;  1G7E A;  4HJM A;  4YAV A;  5D9V A;  2ALB A;  4LLR A;  5D96 A;  1XBS A;  1T3B A;  3LYP A;  4HJ2 A;  1IYH A;  4IN0 A;  3VPT A;  4KW6 A;  1XOB A;  2IFQ B;  3UOM A;  1XVQ A;  4MAB A;  1GNE A;  2BMX A;  4Q5Q A;  3GH9 A;  1A23 A;  3W8J A;  3EWL A;  2AB6 A;  2H66 A;  1BJX A;  1S3D A;  2AAW A;  1T00 A;  3FHK A;  2IN3 A;  2CZ3 A;  2YP6 A;  3LOR A;  1OKT A;  4OCF A;  4FH8 A;  1GSF A;  5ENU A;  1YKC A;  1I9D A;  1T8E B;  3MNG A;  4PUF C;  2WFC A;  1X9W B;  2FWH A;  2HZE B;  4KH7 A;  2VLV A;  1X9S B;  1ZYQ B;  1OE7 A;  2V6K A;  4XTS A;  3TKP A;  3GH6 A;  6GSY A;  2LTK A;  3US3 A;  4PQ1 A;  4N0Z A;  4FYC A;  1F3A A;  1FB0 A;  4XRA A;  2PUK C;  3A2W A;  4XS6 A;  1TTZ A;  5COH A;  5CRD A;  4NAX A;  2VIM A;  3VWV A;  4DSS B;  4G19 A;  4ZB6 A;  3ZRD A;  5HR2 A;  2HI7 A;  5C04 A;  3LFL A;  1JLV A;  3ZYW A;  3JCM L;  1GSD A;  2X8H A;  3C8E A;  5IPG A;  5ELG A;  1BG5 A;  1ZL9 A;  1B9Y C;  2R37 A;  4JU5 A;  4F9Z A;  1G0T A;  2H73 A;  4WET A;  4PQI A;  1V98 A;  3TJJ A;  5CYY A;  1BYE A;  3VWX A;  1M2B A;  5E59 A;  4MP4 A;  3ZTL A;  5IO2 A;  2O89 A;  1OC9 B;  2GQK A;  5HQP A;  2CZ2 A;  4I2U A;  1EV9 A;  3APQ A;  4AGS A;  1M0U A;  5DAL B;  5A4V A;  5EL8 A;  5GSS A;  2MBT A;  4KSO A;  3QOU A;  3CTG A;  1X9M B;  5DJM A;  2IJY A;  2DC5 A;  4K2D A;  3P2A A;  4HUA A;  4LMV A;  4WKW A;  2O85 A;  3EUR A;  4DSR A;  3KTL A;  1O8W A;  1YKA A;  2HRF A;  5ECN B;  3DVW A;  4MF7 A;  4DSQ A;  2MMO A;  2IWT A;  3L4N A;  5ABR A;  2WGR A;  3MSZ A;  4EXJ A;  2VL2 C;  2CVK A;  4GTU A;  4LMW A;  2N5B A;  4K6X A;  4K0G A;  2XPD A;  1A8Y A;  5B6M A;  5F07 A;  4P3Y B;  1A8L A;  4IHU A;  4I97 A;  2AJQ B;  1K0N A;  4Z7X A;  3UAR A;  1PL2 A;  1MEK A;  1RW1 A;  2EIO A;  3H4K A;  4TR3 A;  1M7T A;  4F03 A;  4WR5 A;  3J7Y b;  1X5C A;  1TI1 A;  3LQ7 A;  3HXS A;  1EP8 A;  4N30 A;  2JSZ A;  3TCO A;  4KAE A;  1GUL A;  1Q98 A;  5AN1 A;  4MJA A;  3M9K A;  1UN2 A;  3P7X A;  3BBY A;  3L9S A;  1XPV A;  2V32 A;  4GLT A;  4K7N A;  3ERW A;  5D9T A;  4YQU A;  2R4V A;  4XS4 A;  1HD2 A;  1X5D A;  2DML A;  1W89 A;  3IR4 A;  3IBH A;  3CBU A;  3GRX A;  5IMV A;  3GTU B;  4V2N A;  4IJ3 A;  2RM5 A;  1S3A A;  2MMZ A;  4OCE A;  3EIN A;  1SD8 A;  4AF2 A;  3A2X A;  2VLT A;  3KTB A;  1B4Q A;  5IMZ A;  4TR0 A;  3M8N A;  2HXK A;  1PRX A;  1O7U A;  1OC8 A;  2YCD A;  1WPI A;  4MLY A;  2YOI A;  2LNT A;  3LGC A;  1YEX A;  2JU5 A;  4E8H A;  1K0O A;  3QAW A;  3L78 A;  5HFK A;  3GFK A;  1SKR B;  1OVN A;  1Z5Y E;  2VCZ A;  1FG4 A;  2H19 A;  1O81 A;  3APO A;  4F0C A;  4BL7 A;  1YZX A;  5B8A A;  2QSI A;  3TDG A;  1QFN A;  3N5O A;  2RUE A;  3I69 A;  3UIW A;  1AQV A;  1GSS A;  3ME7 A;  1K0A A;  2RM6 A;  3K8N A;  1USB A;  2GQM A;  4KCE A;  3D0Z A;  2LJR A;  4QL9 A;  2WRT A;  4EDY A;  1DE2 A;  1XWC A;  1ST9 A;  4TR4 A;  1JZO A;  5IIZ A;  2L57 A;  2OKA A;  3D22 A;  3VPQ A;  1HNC A;  2P5Q A;  4AJ7 A;  3HA9 A;  2PVO C;  4MZW A;  4YAP A;  2IPA A;  2H8L A;  5J9B A;  3ZIJ A;  3NIV A;  2FD3 A;  2C1Y A;  1OYJ A;  4J2F A;  3QFA C;  2OBI A;  4L5L A;  1Z7P A;  4BA7 A;  3A5W A;  1EEJ A;  3APS A;  3EU3 A;  3KM6 A;  5E4W A;  5IPH A;  4JR6 A;  2H72 A;  5J41 A;  3BOA A;  3Q6O A;  3WGE A;  1O6J A;  12GS A;  5CP1 A;  3BD2 A;  3SBC A;  1LJR A;  2VCT A;  2L4C A;  2VL9 A;  4WBJ A;  3UBL A;  5ID2 B;  4K9Z A;  3GYK A;  4ZL8 A;  1H4O A;  1YF1 A;  2VM1 A;  4ZXG A;  2P0G A;  4F2I A;  3UVH A;  1GL8 A;  2X8C A;  1FB6 A;  3EU4 A;  1QGV A;  1VRS D;  3WD6 A;  2IMK A;  2PWJ A;  2GS3 A;  3M3M A;  2LUS A;  3F3Q A;  1U3I A;  1M9A A;  2H76 A;  1PX7 A;  5FT3 A;  4NHZ A;  3ME8 A;  1U88 A;  2KP2 A;  4LL4 B;  2H0H A;  3WGD A;  2J23 A;  3F4S A;  2YNX A;  2C0D A;  2HLS A;  4MMM A;  3KH9 A;  2GSR A;  2CVB A;  3IV4 A;  4JED A;  2VCV A;  3HDC A;  1MDK A;  4GF0 A;  1Z9H A;  1R26 A;  3NZN A;  1SL2 B;  1WOU A;  1F6M C;  1VF2 A;  1LU4 A;  4DSS A;  4ECJ A;  3DKS A;  4N11 A;  5IMF A;  2YWM A;  4OO5 A;  1FOV A;  3C1R A;  3FR6 A;  3HJO A;  2CAQ A;  1A24 A;  1J0F A;  5IOW A;  3TKR A;  3UJ1 A;  4KE3 A;  1GSE A;  2F8A A;  1TRV A;  3KMN A;  1NSW A;  1M9B A;  1PQN A;  3FYG A;  4MA9 A;  3N9J A;  3HVX A;  4JZQ A;  4RQX A;  1M2D A;  4MDC A;  2E0Q A;  1RQM A;  4LL1 B;  3F6D A;  3HCZ A;  2GQL A;  4X1U A;  5DAL A;  4KDY A;  2WZ9 A;  2X8G A;  2YWO A;  4KGI A;  4I6X A;  4O32 A;  1XCC A;  4RI7 A;  1LBK A;  1XWB A;  4JBB A;  3BJ5 A;  3HVV A;  4BWQ A;  2DLX A;  2MBS A;  4X43 A;  3D21 A;  1BAY A;  5D93 A;  1Q4J A;  1AXD A;  4GSS A;  4IKH A;  3I43 A;  2LQO A;  1JZR A;  1NHO A;  4EDZ A;  3FW2 A;  4RI6 A;  5HR3 A;  4TRX A;  1PL1 A;  2I3Y A;  3D4T A;  2H0G A;  1AW9 A;  3MDK A;  4TKY A;  4EE0 A;  3UAP A;  1SK0 A;  1N2A A;  4ZB8 A;  4NV2 A;  2YJ7 A;  5A5K A;  4TR1 B;  3CSJ A;  2CA8 A;  4HU9 A;  1JLW A;  5DQY A;  1F2E A;  4XS1 A;  1O73 A;  1JHB A;  4GQF A;  5GST A;  1T4Y A;  17GS A;  4KB3 A;  5DJL A;  2J9H A;  1FAA A;  4TW5 A;  2DJ1 A;  2F51 A;  3H8Q A;  2DJ0 A;  2B1L A;  4ZBA A;  3Q18 A;  1K3Y A;  3RPP A;  3ZMK A;  1WWJ A;  4ZL9 A;  1NM3 A;  2C3T A;  2WDU A;  3LJR A;  4PGT A;  1TW9 A;  1ML6 A;  4BPY A;  3GTU A;  2OA7 A;  3VI5 A;  2VD0 A;  4PX1 A;  4MJC A;  4ZBB A;  3HJP A;  3GV1 A;  4NV5 A;  3BCK A;  4HQZ A;  2YJH A;  