4HK8A

Crystal structures of mutant endo- -1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVQGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
total genus 52
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hk8A00
2QZ2A 2D97A 3VZNA 3B7MA 3AMHA 3WQ7A 1C5IA 2QZ3A 1OLRA 3AMNA 4H7MA 3LGRA 3VL8A 1XNDA 3WR0A 3MFAA 2VULA 3VZKA 3WP4A 3WX5A 2BWAA 2B42B 4S2FA 1BCXA 2VG9A 3VZMA 2VGDA 2DCKA 4S2GA 1T6GC 1REFA 2C1FA 1H4HA 4XQWA 1HIXA 3WXPA 1UKRA 1H1AA 1H0BA 1UU4A 3AKRA 3MF9A 2DCZA 3M4FA 2NLRA 3WQ0A 1PVXA 1KS5A 3VLBB 2DFBA 3VZOA 2BW8A 1QH7A 1YNAA 3VZJA 5K7PA 4HKWA 1XNBA 1AXKA 2B45X 4IXLA 4NPRA 5K9YA 4XPVA 3RI8A 3AMQA 5HXVA 2DCJA 3MFCA 1UU6A 2D98A 1REEA 1BK1A 4S2DA 4XQDA 1H8VA 1XNCA 1OA4A 1OA2A 1ENXA 3LB9A 4HKOA 1XYNA 3VGIA 1H4GA 3AKQA 3VHOA 2F6BA 4HKLA 1F5JA 1HV0A 3VL9A 3AMPA 3WQ1A 4XQ4A 1C5HA 3WP5A 2B46X 1QH6A 4HK8A 3HD8B 1XYPA 1IGOA 3WP6A 2BWCA 3AKSA 1KS4A 1OLQA 3O7OA 1NLRA 3B5LB 3ZSEA 1HV1A 2VUJA 3AKPA 2NQYA 4S2HA 2Z79A 2JENA 3WY6A 1UU5A 1W2UA 1REDA 2JICA 1M4WA 2DFCA 3AKTA 1OA3A 3VHPA 1XYOA 2BVVA 1XXNA 2DCYA 3AMMA 3VHNA 3RI9A 1XNKA 3MF6A 4HK9A 1TE1B 3WP3A 3VZLA 3EXUA 1BVVA 3WT3A 5EJ3A 2JEMA
chains in the Genus database with same CATH superfamily
5FYMA 4TLGA 3L2HA 4YRDA 5JLVA 3FUOA 3ZKUA 5JIUA 3I59A 2Q8EA 4AEDA 5FREA 2X53S 3KD4A 3TEZA 4HMZA 2YROA 1RUG1 3VBHC 4PBOA 3T2QA 2EXKA 5DUWA 2C24A 3ZSLA 2W68A 1VR3A 2QNKA 2MPFA 3AYAA 4BHPA 1I3HA 2ZA9A 3NL1A 1GBGA 4DMIA 1YCIA 4Y1VA 3S7EA 2I2SA 1POV3 3H7JA 3VZMA 1PIV3 2ZZQA 5F37A 4CUCA 2DVGA 1GOFA 3POEA 1AR61 4YVWB 1YC61 5F5CA 3WUDA 3QD6A 4Z8BA 5GLTA 5BNOC 2W1SA 1NE6A 1LENA 5IVCA 3KT4A 4RR3A 1TME3 2WWUA 2VY0A 4ITCA 1HDKA 1RYYA 1ULEA 3IDCB 3KT7A 1QEXA 3VBSB 1ST8A 5L36A 1DBNA 2PLV2 2FCVA 2GU9A 4Q2FA 2G9FA 4RR3B 1KDMA 5K7PA 1C1FA 1R082 4DO0A 2A3WA 1MEC1 4JGYA 1UZVA 1POV0 1AX2A 2R1DA 3ZO0B 4K8FA 5HXVA 4E2SA 4EN0A 2P3KA 3AVRA 2WBKA 3MW3A 5JSPA 3OUIA 1RUNA 2I07B 2GP5A 3BIWE 5IK8A 1PM4A 3I2DA 2R16A 5TSWA 2ZGSA 1DLCA 1YLLA 5FY1A 3PUAA 3RRDA 2XXZA 2IVIB 1F5JA 4XQ4A 3U0ZA 3BTZA 5KHKA 3ECQA 3AP6A 3I3DA 1A8MA 4MOAA 4CEWB 3PIJA 3OPWA 4BMBA 4M4RA 1V6IA 5FZGA 4O9GA 2QQKA 1W3VA 2WO7A 2ZEWA 3ST7A 5JSRA 5IK7A 1ND3C 1UX6A 3IDBB 3RZGA 3AP5A 1V9U1 2RS11 2UWAA 3ZN6A 3ZSEA 5CBLA 1VB4A 5A7PA 3LD8A 2JWPA 3MGUA 1GLHA 1DIWA 1UYXA 2OPKA 2XMLA 3M70A 4GWJA 1X50A 5F3EA 2WNUC 1JUHA 2A6VA 1NUKA 3ZXAC 3NVCA 2B39A 1JMUB 2HWF2 5FZFA 4XFHA 2EIEA 5GZCA 2EXJA 1EPWA 1V6OA 2EAAA 1WW6A 4Q27A 5DG1A 3NW4A 4BK5A 1UNBA 3HQUA 5F3CA 1TE1B 4N43A 1QQP2 4CU6A 2YU2A 5FPBA 2QVSB 3IIIA 1OOPA 3POJA 2BVBA 2GNDA 2QQIA 3GM8A 1LULA 4HLTA 4Z2AA 4CDQB 4FPKA 1CZVA 3OGRA 1LTEA 4JKMA 1NE4A 4KWUA 3EJKA 5IK5A 3CZJA 4OMDA 3UGHA 2QFEA 3WQ7A 2AACA 1G9DA 1C5IA 4HG6B 3B02A 5ANNA 5FP9A 3BODA 1WW4A 2Y26A 1OF4A 2X10A 2YC2A 1H6XA 2WS92 1N3OA 3JB8A 1NY71 1EUUA 4LJHA 2PHFA 2VULA 3J9SA 5JMCA 1W8FA 2QE3A 2BWAA 5A7QA 2CY6A 3LDBA 4Y33A 5DN2A 4Z07A 3UKNA 3PMSA 5CFCC 2G9ZA 3AZZA 2DVDA 2JDNA 2E32A 5F3IA 1EV12 4RA0A 5FK7A 4IE7A 1COV3 4AVAA 1NKGA 2X29A 3INAA 2D6OX 4XDQA 1LHVA 3GBFA 3ELNA 2EIBA 2ZGKA 3J7HA 2FZ1A 2OUJA 3TB0A 1JOBA 4QMAA 4CUGA 4G3YC 3VKLA 4DIQA 1DFQA 4KG8A 2RS53 3FN9A 4IV1C 4UFIA 5CFDA 4AE2A 5B4NA 1MR5A 1PIV2 2H6BA 3MF9A 1ENSA 1R093 2ZGNA 3IT8A 4W6XA 3B01A 2XBO2 3K48A 2W92A 1YJKA 1LOEA 2WA4A 1V0AA 3BN6A 1PO21 1Y9QA 3LSEA 4PIZA 4QPIC 3S7IA 1WA6X 4EN7B 3THPA 3RZKA 5FKCA 3VLBB 4QM8A 3ZR6A 2HWE2 4ARXA 4HPKB 2A71A 3ZFGC 2K9ZA 2ZX4A 4COZA 1FOD1 2E53A 1HB3A 2QQWA 3H42B 2P6HA 3OD4A 1JH5A 4BPZA 1VIWB 1W99A 2VMDA 1UX7A 3VD9A 1PVC1 2OA2A 5JIAA 3JD72 1AYN3 2W0XA 3M7AA 5H9RA 5DUXA 2TNFA 4YM0A 2VTXJ 5C3RA 4Q4X1 4C91A 4B7KA 4MSVA 1GP4A 5FPZA 3ZFGB 4JDMA 5LEJA 4XTMA 1HXS3 1V6NA 2CTVA 4BLIA 1I1EA 1NA1B 4O65A 2YY1A 5KXDA 2JIGA 3ZXGA 4JKKA 1NX9A 2ORZA 4YLZA 3KGLA 1YQCA 4OI0A 3PVBB 3SKVA 4XMAA 2B7YA 1OH4A 3K46A 1UZWA 4MGKE 2I74A 4BQ1A 5T5LA 2DCTA 4N53A 2GNBA 3R05A 1DQ0A 2XLAA 1UMZA 3O7OA 3OUHA 1NA1A 3C8XA 3P3PA 5FJHA 2MEV3 5JVVA 3VUOA 2VQUA 1UW8A 1X9PA 2JDMA 1I9RA 5BYNA 3NJZA 4Y5Z0 4S2HA 4LXLA 5BV6A 4CEYB 5IUQA 3IKWA 1JN2P 4F83A 1J1LA 1AYM2 3DXUA 4KL1A 4RS5B 4YM2A 2EIGA 1REDA 1FNYA 1APNA 3HIFA 2VL4A 2E6VA 5G04L 2AGSA 1PVC3 2AEZA 2RR13 2W91A 3V64A 2PHWA 4Y22B 2VU9A 4PDWC 4BLJA 1LNSA 4L2NA 3MIHA 5KR7A 1Q8SA 1ZRIA 3OGJA 3LFIA 1NQJA 4XYXA 1SG3A 5LBBA 2R071 3FLPA 4CA9A 4RS5A 2B9VA 2W87A 1KGYA 1VBA2 1W2NA 5EJ3A 3OY8B 2JKBA 1N1VA 5KHJA 5GZGA 1UWWA 3Q8BA 4QPIB 3B9IA 1JU3A 3BALA 2D97A 1STMA 2WFPA 4P9JA 4LUMA 3NSTA 2Y64A 1N3QA 1MZ6A 1ZZ9A 1JZ6A 2QZ3A 3VBFC 5L7OA 1PGW2 4B1LA 1YQ6A 3ILFA 1W8WA 5BY5A 2PQSA 1XNDA 2C6SA 2BNOA 3IM0A 4A7YA 1M06G 1V6KA 4AF9A 3T1LA 4H3WA 4W6YA 1ULGA 4QKBA 1ASJ1 1Y9MA 3FJSA 3QCWA 4ET7A 1G6NA 3S0MA 1W90A 4JDNA 1W6MA 4LBKA 3THDA 3CQOA 3U4XA 1PO12 4B3NA 3BTXA 3VBFA 5L7OC 1P8JA 4XCAA 3AYCA 2Z2SB 1CPMA 5CFDC 2BEOA 1LB2A 1YWKA 2UWCA 2DUOA 3SEEA 1J1TA 1FPN3 3UGFA 1NYWA 2BGOA 2VW0A 4FAHA 3FBYA 4BJ0A 1AXZA 4P9GA 5FZDA 4BMEA 5T54A 1OQ1A 2CNAA 5HCAA 2EIDA 4CCOA 3H8RA 3RZLA 2DCZA 1PGL2 3M4FA 1BBT1 2Y6LA 4M00A 4FAGA 1F4AA 5JR7B 3AP9A 4AEDB 4C90A 