4HK0A

Uca fab (unbound) from ch65-ch67 lineage
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
215
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGLYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords UCA heavy chain
total genus 41
structure length 215
sequence length 227
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0A01
2CXGA 2XTJB 2RIKA 3BYTA 3CK0H 3PIQB 5TDNA 2V9RA 4O00A 4XPGH 1JWMA 1JNHB 1BF8A 3WJJA 4XP9H 1ZA6B 1UWXH 1SM3L 1LP9F 3EIFA 3MLRL 4LARH 4UV4H 4WVRA 4KZEH 3ULVD 4LPYA 4KQ4L 1AQKH 3M17B 4HK3J 4TPRH 4YIQB 5FKPA 3MRFA 1IAIH 4BUHA 5HVHC 3Q3GA 3MJ7B 1GAFL 1PSKH 4KI5F 2EE2A 1QPXA 5D6DC 3TA3C 3UTPE 2UV3A 43CAB 5C0GB 3O8XC 1CI5A 4JREC 5C08D 1NFKA 1FVEB 1ADQA 3FO0L 4F7TA 3MV7B 3T0EE 4OGYL 3QDMB 2E6JA 2QEJA 1F97A 2VDRL 1A8JH 3C2AL 3NCCB 1FNSL 2IH1A 3RY5A 4NO5A 4R3SB 1J0JA 2Z35B 2D0HA 1WFOA 3VXMA 1A7PH 4D8PB 1A5FL 3RJQB 4MAYD 4QF1B 4HUUB 2VR5A 5AWNL 2HFTA 5C09E 1OARH 1N0LA 3ARBB 5TDNB 2WWMD 3DO7A 4QT5A 3JTTA 3UTOA 4H20L 4LEXH 1LEGB 1PJ9A 1T83A 2UUDK 3VW3H 2PCPA 1RFDL 1BOYA 3RL1A 5GGVH 4F57H 2NCMA 3UZEA 4NIKB 4R3SA 4L8DA 4WNQB 2QQNL 1VEMA 4XWOD 5CD3B 5E7BA 3FB8A 1TQBC 2EDJA 3NFPB 4OZFH 5KBNC 3CCHB 3VXRB 4YLQT 1UB6B 3LAFA 2FO1A 1MH5A 3BKYH 4KDWA 3QIBD 1UFUA 2KZ1B 5JR1L 4X9FA 4NBZB 2ZWLT 5HGAA 4ZXBD 4IBLT 3BD4A 2E7MA 1JZ7A 1BJ8A 5IW6B 3LMJH 3QP3A 4XNMB 5GGUA 1CQYA 2VWEE 2EE3A 3BWAA 1LNUB 5EIIB 3PV6A 5AAMA 5GRUL 2CDFB 4N5UA 1EFQA 2GCYB 4NP4H 1N3NB 4NQXB 3FQUB 3CVHA 3NOIA 2JELL 2BJML 5ALBL 3B9KB 5JXEC 1GGIH 1Q94B 5ICZB 5E2VL 4JRWA 4CNIB 2ZJSH 3BOVA 2VDOH 1RZKH 1D5IL 4P2OC 5I30L 3G6DL 3RAJH 3DXAE 3ZT5A 4KZDL 4TTGA 1RK0A 3QXAB 4CU7A 4I9WD 4TNVF 1UJ3B 4LCWE 3HAEB 1NAMA 4X6DB 3O6FD 4PBVC 4HKZB 3GSNH 1LK3H 3QIBA 1A1NA 5DUMH 1WFTA 4MAYC 2QQKH 2V6HA 1W8NA 1UZ8B 3C9NA 3JUYA 1PAMA 2EO1A 4Q6IB 4Z7UE 1JYNA 4RMQA 3E1F1 3V5DA 1H3TA 2WUCH 2DQJL 2D7PA 1A6AB 3V0VA 1W0VA 1RUML 3S3SA 3PF2A 1EMTL 4M7JH 4RFEA 3UEZA 5DSCB 2FGWL 5CWSB 5T1DL 4H1LG 1MFCH 3CLEL 1LO5A 4RMVA 4FQIL 3QDGA 4BZ1L 3NFSH 5IMLA 4Y16D 3WXVH 4IMKC 5E2TH 1P7QD 4O58L 1M7IA 1ZVYA 3U0TB 4KMTL 5F97E 4NM4L 1Z6JT 4CW1A 4HJGB 3O2WL 2GSIA 3NZ8B 1WITA 5HHXL 1J1PH 1KNOA 1L7IL 4WI6A 5CP3A 4CRPA 4XB7A 2UVEA 4XX1E 3I84A 4Y4KB 1BZ7B 32C2B 3HZKB 2PNDA 1T0MA 4D3CH 3HHRB 4RNRA 1X5GA 4Y4KC 1CFVL 1H5BA 5E00B 1ZLWK 1E0OB 1F6LL 1T1WB 3ZKXC 4LCWA 5FK9A 1UZ6E 1N6UA 5C07A 2QSQA 2YUWA 1M7IB 3KPOB 1KCSL 2Z92B 5F44A 3BPNB 2BVOA 1NBZA 5B38A 1DUYA 3T4YA 4KK9C 3WS3A 3QI9B 4JAMB 4EI5D 5EC2B 4ODBD 1NBZB 4NQCE 1HI6B 4S1SH 3NCFB 1BQUA 1IAOB 3DRQA 5GGRY 2DJ4A 1MJ7H 5IT2H 4P5TC 3N85L 5ISZD 5CD3A 1WF5A 3LDBC 3H6JA 4KRPB 3U1SH 25C8L 3BN9C 4JQXC 3MV9D 2VXSL 3RTQB 3BUYA 1JTOA 2CKNA 5DJ2B 3IFLH 4ENEC 3FRUA 4Y19D 5GGVL 2QHRH 2Q1EA 1LD9B 3QG7L 4HH9B 5I18H 5HPMA 4OLWH 4NZJA 2DLTA 4Y4FB 2DJUA 5HYJD 3BVNB 4OZHA 3F7PC 4N0UA 2A77L 4WO4B 4N9OB 5F3BA 1NC4D 2OX5A 4YDJB 4KPHH 3ULVC 2IBBA 4MJIA 2F74B 3BEVB 3ZKND 4BQCA 4I0PC 2NY2C 4PP2A 3GSNA 1RIHH 1QYGL 3B3IB 1FFNB 3OKEA 4GG6B 4L3EB 2VZ3A 2DQHH 3QFDB 5SWZB 1GGBH 1NGPL 4F7MA 2BOBB 4W68A 2EXWC 4FQXD 3ARRA 2HKFL 4XB8A 2AK4B 5KSAB 4IEFB 3INUH 1T89A 3P4MB 1JNNH 4JHWL 1C12B 5DLML 3MJ6A 5DUBB 4LBEA 5EN2B 5F89A 1ZVHA 5DRWA 4DVRL 2GKIA 3SDCD 5E2WH 2EDNA 3LKQA 3QXWA 4JFED 1S7TB 2CDEB 3WHXA 1A02N 1DBAL 4P99A 5DJ6A 3CFKA 4NKMA 4UIMB 4XPGL 4PJ8C 3F5WB 2R39A 1EBAA 1QBBA 3HNTH 4P2QD 4DK3A 4I18A 1KPVB 2NNAB 3ROLA 3CX2A 1OP3H 4I8DA 2APXA 2FJHB 3W2DL 5IVXF 4AQOA 2J4WH 4S1DD 2RQ8A 4EN3A 3DNKA 5JDSA 5JPNB 2VLRB 3H42H 4XPFH 1OT1A 5GRYA 3TF7C 4P23C 3HLAA 5HHQA 1P7QA 3UTTA 3KPLB 3NIDF 1F6AB 2FIKB 1WFNA 4JKLA 4TRPH 1DLFL 4ELKA 2JCCF 3DSFH 3K3QA 1AR1C 4CVXA 4H88L 4MAUH 1AD9A 5FFLA 5T5FH 1OGAE 3AY4C 4TVPL 5IVZB 5C09B 1WZ1H 3PP3K 4I0PD 2E9WA 1R0AL 5JHLH 5DMIL 2PW1A 3ARGA 1NC2A 2WWKO 5CP3H 3QDJE 5HPOA 2JB5L 4ZNCD 3MV8A 1UZ6F 1Z2KA 4ELME 4DW2L 4FRWA 1FGVH 2BHZA 4NQEE 1FG2B 1VSCA 4G43B 2EYRB 4WCYL 4KRMB 5JORA 4L4JA 1KENL 2C5DC 1J8HB 3MUHL 2CGRH 5DRXB 1QZ1A 3WUWB 3NCEB 1I7TB 3BDXA 1ZLVK 3IFPB 1MVUB 3WNOA 3OR7A 1D5ZA 1Y0LA 3DRQB 3L95B 3GJFH 1F3JA 2WSKA 3KWWB 3PHOB 1XMWA 2B1AH 1F90H 2R9HD 4EDWL 2ADFL 4PREA 1DSFL 2XICA 3O2DL 2E5EA 5FAAA 1EEUA 1I1YB 4K7FA 2VISA 1XAUA 5IVNA 2X44D 2NX5D 3EKCA 1I8IB 1UYWL 3FQRB 4XHQA 2XTLA 4O58H 2XWTA 2ZUQB 3ARDA 3BMVA 5TE7L 1MNUL 4GMSH 5GHWL 1H9VA 5F9OH 5EU6D 5JIPA 1Y6MR 2AK4D 5GGVY 4DEPB 2WBKA 4OZ4B 3OJMB 3ARBD 2R1XA 3PV6B 3MLYL 4EJ1C 5D72H 3LEVH 3U46B 1U8HA 1NEZA 4FQCH 3GIZH 5A2KH 2DBLH 1OQXA 3TFKC 1EEZA 3CSYA 2JB5H 5I71B 2Z31A 1S3KL 3E2HC 1G7HB 5C0CE 3P73A 3WO3B 5T1LA 1YJDC 4QHUA 4FQCL 4V1DE 1CL7L 2EDBA 5CGMA 1MEXL 4RZCA 5DUML 2NTSP 4NQSA 4K9EC 5EBMB 5EUOF 4F7CA 4M4RA 1TCRA 3NABH 1RZ8B 1BFVL 1KPRA 1O7VA 1INEH 2C1PA 4FXGB 3IJHB 1QSEE 5IK3A 3VH8G 3C2SA 5GRVL 2MKLC 1JZ8A 4JPKH 1KT2A 3TM6A 5TQ2L 3TT3H 1FVDB 2F53D 4JN2B 4OD1L 1Q0XH 3UJJH 3KNBA 1I1AD 1BWWA 1NCWH 2EXYC 2V17H 1X4XA 4KK6C 2Q76A 4X98A 1QLRB 5D9SA 5J3HD 2XYCA 4M7LL 3PDGA 1J12A 1VGEH 4IRSD 4L4VA 3QULA 3VXTB 3UJIH 3UYOD 5L6YH 1JUFA 4OQ1A 4B0MM 3K1KC 1NMAH 1HEZA 3TP4A 1NBVL 4U49A 