3ERG A;  3GA4 A;  3KP9 A;  2CVD A;  3AY8 A;  3VLN A;  2K6V A;  1XWK A;  1TDI A;  5G5F A;  2O7K A;  4K1F A;  3DML A;  2LJA A;  2ZNM A;  4PQH A;  5ECI B;  4KSM A;  2G0F A;  3FZA A;  3ZIV A;  5DCG A;  5INY A;  1TKD B;  4F82 A;  2A2R A;  2GDR A;  3A3T A;  1EOH A;  4GQC A;  4CW9 A;  4BVX A;  4I5Q A;  5DBQ A;  4HDE A;  1ERW A;  5G1L A;  2FWG A;  1G6Y A;  1K0M A;  1J9B A;  2E2G A;  1YY7 A;  3C1S A;  9GSS A;  1HNA A;  2OBK A;  2H74 A;  4TXO B;  2B5Y A;  4POK A;  2GTU A;  2V1M A;  4ZIJ A;  4OD7 A;  2IL3 A;  3ZLP A;  1HNB A;  5DCH A;  1N8J A;  2H1G A;  4K0N A;  3ISO A;  2GST A;  2AYT A;  4FO5 A;  2L6D A;  1T4Z A;  2AUV A;  1SYR A;  2NDO A;  4NPB A;  3LG6 A;  4F0B A;  1DUG A;  4QQ7 A;  2FWF A;  5JWR B;  4L8E A;  1T7P B;  5G5E A;  1O85 A;  1KTE A;  3KP8 A;  2OJL A;  2JL4 A;  3Q74 A;  1TRU A;  1WJK A;  1Z3E A;  3PGT A;  2TRC P;  3UEM A;  2LS5 A;  4OO4 A;  3IK9 A;  4ULX A;  3I9V 2;  1EOG A;  4DEJ A;  4IS0 A;  3GX0 A;  1XFL A;  1B4P A;  2VO4 A;  1TRS A;  2RUF A;  2EIR A;  5ID2 A;  4V1A g;  2EIQ A;  3TOU A;  6GSX A;  4V2M A;  5ECP B;  5ECK B;  1T1V A;  1SL1 B;  3TKQ A;  3KD0 A;  3IPZ A;  4IP1 A;  2YAN A;  3P90 A;  5CAX A;  1BX9 A;  1ACV A;  1Z6M A;  3Q19 A;  2LRT A;  3GSS A;  1OE8 A;  3FR9 A;  2LRC A;  3ZVJ D;  5LD0 A;  3UVT A;  5G2Z A;  1OAZ A;  1QUW A;  2LKU A;  3TKS C;  4PUA A;  3CRU A;  3M1G A;  2B5X A;  1K0D A;  3LWA A;  2XC2 A;  1TRW A;  3IDV A;  2FY6 A;  1XW6 A;  3F8U A;  2BTO T;  2V2G A;  1GTU A;  4XHM A;  4HEA 2;  2WJU A;  1URM A;  1FVJ A;  5CO3 A;  1B9X C;  3TUE A;  14GS A;  1SK2 A;  1F3B A;  4NWY A;  1FVK A;  3A2V A;  5FWG A;  4ECB A;  4KX4 A;  2NVL A;  2GT5 A;  6GST A;  2F9S A;  2HSY A;  3WT2 A;  3QD9 A;  2I4A A;  3DYR A;  2CX4 A;  3ZL5 A;  5EY6 A;  4OMV A;  1GLP A;  4WF5 A;  2IMF A;  2WCI A;  1A2L A;  3HZ8 A;  1AAZ A;  2AV4 A;  3L9U A;  2L5L A;  2LRN A;  4PUR A;  4EVM A;  2M80 A;  2GZY A;  3C73 A;  4IQA A;  1X5E A;  3GL3 A;  1SJ6 A;  3TB2 A;  4V2L A;  5GAN D;  1TXX A;  2JAD A;  5LNK e;  4ZB9 A;  5D9W A;  5IMC A;  3I6A A;  3GN3 A;  5D8I A;  7GSS A;  2I9H A;  2VM2 A;  2DBC A;  3IOS A;  3GMF A;  4L5O A;  5JCG A;  4D73 B;  1EGO A;  2A4V A;  2G2Q A;  4WF4 A;  4X0X A;  1E2Y A;  2K18 A;  2ON5 A;  1NW2 A;  4G10 A;  1VF1 A;  3HVS A;  1XZO A;  5DAK B;  3HZ4 A;  4V1A p;  3GX8 A;  2H30 A;  2LV3 A;  2H1D A;  3PR8 A;  3F63 A;  4IQ1 A;  3LXT A;  5IQY A;  1MD3 A;  2I81 A;  4XCS A;  1GP1 A;  2IIY A;  3M0F A;  3DXB A;  4TR1 A;  1SD9 A;  1Z6N A;  2R6K A;  4N10 A;  3F3R A;  4HS1 A;  1YQ1 A;  1UA5 A;  4JE1 A;  1NHY A;  2LEG A;  5IOX A;  3KCM A;  5KN3 A;  2H71 A;  3GNJ A;  4MJB A;  5CNW A;  5IM9 A;  4IBP A;  1XW9 A;  2H0I A;  5KEJ A;  2FGX A;  3F0I A;  1XW5 A;  2IFQ A;  4EO3 A;  5CRH A;  1G6W A;  1KEB A;  3MWH A;  1WMJ A;  1UVZ A;  4OFT A;  4EKZ A;  4TVE A;  1HYU A;  2L6C A;  4MZC A;  3D6I A;  4KDX A;  1A0R P;  5DDL A;  3IC4 A;  2KP1 A;  2DSA A;  5AIV A;  3DIE A;  4NXI A;  1GTA A;  5J5N A;  2NBS A;  16GS A;  2FHE A;  2GSQ A;  2GZP A;  3ERF A;  3DRN A;  1M2A A;  1AQW A;  2ON7 A;  1BED A;  3IXR A;  3MAK A;  2HZE A;  3UMA A;  2QGV A;  3IAM 2;  1C72 A;  2VOC A;  2EC4 A;  3D4M A;  2N5F A;  1GUM A;  1DE1 A;  5G30 A;  3V1W A;  2VCX A;  1EP7 A;  3QAG A;  5HR1 A;  5H5R A;  4GSN A;  3TJF A;  1VGL A;  2YWI A;  1ERT A;  2DJ2 A;  4POB A;  5D73 A;  3TRQ A;  3WT1 A;  4L0W A;  5FHI A;  1GH2 A;  1FHE A;  4XIH A;  2RLI A;  2KUC A;  2OE1 A;  1XWG A;  2C0E A;  2MMN A;  5A4W A;  1OC9 A;  3UL3 A;  4TXO A;  4NHW A;  5DQS A;  2CV4 A;  2FA4 A;  3O6T A;  4K7O A;  2VL3 A;  3D5J A;  1RK4 A;  3CMI A;  3LSZ A;  4EUY A;  1R7H A;  1WRY A;  3CXG A;  5ECH B;  2H1B A;  18GS A;  2A2S A;  3CTF A;  2H70 A;  2GT6 A;  1YJ6 A;  1KNG A;  3TKS E;  1H75 A;  3FZ4 A;  2M46 A;  1GTB A;  5HFI A;  5D9X A;  2RII A;  2L5O A;  2I1U A;  4MPG A;  4OFM A;  1XWA A;  1CQH A;  2L4Q A;  2PGT A;  1TJD A;  3E0U A;  4Q5N A;  2LQQ A;  2R5G A;  4ZL7 A;  1QK8 A;  2WB9 A;  4HZ2 A;  4JR4 A;  4YH2 A;  2REM A;  1TI3 A;  4BVY A;  3WYW A;  1J08 A;  3TJG A;  2HFD A;  3LEF A;  4EL1 A;  1GRX A;  2CX3 A;  3GUS A;  1ERV A;  4G2E A;  4MH3 A;  1A0F A;  3ZRE A;  4MCU A;  5G31 A;  1EGR A;  2O8V B;  3OR5 A;  3RPN A;  4ILF A;  4J57 E;  2LNS A;  4ZBD A;  3HYP A;  2B5E A;  4POL A;  2WS2 A;  3PH9 A;  8GSS A;  1PGT A;  4WBR D;  2TIR A;  1SU9 A;  5F0G A;  1GSQ A;  1SKS B;  1ERU A;  2VAF A;  2F3M A;  1WE0 A;  1YDK A;  2FNO A;  2FUG 2;  3F6F A;  5F06 A;  2HNL A;  2XBQ A;  3R2Q A;  1QQ2 A;  4H86 A;  2K9F A;  4PXO A;  2C80 A;  2L59 A;  2NTO A;  1JFU A;  3RBT A;  1E6B A;  3ZML A;  2MZC A;  3IK7 A;  4TN8 A;  3QAV A;  2C8U A;  2MYG A;  5KN0 A;  5A4U A;  1MDI A;  2C3Q A;  4FYU A;  1SEN A;  2B6M A;  2R3X A;  5C00 A;  3FKF A;  1V58 A;  2D2Z A;  3RHB A;  1EV4 A;  2M72 A;  3EE2 A;  3W8S A;  2HYX A;  3KJY A;  1F37 A;  1R5A A;  3KMO A;  4FIW A;  2K8V A;  3PIN A;  1VF4 A;  5ELA A;  3RDW A;  1UC7 A;  3CYN A;  4IJI A;  3IHQ A;  3FRC A;  3C7M A;  2ZCT A;  4YQV A;  5HR0 A;  1AUC A;  2HSH A;  2NPB A;  2DIZ A;  1GTI A;  1ABA A;  4KUN A;  4O92 A;  3DWV A;  3GUR A;  4ISD A;  2GVP A;  3P8W A;  3ZZX A;  1TK0 B;  2O87 A;  2XPE A;  5GZZ B;  1WP0 A;  2YZH A;  5KN2 A;  3F9U A;  5J3R A;  