1UY4A 4UAPA 3T0BA 1SDDB 1W6QA 4PDWA 4QX1A 2EAKA 1JBCA 3P6BA 2G1MA 2VMFA 3JB4C 5E89A 4YG6A 1CAVB 1O3TA 1RUF3 3DYMA 4Y1XA 2J22A 2XBO3 2WABA 2XJUA 3KM5A 3PTRB 2VOXA 3ZYGA 2IXIA 1RL3A 4WM8B 3U75A 3OCPA 4OMCA 2DCJA 5L73A 3UJOA 1Q8PA 4HPKA 1ZA7A 2VW2A 2IWGB 5GZFA 5AFEA 1WCSA 5FUNA 4TN7A 4LQRA 3O1OA 2QQUA 1D2SA 2HJIA 1E5SA 4AHWA 3E5XA 1UOBA 2CAUA 3O0VA 2RS51 3VHOA 2V72A 4YW2A 2YYOA 1MQTC 4PQ9A 1JYXA 1IKQA 2B46X 1FYUA 1Z7S3 2JE8A 4PBPA 4LMFA 3I2JA 1UY1A 4XVHA 4XUNA 4OHZA 5BNPB 5FZOA 1LEDA 1MS4A 2QQPA 3OBRA 3ATGA 4WV8A 2VCMA 4A3XA 3IPVA 4X8NA 3T1MA 3GCXA 4AEDC 4Z92B 2NPIA 5CVRA 2RS33 4LO5B 1DF0A 3AKPA 3I7DA 2CU5A 1HJFA 3N3HA 4NHYA 3VD4A 4Q1RA 1NAEA 3I3MA 1GQGA 4P9XA 3BUCA 1NT0A 1NCRC 3HQRA 4QT6A 2R6QA 3H1YA 4RSUA 4NIIA 3I2GA 3FLTA 5A7SA 4XETA 2DU0A 1SPPA 3APBA 3WDYA 1HB2A 3PDQA 2IC1A 3GXUA 3RI9A 1VPHA 4A6OA 4GB32 1QU0A 3OG2A 4KQ7A 5A3UA 2WNOA 4XAAA 2FCUA 2ZHMA 3AZYA 1LU2A 3AZVA 2VM9A 3WT3A 1LR5A 3E1F1 3A4UA 4LO8A 5C4WC 1FT9A 2WO2A 4R4ZA 2OX0A 1SPPB 3ILRA 1Z7S2 3PURA 4URTA 2GZWA 1A34A 1W6PB 2X5IA 3SITA 2DDUA 4YW5A 1UZ0A 5FYVA 3ZYHA 3VZNA 4CDUA 1MACA 2PA7A 4IEOA 2LRPA 3USSA 3UKTA 4DB5A 3DYOA 1UIKA 3UGGA 3ES1A 1HN1A 4M3CB 3MO4A 5FYCA 1OLRA 4ZU5A 1MEC2 3LQCA 5KXBA 4AEMA 1AYN2 4O7XA 2RJ2A 1A3KA 1LOCA 2WT2A 3ZKYA 2ZMKA 3LZZA 3FC0A 3SH4A 1O3SA 4XUPA 3FLRA 2RR11 4QPGB 4E8DA 1RITA 2VMEA 4PHZA 2CWMA 1PK6C 1PM7A 2XWJB 2JDYA 3NJVA 4LBQA 4QX8A 5IW0A 1BCXA 3TYJA 4M3CA 4ATFA 3ACIA 1SLBA 2WFF3 3I2IA 3FHIB 4D7YA 5ACA2 1OOPB 4FXGB 1LGCA 5FQ0B 2D43A 4AXOA 4IGPA 3E5QA 1V00A 1ZRDA 4XF4A 3W20A 2CV6A 4Q4Y3 4UYBA 2G4IA 5BNPC 1HRV1 2PYTA 4JZRA 5FZ9A 2WFF2 2XG3A 4A41A 2PXJA 5CKNA 1SLIA 4CDQC 5A1LA 3FE5A 1GQPA 1VAKA 2PHXA 4OHXA 2X8KA 1OVPA 5A3PA 2XUEA 1PMJX 1IPKA 3PVEA 5D21A 1QH7A 1BQPA 1W0NA 5T5PA 5J96B 2RVAA 4Q0SA 1LGBA 2V4VA 3VHRA 1AR83 1PK6A 4XPVA 2HBTA 1DGLA 5BNQA 1SHWB 2JXAA 3N9OA 5ANQA 1JZ5A 1PNGA 4CZSA 1OUXA 2WA3A 5C9AC 5FWEA 4NN0A 1XNCA 3C7OA 4LR4A 2DBNA 3CDZB 1H2NA 1R1A2 5A1FA 3H3LA 4UW4A 1ND3A 2D5FA 1VBA3 2ZAHA 4BU2A 2EXHA 5GZEA 4AI8A 2RMU2 4IUGA 2WNVB 4E9KA 3J8F3 2J1AA 4LE4A 1QY4A 4AGGA 3V65A 3AP4A 2IFRA 5T5OA 3BGAA 4RYDA 3LEKA 1J59A 4E2GA 1GNYA 1V6LA 2AENA 4UI9L 3CIHA 1HKDA 2QCSB 4Y24A 1RUC2 1IS6A 5D8AC 3N9QA 1UF2C 3MV01 3H8XA 2JB4A 2ZX0A 2ERFA 3OEBA 1RUI3 3OYWA 5JOXA 3SCFA 4B1MA 4L9BA 4NOTA 3RWNA 1UOJA 2DV9A 1BZWA 3CKHA 2IXCA 3ILNA 3NV1A 5F5IA 2PELA 5FYBA 5B2GB 3WNNA 4QAWA 3K4DA 2DFCA 1R091 2LUWA 4YGBA 3U11A 2HWF3 4Q4Y1 2WDBA 4YW3A 4C0HA 5FUIA 2QQMA 1B35C 2DVFA 3OGGA 2YDEA 1DHKB 2NMOA 2SBAA 5E8AA 3FL7A 2WAOA 1PIV1 1CR7A 3NNGA 4Q4V2 2ZOEB 2OXBA 5A3OA 1VBE2 4K7JA 4ISRA 1D7PM 1PO22 4QB1A 1QOSA 1JZ7A 4YW7A 1DQ1A 1GYKA 3JD73 1WMFA 4QQ2A 2YHJA 3WV6A 2WYSA 2VQAA 2E26A 1VBD3 3NNLA 4QQPA 4BQ3A 4LOSA 2VOWA 3ZFEA 1ZBE1 1FV3A 1RUG3 3THCA 1X9TA 3UK9A 3MEPA 3MIBA 4WM8C 1QDCA 3ACHA 4XW3A 2DTWA 4XJUA 5AFBA 5IVBA 3VKMA 5LWBA 1A6CA 1QIQA 5IK4A 2B8MA 4NHMA 5E16A 3VBHA 1B35A 1KXGA 1D4M3 4JTNA 4PI0A 4ATEA 2P5BA 4XFGA 5FY7A 2ZEZA 2VUCA 3ACGA 1BEV2 2VCAA 3MV11 3ZPOA 2J42A 4LHNA 5FZBA 3WDXA 1GV9A 3N7JA 4L99A 3WG2A 1S0CA 2WN2A 4MXWB 2F4PA 2BQPA 4AG4A 3RZMA 1C4RA 1N1YA 2VR4A 3M3OA 3WQ0A 4NRPA 1PVXA 3AFGA 3U37A 1D4M2 3NNJA 1GP5A 1UOFA 1YHFA 3BKZA 3IB3A 1TQ5A 1O7FA 1YNAA 4LKSA 4BISA 1RUE3 5KHHA 1HQLA 4RFT0 3PUIA 5FYHA 2Z5WA 4UFMA 5FOJB 1VBB2 3JQWA 1ZA4A 1C8M3 2R1BA 3MYXA 4LLOA 4HXCA 4FPOB 3ZPYA 4FCAA 4TXWA 3RJRA 4DRRA 1SZBA 1EPZA 2D98A 5EP9A 1RGSA 4OVEA 4FPLA 5GALA 4XQDA 4URAA 1FI2A 2H6CA 1G8WA 2D6NA 2EICA 2CGOA 2R072 4HVOA 4KWLA 1XE8A 4AHYA 2JG9A 3H3UA 1NOVA 4XF0A 5D2AA 1GUIA 2J1RA 4GA9A 2Y34A 3D82A 4DS0A 1HV0A 1DYOA 1TMF2 3AM2A 4K8RB 1UY3A 3I2OA 2KXLA 3N4MA 5LK7B 1RUH3 2L9LA 5EIYB 1IZ3A 4NMIA 1AUYA 4YW1A 4AGVA 1ODMA 2ARAA 4XJZA 3CJIC 5CFCA 1OSGA 5JCTA 4HSJA 4MLOA 1PGW1 2D3SA 3AC0A 4LBJA 4XE9A 5FZ1A 5GJ6A 5C8WA 3BYWA 3I2FA 4MGSA 1MEC3 2Q4SA 4GWMA 3EB7A 4HSLA 1JS9A 2XJPA 1AR91 3KF3A 5FO8B 2BBAA 4Q1PA 1RUD3 1OD5A 4Q0QA 3SHRA 2NQYA 5GLZA 4XBQA 1U5XA 1UCXA 1UU5A 2JENA 3RS6A 1PK6B 4AQ2A 1SBFA 5C9AA 5DAXA 5DZEA 4CE8A 5KHGA 4LHSA 4HT1T 1FAYA 2VZPA 1ZZ8A 4QX7A 1UN1A 1S2KA 4QXKA 2CSGA 1UPSA 5DZFA 4BQWA 1OQDA 2WZR1 3H1MA 3JD71 1RINA 4MUVA 4HFSA 2C4XA 1G9FA 3KSCA 3ORJA 4YVSC 3X29B 4AEKA 3O1PA 5JPNB 2LROA 2Y33A 3AZXA 1ODNA 2HWB2 4Q4W2 2RJLA 3ZSJA 4JGYB 3ZXFA 2WNVA 3MLKA 1WCDJ 3JUUA 2FQPA 5I0DA 1ZM1A 4R8HA 1OPMA 4C0BA 2BJSA 5K0UA 1DYKA 3I54A 4Y1ZA 3RZHA 4PI2A 2RS32 1W8HA 4RGGA 4CVUA 2DVBA 5FO7B 5I8YA 1VBB3 1R1A3 2VCCA 5I93A 3GF6A 2AH2A 1QF3A 1W8NA 2A1XA 2Q5TA 4H7MA 1SDWA 5HPOA 4YGCA 2HWD2 3VL8A 2W47A 1U5ZA 3F2ZA 1JYNA 2VOTA 4LBNA 4QXCA 4AW7A 4JTOA 3WP4A 3O1MA 2VNOA 1YFWA 3JQXA 2D3PA 3BPSA 1LHUA 2HKXA 4SBVA 1Y3TA 2CGNA 2ZKLA 2ZX3A 3BB6A 4YM3A 4NWWA 4XUTA 1AR63 1FX5A 4COVA 4N53B 2PTMA 2X09A 5FMOS 2VCBA 2VVFA 3VN4A 2C9AA 1TNRA 2F4LA 1Q56A 3C7GA 4A42A 2GMPA 3HT1A 2JG9C 2P2KA 3K51A 4XUOA 3WXPA 3NMBA 1IQAA 4BIFA 2XQXA 2CDOA 2A6YA 3KVBA 1NCQB 4XJ9A 4GMP1 2VZ1A 1UU4A 1HQNA 2QUOA 1LHNA 4B4QA 1I5PA 1OFNA 4G9SB 4OULA 2H0BA 1AR93 1B09A 5FYUA 4EQVA 1Z0HA 3FZ3A 3KZ4C 5IVJA 