1VFBA 3V8OA 3MO1A 4NT6A 4RDQG 4BSVB 1IT9H 4Q74A 3T65A 2DM2A 5JA8B 1E4WH 3BP7B 3UPRB 5I1JH 3THML 3EDEA 5F7MC 1QR4A 1QSFB 1CXEA 2VAAB 1UXSB 5JO5B 2G9HA 3PQYD 5DF0A 3U0WL 3UPRA 1I1AA 5I8EB 1JWMB 3S35X 2C1PB 4FXGA 5LBSH 3FN3A 3ZSTA 2DQHL 5C0RH 3CFCH 4JPWH 1S7WA 5GIRB 3UROR 3WJLC 3MXVL 3QUZA 4XHJC 5TQ0H 4OAWA 4WFHE 1F00I 4KDTA 1A5FH 2M26A 1OSPL 3QNXA 4KTDH 3GDBA 3KYMB 4NJ9L 5C2BH 5DJCB 5E95B 5TF1L 5C92A 3LHPH 1UQSA 1T1YA 4CGTA 1BGXH 3VRIB 1K9TA 8FABB 4KRPC 2ED9A 4I1NB 2ADJB 1T21B 1NKOA 2BK8A 2JB6B 2YS4A 4Z0XA 3MRJA 2UWEE 3U1SL 1I7UB 1VFOA 5GS1C 1CT8B 2VABB 1IT9L 3UX9B 2Q8BL 3R0NA 4V1DB 2D7MA 1QG3A 4U1HB 2X89D 3HKFA 5TGBB 1JHKL 2AEWA 3D39E 2IF7A 4Y5VA 1PX4A 4Z7WB 1FSKC 2HFFB 3BAEH 5ITBL 4HDIA 1F11A 1LEKB 5TJWK 2FO4A 3H2WA 1G7QB 1H3GA 5EU3B 3QZWB 2ZZUT 1Z9LA 4WI5A 5E5MA 3QEGL 3SHSA 4Q9BA 1LDPH 3RI5F 3ZKXB 5HHQB 2H3NB 4HC1L 5JOPE 1MH5B 1A6PA 2NMSA 1UQSB 3PP3H 4L5FH 4NOFA 4KKNA 4HV8B 1D6VL 4WDIB 4GBXB 4YHLH 5ICXA 4NZRL 4Z95H 2VXQH 2NTFB 3MV8B 4OLUH 4QOKE 3V5DB 5AG9A 1MRDL 3NFSL 3U6RA 5HYJE 1KJMA 4JPWL 4UUJA 4W6YB 1JPGB 3N50A 1WGOA 5J3HC 4MXVF 3NCBB 2WLYA 1XCQA 5D2LB 5K59E 1PEZA 5DTFB 2V5MA 5IB3B 4OTXH 3TH3T 6CGTA 1S9YB 3D2UD 2IJ0C 4FTVE 1OGTB 3I02B 2NX5A 5HYSB 2IMMA 5C0JB 4KC3B 5L2KD 5CEZH 3QNZB 4G8FB 1X5XA 5LQBL 3O6MH 1HEZB 3ZE1F 4GMTL 1JGVL 1LVEA 1WICA 4L9LB 3K8LA 2OK0L 2BERA 4NSKA 3EYFA 5FO8A 5LJYH 5J11B 2R0KH 4RGMB 3QQNA 2D03L 5IHZA 3GSNL 1QO3A 4P4RA 1KEMH 3ALPA 4JO1L 2F15A 3P11L 2M8XA 4MNQB 2XXCB 1XF4A 2DLIA 3KGRA 4Y5YB 3QFJA 4MVBD 3VRJB 4KJQD 3HR6A 4EQ3A 4HMDA 2VDML 1JPGA 1IZJA 2JKXA 3AAZB 2AJUL 4PS4L 4JO2L 5DS8A 3UYPA 3KS0H 1RQ5A 1NUNB 1KXVC 1XCTA 1J8HA 4CVWA 4O5LL 4JZNA 2IAMB 1ZTXH 1D5BA 1WBZB 3W39B 4PRHE 1X5AA 3DI3B 4UNVA 4P9HL 5DYOA 1SJEB 1SEQL 4MJ2A 4HWZA 3VWKB 2AK4A 4EQ2A 1HYSD 1SYSA 1BZ9A 5I2IA 2ZSVA 4P46B 5J4MA 5T5FL 3P2TA 2ICWA 1VA9A 4PJEB 4WTZG 2G5BB 5C0EB 1FC2D 1DLFH 4QRRD 4S0SD 5F7KC 1QQDB 3VFMB 3LKSB 1J0KA 3N1FC 3AC0A 4APQA 4LLVB 3ARFC 3L3JB 4JQIL 4WU7A 3CJJA 1L9NA 2ORBH 43C9A 3W9EB 4POYA 4P2QA 2YD3A 4Q0XH 2APFA 5EPMA 4NNXA 1G7MB 1P4LB 4Y19A 4X8JB 1HZHH 3TN0C 3TBYB 2FJHA 3MACL 4HD9A 3E0GA 4GKZB 2V7NB 3P77A 1FNSH 1F90L 4GAGL 1DBAH 1JF6A 1PY4A 3OAUL 5ITFA 4GMTH 4LAJH 1U36A 5B39B 1K8IB 4IRJC 3AMLA 5J06A 3TEUA 5LQBH 3FO0H 3ULSB 5GISL 2EDYA 4YXKH 3O4LA 2X4SA 1AGDB 5FA4B 3ZTNH 3O6LH 4OV5B 3BD3A 1LE5B 4HXBL 2VZOA 1JGEB 4PJ8A 4LSRL 1VKXB 3MYJB 5C0AB 1YMHB 2EH7L 2XKNB 3Q0HA 5D2NA 2VLKA 5JW4N 3FHQA 4YHZL 1YQVL 1DQJB 1KXTB 2WBJA 4NGHL 3ZYIA 5CZXD 3VGDA 2RGSA 5DGQA 4KROB 3BGFB 3SGJC 4U1SA 4L4TD 1YJDH 1OAUH 1KLUB 1WZ1L 2UWEA 3KNBB 1S7QB 4Y5XC 2YPLA 3PNWA 4WFHD 4CDHA 4IIQC 5F93C 3Q5OA 2VXQL 3VWKD 1YN6B 2UZIL 4LPWA 4PGCB 4GAYA 2MTPA 1KB5A 1N4XL 3GSWA 3O8XD 3VRLF 1G6RL 1EO7A 3MRLB 3SY0B 3DECA 4OFYA 1QSFE 5I18L 1IAIM 5ITFB 3T0WA 3HN3A 2P5EB 2VDKL 4LSTL 1FGNL 3E6FB 4P3DB 3O81A 2VDLL 1MCPL 1PY9A 4XGZA 2VXSH 3PUCA 3MA9L 4U6XB 1FL5B 2V7HA 3ARWA 3EFDH 4GUPB 3RZCC 3N1GC 1UWGH 4D0CB 1II4E 2ARJB 2F53E 4JKPH 5FGSA 5JXED 3KXFD 1CS6A 2NW2B 3LB6C 4GKSB 3HE6C 4XGZB 3T8XA 2E7LC 3RVXC 1DLHB 1TETL 2HT4C 4FFVC 4N8CL 4YPJA 2VLJB 3CH1B 2VC2L 3WXWL 1YMMD 2BC4A 3RVVC 3CVHH 5E70A 4D9LH 1N8ZA 3QZWA 4X7FC 5C0BE 3DUUA 1N59B 4J4PC 4LHUG 4LVHB 3S4SA 3ZKSD 4NGHH 3SDXF 2VR4A 3UAJC 5IWLC 1MFDL 2DQGH 3LCYA 5IFHL 4LIQE 3OR7B 2IPTH 4NCC2 4H5SA 3C5JA 4EI6A 2ED7A 4LSRH 5SWSE 4TYUA 3IU3B 4WV1C 1SM3H 4KDVA 2VLJA 3CH1A 3I75A 1UJ3A 4X6DA 5MENA 35C8H 1CLYH 4NUJB 2G60L 3TT3L 2X42A 4Q2ZA 1KPUA 3S5LG 3MRNB 4PLJC 1I85C 2AQ2A 2PTUA 4Y5VC 1NFDB 3V4VL 2E8ZA 4Y2DD 3MLSH 2BNRB 3A67H 3HE7B 3TVMA 2Y1VA 4LF3A 1QNZL 2DAVA 1BF2A 3IU4L 3ZYJA 2ZP0T 4WEBL 1BEYH 4QHMA 2BDNH 1MEXH 3WUWA 3MCKA 1NFDF 2GSGA 1YUHB 1CLCA 2R1XB 4RFNC 4JQIH 2CSPA 5HI3D 3C6SA 1LQSR 1I4FB 4UTBH 3DI2B 3QDGB 3L3HA 4L29B 4QLRA 1OOAA 2QSTA 3PGFH 4NN7C 1P5UA 2I25N 5D7LD 2ATKA 2J6EH 2OM5A 5IVXA 1NBYA 4MVBC 4GRLB 4OCRH 4YK4C 3IXAB 3QBTB 4YDKH 1XF2B 3RIAK 3HA0A 1I8LA 3DO7B 5L88H 3H9SD 4PJCA 1Q9KB 4RIRA 1K6QH 2IC2A 2NR6C 1KIPA 1OGTA 2A74A 1IVLA 4M7LH 5C86A 1AP2A 3LH2H 2H32B 1JZ4A 1X5LA 3EYUL 4PJBF 3KPPA 4JPIB 4WU5B 4NNXB 5DA0B 3OL2A 1ZT1B 4APQD 1KCSH 1V3JA 4HCRA 4M1GL 4YDLC 4R8WH 5FK9B 5C07B 4LLUB 3O11A 1RI8A 5EUOB 5KANI 2WBJD 3W11C 3JZ7A 3VGGA 3WEXA 5J1AB 4UT7H 2AS5M 3EYOA 5I19H 3ELAT 2X2YA 3LD8B 5D6CA 1YC7A 4BK5A 1EJ6A 5ETUA 3MRDB 4CW1B 1PBYA 1K3IA 1T6VN 4G3YL 3SE9H 4XC1L 1TVBB 3CD4A 1YEGL 1MY5A 3WFCH 1JNHA 3K80A 2YBRB 2LV4A 4JFFA 1RV6X 1KSRA 1G7IA 1NAMH 2VITB 5EULV 2NY6D 1MOEA 3K2MC 3RVXD 3L5XL 5TH2B 1KYOK 3H3BC 5KS9E 1WTGT 1NMBL 1URLA 4MXVE 1H15A 5D72L 1FJ1A 4H88H 1QHOA 4MJ6A 3W9EA 1TZHB 1F6FB 1S7SA 3M1BA 1MRDH 4WIQA 5I66A 2ESVD 2R4RL 1RPQA 1FPTH 1ZANL 1RJZA 5E9DB 4I9WE 4LSVL 4KI5E 2G2RA 2YRLA 3FT2B 3MV7D 3QDAA 5LCVH 2X70A 5C08B 1X5ZA 4IRSB 4JGUA 3UTSB 1ZSDB 4UILL 5CJQH 2FH8A 4Y88A 5IV2B 1Q9WA 5T3XE 2X70B 4KV5F 1KLGA 4DN3H 2QV2A 4K3DH 3OXSB 4MA1C 1LHZA 5L2JB 1X4ZA 1W8OA 4I48B 1D9KB 2OSLB 2ADIA 3HG1D 1DE4B 4JRYB 2EH7H 2NY6B 1NGZA 5CEZE 4LGRB 1FJ1B 4B7LA 4LLDA 2D9QB 5MP6L 1I9EA 5C0BA 4XVJL 5HI5D 