1GSY A;  4MK3 A;  2PU9 C;  3QMX A;  1K0B A;  3HJM A;  5AIS A;  2XHF A;  5HFG A;  2FWE A;  4D73 A;  1QXH A;  3ZFB A;  2YPM A;  3S9F A;  4J56 E;  3H93 A;  4MH2 A;  4XRD A;  4GXZ A;  3FY7 A;  2DJ3 A;  4IP6 A;  5AIX A;  4DVC A;  5DAK A;  5LCZ A;  1DBY A;  2TRX A;  2DJJ A;  2PN8 A;  4E8E A;  2DMM A;  3HKR A;  1V9W A;  4O5R A;  2ZUP A;  3VWW A;  2CAI A;  2Z9S A;  4BWS A;  2C0F A;  2VUP A;  2IMD A;  3W6G A;  4HOJ A;  1QMV A;  2CQ9 A;  1SJI A;  1ZMA A;  4KCA A;  3TOT A;  1KBN A;  1PMT A;  3L0H A;  4ZIL A;  3KZQ A;  5IMD A;  5H5S A;  1GSU A;  1PA3 A;  6GSW A;  1AQX A;  1SL0 B;  3RHC A;  4ML1 A;  5ECS A;  3TJB A;  1B48 A;  3FEU A;  19GS A;  3EMP A;  2YN1 A;  2OAC A;  1PSQ A;  4JRR A;  1S3C A;  1TP9 A;  2QKE A;  1ON4 A;  4POM A;  1THX A;  5JCW A;  1OKD A;  4TXV A;  5ECR B;  2YWN A;  2XBI A;  3FR3 A;  5F8B A;  13GS A;  5B6N A;  1B8X A;  1XOA A;  2V6O A;  2H01 A;  4Q5F A;  2LST A;  4KND A;  2PER A;  2E2M A;  2HE3 A;  3DEX A;  5ECM B;  4CDO A;  1GUH A;  1FO5 A;  1AC1 A;  1G7O A;  4FYB A;  1U87 A;  1GUK A;  2QC7 A;  3IE3 A;  2JZS A;  2VCQ A;  1ZYE A;  2FA8 A;  3GKN A;  1PX6 A;  2HRN A;  1EZK A;  3G7I A;  3VUR A;  5JCU A;  3LYK A;  2B7J A;  3GHA A;  4HI7 A;  2X99 A; 
#chains in the Genus database with same CATH topology
 1PKW A;  4G9H A;  1GNW A;  3U5R E;  1PKZ A;  3KH7 A;  3TRX A;  1YF0 A;  3IAS 2;  4Z2R A;  2DIY A;  2MMA A;  4ECC A;  3C71 A;  2JZT A;  1AIU A;  3J7Y k;  3EYT A;  1A2J A;  2B1K A;  3H1N A;  4I8B A;  2YV9 A;  3GKM A;  2C3N A;  3QFB C;  2AHE A;  1V57 A;  20GS A;  1MDJ A;  4MNN A;  4N0V A;  4HU7 A;  4GST A;  2GLR A;  4MJE A;  3CSH A;  4IGJ A;  3KEB A;  4MZB A;  2CT6 A;  1Y6E A;  3VFI A;  2VD1 A;  3O76 A;  4HZ4 A;  4LA1 A;  4AJ6 A;  3EC3 A;  2GZZ A;  1PD2 1;  3DGQ A;  2GSS A;  3EVI A;  5GAP D;  5JWO B;  4ACS A;  2PPT A;  1K3O A;  1Z7R A;  3GIX A;  4NMU A;  5J4U A;  4Q5R A;  4GCI A;  3ZIT A;  5F05 A;  1X0R A;  1A2M A;  3QR6 A;  3KXO A;  2IME A;  3FK8 A;  3GKX A;  1HQO A;  2KHP A;  4RQR A;  6GSS A;  2N5A A;  1XXU A;  3FZ5 A;  3RAZ A;  5EVO A;  3CSI A;  2C4J A;  1JZD A;  4K7I A;  1SK1 A;  3TJK A;  2HZF A;  3U6V A;  4RUV A;  1MTC A;  3ZFL A;  1TU8 A;  5ECO B;  5AGY A;  2P31 A;  2GGT A;  2C0G A;  2X4A A;  1GWC A;  4I2T A;  2B3S A;  1GLQ A;  1R4W A;  1XIY A;  2X64 A;  2B7K A;  1FW1 A;  4WXT A;  4YQM A;  2OAD A;  1OC3 A;  5ECL B;  4O7H A;  4K5S A;  10GS A;  3VI7 A;  2H1A A;  3L9V A;  5CRG A;  3FZ9 A;  4AJ8 A;  1SKW B;  2KLX A;  1V40 A;  4MPF A;  1IYI A;  6GSU A;  1CQG A;  2BJX A;  3QPM A;  1TK5 B;  1V2A A;  4L0U A;  4OWY A;  1PN9 A;  4IVF A;  1M3J A;  1R5P A;  4IEL A;  3VK9 A;  1THO A;  1ZGN A;  4MF5 A;  5L71 A;  1ZZY A;  1BQ7 A;  3GKK A;  5H5Q A;  4XS4 B;  2K8S A;  3ED3 A;  1EEM A;  3DD3 A;  1O8X A;  2H6X A;  4ECI A;  2PVQ A;  2F8F A;  4TOP A;  3O3T A;  3QCP A;  3HD5 A;  3CRT A;  4CHS A;  5ECQ B;  6GSV A;  3E3E A;  3KIJ A;  2DJK A;  2V41 A;  2VL2 A;  4YKF A;  4HQS A;  5EPF A;  4WEY A;  5CRE A;  4PNG A;  2OE3 A;  2IMI A;  3F4T A;  2JAC A;  3HY2 A;  3KGK A;  2JSY A;  1W4V A;  3GST A;  5G1K A;  1VF3 A;  3F4R A;  5IO0 A;  4EC0 A;  3NOF A;  1K3L A;  2ES7 A;  3WGX A;  5JWQ B;  2E7P A;  3M9J A;  1TU7 A;  4OFN A;  4BL7 B;  2VLU A;  2H6Y A;  2YV7 A;  3BCI A;  5KN1 A;  1M99 A;  4IW9 A;  1TOF A;  3QDN A;  3TKS A;  1SJZ A;  2PBJ A;  3UBK A;  2PMT A;  1ZOF A;  3GL5 A;  3IRA A;  2DKI A;  3ZVJ A;  11GS A;  3DVX A;  5B7C A;  22GS A;  1ILO A;  3TRP A;  3HHV A;  1Y25 A;  2P5R A;  1SYX A;  1WIK A;  4O5U A;  1U6T A;  4MF6 A;  4ID0 A;  1I5G A;  5B8B A;  1K0C A;  2LJK A;  5IMA A;  3SWL A;  4GRF A;  2OE0 A;  1EWX A;  3LXZ A;  1YEP A;  3E9J B;  1TK8 B;  1U3A A;  1XVW A;  2JZR A;  4KA0 A;  1ZCP A;  2FCH A;  1MD4 A;  4K8M A;  2R2J A;  2DKH A;  4EF0 A;  4WR4 A;  3EMX A;  1F9M A;  4GWR A;  3VWU A;  3G9B A;  5DVB A;  4PNF A;  2H6Z A;  2KOK A;  3G7J A;  5CRW A;  2H75 A;  2YZU A;  2VCW A;  3G7Y A;  3H79 A;  2WUL A;  1DSB A;  2FLS A;  3TGZ A;  1JZW A;  5J9C A;  2HT9 A;  4KDU A;  4QL7 A;  3IA1 A;  4ML6 A;  1G7E A;  4HJM A;  4YAV A;  5D9V A;  2ALB A;  4LLR A;  5D96 A;  1XBS A;  1T3B A;  3LYP A;  2X49 A;  4HJ2 A;  1IYH A;  4IN0 A;  3VPT A;  4KW6 A;  1XOB A;  2IFQ B;  3UOM A;  1XVQ A;  4MAB A;  1GNE A;  2BMX A;  4Q5Q A;  3GH9 A;  1A23 A;  3W8J A;  3EWL A;  2AB6 A;  2H66 A;  1BJX A;  1S3D A;  2AAW A;  1T00 A;  3FHK A;  2IN3 A;  2CZ3 A;  2YP6 A;  3LOR A;  1OKT A;  4OCF A;  4FH8 A;  1GSF A;  5ENU A;  1YKC A;  1I9D A;  1T8E B;  3MNG A;  4PUF C;  2WFC A;  1X9W B;  2FWH A;  2HZE B;  4KH7 A;  2VLV A;  1X9S B;  1ZYQ B;  1OE7 A;  2V6K A;  4XTS A;  4G0I A;  3TKP A;  3GH6 A;  6GSY A;  2LTK A;  3US3 A;  4PQ1 A;  4N0Z A;  4FYC A;  1F3A A;  1FB0 A;  4XRA A;  2PUK C;  3A2W A;  4XS6 A;  1TTZ A;  5COH A;  5CRD A;  4NAX A;  2VIM A;  3VWV A;  4DSS B;  4G19 A;  4ZB6 A;  3ZRD A;  5HR2 A;  2HI7 A;  5C04 A;  3LFL A;  1JLV A;  3ZYW A;  3JCM L;  1GSD A;  2X8H A;  3C8E A;  5IPG A;  5ELG A;  1BG5 A;  1ZL9 A;  1B9Y C;  2R37 A;  4JU5 A;  4F9Z A;  1G0T A;  2H73 A;  4WET A;  4PQI A;  3IC8 A;  1V98 A;  3TJJ A;  5CYY A;  1BYE A;  3VWX A;  1M2B A;  5E59 A;  4MP4 A;  3ZTL A;  5IO2 A;  2O89 A;  1OC9 B;  2GQK A;  5HQP A;  2CZ2 A;  