1CX4A 3ZMNA 1KS5A 1O4ZA 1URXA 3D4KA 5SV8A 3WG1A 2ZHKA 2Q8DA 2YFZA 4NPRA 1FATA 1GZTA 1NZCA 2CDPA 3JCIA 1J84A 2FHRA 3ABZA 4DOUA 5LY2A 4HANA 1UYPA 2ZX1A 3WW1A 4BOWA 3O5SA 3KV9A 4K6BA 3AX4A 5C5UA 4MGTA 3GZTB 1ENXA 1SMVA 1QQP1 3T0DA 4CPBA 1XYNA 1WLWA 4FOQA 1N3PA 2CHHA 2WAAA 4XIOA 3I8TA 1GKBA 4YG3A 4KBZA 1XNTA 1AZDA 1F4HA 2OPWA 2VZ3A 4LBQD 3EYPA 4D8MA 2ZS6B 1W0PA 2IZWA 4GZ9A 2A6XA 4E4SA 3N9MA 1IGOA 4AFBA 3ITQA 4NHXA 4AVVA 1JZ8A 1OT5A 1O5LA 3KF5A 1HLCA 1EY2A 1QJY1 2HWD3 3PUQA 1NLQA 2WS91 3SCHA 1NY72 1W0OA 3B5LB 2XDVA 3BOPA 3FMGA 4KWKA 4YZ1A 2Y0IA 4OLLA 3JZVA 1W9SA 1Z78A 1TVGA 1GQHA 5F6LB 4CDWA 2QJVA 5FXWA 3IAPA 1LOBA 5FTTC 5CG9A 2JDKA 2K46A 2E7TA 4L97A 2V5YA 3H7YA 3GBGA 3D3AA 3A0KA 3IAQA 3B69A 4CDXB 1K3IA 2YXSA 1Q8OA 5ACA1 3AKTA 2OW4A 1QXRA 4XTPA 3Q8CA 1MS1A 2PQQA 3WDTA 3NJXA 2RDSA 4OI4A 5FBJA 1JZ4A 1OPOA 2JJ6A 3WNKA 2Q1MA 3WHUA 4XABA 5FPXA 3TEWA 3O1VA 4OUEA 2ZGLA 4QDRA 1JTZX 3VDDC 3VKNA 4MZUA 2DURA 4UT5A 4CTEA 3RSJA 3O0XA 4AOCA 4FPGA 5JDBA 5CFDB 3M3IA 1QHDA 1AF9A 1F2NA 1W8UA 2VBBA 2OUHA 3OUJA 1RXFA 2A70A 1W8ZA 3MIEA 2PMWB 2WYFA 4AQ6A 2VC9A 3ZFEB 3D8CA 3KMHA 2J1TA 3GHMA 4DEVA 1V9U2 1VMFA 2RS12 1SFYA 1UY2A 3NAPC 2D93A 3OYWB 4PQQA 3N9LA 2Q8CA 4HVQA 1YRZA 1VBD1 4KU7A 4JGYC 4OHVA 1XC6A 4OHWA 5CZKA 3WHTA 5ABJC 1E5IA 1VBC2 1RUH2 1JHNA 3G6JB 4FPCA 4AQTA 3PMEA 1JYIA 5FZHA 2VECA 3U07A 5KWRA 1W3XA 2VMIA 2R041 5FZ8A 4CU9A 5J3UA 3QOPA 1W05A 2RMU1 4FOYA 1AL0G 5C3PA 1VP6A 1F35A 5JUVA 1X7NA 2Y6FA 5DXDA 3RJ2X 2QKDA 4QQHA 1BJQA 1W6OB 2VVDA 1UKRA 5F2WA 3HMYA 3WEZA 1HRI3 2BYVE 5APAA 3ZFFB 4YW6A 1CAUB 1RUI1 4RQPA 3VV1A 1RTVA 4FI9A 2FDGA 4QX5A 1CQ9A 3KVAA 2VD7A 4YW4A 5A3LA 1AL23 4PJYA 1PZ9A 3RNSA 5CIRA 3CEWA 1CIWA 3DEMA 3VZJA 4J1WA 4CXXA 3AJYA 4FOVA 2GN3A 1GWMA 5F32A 1PX4A 2UY8A 4KMQA 1W9TA 1FMD2 1YQ2A 2Q30A 4AI0A 2R49A 1DZQA 1QJU1 1R092 5IHRA 4DUXA 3S57A 1AYN1 2AC1A 3NAPB 5JSOA 4IV3C 2X5IB 3R6SA 3WNPA 4L11A 2D6MA 5CISA 4S2DA 2WO3A 2YFUA 2A3XA 4QQOA 5C5TA 1B35B 4IE6A 4WZFA 3KQRA 3UKVA 4XFCA 1D2QA 5BNNA 3B00A 4ZXKA 3I3EA 5L9BA 2JDUA 2W1UA 1EV11 2ZEXA 4M0HA 3E6DA 1QJX1 5A3NA 4E4ZA 1YFUA 4CPBD 3LOBA 5B4XA 4QKDA 1SLLA 2RDQA 2LM3A 1WUVA 3KLSA 4Y4YA 2O14A 4PLOA 1DYPA 1KJRA 5FLHA 1KS4A 1GWKA 3VBFB 4PIXA 1EP0A 1XNAA 4LITA 3LKJA 5FRAA 1CGPA 2XJTA 3N7KA 2JIJA 4D3WA 5HBAA 1U5IA 5F1RA 4K20A 4Y3OA 2P34A 3KB5A 4QGLA 1W8TA 3JBG3 1JXNA 3KV4A 5KC5A 4XJ8A 3LPFA 1RXGA 2Z4FA 3IIAA 4I09A 1Q5OA 4UW6A 1W04A 1HQWA 1RJ7A 2WIIB 1H30A 1QJEA 1OA3A 3MLJA 1AHSA 1E5HA 1QWRA 1H2LA 1XYOA 1I5ZA 2BVVA 2NYYA 3NV3A 3QBQA 5FMDA 5FYSA 4CDWB 4PF1A 1BEV1 4AFMA 2YC4A 4V2WA 2Q0AA 3C7EA 5DAQA 5DDJ1 3WP3A 2GDFA 1YXWA 3B9CA 4BE3A 4KNCA 4KWJA 2GH8A 4IV1B 2VZRA 4IE0A 5DQ0A 4E4HA 2ZMNA 5JI9A 4HONA 5F8PA 1ZZCA 4OUMA 1DGRN 4P14A 2VO5A 5FY5A 4ZXEA 5C3SA 1D4M1 4XF3A 5A3TA 3AVSA 1VE0A 3PU8A 1XE7A 2Y0OA 4A2UA 3FWEA 3SISA 1RUD2 3CZUA 4AHXA 3M3CA 5IATA 3PUHA 4K3UA 4YZ3A 5ABJA 1S0JA 3P3NA 5C8CB 2D6PA 4XOGA 1WLTA 3LEGA 1O5UA 3VDCA 3HR9A 1QMJA 5LBCA 2Y6KA 5FY9A 4DZGA 1MVQA 5ERLA 3LSDA 4N7UA 2D7FA 1IKPA 1KD7A 2OS2A 2R073 3O12A 4LKEA 4UFHA 2VG9A 3D0SA 1EAH1 2JDAA 2DCKA 3IPVB 1OHFA 4S2GA 5H9QA 4EYUA 3SCGA 3SXWA 3QLQA 4QPWA 3LF7A 1C8M2 1AR73 3TEXA 2A75A 2IXHA 3WSOA 3EBRA 4FTEA 4E2QA 2DYCA 2WNUA 3BPZA 4CCNA 1LODA 5A32B 1UY0A 3HT2A 4DFSA 4RHV1 3GNEA 3LOIA 1PO13 2Q1ZB 2VBPA 4ONUA 3GYDA 1NCQA 3SEPA 2OZJA 1AR92 4Z2WA 2YUEA 2RHPA 4N43C 5EFUA 5FZOB 2Z42A 5LBFA 1H8TC 4AVBA 5HV4A 4HKWA 1MZ5A 2XL7A 3TBDA 4W8JA 2UURA 1ULOA 2SLIA 1RMU2 3DECA 3OBTA 4IDZA 2ZGMA 2VTXA 4CCEA 4CP2A 1CZTA 4L92A 4K9SA 3RGBA 4NRMA 4GB31 2XHKA 2V09A 2XHNA 4IETA 4WVMA 3ZMOA 1AJOA 1W2TA 5FP7A 3S5QA 3DCQA 4UFLA 1JOJA 1UMIA 2W9XA 4A7KA 2Y6GA 2C0ZA 3V56A 4XIKA 2GC0A 3J8F1 5CKQA 4LK7A 3WP5A 5FYZA 1WMDA 5KXEA 3HN1A 1ULCA 4Y5TA 3A7QA 4NRQA 5JXIA 2OKXA 2D5HA 4YNIA 3ZXEA 2CYFA 1F9KA 4C8DA 4AVSA 4ORFA 4OQ9A 3RMXA 3P5BA 4XFBA 5LASA 2ZCWA 3VBRB 3BCWA 2RR12 3U10A 1O3RA 4U2AA 4QQLA 2ZPXA 3C7HA 4D69A 2R043 1L7LA 2YV8A 1EAH3 4XUQA 2P3IA 2BOIA 4LBLA 3KCYA 4LKDA 5EXOA 3BI3A 1EUTA 2OVUA 3UJQA 1AR71 3SLIA 1VMHA 3MPBA 2RDNA 1AXYA 1G86A 4DNYA 2YGLA 1L3JA 2ZMLA 2FMDA 4D6RA 3MF6A 2Z69A 1XJAA 2VXRA 3CF6E 5FZCA 2PAEA 1OBNA 4OHYA 2DU1A 1YJLA 2GC2A 3CMGA 4IL7A 4P9YA 3FFQA 2HYKA 4MH0E 4FXKB 1US3A 1ZRRA 4QPGC 2QQOA 3MUY1 3SMHA 2EA7A 2JECA 1V6MA 1PGSA 2XVGA 3K3OA 3ZN5A 2P17A 3IN9A 1PZ8A 5I8TA 2FDKA 1HJGA 3MI8A 4CDXC 3ZYJB 5L7OB 1WD3A 2ET7A 2GSYA 2PFWA 3AMHA 3POSA 4HL0A 5A1AA 2VOVA 4M3CE 3VBOB 2FDIA 1ZBA1 4JCKA 1S4CA 1EYBA 1W2AX 2ZKNA 4COYA 5LA1A 5D8AB 2Q1FA 4OI1A 3QH7A 1IOAA 1MPXA 1HRI1 1OI6A 1ZZ7A 3I59B 2VOKA 1CJPA 2JDPA 3MIGA 1G9CA 3AK0A 2WSVA 4SLIA 1ACCA 3SQOA 2BBVA 3TNPB 1UQXA 1IPJA 4DRVA 2A6ZA 1JYTA 5HV0A 1H4HA 3RDIA 2WNVC 4LBMA 4LO6B 5FZ3A 4CUBA 2ZGTA 5FFOC 4Z1VA 2W3JA 4MHRA 4D7SA 1KEXA 4Y5SA 4TLFA 5A6QA 1PMHX 4YARA 1WCKA 3PTYA 2A3YA 1W6OA 2R0HA 4BIOA 1NG0A 1RVF3 1QJZA 4Q4W1 4PF5A 2WLQA 4A6SA 4RQPB 2FMYA 4Q0VA 4AI1A 5C3OA 4META 1RUF2 2WZ8A 2NLRA 3NO8A 4UF0B 1RUC1 5JZGC 3K3NA 2GH2A 4W50A 5DUUA 3TN92 4TTGA 5FXVA 3QH6A 4I0AA 4JRLA 4RL7A 4H55A 1IPSA 