4EUPH 1QFHA 1XGTA 1HINL 3HFML 4WWKB 4Z78B 4KZEL 3TWCL 2AK1H 2GSGB 2IAND 1BQLH 1I3RB 4PY7B 3EAKA 3MLVH 3VXUE 3VH8B 2X1XR 1ZHNB 4K23L 2DQCH 5D96C 1HQ4A 2F53A 4CKVX 4E42A 1QYGH 1FYTD 3RKPA 3TT1H 1GGUA 3LKPA 4JFXA 4G8GB 3IJYB 1OTSD 5IVXB 4PD4J 1IAKB 4PJ5A 2FBJH 4KRNA 4U2YA 2QQNH 4NZTL 3MRBB 1MAMH 4Z7WA 5I1HH 4FQPA 4Y5VB 4ONFL 4NPYA 4YBHA 1LWRA 5IHUH 2OMNA 3H9SA 3HMWH 3OKLA 4I3SH 4EIZC 1ONQA 5IBUB 4G7VL 5BVPL 3N1QC 1C16B 4PRDB 3CDGB 4JPIA 5L2KE 5C6WH 3VXRD 1FYTE 2P43B 4J8RB 4QF1A 1DVFC 2ZUUA 4FABL 3GJFK 2R2CA 4S11A 2W0LA 4P49A 5I1CH 2JF1A 2VMFA 2IG2L 4PB9L 3C2AH 5BV7B 3BZEA 4OZIF 2DN7A 3MV7E 3U0WH 1M7DA 4PJHA 5DK3A 2J5LB 4PJFB 1HHHA 5I1JL 4JFZH 4QTIL 1YEKH 1FZOB 3SDAA 3SKOA 4WHDA 4CU6A 5JNYB 3MUY1 4YAQA 3L5JA 3W5NA 5MERB 2WW8A 3ZTNL 1HCFX 5EC1B 1R5WB 1SYVA 8CGTA 1RULH 3KLAA 1ORSB 1FCCA 1A1OA 1CFTB 2C3VB 5JW4R 2PO6C 3V6OC 4DN3L 4M5ZL 4GQPH 3V8CA 5I1LB 5ILTL 3ZL4H 1I3GL 1S5IH 3CFDB 3QA3B 2DQEH 4WGWB 3D18B 2O61B 4HLZH 1T2QH 4CL7A 1GXEA 3PXHA 4HK0B 4K3EH 4OV6F 3RNQA 4WFGE 1NCNA 2O61A 2YUZA 3D39B 2ZSWA 1B3JA 4NHUB 5I71C 3BHBA 1JGVH 2DQTH 3E3QE 4OLWL 3A6BL 4IIQA 3B4NA 2ICWI 1SVCP 3QWQB 3QISA 4NQDE 3BW9A 4GOSA 2BZDA 1XT5A 4MD5B 2P8PA 3VFPB 5EA0L 1NCUA 5F72S 3SGJA 1QA9A 2QTEA 1GOHA 3LQAH 1DUYB 1ROWA 2OI9B 3EGSA 3WIHA 3MTRA 2WBJC 3W11D 4PJ8D 3BSZL 4DUWA 3MZGB 4AK1A 4KVNH 2AJZA 1QKZH 3QIUA 1CK0L 5FCSH 1BZQK 1CDJA 1P4IH 1YEIL 2PXYC 3VG9B 5FF6B 4TSAL 4HKBB 4AZ8A 3QNYB 4GRWH 3K2UL 4OLUL 4LLAA 4PRHB 5D5MB 2R1YB 4IRSC 3F7QA 5DD5L 3LEVL 4XXCC 1G7PA 5D2NB 1BVLA 1Q1JH 4NRZA 3WS3B 3ISWA 1N0XL 1GRWA 3BZFB 3RKDD 1S9XA 3EJZC 3Q6FA 4MJIE 2FGZA 1NGXB 4XI5C 4X98B 1JPSL 4NZUL 2FJFA 5E2UH 5HHNA 3T1WA 3D0VA 5FHAL 2YOCA 4P57A 3RGVB 2IGFL 3NPSB 2BJMH 5ALBH 5IW1B 1VPOH 2OTUA 1ZXQA 1HH6B 5D8JH 2L7JA 4K7PL 2QQLH 4KMQA 3WNPA 5MEPA 5GRUH 1L7TL 1KYOJ 3G6JF 5KTEH 5C8JB 2F8VA 4BYHA 2GSIB 1VFAA 3WN5B 2B2XH 3HE6A 5HD8C 1EIBA 3HI5H 4WU7B 5A1AA 4YE4H 1XGYL 1XIWA 2R2HB 4P2QB 3BKYL 3BH8B 3SDDD 2J88L 2GK0A 1NJ9A 3K8KA 3OKMB 5FM5O 1CDUA 2VB5A 4WW2C 4YQXH 1Q72L 3LRHA 5I2IB 2F54B 1AJ7L 4LRIC 2D7TH 2OXGA 1MY7A 2JJSC 2Z31C 4MLIA 2IANE 4HUUA 2VXTL 3MYZA 3WIIL 2F54A 2XWBB 3V7AG 1A14L 1DUZA 1IL1A 1QBMH 3NCYP 4Z7VA 4AM0A 3UTSA 3VXSB 2K7QA 3DX8A 2YD5A 1JWUB 3QQ3A 3UJTH 5DEGA 5CFHA 2BP3A 5EORL 2Y06L 5EZJB 5HSFA 3TNMB 3IDMA 4HQQL 5CJOL 4EXKA 1SEBB 2JK5B 3PWVB 1AY1H 3MRFB 2DLGA 4OGYH 3WIFA 3JV5A 3MODL 3C8KB 5C0AE 2JELH 4JG0H 4YHIA 5FO9A 1MQKH 5C0CD 4OLYH 3P0VL 1AIFA 3JWDC 3H0TB 4JFDB 4OI7A 2EDRA 1MLCB 3EJJX 4OKDA 4UZGA 3ZE2E 6FABL 4TQEH 2I27N 4ZFZA 3RWGA 1E6JL 3OPZH 1JZ3A 4H0GA 1PDKA 2C7UA 2R0ZH 4X5XA 1RU9H 5BRZD 2HFGH 2X4RA 2HJFA 4M00A 1EPFA 1UCTA 2FSEB 2ZG3A 5E56A 5HGDA 1A6TA 3SE3C 3JV0A 3O4OC 1KJ2H 1OHQA 3GMMA 3VXRA 2N7BA 3H3PH 4XNUL 3I2CL 1F4AA 4K8RD 4YDIL 3IDMB 3MODH 2PYED 2AXHA 4O2FA 1EEYB 1CBVL 2FEDD 5EOQL 3CXHK 4HFUL 3WS6A 5BOZG 2E9BA 1QOKA 1UH4A 5CJOH 3MRMB 4GW1A 1RD6A 1FG2A 4G43A 3BI9X 4PJFF 5KVGL 4PIRF 3ARYA 4E41B 3FFCD 5IB1B 2LABA 2VLKD 1MAJA 3GI8H 3SDYH 3EOBA 3QQ9C 4QRSB 2VZVA 5T1MB 1S7UB 4PRBA 1Q9OA 1LK2A 4U1JA 1BFTA 1MCSA 4GRLC 2IH1B 5F89B 2A6IB 3DRTB 4U6HB 3MNZA 4UAOC 3GKWH 1FRGL 1E4WL 2O5ZH 4YBLC 1LO0H 1RJLA 3KPNB 2X4TB 1IEBB 3B2VL 5FO7B 4ZFOL 2R1YA 3O45A 3QUMB 5EBLA 4LSPH 5C9JA 5TPWL 4MA7L 5D1ZB 1IQDA 1YMMB 3O6LL 3VXOA 5GISH 2PETA 3T77B 3TZVA 5JUEH 2V2TA 4W70A 5CEYA 2GJJA 4K07A 3FB7B 3OQ3B 2Z93A 4K7PH 4JM2D 3D87B 1NCWL 4ZFFB 2A9NH 2YD1A 3QXDB 2EDWA 4LSQL 3OKDB 3FOMA 5FXCH 3ULUF 3BW9B 1HH6A 1P2CA 5F6IC 4KUZL 3K81A 3SDXA 1FDLL 5LXGH 1XF3B 5GZNC 3QDJA 1FZMB 1QSED 4PJIB 2X41A 2FB4H 4LAQL 3D2UA 4JZOB 1BX2B 4GO6B 3TBSA 4U33A 3OGCA 2XY2A 4N0CC 1FZMA 4KMTH 4PJIA 3WFDH 1OQOA 1WWAX 1JMZA 1CD1B 4BQ9A 3FZUC 2KPNA 2FB4L 2XRAL 3K46A 4LAQH 3QUMA 5EBLB 3V0AC 3LRSB 4G6MH 3VXUA 1MJ8L 4HWBA 3TPKA 1AFVL 4QXUH 3BZ4B 4TVPE 2B4CH 5GQBA 1GOGA 3BT2H 3CSGA 3EO9L 3L3JA 3WSQL 4FN0A 3MLZH 3PV7A 1Z9MA 3VI4E 4ESKA 1I1CA 4HGMA 4F8TA 1QFWL 5E2JA 3BO8B 5EA0H 2DQJH 2WUCL 3MLPA 3SJVA 1ZS8B 4PJCE 4Y19B 4HUKB 3UC0H 2XQBH 1G7PB 2VZTA 4PTTB 2W9LA 3RA7L 3VXUB 4ETQA 1EHNA 5JZ7D 3SDCC 3QHTC 5TPWH 4NJAL 1I1YA 2R29L 3CPLA 2D7QA 4EN3D 4A6YH 1TCMA 2ICEB 3WS6C 2EDOA 5E6ZA 3MCLH 4HJJH 2WUBL 3OF6A 3EUUA 4JDVB 2B7DT 1D3CA 1WT5A 5D2NE 3S96B 3SGKA 3MC0A 4B7IA 1KELH 1JGEA 4PJ8B 3ZKMD 3VG9C 1Z5LA 3BGFC 3ME0A 1KPRB 1FE8H 3C60A 2Z31D 4R97B 2R1WB 5FYKL 5B38B 5GS1B 4XPBH 4O2EA 2MOVA 3B83A 4ORGB 2WBJB 4PJBA 3LS5H 5CSZB 2H9GA 5D7JB 1JRHL 4G6AC 1X5JA 4U3CA 5AAWA 4G42A 5KVGH 2HN7A 4LCCC 1HH9A 4L4VD 1U8QB 1FFOB 3H7BA 1JYXA 1KB5H 4WHTA 3EDFA 3IXTA 5EO0B 5CP7B 1GGBL 1NGPH 1TVHA 3RZWA 4PJHB 3TCLA 1FO0L 1P9MC 3SY0A 1W0WA 4Y4HA 5J0BA 1FIEA 1J88A 1M1SA 3UPCA 4PJDE 2B4CC 3HLAB 1RJYA 1LP9A 3AM8C 4M43H 2PKDA 4WEMB 4EEEA 5C6TL 1S8DA 1P69B 1XZ0B 3FOLB 4IRJA 1JWUA 1JVKA 3CDFA 3TH4T 5ALCL 4JFDA 4P2CG 4P5KB 5JQ6L 3QXAA 1VGKA 3KPMA 1Q8MA 3RTQC 4O51A 1I1FB 5ADPL 1EVUA 2EDKA 3HNTL 1CGXA 4GAYB 3IS0X 3WIFB 5C0EA 4M61B 2GI7A 2J5LC 3TT1L 4JFPA 4UIKH 4Y0GA 1UZ8A 3O4LB 4OV5A 3AU1B 3ARBA 2HMIC 5TE6L 1DVFA 5DFTA 2VSCA 5DHVB 1UM5H 