4I2U A;  1EV9 A;  3APQ A;  4AGS A;  1M0U A;  5DAL B;  5A4V A;  5EL8 A;  5GSS A;  2MBT A;  4KSO A;  3QOU A;  3CTG A;  1X9M B;  5DJM A;  2IJY A;  3CQF A;  2DC5 A;  4K2D A;  3P2A A;  4HUA A;  4LMV A;  4WKW A;  2O85 A;  3EUR A;  4DSR A;  3KTL A;  1O8W A;  1YKA A;  2HRF A;  5ECN B;  3DVW A;  4MF7 A;  4DSQ A;  2MMO A;  2UZ8 A;  2IWT A;  3L4N A;  5ABR A;  2QA1 A;  2WGR A;  3MSZ A;  4EXJ A;  4PTS A;  4BVY B;  2VL2 C;  2CVK A;  4GTU A;  4LMW A;  2N5B A;  4K6X A;  4K0G A;  2XPD A;  1A8Y A;  5B6M A;  5F07 A;  4P3Y B;  1A8L A;  4IHU A;  4I97 A;  2AJQ B;  1K0N A;  4Z7X A;  5KOW A;  3UAR A;  1PL2 A;  1MEK A;  1RW1 A;  2EIO A;  3H4K A;  4TR3 A;  1M7T A;  4F03 A;  4WR5 A;  3J7Y b;  1X5C A;  1TI1 A;  3LQ7 A;  3HXS A;  1EP8 A;  4N30 A;  2JSZ A;  3TCO A;  4KAE A;  1GUL A;  1Q98 A;  5AN1 A;  4MJA A;  3M9K A;  1UN2 A;  3P7X A;  3BBY A;  3L9S A;  1XPV A;  2V32 A;  4GLT A;  4K7N A;  3ERW A;  5D9T A;  4YQU A;  2R4V A;  4XS4 A;  1HD2 A;  1X5D A;  2DML A;  1W89 A;  3IR4 A;  3IBH A;  3CBU A;  3GRX A;  5IMV A;  3GTU B;  4V2N A;  4IJ3 A;  2RM5 A;  1S3A A;  4YKG A;  2MMZ A;  4OCE A;  4X4J A;  3EIN A;  1SD8 A;  4AF2 A;  3A2X A;  2VLT A;  3KTB A;  1B4Q A;  5IMZ A;  4TR0 A;  3M8N A;  2HXK A;  1PRX A;  1O7U A;  1OC8 A;  2YCD A;  1WPI A;  4MLY A;  2YOI A;  2LNT A;  3LGC A;  1YEX A;  2JU5 A;  4E8H A;  1K0O A;  3QAW A;  3L78 A;  5HFK A;  3GFK A;  1SKR B;  1OVN A;  5BRT A;  1Z5Y E;  2VCZ A;  1FG4 A;  2H19 A;  1O81 A;  3APO A;  4F0C A;  4BL7 A;  1YZX A;  5B8A A;  4KF9 A;  2QSI A;  3TDG A;  1QFN A;  3N5O A;  2RUE A;  3I69 A;  4CY6 A;  3UIW A;  1AQV A;  1GSS A;  3ME7 A;  1K0A A;  2RM6 A;  3K8N A;  1USB A;  2GQM A;  1PFO A;  4KCE A;  3D0Z A;  4BIK A;  2LJR A;  4BVX B;  4QL9 A;  2WRT A;  4K5R A;  4EDY A;  1DE2 A;  1XWC A;  1ST9 A;  4TR4 A;  1JZO A;  5IIZ A;  2L57 A;  2OKA A;  3D22 A;  3VPQ A;  1HNC A;  2P5Q A;  4AJ7 A;  3HA9 A;  2PVO C;  2QA2 A;  4MZW A;  4YAP A;  2IPA A;  2H8L A;  5J9B A;  3ZIJ A;  3NIV A;  2FD3 A;  2C1Y A;  1OYJ A;  2HRA A;  4J2F A;  3QFA C;  2OBI A;  4L5L A;  1Z7P A;  4BA7 A;  3A5W A;  1EEJ A;  3APS A;  3EU3 A;  3KM6 A;  5E4W A;  5IPH A;  4JR6 A;  2H72 A;  5J41 A;  3BOA A;  3Q6O A;  3WGE A;  1O6J A;  12GS A;  5CP1 A;  3BD2 A;  3SBC A;  1LJR A;  2VCT A;  2L4C A;  2VL9 A;  4WBJ A;  3UBL A;  5ID2 B;  4K9Z A;  3GYK A;  4ZL8 A;  1H4O A;  1YF1 A;  2VM1 A;  4ZXG A;  2P0G A;  4F2I A;  3UVH A;  1GL8 A;  2X8C A;  1FB6 A;  3EU4 A;  1QGV A;  1VRS D;  3WD6 A;  2IMK A;  2PWJ A;  4G0L A;  2GS3 A;  3M3M A;  2LUS A;  3F3Q A;  1U3I A;  1M9A A;  2H76 A;  4ICY A;  1PX7 A;  5FT3 A;  4NHZ A;  3ME8 A;  1U88 A;  2KP2 A;  4LL4 B;  2H0H A;  3WGD A;  2J23 A;  3F4S A;  2YNX A;  2C0D A;  2HLS A;  4MMM A;  3KH9 A;  2GSR A;  2CVB A;  3IV4 A;  4JED A;  2VCV A;  3HDC A;  1MDK A;  4GF0 A;  1Z9H A;  1R26 A;  4G0K A;  3NZN A;  1SL2 B;  1WOU A;  1F6M C;  1VF2 A;  1LU4 A;  4DSS A;  4ECJ A;  3DKS A;  4N11 A;  5IMF A;  2YWM A;  4OO5 A;  1FOV A;  3C1R A;  3FR6 A;  3HJO A;  2CAQ A;  1A24 A;  1J0F A;  5IOW A;  3TKR A;  3UJ1 A;  4KE3 A;  1GSE A;  2F8A A;  1TRV A;  3KMN A;  1NSW A;  1M9B A;  1PQN A;  3FYG A;  4MA9 A;  3N9J A;  3HVX A;  4JZQ A;  4RQX A;  1M2D A;  4MDC A;  2E0Q A;  1RQM A;  4LL1 B;  3F6D A;  3HCZ A;  2GQL A;  4CY8 A;  4X1U A;  5DAL A;  4KDY A;  2WZ9 A;  2X8G A;  2YWO A;  4KGI A;  4I6X A;  4O32 A;  1XCC A;  4RI7 A;  1LBK A;  1XWB A;  3A5I A;  4JBB A;  3BJ5 A;  3HVV A;  4BWQ A;  2DLX A;  1ZYP A;  2A4H A;  2MBS A;  4X43 A;  3D21 A;  1BAY A;  5D93 A;  1Q4J A;  1AXD A;  4GSS A;  4IKH A;  3I43 A;  2LQO A;  1JZR A;  1NHO A;  4EDZ A;  3FW2 A;  3LW9 A;  4RI6 A;  5HR3 A;  4TRX A;  1PL1 A;  2I3Y A;  3D4T A;  2H0G A;  1AW9 A;  3MDK A;  4TKY A;  4EE0 A;  3UAP A;  1SK0 A;  1N2A A;  4USS A;  4ZB8 A;  4NV2 A;  2YJ7 A;  5A5K A;  4TR1 B;  3CSJ A;  2CA8 A;  4HU9 A;  1JLW A;  5DQY A;  1F2E A;  4XS1 A;  1O73 A;  1JHB A;  4GQF A;  5GST A;  1T4Y A;  17GS A;  4KB3 A;  5DJL A;  2J9H A;  1FAA A;  4TW5 A;  2DJ1 A;  2F51 A;  5BMU A;  3H8Q A;  2DJ0 A;  2B1L A;  4ZBA A;  3Q18 A;  1K3Y A;  3RPP A;  3ZMK A;  1WWJ A;  4ZL9 A;  1NM3 A;  2C3T A;  2WDU A;  3LJR A;  4PGT A;  1TW9 A;  1ML6 A;  4BPY A;  3GTU A;  2OA7 A;  3VI5 A;  2VD0 A;  4PX1 A;  4MJC A;  4ZBB A;  3HJP A;  3GV1 A;  4NV5 A;  3BCK A;  4HQZ A;  2YJH A;  3ERG A;  3GA4 A;  3KP9 A;  1FOH A;  2CVD A;  3AY8 A;  3VLN A;  2K6V A;  1XWK A;  4EIQ A;  1TDI A;  5G5F A;  2O7K A;  4K1F A;  3DML A;  2LJA A;  2ZNM A;  4PQH A;  5ECI B;  4KSM A;  2G0F A;  3FZA A;  3ZIV A;  5DCG A;  5INY A;  1TKD B;  1PN0 A;  4F82 A;  1ZYN A;  2A2R A;  2GDR A;  3A3T A;  5KOX A;  4Z2U A;  1EOH A;  4GQC A;  4CW9 A;  4BVX A;  4I5Q A;  5DBQ A;  4HDE A;  1ERW A;  5G1L A;  2FWG A;  1G6Y A;  1K0M A;  1J9B A;  2E2G A;  1YY7 A;  3C1S A;  9GSS A;  1HNA A;  2OBK A;  2H74 A;  4TXO B;  2B5Y A;  4POK A;  2GTU A;  2V1M A;  4ZIJ A;  4OD7 A;  2IL3 A;  3ZLP A;  1HNB A;  5DCH A;  4Z2T A;  1N8J A;  2H1G A;  4K0N A;  3ISO A;  2GST A;  2AYT A;  4FO5 A;  2L6D A;  1T4Z A;  2AUV A;  1SYR A;  2NDO A;  4NPB A;  3LG6 A;  4F0B A;  1DUG A;  4QQ7 A;  2FWF A;  5JWR B;  4L8E A;  1T7P B;  5G5E A;  1O85 A;  1KTE A;  3KP8 A;  2OJL A;  2JL4 A;  