2QQNA 3ZSMA 1JYWA 3VBOC 2NN8A 3AFKA 4YGEA 4LHKA 1A78A 1RJ8A 2B45X 2MEV1 2HH9A 3LDRA 3C3VA 3J7NA 3NQHA 4QHOA 5FO9B 3K4ZA 4YFZA 3EMRA 5DPNA 2Y60A 4CDUC 3T08A 4FTSA 1REEA 4Q4Y2 1XSRA 3PJQA 5F5AA 1KRIA 4BCUA 3LAGA 1H1MA 1OXCA 5L9VA 5GZDA 3BTAA 4FQZA 4QX2A 4A4AA 1QKQA 1ONAA 4IEWA 1UOGA 4LLFA 4QDQA 4R4XA 1S0EA 2UY9A 4UFKA 4BH9A 3AMPA 4GJYA 1LECA 2FZ2A 3OB8A 4RS5C 1DP0A 1QH6A 1RUJ2 1SFNA 2WNUB 4B8EA 1D4VB 2G9GA 1W6PA 1SQ4A 1QNYA 2VQTA 3FHAA 5BNOB 4FPEA 1XU1A 3VBHB 1S1AA 5DG2A 3ZYFA 5FZAA 1PO23 1OKQA 4COWA 1UD1A 1DG6A 2E9QA 4Q4V3 4WM7C 4W65A 4K21A 1ZVFA 5J98B 5T50A 5BNOA 1VBC1 3WDUA 4FQ4A 1LU1A 3MW4A 1N1TA 4QDSA 4GB33 2R042 3WF2A 1J3PA 3KCCA 3OTFA 4N53C 1YYNA 3HJRA 4KI5M 5BXXA 1OOPC 5CYYA 5A3MA 5I0SA 2DCYA 1X8EA 3UNPA 2NMNA 4NUBA 2R063 1X36A 3GZAA 4YM1A 4BQ4A 5LA0A 3GBWA 3ZFFC 4CXYA 1K42A 1RUI2 2XKOA 4GD4A 1LAJA 3RFRA 3ENRA 3JU9A 4NIAA 4NR1A 3AL6A 4B4RA 1RUC3 1MQTB 5FMCA 2E7AA 3GGLA 1RUJ3 4HVRA 1IS4A 3P1IA 4G4FA 3RMYA 3RWKX 4AVCA 4CCDA 3NNMA 4NIDA 4YZ2A 4XAEA 1OLMA 1K5JA 4QU1A 5CADA 1WZXA 3WF1A 4V1PA 1W6QB 2P4EA 1GNZA 2YGMA 3GALA 3ZR5A 1POV1 2YB7A 1H8TB 1QXJA 5DAWA 3E97A 1W6MB 1IG0A 2QDRA 1VBB1 3MLLA 2W2IA 4QPGA 3MZHA 2VH9A 2DBIA 2GALA 3IDEA 4Q29A 3MHZA 3VZKA 4N7IA 2E33A 1ENRA 1VMJA 3I3BA 2ZGRA 1GZWA 4RQPC 1X82A 2FDJA 3OEAA 3PIGA 4BK4A 5E1RA 1Q8QA 3SC7X 1W6NA 2B9UA 1HXS2 1T6GC 3HNMA 1OUSA 1BKZA 4AK3A 3TN93 4TSVA 1LKNA 1TMF1 2C1FA 4AR2A 2A73B 5IVEA 2XJQA 4Q4V1 1ZBE3 4ASLA 1J3QA 1CAXA 1PX3A 3KWVA 3M3QA 2LS6A 1H0BA 4CCLA 2F17A 5FPAA 5LK5A 2JE9A 1JYVA 4OCTA 5JXGA 1BXHA 1VBE1 4ZZ5A 4XXPA 1XOYA 2CAVA 2DUQA 3POFA 2I45A 4P9LA 3VZOA 2BW8A 2XONA 2D6LX 4MGQA 5CEHA 3DKWA 1X33A 5DDJ3 1YFXA 1C28A 1XNBA 1UMHA 2P3JA 2V5DA 4K40A 2BDRA 4QX0A 3C2UA 5D8AA 3KCXA 3K75B 4MGIE 5T52A 4I01A 3W21A 3WF0A 5LEKA 1O8PA 5FKBA 1UIJA 3A22A 3DPRC 3NV2A 4FBFA 1Q3EA 2XJSA 3PVNA 1DGWX 1SLAA 4H14A 1ND3B 3VD3A 3F95A 2VMCA 2J1UA 2LW8A 1K45A 3FFZA 2BUKA 3VGIA 1W28A 4CCKA 4XEZA 1WBFA 3ON7A 2HWB1 4LA2A 1UYZA 2FBEA 4UFJA 3T09A 5I91A 1LHWA 2F6BA 1V9U3 2RS13 4AEJA 3OOXA 4Y26A 4XBNA 4K1ZA 3E6CC 4FP2A 3R0RA 4HK8A 2BV4A 5F2SA 1VBC3 2VAUA 2VW1A 3N9PA 4ZU4A 5K8SA 1DQ4A 1RUD1 2ZBJA 3O0WA 4GXLA 3POGA 5JXHA 4BB3A 3WLUA 3T0AA 3VBSA 2HWD1 4JC1A 2AREA 2PHUA 1BYHA 4X8PA 2EALA 5AVAA 5I8SA 5HCFA 1HRV3 4QB6A 1JODA 4JHZA 4LNVA 4YVSA 3ASIA 2D44A 2ARBA 4IV3A 1EAH2 2ZX2A 1FMD1 4PCRA 3J26N 4I3GA 3ZXKA 1G9BA 3EO6A 2FDHA 5SV5A 3OBAA 1TME1 1JW6A 4HOOA 5AC91 1NQDA 5A70A 1XXNA 3ZYIB 4BYYA 3VHNA 2BOJA 2ZABA 4QKNA 2FCTA 5IT6A 1WWYA 3THTA 5C8CC 1RVF1 1QDOA 3ZFEC 4I3PA 4R9CA 3VBRC 4XACA 3VDAA 4FPFA 3VD5A 4QXBA 3SKJE 3KHCA 1ZZ6A 1QJX2 2JX9A 3OGSA 2BNNA 2QZ2A 3WNLA 4LT5A 1PMIA 1UYYA 2RDRA 4QPYA 2DF7A 4Q0UA 4WM7A 2BNMA 4B7EA 1RMU3 1GANA 5C4WA 4EE2A 1XU2A 1LOFC 1DDLA 3AMNA 1VRBA 2HEVF 5IYYA 1L7QA 3OD0A 3O1UA 2D3RA 4RHV3 4GKYA 4UXAA 3WR0A 4IEXA 5JR2A 1OLME 1TG7A 2A5ZA 4IW3A 2ZGOA 2GAUA 4OYUA 4GH4C 3E6BA 4UW3A 4R52A 1AR82 1GOHA 2PAKA 4QB2A 2YBPA 2R061 3RYPA 3BTYA 3LA7A 5DZGA 5FZ4A 2YPJA 2HWC1 4IV1A 4BXSV 2ID4A 3BVCA 4O61A 2JDHA 2JDZA 3USUA 2QTWB 4NROA 2WZR2 1MS3A 3WW4A 3K2OA 1HIXA 3GZEA 3V0BB 1C1LA 4I0BA 2TEPA 4B4PA 1DGRA 1JYCA 5DDJ2 2TBVA 3R4DB 3CJXA 2O1QA 1CAVA 3N35A 3DPRB 3AP7A 4DXZA 3WG4A 1CVNA 1QJY2 2J1SA 4MO3M 5ABJB 3VBOA 1CZSA 3IMNA 2W46A 4GAZA 4HZFA 4FFGA 1FPN2 4LIUA 1H2MA 4Q0PA 5FP4A 3ZXDA 4LIVA 1LHOA 2JE7A 2RM21 1G9AA 2ARXA 4JDOA 2QQVA 3AMQA 4PT6A 5JMOA 3WF3A 3HOBA 3VD7A 5F39A 4YSFA 1COV2 2VZOA 1O8SA 3KT1A 1WCQA 4PDWB 1GZWB 5T55A 1CIYA 4COUA 1YQ8A 2WO1A 3JBG1 5CB7A 3PVOA 2VQ0A 2H0VA 4YG0A 3WNMA 1HB4A 1RUE1 3UESA 2ENRA 3U4SA 4XHBA 4R9DA 5T3NA 5GLVA 1EV13 1HW5A 4WM8A 5DUVA 1C8M1 3WQ1A 1VRH2 3ES4A 3I2KA 1CAXB 1XYPA 1J83A 1MZFA 3DGTA 3ZLIA 2VVEA 3LEIA 4CSWA 1ZBA2 5A33A 3RZJA 3ZYBA 1H9PA 4DQAA 5FY8A 4YZ5A 4IE4A 1JZ3A 5JXJA 2FDFA 4NIGA 3MDPA 1HV1A 1F5FA 5LCWL 2WZPP 2VUJA 1VBD2 1OFSA 4DPNA 1BMV1 3Q9OA 3Q8AA 1RUH1 4ZS3A 1QQP3 4JGZA 2ILMA 2PHTA 2BTVC 4QM9A 2XLFA 4JHTA 1ZBA3 4XMIA 2YG0A 3W5NA 1M4WA 5IFPA 5FZIA 1QJFA 4IESA 2WT0A 4NE9A 3V0AA 3HWJA 4JAAA 3OPTA 3I97A 4D94A 1XNKA 3A21A 1AYM3 4EJRA 4CXWA 1ZRCA 5A7OA 2E7QA 2W5FA 4ASKA 4CEWA 3N7LA 4FFHA 4LUKA 3W59A 5A6ZA 1YEWA 2XOMA 4JQRA 1C8NA 1ND2C 3D0JA 4ZPIA 4R9BA 5I0RA 1S2BA 1W2OA 3V0AB 2WINB 1YFYA 2ATFA 4NAOA 1Y9GA 1YQ5A 2PHDA 4DUWA 2PLV1 5J36A 4GQ7A 4MVTA 5EZWA 1SLCA 3SH3A 4XJAA 5LATA 4WVWA 1DCSA 1YIPA 4CEYC 3ZIXA 2ZGUA 1QJU2 1OQEA 3LGRA 4JVAA 4D0QA 5FZ7A 4CCCA 4YWAA 5IAXA 4CDUB 3WX5A 2B42B 3L2YA 1UZYA 1GMMA 3WW2A 5FYTA 1E57A 3AL5A 2Q8OA 1KQRA 3LPGA 5CA6A 2VGDA 1OH3A 2RMU3 5CU1A 5C70A 3AB0A 3LEMA 1CWPA 3VBUA 2HWE3 2R32A 3MIFA 5C33A 1L7RA 3HVDA 5FZ0A 3WD5A 3DN7A 2VZSA 4CDQA 2JD4A 4ES8A 4XC9A 2WR9A 4EN9B 5A7WB 1RHI2 1OF3A 1GOGA 3EQEA 3J7LA 4D6SA 1K5MB 4IQPA 5LBEA 3TNQA 1H8TA 2O0OA 4NPMA 5J7MA 5JI7A 4WM7B 4RN5A 2GN7A 2VE1A 5A6YA 4P9IA 2WSUA 3LFMA 2DFBA 2YBKA 3AJZA 3D6EA 4UWDA 5EYXA 2W1WA 4ARYA 2XGXA 1JU4A 2UYAA 4RGAA 1AXKA 5K9YA 4IGQA 2VBDA 3I3QA 2FD8A 3IMMA 1N1SA 4XFFA 4N8MA 1GR3A 2BZDA 1LOAA 1UXZA 1UU6A 3A0NA 4CDXA 4Q26A 5F6KA 3ZYRA 1UZZA 