5GS0H 1JHLH 2CIKB 3LKRB 3LS4H 5I73C 1IKFL 1MCKA 3AU1A 3F7YA 4LASH 3H9SB 2VLRE 4Z5RA 1FFPA 2HFEB 2VXVL 4WW1B 5INDA 5JW4M 3MGTA 4MX7A 1IGTB 3INUL 4J2XA 4JG1L 2AI0L 2HJLB 2K9UA 3SE3A 4Z76A 1BGXL 3EHBD 2F8XC 1B2WH 1K4DB 1JNLH 1KPVA 5B39A 3D3VB 4U1KA 3OHXA 2Q8AH 1F3RB 1JMXA 3DV6B 3HMXL 5EU4B 5HI4C 3BUTA 4ZTPH 5LCVL 2Q7YA 5T1MA 3IFNH 4JE4B 5IG7A 4WTWA 3DV6A 3ZTJH 3E2HB 2IALA 1KJ3L 4GSDH 4GW5B 1SY6H 2FX8H 4WY7H 4ZUSB 1NEUA 4XCCH 2R4RH 4ZFGL 5LWYH 1F3JB 3KWWA 4I18C 5C71A 4KROC 3CFCL 1U3JA 5LAXA 1PYWB 1B9ZA 5DJ0A 4Z7QF 3D48R 2ZCKH 5FV1L 1INQB 4M1DH 5F6HJ 3U82B 2XN9E 1CTNA 3U36B 3QIUC 5BS0A 5E8PB 1VPOL 1UACH 5GGQL 2IGFH 1P9MA 2EDTA 3B9EA 1WEJH 4YFDB 3TVMD 3KPPB 3KHOA 1NDGA 3C8HA 5HI5C 4YC2B 2QQKL 1KJMB 2BRQA 1NJ9B 1NMCC 4MAYB 3T0BA 3RY4A 3SE9L 3GI9H 1I9RL 3VFSB 4Y2DB 1MCHA 3MXWL 2NXYB 2V9QA 2CRZA 1OP3K 4GLRH 3QUXA 3OKYA 1A7BA 5FYKD 4HAFA 2DQDL 5D5ME 4N0CD 4XPHL 1T5XB 1RURH 4DN4H 4LSSH 4PG2A 1DQLL 2X10A 4IHOB 2RFXB 1A9BA 5DO2C 3CU1A 3U0PB 2PO6D 5I1GL 4X4ZA 4UNTA 3VFVA 2F74A 3BEVA 1CWVA 3KJ6L 4QHMB 3L3KA 1RZJL 2Q6WA 3RU8H 3GSUB 3GIVB 2YBRA 4JFFB 4U1MA 1EEQA 4P4RB 4C55A 3HS0B 2X5PA 4R0LC 5DRNA 5J9PB 3LDBB 1GYAA 5JHDD 1S9XB 3BZFA 2LU7A 5ENWB 5DUPH 2ZPKL 4JDZA 1T03H 4K2UL 1VACA 5I76B 3A6BH 2DRUA 4UT9H 1FL3B 1JK8A 5DZLA 3MV9E 5T1DH 1MREH 3HCVA 5MEQB 3S88L 5BS0E 3IFNL 3I85A 5EN2A 1GZQA 4NBYB 3UMTA 4X5LA 3NBNA 2IAMC 4M03A 1CICC 4S2SA 5GRJH 1LEIB 2P5ED 3PHSA 5MI0C 4FQ1L 4RAUB 4DVBB 1Q0YH 2XN9D 4RMUA 3BH9B 5GHWH 2BVEA 3BDYH 4HJGA 5EOTB 5JIKA 5H8DA 4QNPE 3DX7B 2XZCH 2YK1H 5EZIH 4RAVA 3G5XB 1EO8H 3KPRB 4O02L 4PJ9B 1U8HB 2DD8H 4ONGL 4ODWB 3HS0A 4GRLD 4X80L 4YEEA 4KH2A 1JHLL 1JPFA 4W4OA 3KPOA 4C4KT 2VDRH 5HHVH 3JWOC 1OB1A 4RA0C 2P5EA 1U3YA 1T5WA 3BKCH 3RX7A 5DEFA 1FL5A 1TDQA 5GSRA 5IW3A 1JIBA 2VAAA 4MQXD 3DPBA 5EZOH 4DKEL 1RVFH 4F3FA 3PWLA 1WSST 1RZIB 1IAMA 3BDBA 4IMLB 4BFEA 5F9JB 4DVBA 1KCVL 1MCWW 4YBQD 4Z7UF 4ONFH 2FX9L 1A1MA 4TOYH 2J8HA 5EOTA 1PZUB 5IB2A 2OSLA 3QNXB 1J87A 3U4BL 1MUJA 3KYNA 5I1DB 4WWID 4ZSOE 4PGJA 4M4PA 4R4BB 4FZEL 1UKSA 4YPGA 2DS4A 3DSFL 1P53A 5ECJE 1PG7L 4Y4KD 3SO3C 4ODWA 2LAGB 2J6EA 2YEZA 3L6FA 3L3IB 4UINH 4YFEA 5C2UB 3ZT7A 3P9WB 3WFEH 3FZUD 4YHPA 1KFAH 3VXMB 5F71A 1DN0B 1JRHH 1NANI 4MB3A 1U8OA 3C5ZB 5T3ZH 4OUUB 5A2IH 5IFAL 3MRBA 3HUJB 1YJDL 5F1IB 1BFSA 5EOCL 4AMKH 2BY0A 2H2PC 5KG9B 1MFAH 4G9FE 1AGEB 2NYYD 1J8HD 3S5LB 3T2OA 4LQFH 2GCYA 4LLQB 1CE1H 5BVJB 2AJYH 4PJ9C 1GAFH 4GKNA 2VLLB 4RBPH 4U0QB 1F3DH 3KXFA 4N0YL 1A1OB 4IDJH 1YNKL 4PRHD 5SV4A 2XNAA 3K4AA 4B5EA 4L9LA 1U58A 5FYKU 5D7KD 5DRNB 4NWTL 5KSUA 2YK1L 3OHXB 3C6LA 1TFHA 1H8NA 2EDLA 5DT1H 3RA7H 1CVSC 1Z9OA 5DQDH 3ARTA 4X6CF 1OL0A 4MCYB 3ZMRA 2OQJB 2P7TA 2DL2A 2PYEA 3RWFA 4FA8A 5I1IL 4K3HA 2DKMA 1JFQH 4U7SA 4ISVB 3QPQC 4Y5XA 3NFNB 3NA9H 2Q86B 4S1RL 5T1KD 3D3VD 3UTQA 3V7MA 5JORB 1YEFL 5D2LE 4DTGH 2GJ6B 3U4BH 3QDJB 2VXUH 1AO7D 4R4FH 4NQCD 5GGRB 1A0QH 1MI5B 4JO4L 5IOPB 2H6PA 1ACZA 2BNQA 4K8RC 5HGBB 3WFHA 1KCVH 3G5ZB 3NN8B 3OG6B 3WFCL 3SDAD 1S78D 4XP5L 3B5GA 3EYVB 4UU9A 1EFXB 2Q87A 4ELMA 3SBWC 1NCAL 1U8JA 5F1SA 1EAPA 3GSQB 5IVZA 5C09A 2B1HL 5IROC 5KJRL 1GJIA 1J0HA 4MD4B 3UYRH 2CMRL 4GXVL 2ARJQ 3BRDA 3KYOB 2NZ9D 1CFQB 1LK2B 2CIIA 4U1JB 3U7YL 1A3RL 4G9FD 5HVWA 3KJ6H 4LCUA 2OBGA 4DAGH 4XVUD 4PJEA 5I1GH 4LNRB 4XWGL 5JDJA 3ULVL 2ITDB 1ZGLP 5K93A 3QEHA 5CUSL 2W92A 4M1GH 1I9IL 4OM0H 2PN5A 3AXLB 3QHZH 3C6SB 4X9BA 4ONGH 3PGCA 3C6LC 5IIEB 1KGCD 3T0EC 3BRFA 1KIPB 4AIXA 5IJKC 4JO2H 3UTQB 4WHTB 3ALXA 5C0NC 5E94A 1CFQA 2CIIB 4LIQL 2MPAH 5E9DD 2FZ3B 1QFPA 2IQAB 4LKCA 5FKAA 3TYFB 3ZHDA 1I8KB 3DUSA 1K8DA 5T5NF 3V0WL 5ID0A 5I1AA 5CZXC 1HKFA 5EC2A 4NCC1 1P7KB 1SJHA 4MCZA 2J8UB 2BSRA 5FGCE 5BZDB 2DTSA 1ERNA 4AH2A 3EYSL 1HHKA 3RKDC 3X14A 4BFBD 2EIEA 5FYJE 5C08A 1RUKL 4P46C 2PR4H 2H8PA 3WO4C 4N9GB 1U8MB 3FOLA 5BOPA 4AL8L 2ERJC 3CSPA 2EC9U 4H25B 4XVTH 3L3HB 5AG8A 5EUOA 3WXVL 2IQAA 4OFKA 3I9GH 1FZJA 3HNSL 4ERSL 5INCB 2FATL 2HG5A 4UMGA 2P46B 5B8CC 1DTUA 5BMFH 4P9MH 5LGKA 1KTLB 2JCCE 4RISL 3MJ7A 4S1QH 5J12C 4DZBB 4EIGB 4UNUA 1BJ1H 2OR9L 1FNFA 4FQHB 5H2BA 3L1OH 1YZZA 5F3BB 3GUTB 2NZ9C 4PJ7E 4HEME 2B5IB 4DEPC 2YSSB 5DJYB 35C8L 4JO3H 5CIPB 3SJVB 1GPOL 4C54A 2E7CA 2OZ4L 2GW5A 4OCYH 1RZFL 5KSVB 3FN0L 3E6FA 3UBXA 1MHCB 5E6ID 2AXJA 2R8SH 1VFMA 2FLBT 2DQGL 4Q58C 5DMGD 2Z91B 4IOFD 2H3NA 5IB5A 1IC1A 4OLZL 2QKIA 5E7FA 4JN1H 1L0QA 1EDQA 1LGVA 1NUDA 5EU7C 1V3KA 2DQUL 1QLRA 3B5TA 4CMHC 3E8UL 15C8L 3KVQA 3RGHA 4HZAA 2OL3H 4XPTL 4UOJA 5IB4A 4FQXB 3WJLA 5D7JC 3E3QC 2OS7A 3VFNA 1NGQH 1J1XL 3KLDA 1A7NH 1X5IA 4XP1H 2QKIB 2R2EB 2MJWA 4L8CB 2GITA 2X4PA 2YC1A 1MCOH 2SEBB 1L9MA 5BCAA 1T0MB 2FLRT 4WY7L 3NCJL 3EJZD 1UXSA 2FX8L 4BSJA 1DZBA 2HT4D 2ZUYA 5F9JA 1I7RB 4OCLC 2Z8VC 1K3ZA 4LLYB 4ZAKD 2CDFA 1JPST 2BC4B 3SOBL 2V7NA 3P77B 1N6VA 3V5KB 2VH5H 3K0WA 4YNYB 1ND0A 1CFTA 4I5BB 2NY7L 1KCKA 2MQ3A 2WQRA 3EDJA 4NN6B 4BZYA 5JHDE 3VW3L 2Z8SA 3SOBH 2HKHL 5JMOC 4KTDL 3S37X 4NQEB 4POUB 5HYQA 1A7OL 1U3HC 3GHBL 4ODSL 3MBED 1RVFL 4M48L 4S1QL 4XTRC 3RVWC 3SEPA 4R0LA 5D70H 5HYIA 3EDKA 4G8GA 5IMMB 4P2RE 5IGXL 4YHPB 4OIBA 