3Q74 A;  2R0C A;  1TRU A;  1WJK A;  1Z3E A;  3PGT A;  2TRC P;  3UEM A;  2LS5 A;  4OO4 A;  3IK9 A;  4ULX A;  3I9V 2;  1EOG A;  4DEJ A;  4IS0 A;  3GX0 A;  1XFL A;  1B4P A;  2VO4 A;  1TRS A;  2RUF A;  2EIR A;  5ID2 A;  4A5P A;  4V1A g;  2EIQ A;  3TOU A;  6GSX A;  4V2M A;  5ECP B;  5ECK B;  1T1V A;  4FQU A;  1SL1 B;  3TKQ A;  3KD0 A;  3IPZ A;  4IP1 A;  2YAN A;  3P90 A;  5CAX A;  1BX9 A;  1ACV A;  1Z6M A;  3Q19 A;  2LRT A;  3GSS A;  1OE8 A;  3FR9 A;  2LRC A;  3ZVJ D;  5LD0 A;  3UVT A;  5G2Z A;  1OAZ A;  1QUW A;  2LKU A;  3TKS C;  4PUA A;  3CRU A;  3M1G A;  2B5X A;  1K0D A;  3LWA A;  2XC2 A;  1TRW A;  3IDV A;  2FY6 A;  1XW6 A;  3F8U A;  2BTO T;  2V2G A;  1GTU A;  4XHM A;  4HEA 2;  2WJU A;  1URM A;  1FVJ A;  5CO3 A;  1B9X C;  3TUE A;  14GS A;  1SK2 A;  1F3B A;  3EPT A;  4NWY A;  1FVK A;  3A2V A;  5FWG A;  4ECB A;  4KX4 A;  2NVL A;  2GT5 A;  6GST A;  2F9S A;  2HSY A;  3WT2 A;  3QD9 A;  2I4A A;  3DYR A;  2CX4 A;  3ZL5 A;  5EY6 A;  4OMV A;  1GLP A;  4WF5 A;  2IMF A;  2WCI A;  1A2L A;  3HZ8 A;  1AAZ A;  2AV4 A;  3L9U A;  2L5L A;  2LRN A;  4PUR A;  4EVM A;  2M80 A;  2GZY A;  3C73 A;  4IQA A;  2HRK A;  1X5E A;  3GL3 A;  1XG8 A;  1SJ6 A;  3TB2 A;  4V2L A;  5GAN D;  1TXX A;  2JAD A;  5LNK e;  3HVN A;  4ZB9 A;  5D9W A;  5IMC A;  3I6A A;  3GN3 A;  5D8I A;  7GSS A;  2I9H A;  2VM2 A;  2DBC A;  3IOS A;  3GMF A;  4L5O A;  5JCG A;  4D73 B;  1EGO A;  2A4V A;  2G2Q A;  4WF4 A;  4X0X A;  1E2Y A;  2K18 A;  2ON5 A;  1NW2 A;  4G10 A;  1VF1 A;  3HVS A;  1XZO A;  5DAK B;  3R3E A;  3HZ4 A;  4V1A p;  3GX8 A;  2H30 A;  2LV3 A;  2H1D A;  4EIP A;  3PR8 A;  3F63 A;  4IQ1 A;  3LXT A;  5IQY A;  1MD3 A;  2I81 A;  4XCS A;  1GP1 A;  2IIY A;  3M0F A;  3DXB A;  4TR1 A;  1SD9 A;  1Z6N A;  2R6K A;  4N10 A;  3F3R A;  4HS1 A;  1YQ1 A;  1UA5 A;  4JE1 A;  1NHY A;  2LEG A;  5IOX A;  3KCM A;  5KN3 A;  2H71 A;  3GNJ A;  4MJB A;  5CNW A;  5IM9 A;  4IBP A;  1XW9 A;  2H0I A;  5KEJ A;  2FGX A;  3F0I A;  1XW5 A;  2IFQ A;  4EO3 A;  5CRH A;  1G6W A;  1KEB A;  3MWH A;  1WMJ A;  1UVZ A;  4OFT A;  4EKZ A;  4TVE A;  1HYU A;  2L6C A;  4MZC A;  2HSM A;  3D6I A;  4KDX A;  1A0R P;  5DDL A;  3IC4 A;  2KP1 A;  2DSA A;  5AIV A;  3DIE A;  4NXI A;  1GTA A;  5J5N A;  2NBS A;  16GS A;  2FHE A;  2GSQ A;  2GZP A;  3ERF A;  3DRN A;  1M2A A;  1AQW A;  2ON7 A;  1BED A;  3IXR A;  3MAK A;  2HZE A;  3UMA A;  2QGV A;  3IAM 2;  1C72 A;  2R0G A;  2VOC A;  2EC4 A;  3D4M A;  2N5F A;  1GUM A;  1DE1 A;  5G30 A;  3V1W A;  2VCX A;  1EP7 A;  3QAG A;  5HR1 A;  5H5R A;  4GSN A;  3TJF A;  1VGL A;  2YWI A;  1ERT A;  2DJ2 A;  4POB A;  5D73 A;  3TRQ A;  3WT1 A;  4L0W A;  5FHI A;  1GH2 A;  1FHE A;  4XIH A;  2RLI A;  2KUC A;  2OE1 A;  1XWG A;  2C0E A;  2MMN A;  5A4W A;  1OC9 A;  3UL3 A;  4TXO A;  4NHW A;  5DQS A;  2CV4 A;  2FA4 A;  3O6T A;  4K7O A;  2R0P A;  2VL3 A;  3D5J A;  1RK4 A;  3CMI A;  3LSZ A;  4EUY A;  1R7H A;  1WRY A;  3CXG A;  2H1B A;  18GS A;  2A2S A;  5ECH B;  3CTF A;  2H70 A;  2GT6 A;  1YJ6 A;  1KNG A;  3TKS E;  1H75 A;  3FZ4 A;  2M46 A;  3IHG A;  1GTB A;  5HFI A;  5D9X A;  2RII A;  2L5O A;  2I1U A;  4MPG A;  4OFM A;  1XWA A;  1CQH A;  4O5Q A;  2L4Q A;  3FMW A;  2PGT A;  1TJD A;  3E0U A;  4Q5N A;  2LQQ A;  2R5G A;  4ZL7 A;  1QK8 A;  2WB9 A;  4HZ2 A;  4JR4 A;  4YH2 A;  2REM A;  1TI3 A;  4BVY A;  3WYW A;  1J08 A;  3TJG A;  2HFD A;  3LEF A;  4EL1 A;  1GRX A;  2CX3 A;  3GUS A;  1ERV A;  4G2E A;  4MH3 A;  1A0F A;  3ZRE A;  4MCU A;  5G31 A;  1EGR A;  2O8V B;  3OR5 A;  3RPN A;  4ILF A;  4J57 E;  2LNS A;  4ZBD A;  3HYP A;  2B5E A;  4POL A;  2WS2 A;  3PH9 A;  8GSS A;  1PGT A;  4WBR D;  2TIR A;  1SU9 A;  5F0G A;  1GSQ A;  1SKS B;  1ERU A;  2VAF A;  2F3M A;  1WE0 A;  1YDK A;  2FNO A;  2FUG 2;  3F6F A;  5F06 A;  2HNL A;  2A2P A;  2XBQ A;  3R2Q A;  1QQ2 A;  4H86 A;  2K9F A;  4PXO A;  2C80 A;  2L59 A;  2NTO A;  1JFU A;  3RBT A;  1E6B A;  3ZML A;  2MZC A;  3IK7 A;  4TN8 A;  3QAV A;  2C8U A;  2MYG A;  5KN0 A;  5A4U A;  1MDI A;  2C3Q A;  4FYU A;  1SEN A;  2B6M A;  2R3X A;  5C00 A;  3FKF A;  1V58 A;  2D2Z A;  1M3I A;  3RHB A;  1EV4 A;  2M72 A;  3EE2 A;  3W8S A;  2HYX A;  3KJY A;  1F37 A;  1R5A A;  3KMO A;  4FIW A;  2K8V A;  3PIN A;  1VF4 A;  5ELA A;  3RDW A;  1UC7 A;  3CYN A;  4IJI A;  3IHQ A;  3FRC A;  3C7M A;  2ZCT A;  3PPU A;  4YQV A;  5HR0 A;  1AUC A;  2HSH A;  2NPB A;  2DIZ A;  1GTI A;  1ABA A;  4KUN A;  4O92 A;  3DWV A;  3GUR A;  4ISD A;  2GVP A;  3P8W A;  3ZZX A;  1TK0 B;  2O87 A;  2XPE A;  5GZZ B;  1WP0 A;  2YZH A;  5KN2 A;  3F9U A;  5J3R A;  1GSY A;  4MK3 A;  2PU9 C;  3QMX A;  1K0B A;  3HJM A;  5AIS A;  2XHF A;  5HFG A;  2FWE A;  4D73 A;  1QXH A;  3ZFB A;  2YPM A;  3S9F A;  4J56 E;  3H93 A;  1S3R A;  4MH2 A;  4XRD A;  4GXZ A;  3FY7 A;  2DJ3 A;  4K2X A;  4IP6 A;  5AIX A;  4DVC A;  5DAK A;  5LCZ A;  1DBY A;  2TRX A;  4HSC X;  2DJJ A;  2PN8 A;  4E8E A;  2DMM A;  3HKR A;  1V9W A;  4O5R A;  2ZUP A;  3MYD A;  3VWW A;  2CAI A;  2Z9S A;  4BWS A;  2C0F A;  2VUP A;  2IMD A;  3W6G A;  4HOJ A;  1QMV A;  3MIX A;  2CQ9 A;  1SJI A;  1ZMA A;  4KCA A;  3TOT A;  1KBN A;  1PMT A;  3L0H A;  4ZIL A;  3KZQ A;  5IMD A;  5H5S A;  1GSU A;  1PA3 A;  6GSW A;  1AQX A;  1SL0 B;  3RHC A;  4ML1 A;  5ECS A;  3TJB A;  1B48 A;  3FEU A;  19GS A;  3EMP A;  2YN1 A;  2OAC A;  1PSQ A;  4JRR A;  1S3C A;  1TP9 A;  2QKE A;  1ON4 A;  4POM A;  1THX A;  5JCW A;  1OKD A;  4TXV A;  5ECR B;  2YWN A;  2XBI A;  3FR3 A;  5F8B A;  13GS A;  5B6N A;  1B8X A;  1XOA A;  2V6O A;  2H01 A;  4Q5F A;  2LST A;  4KND A;  2PER A;  2E2M A;  2HE3 A;  3DEX A;  5ECM B;  4CDO A;  1GUH A;  1FO5 A;  1AC1 A;  1G7O A;  4FYB A;  1U87 A;  1GUK A;  2QC7 A;  3IE3 A;  2JZS A;  2VCQ A;  1ZYE A;  2FA8 A;  3GKN A;  1PX6 A;  2HRN A;  1EZK A;  3G7I A;  3VUR A;  5JCU A;  3LYK A;  2B7J A;  3GHA A;  4HI7 A;  2X99 A; 