4MGZE 4I2OA 3RQ0A 4CU7A 3LB9A 4HKOA 4P08A 1C57A 4HBNA 1MS5A 3IDAA 1ZREA 4XHXA 2W95A 2XKPA 4QWNA 1H4GA 4YZ4A 4LEJA 4AGRA 3VDBA 3AKQA 4AFCA 3POBA 2IXJA 3S6PA 3CL1A 1GFF2 5FMOL 3BU0A 2WS93 1AX0A 2YBSA 5DABA 3D5OA 4UF0A 4E27A 1BBT3 3HD8B 5FLIA 3H50A 3WZ1A 4M4PA 4W6WA 2BRTA 3KS7A 4GJZA 4UBHA 3TWIA 2RM23 1QOTA 4M3CF 5C9AB 1OLQA 4C1WA 5J1XA 1S0IA 2PHLA 5AVPA 2IVJA 4ASMB 4FTBA 5FBZA 1RUF1 4LPLA 5JZGB 3U1XA 1W06A 4BQ2A 3TN91 2VXJA 1R1ZA 4QGNA 5FZEA 5HCHA 4TZDA 1XSQA 2QDNA 3SH5A 2BFUS 2UU8A 3RYKA 5HXMA 1R081 4FFFA 3S5AA 4IEPA 4EWEA 4XJWA 2JICA 1VJ2A 5DAVA 1ZRFA 2YC0A 3IBMA 4P5YA 5JWPA 1O91A 4IV3B 1XBFA 2UYBA 2ZACA 3HNYM 4J1XA 1QNWA 4Y1UA 2VZUA 3W58A 3H9AA 3T2TA 2C9KA 3MBWA 3O14A 5K0UB 4GWNA 4JGZC 1SFPA 2JD9A 1BVVA 1LRHA 2VNGA 5J48A 5F5QA 3ZM8A 1SBDA 2ZHNA 1JOPA 3CU7A 1TMF3 1ASJ3 3ZN6B 4DINB 1RUJ1 4XZPA 5EHDA 4EWAA 4QXHA 5A32A 1KJLA 2WWJA 4KGGA 4ES9A 3HNBM 1V70A 2WKKA 3ALQA 5EJ1B 3T4HB 4YVSB 1H9WA 3WINE 4EROA 4AAXA 1A8DA 1W9WA 3WDWA 4IE5A 4B29A 4BDVB 2WWSA 1LEMA 4A45A 3VBUC 1OURA 5JOYA 2O8OA 3O1SA 2KR2A 2XWBB 1R083 3PU3A 1W03A 2WC2A 3E5UA 4XZUG 2P6CA 4YGDA 2HWF1 4GWIA 1MS9A 2ES3A 1NA1C 5A80A 4ZONA 4ISQA 2WZR3 5BNNB 1GU3A 3HBZA 5D1IA 2CGPA 3H3ZA 3AKRA 2XVKA 1WW7A 3FBMA 2HYXA 5JAXA 4M01A 1NZIA 2VPVA 4AI2A 5IWFA 3NKGA 4PIYA 5KC6A 4ZHNA 3DPRA 5E6HA 2BU9A 5AC93 5LZ6A 3FX3A 4OZOA 3H0OA 4OZXA 4X6RB 1HN0A 4XF9A 4Y4RA 1SLTA 3EHKA 3MW2A 3ZDSA 4D7TA 1CJDA 3ZN4A 1AYM1 2JG9B 5JOWA 3NAPA 1RB8G 1YIFA 4GH4A 5FK8A 3RI8A 4BA6A 1AR72 5BPXA 3U14A 1O3QA 2VUDA 4QHBA 1QGLA 5GLUA 4TWTA 2W39A 3J4UH 4L0PA 4MV2A 3MFCA 5T5JA 3W9AA 2VJXA 4BQYA 3BU7A 3T30A 4LA3A 1BK1A 4P02B 1AL21 1H8VA 1XB9A 3MUZ1 1OA2A 4GKXA 1ZYBA 4MG2A 4FPJA 1DLLA 4AWDA 5FPUA 1AX1A 1J58A 1LESA 3ME2A 4QGMA 2ET1A 2K0GA 1QJU3 1UKGA 4UOJA 4AZZA 5L19A 1S0GA 4P5HA 3UV9A 4INDA 2ADDA 2HWB3 2XJRA 5C6CA 1K5MA 3GJBA 4AYUA 3LE0A 3AKSA 4RHV2 5A6XA 2IUWA 3BOWA 4XURA 1C3HA 4FPYA 1NLRA 4NVPA 5FDBA 1H6YA 4FFIA 4FP3A 5I0UA 4IEQA 2XLGA 4QKFA 3ZDVA 3WY6A 2GMEA 1ZX5A 1W9YA 2RE9A 4UW5A 2B4KA 5C8CA 1PO11 5CG8A 2OT7A 2E51A 1RMU1 5JZGA 2ZGPA 1VLNA 2HEWF 5E88A 1D0GA 2GC1A 2HLEA 4GULA 3AYDA 4Q8LA 1W9FA 3CBNA 3G7DA 4N9HA 2P1BA 4HK9A 1O4TA 1Y4WA 2OIIA 3TRSB 1WLCA 1BLZA 2ZEYA 3LIHA 1CPNA 3AXEA 2RV9A 3TOJA 1H2KA 4FT8A 1BBT2 4MXVA 1HB1A 3DYPA 3J8F2 3K77A 4KH9A 2GNMA 3VBSC 5BNPA 2Y8KA 1W8OA 2RM22 1POQA 5A7NA 1ULPA 1WCUA 2V73A 4FO9A 1ULDA 2HEYF 4NJ4A 3RVHA 3ZVXA 4CEYA 1FNZA 3N36A 5FXXA 2MEV2 2GP3A 4QU2A 4AI3A 4P9WA 4K1YA 4BWOA 3DKQA 1DZRA 5LY1A 1JHJA 2OYZA 1E5RA 1MS0A 3T3YA 4IEVA 3IZOA 2WQZC 1K5MC 4KBBA 2ADEA 3LA3A 1ENQA 1LCLA 1SCSA 4BZ4A 1YI7A 1CAUA 1RUE2 4P00B 4NO4A 1TNFA 2RJKA 5C7GA 2RS52 4QHZA 1U0AA 5AC92 3HN3A 4LTAA 5LA9A 1W39A 4QPIA 3HPNA 4W4ZA 3UETA 1T2XA 1WA4A 5L9RA 1CX1A 1RVF2 2PN5A 4IEYA 4QD2A 5FP3A 3W5MA 4NHKA 1H1AA 2J7MA 1NCRA 3CJIB 4UBGA 3S30A 1VAVA 2V4AA 2X5IC 1O4YA 4Y20B 5FPLA 3KV6A 3DL3A 4FSJA 4A44A 2W08A 3H1WA 1O6UA 4MADA 3UT0A 3VB9A 1D0HA 3PJYA 3GHNA 3NJYA 4LBOA 4LKFA 5LA2A 1UL9A 5F3GA 1RHI3 2ZHLA 2VUAA 2A6WA 4DXRA 3VBRA 1NCRB 1NXD1 5EV7A 3VKFC 1RUG2 5FZ6A 4GMP0 4IXLA 3N7MA 3WW3A 4EN6B 3AYEA 5F9TA 4IERA 3M2MA 1Y7BA 2VZTA 1ZNPA 5ACA3 3WUCA 2JB8A 3VDDA 1HRI2 1ASJ2 2JG8C 2JKXA 4Q4X3 2XB6C 2OQ7A 1AR81 3T2OA 4IEUA 4AL9A 5K0UC 5J09A 3WCSA 4RD7A 1XPWA 4Q4W3 5FP8A 4I30A 2HWC2 2KD7A 3B3QE 3CHXA 4HKLA 1AR62 4YVWC 1WW5A 1JI6A 5LB6A 3WNXA 3L9JT 4CP0A 2XJVA 4DXTA 1C5HA 2O8QA 4E8CA 1Y43B 2W94A 3VDDB 5BUVA 3M8LA 1S55A 4H2AA 5CAZA 1NCQC 1T6BX 4L8QA 4YPJA 4HETA 1S0BA 5FY4A 4WVZA 1S2EA 1BVP1 1PNFA 1MQTA 4N9IA 2MNGA 2GMMA 2EXIA 1QJX3 1SACA 2XPJA 4KG0A 2VNVA 4ZZ8A 1ND2B 2PHRA 3LCPA 2RG4A 1FV2A 1BHGA 3GCWA 3HEIA 2XQRA 4D6QA 3GJAA 3ZSKA 2DWRA 2WJSA 3FHQA 2YPDA 4E4DX 1HXS1 3RPQA 3TAYA 4WVVA 3N9NA 4CCMA 2YZ4A 5FIXA 3VHPA 5IVFA 2E31A 2KM2A 4I0WB 1IS5A 2OZ6A 5FV3A 3T2PA 4GIQA 2VTFA 4YVWA 2XR4A 4AI9A 2DTYA 3JBG2 2LTNA 2NZ9A 3IWZA 3LA2A 1HRV2 3JXSA 3EXUA 1W6NB 4NAMA 1S0FA 1XRUA 2WFF1 1CESA 1WLDA 3OJBA 1OMIA 1ZZBA 4I02A 2QBXA 4CP9A 2JG8A 3PHMA 4FPHA 1WKYA 4BM8A 2Y6HA 3ACLA 2HWE1 5C71A 3KQ4B 3SNMA 3AXDA 4YYOA 4RGKA 2OQ6A 4QX3A 2QQLA 5FR3A 1KDKA 2R0FA 1FOD2 2R7EB 3PNAA 3QACA 4J25A 5FZLA 3H8OA 2KA3A 3ZFGA 3M1HA 1US2A 3RZZA 1XQNA 1FXZA 2ARCA 1GNHA 1MS8A 3UL2A 5LRSA 4DUVA 4Y1YA 4A7ZA 1PHMA 1G7YA 2Y38A 5A3WA 5C4WB 1LOGA 1DQ5A 2WUHA 3NWKA 4H7LA 1UXXX 5FOBB 4Q4X2 1GWLA 3ETQA 5H9SA 3A23A 4MYEA 3NV4A 5A33B 4WBBA 3HBKA 4JQTA 4ZU7A 1DU3D 1WMXA 2HWC3 5K4LA 3ZYPA 4EZHA 4WZCA 1BK0A 4XQWA 5CKMA 5FZKA 1WD4A 1MVEA 3WDVA 2C26A 4AAPA 4DEQA 4EWDA 1PZ7A 1CAWB 3B94A 1QOOA 2VZQA 1S0DA 4JGZB 2E63A 5FCCA 4RFRB 3C7FA 1I6XA 5FWJA 2WT1A 1TEIA 2CL2A 2W1QA 4OFGA 3ROUA 3O1RA 5DMYA 5JPMB 1GSLA 1CAWA 2WLPA 2EF6A 3UYJA 2D40A 4CU8A 1ALYA 5IFTA 1GZCA 5G05L 4FOWA 3T4VA 3MPPG 5BNNC 1V6JA 5LW9A 4JRAA 5FYYA 1TME2 3PL0A 4IEZA 3PLQA 3R4SA 1YI9A 3CLPA 2EVXA 4CUAA 2DVAA 1WGPA 1IG3A 1OA4A 1BEV3 2G19A 2MHFA 2D6KA 2J1EA 1CD3G 3GZUC 2IXLA 2QQJA 3LIGA 4MHUA 4NWVA 4ZS2A 5FLJA 4NIHA 2VMGA 5IJRA 3NRUA 4CRQA 5FXZA 1JUIA 1R64A 4ZKTB 2BFUL 1WBLA 1RC6A 5GKAC 2ZZJA 