4C83B 4FFZH 3NIFF 5JQHC 2VSDA 1FL6A 3L5WB 4XVSL 4ZUUA 2F5AL 2XA8L 5LBSL 1NCDH 1MF2L 4UTAL 5I6XC 5HDQH 1LEGA 3MV8E 4GW1B 1KC5H 3MRQB 4LDOB 3WD5H 2YPLB 1SJHB 1WV7T 4PG2C 2J12B 1UM4H 1T20A 4M93C 4LNVA 5ACLA 2APBA 3SCMA 3HZMB 5IMOB 3L95A 4BM7A 3T77A 3D3VE 1RK0B 3BHBB 3L7FA 4H25A 1CD9B 2Z35A 2DQUH 3VGAC 1DL7L 3FFCA 4CMHB 3W81A 5KN5B 3NCMA 4LLMA 2FSEA 5LGHH 3CUPB 4XP9L 3R8QA 1VGEL 3K74B 1MWAL 5CJXA 1DBMH 3CK0L 2XZAH 3O41A 4EI5C 1RAMA 1QA9B 2YXMA 4WUKL 4LP5A 4CN6A 5DJ8B 1X9QA 2W0KA 4HZLA 2VQ1A 3QUYC 4LCYB 4AT6A 4HS6B 4RMTA 5D1ZC 4WO4C 5DWUL 5F7DB 4N90D 4P9HH 1NDGB 3KYOA 4HG4K 1C1EL 1TVBA 1AXSB 3HR5B 3BSZH 4JREB 3HRZB 5IB1A 4KTYA 1ZT4A 2VLRD 5L8LB 4PJFE 2ESVB 3QIBC 5H35B 5TDPB 2YMXL 2JJVA 2GTZB 1BOGB 3NTCH 2NY5L 3NN8A 4F58L 5FDYA 5GGTA 2DYPB 1DVFD 1J86A 4PRAA 2EEAA 5F70A 1HSAA 2HT3D 3NVQA 1WC7A 3LN4A 5F7EH 3OTTA 3ZKMC 3DXAB 4EVNB 4K94C 4X7CC 3IJHA 2D3VA 5GGTH 5KW9L 4F7PA 3WKNA 2EXWD 3NH7H 1NEZB 3Q1SL 1JF1B 1A3QA 1D5BB 1DQMH 3MNWB 4KUCD 1G6RA 2BNQB 5ISZB 3G9AB 2VLJD 3VFTB 2PW1B 3MPCA 1NKRA 5C3LD 3WLWC 1U92A 5A3ID 4YXLL 5C0FB 2DF3A 4NWTH 2XIDA 1ZVSA 4NO0D 5SWZD 1E28B 4FOMA 4QTIH 2HTKC 4U6VL 1J9CT 2X4OA 3D1MC 4HS8H 3DUSB 4TUOB 1ZLVH 3RPKA 4NRXB 3OAYH 4OGAC 4HIHA 2VITA 5FKPB 2MNUA 3GSNB 4IRZH 2VZ1A 5C0DA 1IFHL 3G6AA 2XACC 3O8XB 3DO3A 4C58B 4HIEA 1FLRH 4UBDC 1OAKL 4MJ6B 5FA3B 4PJAF 2YUVA 3RVTC 1UKTA 3EJYC 3RZCB 3OKKB 3WUWG 2BOCA 5A16A 1CF8H 3QXUA 4G7VH 5BVPH 4ODSH 3TV3L 3HNVH 4I3SL 4YHML 3WFEL 3HMXH 4WEUD 3U30C 2ICWB 5E8EB 5DWUH 3OAYK 3F5WA 1HHJA 1ZHKB 1ZVSB 5I8CB 1QHPA 2W38A 2VL5B 5F1OB 4FZEH 1RZ7H 3MRIB 4LCCA 2X4OB 4WTZA 1FFOA 4L8DB 2WV3A 2XWJB 4QXTB 3VCLA 3ZDZE 1RZIA 4K7PY 1IGJA 2FX9H 2A6KA 2YR3A 3KAAA 1RU9L 3MLVL 4QTHA 4OF7A 5BJTA 3MV9A 5E8EA 1RJCA 2VABA 3BP6B 1FNEB 2PF6A 2XV6B 5FUOL 4P2RA 1AH1A 1AQDB 5ANMB 1R3KA 2BOCB 1WT5C 1CDHA 3VG0H 3GKWL 5KSBB 3GJEA 1WK0A 4ZO7A 2A0LD 5D1XD 1QSFD 3MMEA 4F15C 4LHUD 1MQKL 4CN1A 5JHDA 2FNBA 5DEZA 5T33H 5K9KB 3RY6A 3X11A 5E6IB 5E5MB 4CDGC 5DD6B 4PGDB 4KK5C 1U8NB 3R1GH 4X80H 4WV1A 5ESQA 3RIFK 4Z76B 3WHXB 2VLRA 2NW2A 3HUJF 3GB7B 5EZIL 3Q3GB 3NPSC 3V6ZA 2APVA 5H94B 4LNRA 2CLRB 2DDQH 4XNYL 5L2KB 4KJPD 2O5XH 4WUUE 5E8DL 3MFGB 5E24E 1CBVH 4K9EL 5CKAA 3KPSB 5E8OA 5DK2B 4C59B 3LZFH 5JNYA 3O3BB 3V7AE 1QLFB 4PJDF 3SQOH 4M3JA 4U1IA 4YQXL 3SQBA 3G5ZA 4OBSA 1CFNA 1A7QH 4QRUA 3UTSE 4IOIB 3O0RL 3DBXA 3VWKC 2QR0B 3S88H 1RZGA 3D39D 4DKAA 1VGKB 2BVPA 1UEYA 1E4XH 4X6CE 1T04A 1AHWA 1G6VK 3QG7H 4G8IA 4YHKH 2V2TB 4JRYE 5TFSH 1M6OB 1JZ5A 1V5JA 4PV8A 4UDUB 5IEHB 2C26A 3BPOC 4JM2F 3REVB 2DQIL 2X09A 2NXZD 2J8UE 3CFBB 3KR3L 4FNLL 4KKCD 5IEHA 3SE8H 4GRMA 3FOMB 1E4XI 1XGQB 1UH2A 2VOTA 3E8UH 3CIQA 4HKJB 1G9MC 2RAMA 4I3RL 3FB5A 1U58B 3MGOB 4NKDA 4XMLL 4Z7NF 1HHIA 4JM2B 2B8OT 3P0YL 3O6FB 1X6NA 1B6DA 1OTUD 3KHQA 5HD8D 5EORH 4LCIL 2D7NA 1R5WA 3MLUH 5J11C 2DMBA 3RFZC 4L29A 4JZJB 3WNMA 3O3BA 2JCCA 4QRPD 1CD1A 1CL7H 3RBGA 4N68A 4WUUD 1RZ8A 3QJFA 5EU5B 4I3GA 3BQUD 4W6XB 5ESAB 3FT4B 2HT2C 3WDIA 2OP4L 4NO2B 2HVJB 4YWGH 1AHWB 3RDTB 1N5AB 3FMGL 1M7DB 3MOBL 2IAMA 4H1LH 5KOMC 2XZQL 1IC4L 5CZVH 3LKOB 2DBLL 1OF2B 4JY5H 4TUJB 1U8MA 2Z31B 3HNVL 3V6FA 3EBAA 1T7WA 7CGTA 3MROB 4XP4L 4KHTH 4JDVA 5D7IE 4PRID 1UA6L 4FQLL 5EUKB 4PJCF 2NY4D 2PYFA 2V2XB 4LLWB 2X89A 4Q9QL 3EOYG 2FATH 4M7ZC 2O93L 3DGGA 4OD3L 5CHNA 3U9PH 1K8DB 4P59L 4X8XA 4OKVA 1PKOA 4XAKD 1BEYL 2VYRE 3TJHC 4K3GA 1YN7A 3MRCA 5EU4A 3SKJH 3P73B 4D9QE 5KS9F 32C2A 1G9NC 1BQSA 2P5EE 5E0QA 4H0IA 3DJ9A 5EPMB 3QCTL 4BUGA 3EFFB 5FCUL 1QEWB 1X3DA 3MLTA 2F53B 3RL2A 4F7EB 3GSXB 2BVQA 3PABA 4K8RH 4PJIE 3CC5B 1KTRL 1U8LB 3GJFB 5K9QG 2OJEB 5IF0A 3KPQB 4NM8L 4WCYH 1WBXA 3EO0A 2YZ1A 1T5WB 2HLAA 1BREA 4PJEF 4DW2H 3NGBC 2AV1A 5I30H 1YEIH 3SGEI 2N7AA 5IM7A 1DQQB 1IC7H 1DBBH 1GGIL 3QNZA 4G8FA 4UOW1 1KIUA 4ZOCA 1KT2B 5AZEH 5EH1A 4ZFZB 3RWGB 1N5YL 2IWGA 1P4BH 1A3RH 5EO9B 4JDZB 4PJ7B 4Y4HC 3VXNB 3VE0A 2ITCB 1N6QL 4HIEB 4LHUA 1ZK9A 9CGTA 5TFSL 3DGCR 3S98A 3C60D 4DGYL 2BVTA 4OZFA 4PG9A 3D85D 5LGJB 1UEMA 1S7VA 4M43L 4QCIA 3P4MA 4XNXL 3K4ZA 4JO4H 2O26U 1RSFA 3DVGA 2EIDA 2UUDH 1TJHL 3RL1B 5AZ2H 1MCIA 1QRND 4OBRA 1KXQE 5ADOH 2NXYC 3ALWA 1G9EA 2X1OA 4ZUTA 4XNXH 5HDBE 3VMPA 1S7TA 1RY7B 4WENB 1CGWA 5E9DA 4CVXB 4L4TE 4NKDB 2NY3C 2DLFL 1K4CA 1KEGH 1MJJA 3MRPB 2LU3A 2CXKA 3ARGC 2YA0A 5HGAB 3RX8A 3SDDB 4Y4HB 4NKOA 2PTTB 4J3OC 3WKML 3S5LA 1AKJA 2VERN 3KYKL 1FNEA 3V79C 3FCTA 4N0YH 1J8HE 1NGZB 3IVKA 3PDDA 4AIOA 3WLBB 3NGBB 2W07A 3HR5A 2GTWB 5DJXA 4HPOH 3T3ME 3T3MF 5DDHA 5D7LA 1S7VB 4QCIB 2Y5TB 4UILH 5CJQL 1BOGA 3KPMB 3HC4H 4PJAE 5IB3A 2OQJA 2P7TB 4HH8A 4WI9A 1CG9B 4RGNE 4GBXC 5FUOH 1S7WB 1S7RA 4TVSa 4NJAH 1KEGL 3O41B 1C7TA 4LK4A 4JO3L 4MWFB 3R06B 2CDEA 3X13B 4G8EA 3RVUC 1CDIA 3QWOA 1MJJB 4ZTOL 2R56L 4HIJA 1EHXA 2A1WH 5KSAA 1G1CA 2H6PB 4OF3A 3VFGH 5BV7L 4JCLA 2YRPA 3QXTA 4JJ5B 4OB5L 4G9DB 1C12A 4P9HC 5HYEA 1E4KC 4P5MA 3MJ8A 3FO9B 1AKJB 1OTSC 4LMQE 4NQEA 1NGWB 3UTZB 3C08L 5D6DA 5D96B 1DCLA 3FFCB 4DGYH 4X7TA 1EXUB 2BVQB 3EYQD 2YPLD 3VXPB 4ENED 4N8VB 3O6KH 2H45A 4GKOA 1ZE3C 2Z92A 3BGMA 3HFMH 4O2CA 1C5DA 3TV3H 