#chains in the Genus database with same CATH homology
 1PKW A;  4G9H A;  1GNW A;  3U5R E;  1PKZ A;  3KH7 A;  3TRX A;  1YF0 A;  3IAS 2;  4Z2R A;  2DIY A;  2MMA A;  4ECC A;  3C71 A;  2JZT A;  1AIU A;  3J7Y k;  3EYT A;  1A2J A;  2B1K A;  3H1N A;  4I8B A;  2YV9 A;  3GKM A;  2C3N A;  3QFB C;  2AHE A;  1V57 A;  20GS A;  1MDJ A;  4MNN A;  4N0V A;  4HU7 A;  4GST A;  2GLR A;  4MJE A;  3CSH A;  4IGJ A;  3KEB A;  4MZB A;  2CT6 A;  1Y6E A;  3VFI A;  2VD1 A;  3O76 A;  4HZ4 A;  4LA1 A;  4AJ6 A;  3EC3 A;  2GZZ A;  1PD2 1;  3DGQ A;  2GSS A;  3EVI A;  5GAP D;  5JWO B;  4ACS A;  2PPT A;  1K3O A;  1Z7R A;  3GIX A;  4NMU A;  5J4U A;  4Q5R A;  4GCI A;  3ZIT A;  5F05 A;  1X0R A;  1A2M A;  3QR6 A;  3KXO A;  2IME A;  3FK8 A;  3GKX A;  1HQO A;  2KHP A;  4RQR A;  6GSS A;  2N5A A;  1XXU A;  3FZ5 A;  3RAZ A;  5EVO A;  3CSI A;  2C4J A;  1JZD A;  4K7I A;  1SK1 A;  3TJK A;  2HZF A;  3U6V A;  4RUV A;  1MTC A;  3ZFL A;  1TU8 A;  5ECO B;  5AGY A;  2P31 A;  2GGT A;  2C0G A;  2X4A A;  1GWC A;  4I2T A;  2B3S A;  1GLQ A;  1R4W A;  1XIY A;  2X64 A;  2B7K A;  1FW1 A;  4WXT A;  4YQM A;  2OAD A;  1OC3 A;  5ECL B;  4O7H A;  4K5S A;  10GS A;  3VI7 A;  2H1A A;  3L9V A;  5CRG A;  3FZ9 A;  4AJ8 A;  1SKW B;  2KLX A;  1V40 A;  4MPF A;  1IYI A;  6GSU A;  1CQG A;  2BJX A;  3QPM A;  1TK5 B;  1V2A A;  4L0U A;  4OWY A;  1PN9 A;  4IVF A;  1R5P A;  4IEL A;  3VK9 A;  1THO A;  1ZGN A;  4MF5 A;  5L71 A;  1ZZY A;  1BQ7 A;  3GKK A;  5H5Q A;  4XS4 B;  2K8S A;  3ED3 A;  1EEM A;  3DD3 A;  1O8X A;  2H6X A;  4ECI A;  2PVQ A;  2F8F A;  4TOP A;  3O3T A;  3QCP A;  3HD5 A;  3CRT A;  4CHS A;  5ECQ B;  6GSV A;  3E3E A;  3KIJ A;  2DJK A;  2V41 A;  2VL2 A;  4YKF A;  4HQS A;  5EPF A;  4WEY A;  5CRE A;  4PNG A;  2OE3 A;  2IMI A;  3F4T A;  2JAC A;  3HY2 A;  3KGK A;  2JSY A;  1W4V A;  3GST A;  5G1K A;  1VF3 A;  3F4R A;  5IO0 A;  4EC0 A;  3NOF A;  1K3L A;  2ES7 A;  3WGX A;  5JWQ B;  2E7P A;  3M9J A;  1TU7 A;  4OFN A;  4BL7 B;  2VLU A;  2H6Y A;  2YV7 A;  3BCI A;  5KN1 A;  1M99 A;  4IW9 A;  1TOF A;  3QDN A;  3TKS A;  1SJZ A;  2PBJ A;  3UBK A;  2PMT A;  1ZOF A;  3GL5 A;  3IRA A;  2DKI A;  3ZVJ A;  11GS A;  3DVX A;  5B7C A;  22GS A;  1ILO A;  3TRP A;  3HHV A;  1Y25 A;  2P5R A;  1SYX A;  1WIK A;  4O5U A;  1U6T A;  4MF6 A;  4ID0 A;  1I5G A;  5B8B A;  1K0C A;  2LJK A;  5IMA A;  3SWL A;  4GRF A;  2OE0 A;  1EWX A;  3LXZ A;  1YEP A;  3E9J B;  1TK8 B;  1U3A A;  1XVW A;  2JZR A;  4KA0 A;  1ZCP A;  2FCH A;  1MD4 A;  4K8M A;  2R2J A;  2DKH A;  4EF0 A;  4WR4 A;  3EMX A;  1F9M A;  4GWR A;  3VWU A;  3G9B A;  5DVB A;  4PNF A;  2H6Z A;  2KOK A;  3G7J A;  5CRW A;  2H75 A;  2YZU A;  2VCW A;  3G7Y A;  3H79 A;  2WUL A;  1DSB A;  2FLS A;  3TGZ A;  1JZW A;  5J9C A;  2HT9 A;  4KDU A;  4QL7 A;  3IA1 A;  4ML6 A;  1G7E A;  4HJM A;  4YAV A;  5D9V A;  2ALB A;  4LLR A;  5D96 A;  1XBS A;  1T3B A;  3LYP A;  2X49 A;  4HJ2 A;  1IYH A;  4IN0 A;  3VPT A;  4KW6 A;  1XOB A;  2IFQ B;  3UOM A;  1XVQ A;  4MAB A;  1GNE A;  2BMX A;  4Q5Q A;  3GH9 A;  1A23 A;  3W8J A;  3EWL A;  2AB6 A;  2H66 A;  1BJX A;  1S3D A;  2AAW A;  1T00 A;  3FHK A;  2IN3 A;  2CZ3 A;  2YP6 A;  3LOR A;  1OKT A;  4OCF A;  4FH8 A;  1GSF A;  5ENU A;  1YKC A;  1I9D A;  1T8E B;  3MNG A;  4PUF C;  2WFC A;  1X9W B;  2FWH A;  2HZE B;  4KH7 A;  2VLV A;  1X9S B;  1ZYQ B;  1OE7 A;  2V6K A;  4XTS A;  4G0I A;  3TKP A;  3GH6 A;  6GSY A;  2LTK A;  3US3 A;  4PQ1 A;  4N0Z A;  4FYC A;  1F3A A;  1FB0 A;  4XRA A;  2PUK C;  3A2W A;  4XS6 A;  1TTZ A;  5COH A;  5CRD A;  4NAX A;  2VIM A;  3VWV A;  4DSS B;  4G19 A;  4ZB6 A;  3ZRD A;  5HR2 A;  2HI7 A;  5C04 A;  3LFL A;  1JLV A;  3ZYW A;  3JCM L;  1GSD A;  2X8H A;  3C8E A;  5IPG A;  5ELG A;  1BG5 A;  1ZL9 A;  1B9Y C;  2R37 A;  4JU5 A;  4F9Z A;  1G0T A;  2H73 A;  4WET A;  4PQI A;  3IC8 A;  1V98 A;  3TJJ A;  5CYY A;  1BYE A;  3VWX A;  1M2B A;  5E59 A;  4MP4 A;  3ZTL A;  5IO2 A;  2O89 A;  1OC9 B;  2GQK A;  5HQP A;  2CZ2 A;  4I2U A;  1EV9 A;  3APQ A;  4AGS A;  1M0U A;  5DAL B;  5A4V A;  5EL8 A;  5GSS A;  2MBT A;  4KSO A;  3QOU A;  3CTG A;  1X9M B;  5DJM A;  2IJY A;  2DC5 A;  4K2D A;  3P2A A;  4HUA A;  4LMV A;  4WKW A;  2O85 A;  3EUR A;  4DSR A;  3KTL A;  1O8W A;  1YKA A;  2HRF A;  5ECN B;  3DVW A;  4MF7 A;  4DSQ A;  2MMO A;  2UZ8 A;  2IWT A;  3L4N A;  5ABR A;  2QA1 A;  2WGR A;  3MSZ A;  4EXJ A;  4PTS A;  4BVY B;  2VL2 C;  2CVK A;  4GTU A;  4LMW A;  2N5B A;  4K6X A;  4K0G A;  2XPD A;  1A8Y A;  5B6M A;  5F07 A;  4P3Y B;  1A8L A;  4IHU A;  4I97 A;  2AJQ B;  1K0N A;  4Z7X A;  5KOW A;  3UAR A;  1PL2 