1Q43A 4KGQA 4PLMA 1LJ7A 3OGVA 3WP6A 2BWCA 4C1XA 4Q5OA 3OSDA 3OPZA 4LULA 3Q8FA 4XCBA 2XBO1 4M0NA 3BIEA 1H1IA 2VNRA 4OQ8A 4OUSA 2J1VA 5FQ0A 1AJKA 1VAMA 2Z79A 4F3JA 4GH4B 1W2UA 5A7WA 2XH6A 1O59A 2R062 3ZXLA 3MICA 4V2VA 1Q8VA 1VBE3 2WN3A 4GMP3 4AQSA 1JZ2A 3O1TA 2AZ5A 2W52A 2PAMA 1PVC2 3KHBA 3WG3A 3ETPA 3AMMA 4OI2A 1GICA 2BGPA 2ZGQA 1GZ9A 1KFXL 1VRH3 5EYYA 4HN0A 4F8AA 2N7GA 1IS3A 1R1A1 3POIA 3VZLA 4JKLA 2AR6A 4TYSA 3RG0A 1OVSA 2CWSA 4KU8A 4JX0A 1PGL1 5FZMA 1UO9A 2JEMA 3WOGA 5KXCA 1LOFA 4LHLA 1NLSA 2BERA 1VALA 1NXMA 5CFCB 2YMZA 3HQXA 4BXFA 3B7MA 1GP6A 5EPAA 4Q8KA 1SCRA 2ZAAA 2P3YA 5HCBA 1FMD3 3DF0A 2ZTNA 5JOZA 4BQXA 1QXPA 1F8VA 2UWBA 3NKTA 4CP9B 3GDBA 3POWA 4LO4B 3AZWA 4GALA 5C3QA 2IXKA 1COV1 2K2SA 3MFAA 4HN1A 4MGYE 4N90A 4XFAA 4XFIA 3TEYA 1AL22 5HI0A 4JV4A 4S2FA 1KITA 5DAPA 2AYHA 4AFDA 2AUYA 4U36A 1RIRA 4LE3A 4CCJA 2ZXQA 3I49A 2WZEA 2DUPA 2A7AA 1TZOA 5IVYA 4J6GA 1REFA 4R9AA 3M3EA 1DQ2A 5CNAA 5FJKA 4ZY9A 4AHZA 4CDWC 4XXAA 1VRH1 4EV0A 4NHLA 5F7UA 5FYIA 3KV5A 5GM0A 4A3ZA 5ISLA 1CN1A 3VKOA 1QJY3 1SBEA 4XILA 2PLV3 3U78A 4FVVA 2ETEA 2B5HA 2WRAA 1VBA1 3H8UA 1HX6A 4AVTA 3CO2A 5H9PA 2JG8B 1LGNA 1F15A 2C5DA 1KFUL 3DUIA 3WQBA 3ZIWA 4NPLA 4AFAA 3R4UA 4Y20A 5IAVA 3WVJA 3WNOA 2BP6A 4CP1A 2GC3A 4CYDA 3ZX7A 1WMEA 1UAIA 4LO7A 3ZFFA 1BMV2 2TUNA 1MZEA 3FUQA 5KHIA 5FAXA 2XL9A 1AVBA 1ZBE2 4Z82A 3HAGA 4LOTA 3OBZA 2AEYA 4EN8B 1UPIA 5EJZB 2VZVA 3KGZA 3CNAA 1OD3A 3ZXJA 4F7ZA 1DGWA 2NM1A 4Y22A 1IHMA 1SEFA 1VB2A 2WNEA 2NP0A 1FOD3 4N43B 1U12A 4XDOA 3CJIA 3ZOIA 4XBLA 1OKOA 2XVLA 2ZJCA 1Z7S1 3VL9A 2Y6JA 3OY8A 4EZ4A 4WVMB 1YO8A 4DY5A 5KBFA 4LBQB 5J37A 3NNFA 2RS31 3URFA 2XUMA 5FPVA 3Q8EA 2R30A 3B93A 1FPN1 1N47A 4PLNA 5FMBA 5GLWA 3RYRA 2LALA 4DXSA 3OF1A 5M0TA 4XF1A 3ACFA 2GNTA 5FUPA 1CONA 3POYA 3DXTA 5EQUA 1ULFA 3WCRA 1F31A 4RR3C 3I2HA 1ND2A 2WQ4A 2YU1A 4BQ5A 2WL1A 4MXWA 2X05A 4CEWC 3K4AA 4O9EA 1J3RA 1XE0A 2HBUA 3LWCA 3PUSA 4LK6A 4X6QB 4XDPA 2VMHA 5FY0A 5I0TA 1DZTA 3DV8A 3LDKA 5EWSA 2ORXA 2BGCA 2IFWA 4IGOA 4YFWA 5LRRA 3WF4A 3MIDA 5IVVA 1OC1A 4LORA 4DY3A 1RHI1 3V0BA 3J7MA 1K12A 1DQ6A 1U5YA 3I4IA 3USUB 1RUOA 4MX3A 3VBUB 1IQDC 2BPA2 1YUDA 1X8MA 2P37A 2WQ8A
chains in the Genus database with same CATH topology
3L2HA 4YRDA 5JLVA 3FUOA 5JIUA 3I59A 4AEDA 5FREA 2X53S 3KD4A 4HMZA 2YROA 1RUG1 3VBHC 4PBOA 2EXKA 5DUWA 3ZSLA 2W68A 1VR3A 2QNKA 2MPFA 3AYAA 4BHPA 1I3HA 2ZA9A 3NL1A 1GBGA 4DMIA 1YCIA 4Y1VA 3S7EA 2I2SA 1POV3 3H7JA 3VZMA 1PIV3 2ZZQA 2DVGA 1AR61 4YVWB 3WUDA 3QD6A 4Z8BA 5GLTA 5BNOC 1NE6A 1LENA 3KT4A 4RR3A 1TME3 2VY0A 4ITCA 1HDKA 1ULEA 3KT7A 3IDCB 3VBSB 5L36A 1DBNA 2PLV2 2GU9A 4Q2FA 2G9FA 4RR3B 1KDMA 5K7PA 1C1FA 1R082 2A3WA 1MEC1 4JGYA 1POV0 1AX2A 2R1DA 3ZO0B 4K8FA 5HXVA 4E2SA 4EN0A 2P3KA 3MW3A 5JSPA 2I07B 3BIWE 5IK8A 3I2DA 2R16A 5TSWA 2ZGSA 1YLLA 3RRDA 1F5JA 4XQ4A 3U0ZA 5KHKA 3ECQA 3AP6A 1A8MA 4CEWB 4BMBA 1V6IA 4O9GA 3ST7A 5JSRA 5IK7A 1ND3C 1UX6A 3IDBB 3AP5A 1V9U1 2RS11 2UWAA 3ZN6A 3ZSEA 5CBLA 1VB4A 3MGUA 1GLHA 1DIWA 2OPKA 3M70A 1X50A 2WNUC 1JUHA 2A6VA 3ZXAC 3NVCA 2B39A 2HWF2 4XFHA 5GZCA 2EXJA 1EPWA 1V6OA 2EAAA 1WW6A 4Q27A 5DG1A 3NW4A 1TE1B 4N43A 1QQP2 2QVSB 1OOPA 2BVBA 2GNDA 4HLTA 1LULA 4CDQB 4FPKA 1LTEA 1NE4A 3EJKA 5IK5A 2QFEA 3WQ7A 1G9DA 1C5IA 3B02A 3BODA 1WW4A 2Y26A 2WS92 1N3OA 3JB8A 1NY71 2PHFA 2VULA 3J9SA 5JMCA 2QE3A 2BWAA 2CY6A 4Z07A 3UKNA 3PMSA 5CFCC 3AZZA 2DVDA 1EV12 4RA0A 1COV3 4AVAA 2X29A 3INAA 2D6OX 4XDQA 1LHVA 3GBFA 3ELNA 2ZGKA 2FZ1A 2OUJA 3TB0A 4QMAA 4G3YC 3VKLA 1DFQA 4KG8A 2RS53 5CFDA 4IV1C 4AE2A 1MR5A 1PIV2 2H6BA 3MF9A 1ENSA 1R093 2ZGNA 3IT8A 4W6XA 3B01A 2XBO2 3K48A 4Q4V1 1YJKA 1LOEA 2WA4A 4QPIC 4PIZA 1PO21 1Y9QA 3LSEA 4EN7B 3S7IA 3THPA 3VLBB 4QM8A 2HWE2 4HPKB 2A71A 3ZFGC 2K9ZA 2ZX4A 4COZA 1FOD1 2E53A 3OD4A 1JH5A 4BPZA 1VIWB 1PVC1 2OA2A 5JIAA 3JD72 1AYN3 2W0XA 3M7AA 5H9RA 5DUXA 2TNFA 4YM0A 4Q4X1 4C91A 4B7KA 4MSVA 5FPZA 3ZFGB 4JDMA 5LEJA 4XTMA 1HXS3 1V6NA 2CTVA 4BLIA 1I1EA 1NA1B 2YY1A 5KXDA 3ZXGA 4YLZA 3KGLA 4OI0A 3PVBB 4XMAA 2B7YA 4MGKE 2I74A 4BQ1A 5T5LA 2DCTA 4N53A 2GNBA 3R05A 1DQ0A 2XLAA 1UMZA 3O7OA 5FLIA 1NA1A 3VUOA 3P3PA 5JVVA 2MEV3 5BYNA 1UW8A 1I9RA 3NJZA 4Y5Z0 4S2HA 5BV6A 4CEYB 5IUQA 3IKWA 1JN2P 4F83A 1J1LA 1AYM2 4KL1A 4RS5B 4YM2A 2EIGA 1REDA 1FNYA 1APNA 3HIFA 2E6VA 2AGSA 1PVC3 2RR13 3V64A 2PHWA 4Y22B 2VU9A 4PDWC 4BLJA 4L2NA 3MIHA 1Q8SA 3OGJA 1NQJA 4XYXA 2R071 3FLPA 4RS5A 1VBA2 5EJ3A 3OY8B 2JKBA 1N1VA 5KHJA 5GZGA 4QPIB 3B9IA 3BALA 2D97A 2WFPA 4P9JA 4LUMA 3NSTA 1N3QA 1MZ6A 1ZZ9A 2QZ3A 3VBFC 5L7OA 1PGW2 3ILFA 5BY5A 1XNDA 3IM0A 2BNOA 4A7YA 1M06G 1V6KA 4AF9A 3T1LA 4H3WA 4W6YA 1ULGA 1ASJ1 3FJSA 3QCWA 1G6NA 3S0MA 4JDNA 1W6MA 4LBKA 3U4XA 1PO12 4B3NA 3VBFA 5L7OC 5CFDC 3AYCA 2Z2SB 1CPMA 1LB2A 2BEOA 1YWKA 2UWCA 2DUOA 1J1TA 1FPN3 1NYWA 2VW0A 4FAHA 3FBYA 1AXZA 4P9GA 4BMEA 5T54A 1OQ1A 2CNAA 5HCAA 2DCZA 1PGL2 3M4FA 1BBT1 4M00A 4FAGA 5JR7B 3AP9A 4AEDB 4C90A 1W6QA 4PDWA 2EAKA 1JBCA 3JB4C 5E89A 4YG6A 1CAVB 1O3TA 1RUF3 4Y1XA 2XBO3 2XJUA 3ZYGA 3KM5A 2VOXA 2IXIA 1RL3A 4WM8B 3OCPA 5L73A 2DCJA 3UJOA 1Q8PA 4HPKA 2VW2A 2IWGB 5GZFA 5AFEA 1WCSA 