1MAKA 1FIGL 5HHOE 3I50H 5DHVA 3LS5L 1RIUH 3GM8A 4NQDB 5A2FA 1ETZA 4I0PA 4LGSB 3TZVC 4M9PA 2ENSA 4QRRE 3QQ4B 1KN4H 2ADGB 1VB9A 3WFHB 3GMRA 3UZVB 1T6WA 1B0RB 4WW1A 4X6CB 3VMNA 5DK2A 3BIKA 4V2CB 2AAVA 3IAGC 3ABZA 4OLZH 3DLQR 5C08E 3O11B 1M7XA 3JBG7 4LLUA 3IETA 4U6VH 3OV6A 4LSVH 5HDOA 5C0IB 4MAYA 4ODVL 4AQ1B 2XQYK 3O6FC 4RAUA 4XMLH 3VGBA 4ZUVA 2DYPA 4JZJA 1RUPL 4U7KA 1JK8B 1HNFA 2WBWB 4HKZA 3OJDB 2FR4B 3QCTH 5DD3L 3CLEH 5F7YC 4JCMA 1V3LA 3L1OL 3L7EA 4GRWF 1UVQB 3DMMA 3FT4A 1TCRB 5GRJL 4RCAA 2XN9B 1G7JB 2P44B 1AXIB 5TDOB 1GGCH 3MO1B 5F7EL 1FO0A 4D9QD 2B4CL 2KL6A 3L3KB 3RY6C 1A4JB 1GC1L 3WE6B 1YMMA 4XTRD 4HJ0D 3IFOA 3T4AB 4YO0B 4YGVA 1VFUA 1QSFA 1HHIB 3MSPA 1XR9B 4WEBH 1KOAA 1J0IA 5IMLB 4I2XE 2HP4A 1U8KB 3MRKA 3SGEH 1IC4H 5CZVL 4MDIB 5JHDB 4OI8A 1OAQH 1L0XA 5D5MA 1NLDH 3IRZA 2ZJSL 4RMRA 2YD7A 1ITBB 1C5CH 4HIXH 3WE6A 4PP1D 4PR5B 3RUGE 1ES0A 1WCBA 3MFFB 4Y1AB 3FONB 2APWA 4YDIH 3DWTA 4BA8A 2QJDA 5CSZA 4BQ6A 5DT1L 4G80B 4YDVB 3TBSB 4G6JL 5M94B 4WFEE 4MA8H 2AEPL 5IV2A 2VIRA 3FAXA 3U79A 1TMCB 2W9EL 3C60B 1AGDA 5FA4A 4RX4D 3B9DA 2P4AB 3QCVL 3BAEL 4WI3A 5GS0L 5DURD 3TNNB 1CE1L 1DQTA 4OD2A 3SBWA 1OGAD 1PFCA 1KTKE 3GIVA 1LDSA 4JVPA 4XWGH 2BMKB 2KDGA 1V7ML 4NYLA 4QRRB 5I17B 2KQMA 1HHJB 5CBAB 3IDGB 1UACL 5GGQH 1NFIB 2JTDA 4NO0B 5DJXB 2Y25A 1TETH 5K9KA 2OMBA 5EFIA 1RHFA 3TBYA 4N5EC 4OLXH 1FHGA 4UAOB 1ZLSH 4IRJB 4OGAD 4QRQB 3LKPB 4MD0A 4WFGD 2XT1B 4LSTH 5D7SL 1YYML 4ZS7L 1XH3A 5I1HL 1YA5A 1QFOA 2BDNL 3ZZ1A 5AWNH 2YKLL 4LLVA 3UJTL 4MLSA 1R3KB 4MCZB 4M48H 1PKQA 1HDMA 3ZE0F 3D0LA 4KQ3H 1KCUL 3CZFB 1XFPA 4Q7DA 5GJSL 2ZOLA 1PD6A 4PRIB 2BVUA 2GITB 2X4PB 2YC1B 1P4LA 2JLLA 4LVNC 4NKOB 3TYGH 4NO5B 4AEEA 4OZGE 3QUZD 4XRCB 3ZT6A 3MLXH 3Q2CA 3Q5TA 1U3HA 3H9SE 3E6HA 2VLKE 2E27L 1NBVH 3NCJH 1T4KB 1T0NA 1OAXH 2ZOLB 2VDNH 4ZDHA 1EHLL 4PV9A 4P3CL 4RGOL 2MSPA 5IFAH 5DFWH 2BRRH 3WIHH 1JGLH 2JE8A 1EVTC 1INDH 3LN5B 3FHAA 3QDMA 3I6KB 5DO2D 4JKPL 4O02H 2FH6A 4A6YL 4JHAL 3EOBB 3F6LA 3O3UN 2EXYD 2EEDA 3KPRE 3AMKA 5HGBA 5J7CC 4LVNB 4KK8D 5ALCH 4Z7NE 5FUZL 2BSTA 4QOKA 3U7AA 5IG7B 2A74B 1F11B 1LEKA 4UB0L 4PRPD 3F58H 2G75B 5CMAB 1UC6A 2W91A 4RGMC 5AZ2L 4XC3H 1D5XA 1IBGH 3IRPX 1ORQB 1DR9A 2X4QA 3C87A 3RWIA 2MHAA 3VFUB 1R24B 4BKLA 4OZIE 1MCBA 1LE9B 4HBQA 2BY1A 2PXYB 2QBWA 5GRWA 5GSVB 4G6ML 2C9AA 5F21B 2D7TL 1NC4B 2HA1A 3STLB 2DMCA 1YQVH 4YHZH 3ARFD 3UBXG 4F15B 4Z5RB 4LU5H 1B0GA 3HUJA 2F8OA 4QOKD 5D7IF 5BZDA 1MWAB 4HF5L 4Z0BL 4MX7B 3FTGB 4KXZH 1WC7B 3PWJB 4MXWH 2NQCA 5D1ZD 2N56A 1OW0C 4OSUH 1U0QA 5FYKH 4GFTB 4LVOC 1I85A 3RP1A 3SCMB 4AL8H 3UPAA 4PB0H 5B4MD 3HRZA 2BNRD 3HE7D 5DRXA 4NO3A 3X17A 3RWHB 3EYSH 4NUJA 3DMMC 1AO7E 2WUBH 5FYLD 5CEYB 2NXZC 4BQBA 3V0WH 2XZCL 4QWWC 2VR9A 3CXDL 1V05A 4MD0B 1NFDA 2J7LA 4FQJH 5DJYA 4YDKL 3U7WH 4OKVB 1WEJL 1QRNA 4LIQH 3REWB 4X7DC 2FYYB 2VUYA 1M4KA 4FXLA 4N0UE 3NZHH 3DSNA 5C0DB 3MCKB 5MI0B 3RWHA 3RDTA 2I07B 1H8OA 3DARA 4TSAH 3RWEA 1MREL 3N0PB 4GAJL 3TO4C 4NNPL 2XA8H 3VGEA 4Q9CA 3ILQD 5SX4I 5F7NC 5GRXG 1LO5B 4UQ2A 3LQAL 5DJAB 4EUPA 4ODHL 3ZTJG 4RWYH 3IETB 1CXKA 3U4AA 5CHNB 5ICYA 1HSBA 2F19H 4UQ2B 3RVUD 4H0HB 5BZWB 3HMWL 3LRGA 2ARWA 4JANA 1OTTD 3VFOB 4AENA 3LIZH 3QH3A 4NQSB 2XKSA 4MZ2A 5CGTA 1EAJA 1VADA 3NCYS 1CZ8H 5ACZA 4F3FB 2AJ3A 1F5WA 4QRTB 1V7NH 4ONHA 1I1AC 5IFHH 5FYLH 1DQJA 5CLWA 1IILE 1NMCB 4GJTB 5AYQA 2ICEA 2AJXH 1FSKB 1WTLA 5DEFB 4G6KL 3S34L 5J1TC 3DYOA 1E27B 2YZ8A 3W82A 4JRXB 4JFDD 3CFIC 4TQEL 1MLCA 4GH7B 1HINH 1J7VR 3QNYA 4HUVA 5KS9A 3QULB 3VXTA 5E6IA 4PLOB 4KVCL 2EYSB 1HK6A 2AXGA 2AJ3B 4DGIL 1HQ4B 3LKSA 2AXFA 4M1DL 1CFSB 1DFBH 1IEAA 2HH0L 1AY1L 2VAJA 1S9VA 2P8MB 3GB7A 1C5BL 5HGGS 3EOAA 3SO3B 4U31A 5AUMA 1HHHB 4F9LA 3ULUD 1NUFA 3ARFA 1YNTB 2ATPA 1TPXB 4FQXA 2P1YA 1A4KA 3SQOL 4M6OL 4Y1AD 2YWYA 5HI3C 3AREC 2HKHH 5AEAA 5CJBA 1JTTA 5TF0A 5J89A 3DVNB 1OCWH 4DGVL 5CJ8A 3QO1A 1Q94A 1QLFA 3S4SB 4P5MB 4WHYG 5I8KH 3T0EA 1ND0B 4X7SH 5GSVA 4JG1H 1IGIH 3EDDA 5D4QA 2E3VA 3VI4F 2EYSA 1FNGA 2DYPD 4LLYA 3B8YA 1F2QA 2NZIA 4HXBH 4J3SA 3EO1B 5D71L 2ZSWB 4QEGA 1YYMH 4YE4L 3PHQA 4J3TA 4R7DA 1U95A 3OAUH 2AK1L 4X9HA 3OPZL 3CCHA 1N3NA 4NQXA 5C1MB 4GW4B 5C9JB 5C6PB 1LO3L 5IROA 3RHWK 3QEHB 2HT2D 4OCMC 4TVPD 2C1OB 2DIBA 3KG5A 5CEZD 3ARUA 5IKCB 1Q0XL 3UJJL 5IJVB 5E08H 1O0VA 4H8WL 5I19L 3TNMA 1TQCC 4LP4A 1U8IB 2E9IA 5HHVL 1A1NB 3V6OE 5C6TH 3V52L 5C0CA 2R8SL 1CGVA 3O2WH 3RWIB 4TNVK 1OSPH 4G7YH 4FMFA 4OCYL 4CN4A 1AKJD 2JJSA 5MEND 1I9IH 4OM0L 4G6FB 4ZO6A 5L0QB 2CLZB 4RBPK 4BZ1H 2BFVH 3QCUH 2DWDA 1FO0H 4H8WC 3IDJA 4WDIA 4HUWA 2BHUA 3SCMC 5K9OA 2Q86A 2EYTB 2DM7A 1D5XB 4Y1AE 4R26H 1U2CA 1CGTA 3M8OH 1KIQA 1OAQL 3VD7A 2MHAB 3VFUA 1K85A 3R4DA 2W0FA 3A0OA 3U6RB 1G7IB 4X7TB 3CDYA 2EKSA 3WFZA 3GK8L 4GT7A 4PJCB 3V95A 4G8GE 5CBEB 5IVOA 3MBEB 3FT3A 1NAKH 3IDYB 2NY1B 1Z0NA 2CUMA 5KAQF 1T1ZA 5L7XL 3P4NB 4KJPC 4P5TA 4PD4K 1XIWD 1HSAB 3MLSL 2A73B 3VI3E 4E41A 5GRVK 5HHNB 3OKNB 1PKQE 1S9WB 1I3GH 1S5IL 3WEXB 3PABB 5FOJA 2P49B 5FGCB 4PREB 5TQ2H 2XA3A 1PG7W 2FX7H 3ULUC 4MJID 5B38G 1CLYL 1DANT 4HWZB 3MBXL 3W0WB 4OFYD 1EFXA 4HWEH 2ZKHL 4PRAB 4ZOBA 1TNNA 3BISA 4KJYA 1DQML 