A;  1MEK A;  1RW1 A;  2EIO A;  3H4K A;  4TR3 A;  1M7T A;  4F03 A;  4WR5 A;  3J7Y b;  1X5C A;  1TI1 A;  3LQ7 A;  3HXS A;  1EP8 A;  4N30 A;  2JSZ A;  3TCO A;  4KAE A;  1GUL A;  1Q98 A;  5AN1 A;  4MJA A;  3M9K A;  1UN2 A;  3P7X A;  3BBY A;  3L9S A;  1XPV A;  2V32 A;  4GLT A;  4K7N A;  3ERW A;  5D9T A;  4YQU A;  2R4V A;  4XS4 A;  1HD2 A;  1X5D A;  2DML A;  1W89 A;  3IR4 A;  3IBH A;  3CBU A;  3GRX A;  5IMV A;  3GTU B;  4V2N A;  4IJ3 A;  2RM5 A;  1S3A A;  4YKG A;  2MMZ A;  4OCE A;  4X4J A;  3EIN A;  1SD8 A;  4AF2 A;  3A2X A;  2VLT A;  3KTB A;  1B4Q A;  5IMZ A;  4TR0 A;  3M8N A;  2HXK A;  1PRX A;  1O7U A;  1OC8 A;  2YCD A;  1WPI A;  4MLY A;  2YOI A;  2LNT A;  3LGC A;  1YEX A;  2JU5 A;  4E8H A;  1K0O A;  3QAW A;  3L78 A;  5HFK A;  3GFK A;  1SKR B;  1OVN A;  5BRT A;  1Z5Y E;  2VCZ A;  1FG4 A;  2H19 A;  1O81 A;  3APO A;  4F0C A;  4BL7 A;  1YZX A;  5B8A A;  4KF9 A;  2QSI A;  3TDG A;  1QFN A;  3N5O A;  2RUE A;  3I69 A;  4CY6 A;  3UIW A;  1AQV A;  1GSS A;  3ME7 A;  1K0A A;  2RM6 A;  3K8N A;  1USB A;  2GQM A;  4KCE A;  3D0Z A;  2LJR A;  4BVX B;  4QL9 A;  2WRT A;  4K5R A;  4EDY A;  1DE2 A;  1XWC A;  1ST9 A;  4TR4 A;  1JZO A;  5IIZ A;  2L57 A;  2OKA A;  3D22 A;  3VPQ A;  1HNC A;  2P5Q A;  4AJ7 A;  3HA9 A;  2PVO C;  2QA2 A;  4MZW A;  4YAP A;  2IPA A;  2H8L A;  5J9B A;  3ZIJ A;  3NIV A;  2FD3 A;  2C1Y A;  1OYJ A;  2HRA A;  4J2F A;  3QFA C;  2OBI A;  4L5L A;  1Z7P A;  4BA7 A;  3A5W A;  1EEJ A;  3APS A;  3EU3 A;  3KM6 A;  5E4W A;  5IPH A;  4JR6 A;  2H72 A;  5J41 A;  3BOA A;  3Q6O A;  3WGE A;  1O6J A;  12GS A;  5CP1 A;  3BD2 A;  3SBC A;  1LJR A;  2VCT A;  2L4C A;  2VL9 A;  4WBJ A;  3UBL A;  5ID2 B;  4K9Z A;  3GYK A;  4ZL8 A;  1H4O A;  1YF1 A;  2VM1 A;  4ZXG A;  2P0G A;  4F2I A;  3UVH A;  1GL8 A;  2X8C A;  1FB6 A;  3EU4 A;  1QGV A;  1VRS D;  3WD6 A;  2IMK A;  2PWJ A;  4G0L A;  2GS3 A;  3M3M A;  2LUS A;  3F3Q A;  1U3I A;  1M9A A;  2H76 A;  4ICY A;  1PX7 A;  5FT3 A;  4NHZ A;  3ME8 A;  1U88 A;  2KP2 A;  4LL4 B;  2H0H A;  3WGD A;  2J23 A;  3F4S A;  2YNX A;  2C0D A;  2HLS A;  4MMM A;  3KH9 A;  2GSR A;  2CVB A;  3IV4 A;  4JED A;  2VCV A;  3HDC A;  1MDK A;  4GF0 A;  1Z9H A;  1R26 A;  4G0K A;  3NZN A;  1SL2 B;  1WOU A;  1F6M C;  1VF2 A;  1LU4 A;  4DSS A;  4ECJ A;  3DKS A;  4N11 A;  5IMF A;  2YWM A;  4OO5 A;  1FOV A;  3C1R A;  3FR6 A;  3HJO A;  2CAQ A;  1A24 A;  1J0F A;  5IOW A;  3TKR A;  3UJ1 A;  4KE3 A;  1GSE A;  2F8A A;  1TRV A;  3KMN A;  1NSW A;  1M9B A;  1PQN A;  3FYG A;  4MA9 A;  3N9J A;  3HVX A;  4JZQ A;  4RQX A;  1M2D A;  4MDC A;  2E0Q A;  1RQM A;  4LL1 B;  3F6D A;  3HCZ A;  2GQL A;  4CY8 A;  4X1U A;  5DAL A;  4KDY A;  2WZ9 A;  2X8G A;  2YWO A;  4KGI A;  4I6X A;  4O32 A;  1XCC A;  4RI7 A;  1LBK A;  1XWB A;  3A5I A;  4JBB A;  3BJ5 A;  3HVV A;  4BWQ A;  2DLX A;  1ZYP A;  2A4H A;  2MBS A;  4X43 A;  3D21 A;  1BAY A;  5D93 A;  1Q4J A;  1AXD A;  4GSS A;  4IKH A;  3I43 A;  2LQO A;  1JZR A;  1NHO A;  4EDZ A;  3FW2 A;  3LW9 A;  4RI6 A;  5HR3 A;  4TRX A;  1PL1 A;  2I3Y A;  3D4T A;  2H0G A;  1AW9 A;  3MDK A;  4TKY A;  4EE0 A;  3UAP A;  1SK0 A;  1N2A A;  4USS A;  4ZB8 A;  4NV2 A;  2YJ7 A;  5A5K A;  4TR1 B;  3CSJ A;  2CA8 A;  4HU9 A;  1JLW A;  5DQY A;  1F2E A;  4XS1 A;  1O73 A;  1JHB A;  4GQF A;  5GST A;  1T4Y A;  17GS A;  4KB3 A;  5DJL A;  2J9H A;  1FAA A;  4TW5 A;  2DJ1 A;  2F51 A;  5BMU A;  3H8Q A;  2DJ0 A;  2B1L A;  4ZBA A;  3Q18 A;  1K3Y A;  3RPP A;  3ZMK A;  1WWJ A;  4ZL9 A;  1NM3 A;  2C3T A;  2WDU A;  3LJR A;  4PGT A;  1TW9 A;  1ML6 A;  4BPY A;  3GTU A;  2OA7 A;  3VI5 A;  2VD0 A;  4PX1 A;  4MJC A;  4ZBB A;  3HJP A;  3GV1 A;  4NV5 A;  3BCK A;  4HQZ A;  2YJH A;  3ERG A;  3GA4 A;  3KP9 A;  1FOH A;  2CVD A;  3AY8 A;  3VLN A;  2K6V A;  1XWK A;  4EIQ A;  1TDI A;  5G5F A;  2O7K A;  4K1F A;  3DML A;  2LJA A;  2ZNM A;  4PQH A;  5ECI B;  4KSM A;  2G0F A;  3FZA A;  3ZIV A;  5DCG A;  5INY A;  1TKD B;  1PN0 A;  4F82 A;  1ZYN A;  2A2R A;  2GDR A;  3A3T A;  5KOX A;  4Z2U A;  1EOH A;  4GQC A;  4CW9 A;  4BVX A;  4I5Q A;  5DBQ A;  4HDE A;  1ERW A;  5G1L A;  2FWG A;  1G6Y A;  1K0M A;  1J9B A;  2E2G A;  1YY7 A;  3C1S A;  9GSS A;  1HNA A;  2OBK A;  2H74 A;  4TXO B;  2B5Y A;  4POK A;  2GTU A;  2V1M A;  4ZIJ A;  4OD7 A;  2IL3 A;  3ZLP A;  1HNB A;  5DCH A;  4Z2T A;  1N8J A;  2H1G A;  4K0N A;  3ISO A;  2GST A;  2AYT A;  4FO5 A;  2L6D A;  1T4Z A;  2AUV A;  1SYR A;  2NDO A;  4NPB A;  3LG6 A;  4F0B A;  1DUG A;  4QQ7 A;  2FWF A;  5JWR B;  4L8E A;  1T7P B;  5G5E A;  1O85 A;  1KTE A;  3KP8 A;  2OJL A;  2JL4 A;  3Q74 A;  2R0C A;  1TRU A;  1WJK A;  1Z3E A;  3PGT A;  2TRC P;  3UEM A;  2LS5 A;  4OO4 A;  3IK9 A;  4ULX A;  3I9V 2;  1EOG A;  4DEJ A;  4IS0 A;  3GX0 A;  1XFL A;  1B4P A;  2VO4 A;  1TRS A;  2RUF A;  2EIR A;  5ID2 A;  4A5P A;  4V1A g;  2EIQ A;  3TOU A;  6GSX A;  4V2M A;  5ECP B;  5ECK B;  1T1V A;  4FQU A;  1SL1 B;  3TKQ A;  3KD0 A;  3IPZ A;  4IP1 A;  2YAN A;  3P90 A;  5CAX A;  1BX9 A;  1ACV A;  1Z6M A;  3Q19 A;  2LRT A;  3GSS A;  1OE8 A;  3FR9 A;  2LRC A;  3ZVJ D;  5LD0 A;  3UVT A;  5G2Z A;  1OAZ A;  1QUW A;  2LKU A;  3TKS C;  4PUA A;  3CRU A;  3M1G A;  2B5X A;  1K0D A;  3LWA A;  2XC2 A;  1TRW A;  3IDV