1D2SA 2HJIA 4AHWA 3E5XA 2CAUA 3O0VA 2RS51 3VHOA 4YW2A 2YYOA 1MQTC 4PQ9A 1IKQA 2B46X 1FYUA 1Z7S3 4PBPA 4OHZA 5BNPB 1LEDA 1MS4A 2QQPA 3OBRA 3ATGA 4WV8A 4A3XA 3IPVA 4X8NA 3T1MA 4AEDC 4Z92B 2NPIA 5CVRA 2RS33 4LO5B 1DF0A 3AKPA 3I7DA 3N3HA 4Q1RA 1GQGA 4P9XA 1NCRC 4QT6A 2R6QA 3H1YA 4RSUA 3FLTA 4XETA 2DU0A 3APBA 3WDYA 2IC1A 3RI9A 4GB32 1QU0A 4KQ7A 2ZHMA 3AZYA 1LU2A 3AZVA 3WT3A 1LR5A 3A4UA 4LO8A 5C4WC 1FT9A 4R4ZA 3ILRA 4URTA 1Z7S2 2GZWA 1W6PB 2X5IA 3SITA 4YW5A 3VZNA 4CDUA 1MACA 2PA7A 4IEOA 3USSA 3UKTA 4DB5A 1UIKA 3ES1A 4M3CB 1OLRA 4ZU5A 1MEC2 5KXBA 4AEMA 1AYN2 1A3KA 1LOCA 2WT2A 2ZMKA 3LZZA 3FC0A 3SH4A 1O3SA 3FLRA 2RR11 4QPGB 1RITA 2CWMA 1PK6C 2XWJB 1PM7A 4LBQA 3TYJA 1BCXA 4ATFA 4M3CA 1SLBA 2WFF3 3FHIB 4D7YA 5ACA2 1OOPB 4FXGB 1LGCA 5FQ0B 2D43A 4AXOA 3E5QA 1V00A 1ZRDA 4XF4A 2CV6A 4Q4Y3 2G4IA 5BNPC 1HRV1 2PYTA 2WFF2 2XG3A 1SLIA 4CDQC 3FE5A 1VAKA 2PHXA 4OHXA 2X8KA 1IPKA 3PVEA 1QH7A 1BQPA 5T5PA 5J96B 4Q0SA 1LGBA 3VHRA 1AR83 1PK6A 4XPVA 1DGLA 5BNQA 2JXAA 1PNGA 4CZSA 2WA3A 5C9AC 4NN0A 1XNCA 4LR4A 1H2NA 1R1A2 4UW4A 1ND3A 2D5FA 1VBA3 2ZAHA 2EXHA 5GZEA 4AI8A 2RMU2 2WNVB 4E9KA 3J8F3 4LE4A 1QY4A 4AGGA 3V65A 3AP4A 2IFRA 5T5OA 4E2GA 1V6LA 2AENA 1HKDA 2QCSB 4Y24A 1RUC2 1IS6A 5D8AC 1UF2C 2ZX0A 2ERFA 3OYWA 1RUI3 5JOXA 3SCFA 4L9BA 4NOTA 3RWNA 1J59A 2DV9A 1BZWA 3ILNA 2IXCA 3NV1A 5B2GB 2PELA 2DFCA 1R091 2LUWA 4YGBA 3U11A 2HWF3 4Q4Y1 4C0HA 4YW3A 1B35C 2DVFA 3OGGA 2YDEA 1DHKB 2NMOA 2SBAA 5E8AA 1PIV1 1CR7A 4Q4V2 2ZOEB 1VBE2 4K7JA 4ISRA 1PO22 1QOSA 1DQ1A 1GYKA 3JD73 1WMFA 4QQ2A 2YHJA 3WV6A 2VQAA 1VBD3 4QQPA 3ZFEA 2VOWA 1ZBE1 1FV3A 1RUG3 3UK9A 3MEPA 3MIBA 4WM8C 1QDCA 4XW3A 2DTWA 4XJUA 5AFBA 3VKMA 1A6CA 5IK4A 2B8MA 4NHMA 5E16A 3VBHA 1B35A 1KXGA 1D4M3 4JTNA 4ATEA 4XFGA 1BEV2 4LHNA 3WDXA 1GV9A 3N7JA 4L99A 3WG2A 1S0CA 4MXWB 2F4PA 2BQPA 4AG4A 1C4RA 1N1YA 3M3OA 3WQ0A 1PVXA 3AFGA 1D4M2 1YHFA 1TQ5A 1O7FA 1YNAA 1RUE3 5KHHA 1HQLA 4RFT0 2Z5WA 5FOJB 1VBB2 3JQWA 1ZA4A 1C8M3 2R1BA 3MYXA 4LLOA 3ZPYA 4FPOB 4FCAA 3RJRA 4DRRA 1EPZA 2D98A 1RGSA 4OVEA 4FPLA 5GALA 4XQDA 1FI2A 2H6CA 1G8WA 2D6NA 4AHYA 2CGOA 2R072 4HVOA 4KWLA 1XE8A 2JG9A 3H3UA 1NOVA 4XF0A 4GA9A 3D82A 4DS0A 1HV0A 1TMF2 3AM2A 2KXLA 3N4MA 5LK7B 1RUH3 1IZ3A 1AUYA 4YW1A 4AGVA 4XJZA 5CFCA 3CJIC 1OSGA 5JCTA 4HSJA 4MLOA 1PGW1 2D3SA 4LBJA 4XE9A 5GJ6A 1MEC3 2Q4SA 4GWMA 4HSLA 2XJPA 1AR91 5FO8B 4Q1PA 1RUD3 1OD5A 4Q0QA 3SHRA 2NQYA 5GLZA 4XBQA 1U5XA 1UCXA 1UU5A 2JENA 3RS6A 1PK6B 4AQ2A 1SBFA 5C9AA 5DZEA 5KHGA 4HT1T 1FAYA 1ZZ8A 1UN1A 1S2KA 4QXKA 5DZFA 1UPSA 1OQDA 2WZR1 3H1MA 3JD71 1RINA 4MUVA 4HFSA 1G9FA 3KSCA 4YVSC 3X29B 4AEKA 5JPNB 3AZXA 4Q4W2 2HWB2 3ZXFA 2RJLA 3ZSJA 4JGYB 2WNVA 3MLKA 1WCDJ 3JUUA 2FQPA 1ZM1A 4R8HA 1OPMA 4C0BA 5K0UA 1DYKA 3I54A 4Y1ZA 2RS32 4RGGA 2DVBA 5FO7B 5I8YA 1VBB3 1R1A3 5I93A 3GF6A 2AH2A 1QF3A 4H7MA 2Q5TA 1SDWA 4YGCA 2HWD2 3VL8A 1U5ZA 4AW7A 4LBNA 4JTOA 3WP4A 2VNOA 1YFWA 3JQXA 2D3PA 1LHUA 2HKXA 4SBVA 1Y3TA 2CGNA 2ZKLA 2ZX3A 3BB6A 4YM3A 4NWWA 1AR63 1FX5A 4COVA 4N53B 2PTMA 5FMOS 2VVFA 3VN4A 2C9AA 1TNRA 1Q56A 2GMPA 3HT1A 2JG9C 2P2KA 3K51A 3WXPA 1IQAA 4BIFA 2A6YA 4XJ9A 1NCQB 4GMP1 1UU4A 1HQNA 2QUOA 1LHNA 4B4QA 1OFNA 4G9SB 4OULA 2H0BA 1AR93 1B09A 1Z0HA 3FZ3A 3KZ4C 1CX4A 3ZMNA 1KS5A 1O4ZA 1URXA 3D4KA 5SV8A 3WG1A 2ZHKA 4NPRA 1FATA 1NZCA 3JCIA 2FHRA 4DOUA 4HANA 2ZX1A 3WW1A 4BOWA 3O5SA 4K6BA 3AX4A 3GZTB 1ENXA 1SMVA 1QQP1 1XYNA 1WLWA 4FOQA 1N3PA 4XIOA 3I8TA 1GKBA 4YG3A 1AZDA 4LBQD 2ZS6B 1W0PA 2IZWA 2A6XA 4E4SA 1IGOA 4AFBA 4AVVA 1O5LA 1HLCA 1EY2A 1QJY1 2HWD3 2WS91 3SCHA 1NY72 1W0OA 3B5LB 3BOPA 3FMGA 4YZ1A 4KWKA 2Y0IA 4OLLA 3JZVA 1Z78A 1GQHA 5F6LB 4CDWA 2QJVA 5CG9A 5FTTC 1LOBA 2E7TA 4L97A 2V5YA 3H7YA 3GBGA 3A0KA 3B69A 4CDXB 2YXSA 1Q8OA 5ACA1 3AKTA 2OW4A 1QXRA 4XTPA 1MS1A 2PQQA 3WDTA 4OI4A 1OPOA 2JJ6A 3WHUA 5FPXA 2ZGLA 1JTZX 3VDDC 3VKNA 4MZUA 2DURA 4CTEA 3RSJA 3O0XA 4FPGA 5JDBA 5CFDB 3M3IA 1QHDA 1AF9A 1F2NA 2OUHA 2A70A 3MIEA 4AQ6A 3ZFEB 3D8CA 3KMHA 3GHMA 1V9U2 2RS12 1SFYA 3OYWB 3NAPC 2D93A 4HVQA 1YRZA 1VBD1 4KU7A 4JGYC 4OHVA 4OHWA 3WHTA 5ABJC 1VBC2 1RUH2 1JHNA 3G6JB 4FPCA 4AQTA 3PMEA 1JYIA 2VECA 3U07A 5KWRA 2VMIA 2R041 5J3UA 3QOPA 2RMU1 4FOYA 1AL0G 1VP6A 1X7NA 5DXDA 3RJ2X 2QKDA 4QQHA 1BJQA 1W6OB 2VVDA 1UKRA 3HMYA 1HRI3 2BYVE 3ZFFB 1CAUB 1RUI1 4RQPA 3VV1A 1RTVA 4QX5A 1CQ9A 4YW4A 5A3LA 1AL23 4PJYA 1PZ9A 3RNSA 5CIRA 3CEWA 1CIWA 3VZJA 4J1WA 3AJYA 4FOVA 2GN3A 2UY8A 1FMD2 2Q30A 4AI0A 2R49A 1DZQA 1QJU1 1R092 1AYN1 5JSOA 3NAPB 4IV3C 2X5IB 3R6SA 4L11A 2D6MA 4S2DA 2A3XA 4QQOA 1B35B 3UKVA 4WZFA 3KQRA 4XFCA 1D2QA 5BNNA 3B00A 4ZXKA 1EV11 4M0HA 3E6DA 1QJX1 4E4ZA 1YFUA 3LOBA 1SLLA 2LM3A 1WUVA 3KLSA 4Y4YA 4PLOA 1DYPA 1KJRA 5FLHA 1KS4A 3VBFB 4PIXA 1EP0A 3LKJA 5FRAA 1CGPA 2XJTA 3N7KA 4D3WA 5HBAA 1U5IA 5F1RA 4K20A 2P34A 3KB5A 4QGLA 3JBG3 1JXNA 5KC5A 4XJ8A 3IIAA 4I09A 1Q5OA 4UW6A 1HQWA 1RJ7A 2WIIB 1H30A 1OA3A 3MLJA 1AHSA 1QWRA 1XYOA 1H2LA 2BVVA 1I5ZA 2NYYA 3NV3A 3QBQA 4CDWB 1BEV1 4AFMA 2Q0AA 5DDJ1 3WP3A 2GDFA 1YXWA 3B9CA 4BE3A 4KNCA 4KWJA 1X8MA 2GH8A 4IV1B 5JI9A 2ZMNA 1ZZCA 4OUMA 1DGRN 4P14A 1D4M1 4XF3A 4A2UA 