4AM0B 4MXQC 3VFTA 2X4UA 2NY0C 4KROD 1BQHG 4OTXL 5MHSE 1MI5E 3GEWB 1N5AA 2X4NB 4XBEL 4PJBB 3V4UL 4ZQKA 1G6RB 5FM4A 1S3KH 1ZKAA 4D0DA 5ERWB 5KZCD 2IPKB 2VRAA 4PGEB 4ZPTA 3U7YH 2ERJB 3NMEA 3R0MA 1AP2B 4LRNH 4RQQB 5EUKA 2BY2A 4DKFH 2I5YH 4YX2H 1B90A 1TJGL 3GMNB 4WI7A 3ARVA 2KQNA 5JIIA 5HXMA 1F4WH 2WP3T 3O4LD 1W0WB 3MJ9A 4JFFD 4HSQA 1F4YH 1VFAB 2MQCA 3WN5A 3BIAX 1J1OL 1WBYA 4OAWB 3ZLQC 4BFGA 3ILPA 3TLRA 3J8F7 1DBJL 4PJGF 3UBXB 1VFBB 1KLFA 5FYJD 3HPJB 3DVNA 4NN5C 3MA7B 2GT9A 2W65A 3AREB 3ARPA 1GSMA 2V5RA 5SWZA 1IGYA 5DVMA 4PUBL 2DOCA 3JUZA 1XF5A 2HJKA 1QLEL 2FJFB 2NW3A 4HWBH 4HFWA 2ZG1A 1AGBA 3G6JA 3OF6D 3I75B 5MENB 4PJ7F 2IAMD 3BP5A 2GFBA 5IW1A 4KTEH 1UJ3C 2HTLD 3JV6B 4JFEE 2IADA 1X5KA 2VZUA 4NWUL 4PPTA 1ADQH 3S6CA 4FFWD 4U1NA 3ARQA 3QI9A 4JAMA 5JOFB 5GGSB 4TPRL 4C56E 5F9AC 1DEDA 3TCXA 4WI4A 2AGJH 3MV8D 4YNYA 5FM5M 3EOTH 5KVEL 4LKXB 5IBLD 2R9HC 2F58L 3HZVB 4XNZC 2D0FA 5DZOA 1T04B 2Q3ZA 2RHEA 4HXAH 4ZSOB 1LO2H 1WAAE 3ILPB 1LILA 4LPUA 5DRZB 5GJSH 4JGMA 4I13B 5I16A 1I1AB 5I8EA 3QHFL 3C8DA 4U1IB 1TNMA 1A2YA 1FN4A 4QRTA 3TN0B 1A9EA 4B50A 1OWWA 5D70L 4XXDA 1F42A 5DD1L 3MA9H 4RRPG 3FQUA 1HXYB 2ZG2A 5JOPD 5IB5B 3IXAA 4C57C 5JQ6H 2D7OA 1ZLUK 5DI8B 3BP5B 3FO1B 3ET9F 4JR9H 4UINL 4N5ED 4UT6H 5CMAA 2AQ3A 4HFUH 5J6GA 2VJXA 1CIUA 2HFFA 3LQZB 2R2BA 3VGAB 4LQ1A 3FO9A 1GGTA 1DEEA 4QRSA 4NHUA 3JWDL 2I5YL 1GVIA 2VL4A 3DV4B 2BXYA 1CU4H 3GSVA 4K94L 4LLDB 1T3FA 4WGVB 2VISB 3SE4C 3OKOB 5HDBF 5HVFB 4U4BA 4FQQA 2HFGL 3WO4B 2P8LA 1DN0A 3U36A 1NMAL 3T0XA 5BS0B 2VE6B 1NL0L 5H37H 5JW3H 3RWDB 5CGYC 1UB6A 3ARDC 1KB5L 1JNJA 4ZG1A 1KULA 1A21A 3OKLB 4O5LH 4R7NA 2VE6A 3TWCH 2F5BL 3IAPA 3PQYA 5IESL 4XCNB 3HC3H 4L1DA 2AJUH 4PS4H 4X6CA 3PL6D 3U46A 5GZOD 1DDHB 4MA3B 2AEIT 3RGVC 3QZWG 4BQ8A 4KGJA 1JYWA 1UCBH 4PRIE 1IGML 3M45A 3WYRA 5IOPA 5CJXC 2EYRA 3CXHJ 2KZWA 4YZFF 2FIRT 1IC7L 3FQNB 4EI6B 3CVHB 4LSSL 3BN9D 5T1LB 1INEL 2B39A 1ZHBA 1C5DB 3ROOA 1DQDH 1Y0LB 1XF1A 4NQED 4OZGA 4JRXD 2PYEB 3LH2L 4HGKC 4Q0XL 3F6IA 5DR5L 1KG0B 1JF5A 2X4UB 4L9LC 4R6UA 3F65A 4GXUM 2Q6WB 4MGXA 2I26N 2IBGA 4QKXB 2X1PA 4HIHB 4X5WA 3TH2T 2VXTH 3A6OA 1N64L 1MFBH 1HYRC 4FXKA 4U0RB 4FQ2L 2CLZA 4HUMB 4JEGB 3UXFA 1F3DJ 5IHZB 1I3UA 4S10A 1QFWH 3N85H 5FYJL 4X9GA 1W72B 5KANG 2J88H 4FQ2H 1ZEAH 1CCZA 2Y07H 4TNWK 5IQ9A 1U8PB 3QG6A 3K7UA 4FFWC 4XNQB 4ERSH 3S36L 4P5TB 1RUPH 3SKNB 1AGCA 1BBJA 2EKSB 2PYFB 1TJIL 2V2XA 4NC1C 4Q6IA 3QI9C 4ZFOA 5E4EC 3I6LD 4DZ8B 2WWMC 4TUOA 5EO9A 1XR8B 5DQJA 1AGFB 1JCKA 3DURA 4ZTPL 4JY4A 1I1RA 3VWJD 1MCEA 2DQEL 3BPNC 5FHAH 3QPQD 3ZL4L 3PGCB 5IIEA 5IM7B 3FMGH 4POZC 1P5VA 2A73A 4WU5A 2A0LC 5D1XC 2K7PA 2CUIA 5TH2A 1IGMH 5A16B 3ETBF 1VERA 5C8JA 3JWNC 2UVFA 2ESVA 5F7HA 2E7HA 1MCLA 4NM4H 4LKCB 5FKAB 3TYFA 2AJVL 2XTJE 4ZXBC 1MCNA 1T7ZA 1MFDH 2YN5A 3O8XA 5B21A 3O6KL 5DI8A 3FRPG 3QHZL 4L8SC 1TJIH 2LAAA 3I02A 5J6HA 2GK0B 1GZPB 4RWHA 3OMZA 3EFFA 1A7RL 1K4CB 1NGXA 3BVNA 4OZHB 3ULVH 5TE6H 1JHKH 1R0AH 1I3RA 4PY7A 1AXTL 3LB6D 2CKBB 4KVNL 5FDWB 5L8KB 5HHMB 4N8CH 5I1CL 1KV3A 1T21A 3DV4A 5HVHB 3S97C 5DHYA 2J6EL 1YEJL 3FRUB 3T04D 2IQ9H 3O2VH 1NQBA 5AD0B 5MEPB 4CMMA 5DA4A 1IGJB 4JY4B 3DOSA 3FKUS 2VDLH 3ZSSA 2D31A 2ZCLL 1SY6A 5LKNA 4ZAKB 4XP5H 1FVCA 2P24B 4P4KD 4YDJA 5H37G 5D1XA 4EXPX 2J4WL 3WHE1 1AC6A 3JTTB 1UADC 5B3NA 2YA2A 3UTTE 2UZIH 4K3EL 1YEFH 1QNZH 1YY9C 1CG9A 1QBAA 4S1RH 2P5WB 5SWSA 2UYLA 3STZB 3RJDA 1KF9B 4B53A 3DMMD 1XIWB 1I8MB 1LO2L 1RIVL 4O9HL 1H0DA 2YD8A 5F9DC 4OF6A 4FQQB 1N7ML 5IB2B 3THMH 3I6LE 2AGJL 1BBDL 2X6MA 4X7EC 4R7DB 1HDMB 3VFWB 4JHWH 4A6YB 3BKML 1LE5A 1EUTA 1D6EA 1AE6H 3R1GL 4QRRA 1NBQA 3I6GA 4IOFC 2XNAB 4LQFL 3UO1L 4M6NH 2GAZA 2AXGB 1KIQB 2MCPH 5GJTH 4M8VA 4JFDE 1ZHLA 4OF5A 2HN7B 3SJVD 1ZAGA 1DVFB 1UWXK 4D0CA 3H9YA 3FQNA 4HDIB 1KPUB 3QYCA 3NPZB 4AG4L 1IJ9A 3IDIB 4QHNA 2WZPD 3LD8C 2A77H 3IF1A 3EFDL 1R3LA 2NX5B 5HYSA 2DTMH 1IQWH 3LHPL 2ORBL 5IBUG 1DJSA 5IHUL 3UBXI 4NJ9H 1KB5B 3GSWB 4PV8B 2QHRL 2DQFA 5FM8A 1MAML 4X4YA 2EKJA 2RCSH 3LOWA 4IOIA 2CIKA 1OARL 1OTTC 4NN6C 3QAZC 2X9YA 3S9DB 1XR8A 5DQJB 1NGYA 2P8LB 3NZ8A 1YEJH 1HHGA 5C0IA 3H9HA 3BFOA 4Y16B 1HYSC 2P8PB 3AS3A 5GZOC 4MSWB 4NQVB 1G0DA 4RFEB 1FAIL 1XGPB 1ORSA 2C3VA 3KLAB 4GKSA 2NTFA 3MRNA 4N90E 1IZKA 4HS3B 5KSAD 1P1ZB 2XRAH 3KLHC 1FNAA 4ZYKB 3L5IA 2IH3A 2LVEA 4JFOA 4YHMH 2Z4QA 5HYFA 5MP6H 4L4VE 3WLBA 3KYNB 1P1ZA 1RZJC 3V6ZB 3FB5B 3ES6B 2DB8A 5F9OL 4LCYA 4MA1B 4AT6B 1J5OL 4P3WA 3ZDYE 3MBXH 5BW7A 2HWZL 4KTEL 3D2UB 3JVGA 4JZOA 3QIWC 5DHVH 3VRIA 3GMRB 4Y7MA 5HHXH 1PX3A 2AV7B 3MRGB 2D03H 1OAZH 5TDOA 3CUPA 4OD1H 3QFJE 2EE9A 1A6WL 4U1HA 1A6AA 4XHJD 3KPSE 4G8GD 2C3GA 3LEXA 4OD3H 3U9PL 3X12A 1YY9D 3RVVD 4W6WB 1NANH 1Q0YL 3TZVB 4NKIH 1F4WL 5E4IA 5HBBA 3LPFA 1WBZA 4RSVA 1QR1A 2VL5A 1UA6H 3BYYA 3BJ91 3OG4B 2Z93B 1LO0L 1CLZH 4J23A 1BZ9B 3Q48A 1SMAA 3K8MA 5EB9A 2HG5B 3OKMA 2X1WL 2P5WD 1OF2A 1OLZA 4QTHB 4QHKI 5A2LH 3OXRB 1GZQB 5SWSD 1UKQA 3VXOB 2BCKA 1AC0A 4DZBA 4WRLA 1SEQH 1UGNA 4F7CB 1D9KD 4NT6B 2RFXA 5DR5H 3REWA 3BEWB 4G6AD 4KJYB 4Y16C 4X99A 5HHPB 2YUXA 4L9DA 5KSBA 2H1PL 2BNQE 3HC0B 3MOAH 4UB0H 2FBOJ 5C0BD 3AM8A 4A2MA 