A;  2FY6 A;  1XW6 A;  3F8U A;  2BTO T;  2V2G A;  1GTU A;  4XHM A;  4HEA 2;  2WJU A;  1URM A;  1FVJ A;  5CO3 A;  1B9X C;  3TUE A;  14GS A;  1SK2 A;  1F3B A;  3EPT A;  4NWY A;  1FVK A;  3A2V A;  5FWG A;  4ECB A;  4KX4 A;  2NVL A;  2GT5 A;  6GST A;  2F9S A;  2HSY A;  3WT2 A;  3QD9 A;  2I4A A;  3DYR A;  2CX4 A;  3ZL5 A;  5EY6 A;  4OMV A;  1GLP A;  4WF5 A;  2IMF A;  2WCI A;  1A2L A;  3HZ8 A;  1AAZ A;  2AV4 A;  3L9U A;  2L5L A;  2LRN A;  4PUR A;  4EVM A;  2M80 A;  2GZY A;  3C73 A;  4IQA A;  2HRK A;  1X5E A;  3GL3 A;  1SJ6 A;  3TB2 A;  4V2L A;  5GAN D;  1TXX A;  2JAD A;  5LNK e;  4ZB9 A;  5D9W A;  5IMC A;  3I6A A;  3GN3 A;  5D8I A;  7GSS A;  2I9H A;  2VM2 A;  2DBC A;  3IOS A;  3GMF A;  4L5O A;  5JCG A;  4D73 B;  1EGO A;  2A4V A;  2G2Q A;  4WF4 A;  4X0X A;  1E2Y A;  2K18 A;  2ON5 A;  1NW2 A;  4G10 A;  1VF1 A;  3HVS A;  1XZO A;  5DAK B;  3R3E A;  3HZ4 A;  4V1A p;  3GX8 A;  2H30 A;  2LV3 A;  2H1D A;  4EIP A;  3PR8 A;  3F63 A;  4IQ1 A;  3LXT A;  5IQY A;  1MD3 A;  2I81 A;  4XCS A;  1GP1 A;  2IIY A;  3M0F A;  3DXB A;  4TR1 A;  1SD9 A;  1Z6N A;  2R6K A;  4N10 A;  3F3R A;  4HS1 A;  1YQ1 A;  1UA5 A;  4JE1 A;  1NHY A;  2LEG A;  5IOX A;  3KCM A;  5KN3 A;  2H71 A;  3GNJ A;  4MJB A;  5CNW A;  5IM9 A;  4IBP A;  1XW9 A;  2H0I A;  5KEJ A;  2FGX A;  3F0I A;  1XW5 A;  2IFQ A;  4EO3 A;  5CRH A;  1G6W A;  1KEB A;  3MWH A;  1WMJ A;  1UVZ A;  4OFT A;  4EKZ A;  4TVE A;  1HYU A;  2L6C A;  4MZC A;  2HSM A;  3D6I A;  4KDX A;  1A0R P;  5DDL A;  3IC4 A;  2KP1 A;  2DSA A;  5AIV A;  3DIE A;  4NXI A;  1GTA A;  5J5N A;  2NBS A;  16GS A;  2FHE A;  2GSQ A;  2GZP A;  3ERF A;  3DRN A;  1M2A A;  1AQW A;  2ON7 A;  1BED A;  3IXR A;  3MAK A;  2HZE A;  3UMA A;  2QGV A;  3IAM 2;  1C72 A;  2R0G A;  2VOC A;  2EC4 A;  3D4M A;  2N5F A;  1GUM A;  1DE1 A;  5G30 A;  3V1W A;  2VCX A;  1EP7 A;  3QAG A;  5HR1 A;  5H5R A;  4GSN A;  3TJF A;  1VGL A;  2YWI A;  1ERT A;  2DJ2 A;  4POB A;  5D73 A;  3TRQ A;  3WT1 A;  4L0W A;  5FHI A;  1GH2 A;  1FHE A;  4XIH A;  2RLI A;  2KUC A;  2OE1 A;  1XWG A;  2C0E A;  2MMN A;  5A4W A;  1OC9 A;  3UL3 A;  4TXO A;  4NHW A;  5DQS A;  2CV4 A;  2FA4 A;  3O6T A;  4K7O A;  2R0P A;  2VL3 A;  3D5J A;  1RK4 A;  3CMI A;  3LSZ A;  4EUY A;  1R7H A;  1WRY A;  3CXG A;  2H1B A;  18GS A;  2A2S A;  5ECH B;  3CTF A;  2H70 A;  2GT6 A;  1YJ6 A;  1KNG A;  3TKS E;  1H75 A;  3FZ4 A;  2M46 A;  3IHG A;  1GTB A;  5HFI A;  5D9X A;  2RII A;  2L5O A;  2I1U A;  4MPG A;  4OFM A;  1XWA A;  1CQH A;  4O5Q A;  2L4Q A;  3FMW A;  2PGT A;  1TJD A;  3E0U A;  4Q5N A;  2LQQ A;  2R5G A;  4ZL7 A;  1QK8 A;  2WB9 A;  4HZ2 A;  4JR4 A;  4YH2 A;  2REM A;  1TI3 A;  4BVY A;  3WYW A;  1J08 A;  3TJG A;  2HFD A;  3LEF A;  4EL1 A;  1GRX A;  2CX3 A;  3GUS A;  1ERV A;  4G2E A;  4MH3 A;  1A0F A;  3ZRE A;  4MCU A;  5G31 A;  1EGR A;  2O8V B;  3OR5 A;  3RPN A;  4ILF A;  4J57 E;  2LNS A;  4ZBD A;  3HYP A;  2B5E A;  4POL A;  2WS2 A;  3PH9 A;  8GSS A;  1PGT A;  4WBR D;  2TIR A;  1SU9 A;  5F0G A;  1GSQ A;  1SKS B;  1ERU A;  2VAF A;  2F3M A;  1WE0 A;  1YDK A;  2FNO A;  2FUG 2;  3F6F A;  5F06 A;  2HNL A;  2A2P A;  2XBQ A;  3R2Q A;  1QQ2 A;  4H86 A;  2K9F A;  4PXO A;  2C80 A;  2L59 A;  2NTO A;  1JFU A;  3RBT A;  1E6B A;  3ZML A;  2MZC A;  3IK7 A;  4TN8 A;  3QAV A;  2C8U A;  2MYG A;  5KN0 A;  5A4U A;  1MDI A;  2C3Q A;  4FYU A;  1SEN A;  2B6M A;  2R3X A;  5C00 A;  3FKF A;  1V58 A;  2D2Z A;  3RHB A;  1EV4 A;  2M72 A;  3EE2 A;  3W8S A;  2HYX A;  3KJY A;  1F37 A;  1R5A A;  3KMO A;  4FIW A;  2K8V A;  3PIN A;  1VF4 A;  5ELA A;  3RDW A;  1UC7 A;  3CYN A;  4IJI A;  3IHQ A;  3FRC A;  3C7M A;  2ZCT A;  3PPU A;  4YQV A;  5HR0 A;  1AUC A;  2HSH A;  2NPB A;  2DIZ A;  1GTI A;  1ABA A;  4KUN A;  4O92 A;  3DWV A;  3GUR A;  4ISD A;  2GVP A;  3P8W A;  3ZZX A;  1TK0 B;  2O87 A;  2XPE A;  5GZZ B;  1WP0 A;  2YZH A;  5KN2 A;  3F9U A;  5J3R A;  1GSY A;  4MK3 A;  2PU9 C;  3QMX A;  1K0B A;  3HJM A;  5AIS A;  2XHF A;  5HFG A;  2FWE A;  4D73 A;  1QXH A;  3ZFB A;  2YPM A;  3S9F A;  4J56 E;  3H93 A;  4MH2 A;  4XRD A;  4GXZ A;  3FY7 A;  2DJ3 A;  4K2X A;  4IP6 A;  5AIX A;  4DVC A;  5DAK A;  5LCZ A;  1DBY A;  2TRX A;  2DJJ A;  2PN8 A;  4E8E A;  2DMM A;  3HKR A;  1V9W A;  4O5R A;  2ZUP A;  3MYD A;  3VWW A;  2CAI A;  2Z9S A;  4BWS A;  2C0F A;  2VUP A;  2IMD A;  3W6G A;  4HOJ A;  1QMV A;  3MIX A;  2CQ9 A;  1SJI A;  1ZMA A;  4KCA A;  3TOT A;  1KBN A;  1PMT A;  3L0H A;  4ZIL A;  3KZQ A;  5IMD A;  5H5S A;  1GSU A;  1PA3 A;  6GSW A;  1AQX A;  1SL0 B;  3RHC A;  4ML1 A;  5ECS A;  3TJB A;  1B48 A;  3FEU A;  19GS A;  3EMP A;  2YN1 A;  2OAC A;  1PSQ A;  4JRR A;  1S3C A;  1TP9 A;  2QKE A;  1ON4 A;  4POM A;  1THX A;  5JCW A;  1OKD A;  4TXV A;  5ECR B;  2YWN A;  2XBI A;  3FR3 A;  5F8B A;  13GS A;  5B6N A;  1B8X A;  1XOA A;  2V6O A;  2H01 A;  4Q5F A;  2LST A;  4KND A;  2PER A;  2E2M A;  2HE3 A;  3DEX A;  5ECM B;  4CDO A;  1GUH A;  1FO5 A;  1AC1 A;  1G7O A;  4FYB A;  1U87 A;  1GUK A;  2QC7 A;  3IE3 A;  2JZS A;  2VCQ A;  1ZYE A;  2FA8 A;  3GKN A;  1PX6 A;  2HRN A;  1EZK A;  3G7I A;  3VUR A;  5JCU A;  3LYK A;  2B7J A;  3GHA A;  4HI7 A;  2X99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...