1XE7A 2Y0OA 3FWEA 3SISA 1RUD2 4AHXA 3M3CA 4K3UA 4YZ3A 5ABJA 1S0JA 3P3NA 5C8CB 2D6PA 4XOGA 1WLTA 1O5UA 3HR9A 1QMJA 4DZGA 1MVQA 3LSDA 4N7UA 2D7FA 1IKPA 1KD7A 2R073 3O12A 2VG9A 3D0SA 1EAH1 2DCKA 3IPVB 1OHFA 4S2GA 5H9QA 3SCGA 3SXWA 3QLQA 1C8M2 1AR73 2A75A 2IXHA 3EBRA 4FTEA 4E2QA 2DYCA 2WNUA 3BPZA 1LODA 5A32B 3HT2A 4DFSA 4RHV1 3GNEA 3LOIA 1PO13 2Q1ZB 4ONUA 3GYDA 1NCQA 2OZJA 1AR92 4Z2WA 2YUEA 2RHPA 4N43C 5EFUA 2Z42A 1H8TC 4AVBA 4HKWA 1MZ5A 2XL7A 3TBDA 2UURA 2SLIA 1RMU2 3OBTA 2ZGMA 4CP2A 4L92A 4K9SA 4GB31 2XHKA 2V09A 4IETA 4WVMA 3ZMOA 1AJOA 1JOJA 4A7KA 2C0ZA 3V56A 4XIKA 2GC0A 3J8F1 3WP5A 1WMDA 5KXEA 3HN1A 1ULCA 2D5HA 4YNIA 3ZXEA 2CYFA 1F9KA 4AVSA 4ORFA 3RMXA 4XFBA 2ZCWA 3VBRB 3BCWA 2RR12 3U10A 1O3RA 4U2AA 4QQLA 2ZPXA 4D69A 5C4WB 2R043 2YV8A 1EAH3 2P3IA 4LBLA 3KCYA 5EXOA 2OVUA 3UJQA 1AR71 3SLIA 3MPBA 1AXYA 1G86A 4DNYA 2YGLA 1L3JA 2ZMLA 2FMDA 3MF6A 2Z69A 2VXRA 3CF6E 2PAEA 4OHYA 2DU1A 1YJLA 2GC2A 4IL7A 4P9YA 3FFQA 2HYKA 4MH0E 4FXKB 4QPGC 1ZRRA 4CEYC 1RUNA 3SMHA 2EA7A 2JECA 1V6MA 1PGSA 2XVGA 3ZN5A 2P17A 3IN9A 1PZ8A 5I8TA 3MI8A 4CDXC 3ZYJB 5L7OB 1WD3A 2ET7A 2GSYA 2PFWA 3AMHA 3POSA 4HL0A 2VOVA 4M3CE 3VBOB 1ZBA1 4JCKA 1EYBA 2ZKNA 4COYA 5D8AB 4OI1A 3QH7A 1IOAA 1ZZ7A 1HRI1 1OI6A 3I59B 2VOKA 1CJPA 3MIGA 1G9CA 3AK0A 2WSVA 4SLIA 2BBVA 3TNPB 1IPJA 4DRVA 2A6ZA 1H4HA 3RDIA 2WNVC 4LBMA 4LO6B 4Z1VA 2ZGTA 5FFOC 4D7SA 4TLFA 4YARA 1WCKA 3PTYA 2A3YA 1W6OA 2R0HA 4BIOA 1NG0A 1RVF3 1QJZA 4Q4W1 4PF5A 2WLQA 4RQPB 2FMYA 4Q0VA 4AI1A 4META 1RUF2 3NO8A 2NLRA 1RUC1 5JZGC 2GH2A 5DUUA 3TN92 3QH6A 4I0AA 4JRLA 4RL7A 4H55A 3ZSMA 3VBOC 2NN8A 3AFKA 4YGEA 4LHKA 1A78A 1RJ8A 2B45X 2MEV1 3C3VA 5FO9B 4YFZA 4CDUC 4FTSA 1REEA 4Q4Y2 3PJQA 1KRIA 4BCUA 3LAGA 1H1MA 5GZDA 3BTAA 4FQZA 1QKQA 1ONAA 4IEWA 4LLFA 4R4XA 4BH9A 1S0EA 2UY9A 3AMPA 1LECA 2FZ2A 4RS5C 1RUJ2 1QH6A 2WNUB 1SFNA 4B8EA 1D4VB 2G9GA 1W6PA 1SQ4A 1QNYA 5BNOB 4FPEA 1XU1A 3VBHB 1S1AA 5DG2A 1PO23 1OKQA 1UD1A 1DG6A 2E9QA 4Q4V3 4WM7C 4W65A 4K21A 1ZVFA 5J98B 5T50A 5BNOA 1VBC1 3WDUA 4FQ4A 1LU1A 3MW4A 1N1TA 4GB33 2R042 1J3PA 3KCCA 3OTFA 4N53C 1YYNA 5BXXA 5A3MA 1OOPC 2DCYA 1X8EA 2NMNA 2R063 1X36A 3GZAA 4YM1A 3GBWA 3ZFFC 1RUI2 2XKOA 3ENRA 3JU9A 4NR1A 4B4RA 1RUC3 1MQTB 2E7AA 3RMYA 1RUJ3 4HVRA 1IS4A 4G4FA 4AVCA 5C8WA 4YZ2A 5CADA 4V1PA 1W6QB 1GNZA 2YGMA 3GALA 1POV1 1H8TB 1QXJA 3E97A 1W6MB 2QDRA 1VBB1 3MLLA 4QPGA 3MZHA 2VH9A 2GALA 3IDEA 4Q29A 3VZKA 4N7IA 1ENRA 2ZGRA 1GZWA 4RQPC 1X82A 5E1RA 1Q8QA 1W6NA 2B9UA 1HXS2 1T6GC 4AK3A 1BKZA 3TN93 4TSVA 1LKNA 1TMF1 2C1FA 2A73B 2XJQA 1ZBE3 4ASLA 1J3QA 1CAXA 3M3QA 1H0BA 5LK5A 2JE9A 1BXHA 1VBE1 4XXPA 2CAVA 2DUQA 2I45A 4P9LA 3VZOA 2BW8A 2D6LX 3DKWA 1X33A 5DDJ3 1YFXA 1C28A 1XNBA 2P3JA 4K40A 3C2UA 5D8AA 3KCXA 4MGIE 5T52A 4I01A 5LEKA 1UIJA 3DPRC 3NV2A 4FBFA 1Q3EA 2XJSA 3PVNA 1DGWX 1SLAA 4H14A 1ND3B 3FFZA 2BUKA 3VGIA 4XEZA 1WBFA 2HWB1 4LA2A 2FBEA 5I91A 1LHWA 2F6BA 1V9U3 2RS13 4AEJA 4Y26A 4XBNA 4K1ZA 3E6CC 4FP2A 3R0RA 4HK8A 1VBC3 2VW1A 4ZU4A 5K8SA 1DQ4A 1RUD1 2ZBJA 3O0WA 4GXLA 3WLUA 3VBSA 2HWD1 4JC1A 2AREA 2PHUA 1BYHA 4X8PA 2EALA 5AVAA 5I8SA 5HCFA 1HRV3 4LNVA 4YVSA 3ASIA 2D44A 2ARBA 4IV3A 1EAH2 2ZX2A 1FMD1 4PCRA 3J26N 4I3GA 3ZXKA 1G9BA 3EO6A 5SV5A 1TME1 1JW6A 5AC91 1NQDA 1XXNA 3ZYIB 4BYYA 3VHNA 2ZABA 5IT6A 3THTA 5C8CC 1RVF1 1QDOA 3ZFEC 4I3PA 4R9CA 3VBRC 4FPFA 1ZZ6A 1QJX2 2JX9A 2BNNA 2QZ2A 4LT5A 1PMIA 4QPYA 2DF7A 4Q0UA 4WM7A 2BNMA 4B7EA 1RMU3 1GANA 5C4WA 1XU2A 1LOFC 1DDLA 3AMNA 2HEVF 3OD0A 2D3RA 4RHV3 4GKYA 4UXAA 3WR0A 4IEXA 2A5ZA 2ZGOA 2GAUA 4GH4C 3E6BA 4UW3A 4R52A 1AR82 2PAKA 2R061 3RYPA 3LA7A 5DZGA 2YPJA 2HWC1 4IV1A 2JDZA 3USUA 2WZR2 1MS3A 3WW4A 1HIXA 3V0BB 1C1LA 4I0BA 2TEPA 4B4PA 1DGRA 1JYCA 5DDJ2 2TBVA 3R4DB 3CJXA 2O1QA 1CAVA 3N35A 3DPRB 3AP7A 4DXZA 3WG4A 1CVNA 1QJY2 5ABJB 3VBOA 3IMNA 4HZFA 1FPN2 1H2MA 4Q0PA 3ZXDA 1LHOA 2JE7A 2RM21 1G9AA 2ARXA 4JDOA 3AMQA 4YSFA 1COV2 3KT1A 4PDWB 1GZWB 5T55A 4COUA 3JBG1 5CB7A 3PVOA 2VQ0A 2H0VA 4YG0A 1RUE1 2ENRA 4XHBA 4R9DA 5T3NA 5GLVA 1EV13 1HW5A 4WM8A 5DUVA 1C8M1 3WQ1A 1VRH2 3ES4A 1CAXB 1XYPA 1MZFA 3DGTA 2VVEA 1ZBA2 5A33A 1H9PA 4DQAA 4YZ5A 3MDPA 1HV1A 1F5FA 2WZPP 2VUJA 1VBD2 1OFSA 4DPNA 1BMV1 3Q9OA 1RUH1 1QQP3 4JGZA 2ILMA 2PHTA 2BTVC 4QM9A 2XLFA 1ZBA3 4XMIA 1M4WA 3V0AA 4IESA 2WT0A 3HWJA 4JAAA 4D94A 1XNKA 1AYM3 4EJRA 1ZRCA 2E7QA 4CEWA 3N7LA 3W59A 4LUKA 4JQRA 1C8NA 1ND2C 3D0JA 4R9BA 5I0RA 1S2BA 3V0AB 2WINB 1YFYA 2ATFA 2PHDA 2PLV1 5J36A 4GQ7A 4MVTA 5EZWA 1SLCA 3SH3A 4XJAA 4WVWA 1YIPA 3ZIXA 2ZGUA 1QJU2 1OQEA 3LGRA 4JVAA 4CDUB 3WX5A 2B42B 3L2YA 1UZYA 3WW2A 1E57A 5CA6A 2Q8OA 1KQRA 2VGDA 2RMU3 5CU1A 3AB0A 3VBUA 2HWE3 2R32A 3MIFA 5C33A 3WD5A 3DN7A 4CDQA 2JD4A 4ES8A 4EN9B 1RHI2 3EQEA 1K5MB 4IQPA 3TNQA 1H8TA 2O0OA 5J7MA 5JI7A 4WM7B 2GN7A 4P9IA 2WSUA 2DFBA 3AJZA 3D6EA 5EYXA 2XGXA 2UYAA 4RGAA 1AXKA 5K9YA 1N1SA 4XFFA 1GR3A 1LOAA 1UU6A 3A0NA 4CDXA 4Q26A 5F6KA 3ZYRA 1UZZA 4MGZE 4I2OA 3RQ0A 3LB9A 4HKOA 1C57A 4HBNA 1MS5A 1ZREA 4XHXA 2XKPA 4YZ4A 1H4GA 4LEJA 4AGRA 3AKQA 4AFCA 2IXJA 3S6PA 3CL1A 1GFF2 5FMOL 2WS93 1AX0A 4E27A 3D5OA 1BBT3 3HD8B 3H50A 3WZ1A 4W6WA