2IANB 3TIEB 1D5IH 2VDMH 4NSKB 4X6EA 1U8LA 5ENWA 1XF5B 2P5WA 1XF3A 1QFWM 5D1QB 4BSWB 3TN0D 3CMGA 4KI5D 4PGEA 1NC4A 2D2OA 3TBVB 4B41A 1UCBL 1ZWIA 1WJ3A 2HMID 1CR9L 5HYJB 1BFOA 1CICB 4HMCA 4D94A 1JUFB 4KKLD 1NSNL 1F13A 2C3HA 1G7MA 1D9KA 5CCKH 1H3PL 3GMOA 3UAJD 2WQ8A 1EK3A 3O4LE 4M6NL 2FHBA 3UO1H 1CE6A 3M1BB 5I1EH 3D69A 4H26A 4HKXA 3UCRA 1NAKL 3NIDE 5EU6E 5AD0A 4NRYA 4D9LL 3WJJC 4F33A 3D69B 4WFFD 4I2XA 4JN2A 1XGRB 4LVEA 4OLVH 4YK4B 4RRPA 1PKQB 2COQA 3EZJB 3PGFL 4RX4A 4D0DB 3MRIA 1IKNC 2YHGA 3VWKA 1FV1B 3TO4A 2NY3D 2P42B 5KSAC 3NACL 3AB0B 4HBCH 4U7MA 4PJGB 4OFDA 3DVGB 1MCPH 1IGTA 1MJUH 3JWOL 3F62A 3OSKA 2ZUQC 1RIHL 1A4KB 4G5ZL 5FEBA 4KQ3L 1OCWL 1WLHA 4OCNC 4QRQA 3S7GA 1OT2A 1AD0A 4OF0A 4OZHF 2YKLH 4OFIA 2EDDA 1CXHA 1OP5K 1S8DB 3MXVH 4XI5D 1GH7A 5EFIB 3GHBH 2GQHA 3WLWD 4ZS7H 5KOVC 3H42L 4XPFL 1YDPA 5HHOD 3L3GB 3DX8B 1C5BH 3D0LB 3DIFA 4PJDB 1ZLSL 3F7YB 3O6FA 4GW5A 2YPLE 5SWQA 4KFZC 5CLTA 4AG4H 3W5MA 2B0SH 5GS2H 1SEBA 5JW5B 4P0DA 3CFKB 3GMMB 2CLVB 4JHBA 2IH3B 4JFOB 2NR6D 1HH9B 4J4PD 1ZGLB 3DTXA 2C3WA 4PJGA 4FMKA 2WWKT 5E1HB 3SGDI 2H26A 4OQTL 1ACYL 2PCPB 1PLGH 3UJIL 2HTLC 3P30L 1QRNE 4I18B 1H3PH 1MELA 3QCVH 4Z7UA 5CJ5A 4GLRI 4HV8A 4DVRH 5E8NA 1NDMB 4J3XA 5DTFA 1QFUL 3G08A 1J1XH 3O3AB 5MEOA 2ADJA 3I3DA 2CK2A 3C5ZC 4P48A 5D1QD 5HHOA 1JNNL 2IPUK 4JKKA 4MMXC 4J8RA 2X4QB 3VI3F 1M05B 2PXYD 3B3IA 4CVUA 4JPKL 1AGCB 4P23B 1FGNH 5HGDB 4NZUH 4UUJB 4ELKB 1NC2D 3DIFB 4PJDA 5CAYB 4PRPB 2MFNA 3PL6A 3ZHKA 1V3MA 1F4HA 3FFCE 5C2BL 3AXLA 4HS6A 1J1PL 4PLKD 1Y18A 4YX2L 5EU6B 4Y2DC 1Q9LB 2F19L 5DMYA 3QPXH 4NQCB 4OIIL 4XCNA 5IMKB 2GK2A 4N0FA 4U6YB 1KJ2B 1EBPA 1IAII 2W60A 1ZT4B 1G84A 4AIZB 3BX7C 3DETC 2RBLA 1NCBH 1IFHH 2BSED 1T7YA 1FYHB 1MJUL 2VTFA 3MGOA 4C56D 1T0PB 4D2NA 1HN1A 3BXNA 2AQ1A 2AVGA 3QSKB 5J8OA 4PRPA 5C3TA 3CFDA 5CSGA 2IQ9L 3O2VL 2OR9H 3TO2B 2NYYC 3QIUB 1Q9OB 1YN6A 4XCFL 3PJSB 4P9ML 3PHQB 5D2LA 4Q6IC 2R23B 1R5IA 1EA9C 5ISZE 1KJ2A 1NAML 4HWEL 3REVA 5GPRA 4DUXA 1EO5A 1ZA3A 4YEFA 2R0WL 4BH7B 2BVYA 3H7LA 5I1EL 5IQ7L 4ORGA 2EIZB 5FYLE 5T1KB 5DVKA 1IM9A 5I1KH 1L7TH 3MNWA 3IU3A 4ZD3H 3T0EB 1ZA3B 3V0VB 5GGTL 5KW9H 3P11H 3MFFA 1WZMA 4CNIA 4RNRB 2OTWA 4PJ5E 1OAYH 1A4JA 4MCYA 2BNRE 4YUEL 3VXME 5E2UL 3VU2A 4D3CL 2VDOL 4M5ZH 2EC8A 2R29H 1WVZA 3QUMH 5D1XB 3T0DA 1FC1A 5C70A 1EXUA 4HCRL 4F2MB 2W59A 3MV01 3D39A 4ELMF 4F58H 3QUZB 4Z7VE 3CVIL 5GZND 3QEUB 1QVOA 3OKNA 3OB8A 2F5BH 3SDXB 4NRZB 3UTPD 5D7KE 2A83B 1K6QL 2AKRA 3QQ4A 3BEWA 4PJEE 5E4EB 3RZCD 3LSOA 3ZDXF 1FAIH 3CSBA 3OKKA 1CD0A 4P2YA 2XN9A 5BV7C 1S5HA 5DJDB 1MCDA 3RGVA 3BIKB 2FGWH 2CDGA 3DVFA 4HUVB 1EMTH 4M7JL 3W0WD 5CS7A 3MYJA 1JI1A 1YPZB 4ODUA 3AS0A 4P2OD 2HVKB 4XC3L 3D5OF 12E8H 1HE7A 4LHQB 1QBLH 2GT9B 4JFEB 5IFJA 1K8IA 4FS0A 3U7WL 4L5FL 4M1CD 3FJTA 3PL6C 1R3IL 5DYOB 4KUZH 2Q76B 3KYMA 2DI8A 4QY8A 3BP4B 4X0KB 4R4FL 5IBLC 1NPUA 1OAYL 2H2PD 5L0QC 1EJOH 2A9NL 5C07D 3QEGH 3U2SB 3BQUB 4JPVL 5I1KL 4XNZB 2VLJE 3DROA 3ESVF 5BZWA 3X3GH 1AQDA 1BFOB 5ANMA 5EO1B 4NPYB 2CRMA 4JM4L 3O9WC 4POZD 1A3LH 4KMLB 4MA7H 1AR1D 3BKMH 3WKMH 1JN6A 3PWPA 4PTUA 3TVMC 4LSPL 5J6HB 4QHKJ 3TA3D 3B2VH 3S4SG 3LN9A 1IGIL 3B5HA 3HI1B 4X6FB 1MI5D 4E42B 5HY9B 4U3HA 4QRPE 3HI6H 4Q9RH 5LAXB 5GS0D 4OJFL 1KJVA 3QFDA 4HS3A 3MV9B 1J0ZA 1C7SA 2XTJC 1U95B 3WBDA 1H15B 1NCBL 5TF1H 1ZWIB 4P23A 3QR2A 1SBSL 1ZHNA 3CFEA 2WINA 4OIIH 3L3GA 4KPHL 2BSTB 4OZFB 1KTDA 4JFQB 1S7QA 4YHLL 1IE5A 4WI8A 4OUOA 2RCSL 3OBAA 4LEXL 4PV9B 2QLVB 2IALB 3VGHA 1RJZB 2QADC 4KK9D 4ZQKB 5F88A 3IFLL 2CK0L 4OCSL 4NRYB 1N6QH 2A6JB 1OW0A 1NFIA 4NO0A 3ARSA 3IS1X 5FV2A 2XQYG 1FV1A 1OWRM 4OT1L 3L5XH 4YFLI 2DQCL 2NXYD 3CDGA 4K23H 4MNHA 4O2FB 3WN5C 2LTQB 3HI6L 1QR1B 1N2RA 4ZPVA 4JFPB 4OM1L 3UTTB 5I0ZA 5CCKL 4MB4A 4XPAL 4ZUUB 3HUJE 3DTXB 4PLNC 3ARGD 3FN0H 1IEHA 3MLXL 4GW4A 2HJFB 4LSDA 4M5YL 4NUGL 1LE9A 3BN3B 1A3LL 4LOUC 1CFVH 2V17L 1EH9A 4XZUB 3GRWL 2FL5B 4Z9KB 3WFBL 4DJMA 5IMMA 4HUNB 4HUWB 4HLJA 1AHWC 3ROOB 2AP2A 5D93B 2F54E 3LN5A 3MRGA 1IMHC 3LIZL 4ONOA 2RR3A 5D2NC 4R8WL 1NLDL 1BIIB 1WZLA 4MD4A 3C8KA 3LV3B 3MACH 1K5NB 1BFVH 2DD8L 3CMOH 5K33A 3WV0A 1I7UA 4QT5B 1FPTL 3TIEA 3VXSE 5M95B 1EGJH 1F6AA 4TUJA 3I9GL 5TDPA 4KKBC 5H35A 2ZCHL 1QSEA 1D5ZB 2Y07L 2ZNXA 3MROA 1A6ZB 5DQ9B 1L4IA 4LFHG 2CJUH 4LLMB 1ZHBB 3IKKA 4JDTL 1TJGH 1JPTL 3MUJA 5SWZE 3PDOB 3QG6B 1U8PA 4ZO9A 1RUMH 1BM3L 3GMLA 3TJEH 4C4KO 1AO7A 3PXJA 2XZQH 4RFNB 3TNNA 4JDTH 5DJ8A 4R26L 4LMQI 5ELIA 5EO1A 5DD3H 1EV2E 3KPRD 1BVLB 3H9ZA 1SJVA 2QSVA 2YRZA 3V9FA 4S1DC 4CVZB 3QXVA 4PTUB 2FEDC 5FGBC 3TGXA 2V2WB 4TN9A 3DX6B 2YD2A 3MLTB 5MHSD 1BD2E 1REIA 4HLZG 2GTZA 3IAQA 5LVEA 4J7RA 2V5YA 4UT7L 2B1AL 1QSZA 3HB3C 2IFGA 3MX0A 2GUOB 3ULUE 2HWZH 4YO0A 1JWSA 4M8QB 1ODAA 5JTWA 2DI9A 2UWEB 3RUGF 1CL7I 4FNLH 1M6OA 4QYOA 1KENH 1LNUA 4Z0BH 2OZ4A 4GXVH 4C56A 4OM1H 1S5HB 3JV4A 5KS9B 4CJ1A 3QO0B 3MRDA 1XGQA 2EDXA 1VEOA 1E4XL 3OGOE 1TZGL 2HRPL 1G7JA 1BAFL 1Q9KA 2LVCA 4RIRB 3ZYOA 1QKZL 4LCWB 4X6DE 2P47B 4TVPH 4JRYA 3GIZL 3P4OA 5DC4B 3TJEL 1U3HB 1FORL 4RAVB 1VESA 4P5TD 4HX1A 3UTSD 4XX1G 1WFUA 1AGBB 5D9SB 1U41A 3OR6B 4X7SL 1ZT1A 3ZE2F 5FF6A