4HK8A

Crystal structures of mutant endo- -1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVQGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 52
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hk8A00
3WP6A 3B5LB 1REEA 3LGRA 1OLRA 2BWCA 1ENXA 1XNKA 3WP3A 1BVVA 4NPRA 4HK9A 1XNBA 3WP5A 2JICA 2B45X 3ZSEA 3VHNA 2D97A 4HKWA 3VL8A 1XYNA 1XNCA 1H4HA 2B42B 3MFCA 3VHPA 1H4GA 3VL9A 3AKTA 4XPVA 3VZMA 2F6BA 2DCYA 2B46X 2VULA 3RI8A 1F5JA 3WP4A 3WR0A 3AMPA 3AMHA 2DCZA 1KS5A 1TE1B 3AKRA 3B7MA 3WQ1A 4S2FA 3AKSA 1OLQA 1PVXA 2BW8A 2VUJA 1UKRA 1UU4A 2NLRA 4HKLA 1REFA 4S2HA 1XNDA 3AKQA 3VLBB 3WX5A 3WT3A 4XQ4A 3AMMA 1M4WA 3MF6A 1REDA 1UU5A 3WY6A 3VZJA 2QZ3A 2BVVA 1AXKA 2Z79A 1H1AA 3RI9A 4HK8A 3EXUA 1QH7A 1QH6A 3M4FA 2NQYA 1C5IA 1HV1A 2BWAA 1NLRA 1BCXA 3LB9A 3AMQA 3AKPA 1IGOA 2DCJA 1XXNA 3VZOA 1OA3A 4XQDA 2QZ2A 2VGDA 2DFCA 4XQWA 1HV0A 3VZNA 3VZKA 1YNAA 1KS4A 4S2GA 3WQ0A 1W2UA 1T6GC 1XYOA 3MF9A 2JENA 2D98A 3VGIA 1UU6A 4H7MA 4IXLA 2C1FA 3HD8B 3WXPA 5EJ3A 3O7OA 4S2DA 5K9YA 1H0BA 1XYPA 1H8VA 3MFAA 1C5HA 2JEMA 4HKOA 3VHOA 1HIXA 5K7PA 2VG9A 1BK1A 5HXVA 3VZLA 3WQ7A 2DFBA 1OA4A 2DCKA 1OA2A 3AMNA
chains in the Genus database with same CATH superfamily
1IPSA 1DCSA 4XBQA 1W6OB 3CKHA 1O8SA 1S0EA 3I2HA 2C9AA 2OVUA 4FFGA 3RYKA 4MOAA 4AAXA 3N4MA 1FNZA 1UOFA 2VBPA 1WKYA 2DTYA 1BBT3 4MSVA 1JUIA 4NAOA 5E16A 3AL6A 4PLOA 2DBIA 4XFHA 1PM7A 2XUEA 3WP5A 3WZ1A 5EIYB 1HRV3 1FX5A 4XFIA 2WYSA 1QU0A 4GWIA 1LU2A 3ZSEA 2RS51 2VVEA 3I2JA 3G7DA 3H3ZA 1N1VA 4Q4X3 3POYA 1XNCA 1STMA 5DUVA 5FZLA 1SQ4A 1POV1 4HN0A 2VOVA 4OZOA 3AP6A 1WCDJ 2YYOA 5CVRA 1OUSA 2PLV1 2JKBA 2JIGA 2XJTA 4UAPA 1NQDA 4L97A 2BP6A 1ULDA 2DUOA 2J1UA 2XLFA 4XTPA 5FZKA 1AR71 2BYVE 4MUVA 2AENA 2WA4A 5FYIA 1G9AA 1LOGA 5DG1A 1GNHA 3MLLA 3MIDA 3O1VA 4IW3A 5DZEA 3BKZA 2VNVA 2ZZJA 4AEJA 1HRV1 1W06A 2VY0A 4W65A 1W6MB 1QQP3 2QVSB 4BHPA 5KBFA 3PIGA 2AREA 3ZR6A 5FP9A 2HWC2 4FPEA 1LJ7A 1UZ0A 1QH7A 2JWPA 3I49A 5F2WA 4L0PA 4ZZ8A 1NCQA 3B9CA 3K4AA 4K3UA 3ZMOA 5BNOB 4FSJA 5A7OA 1H30A 2QQLA 1PX4A 5HV4A 3CQOA 3I3EA 5HCAA 1G8WA 5D2AA 1ZYBA 5IT6A 1RTVA 2QUOA 5ANQA 1CPMA 3OBRA 4V2VA 4UFHA 5J7MA 1Q8OA 2YBKA 1DHKB 2Y6FA 2WL1A 4RR3C 1VBC3 3LDBA 2ZHMA 5FZOA 4UF0B 2XHKA 3CF6E 3RZMA 1XC6A 3HJRA 2VXRA 4YGBA 4DUXA 1PK6A 1LGNA 5I0DA 1D4M2 4QKFA 1RUG1 1W39A 2HLEA 3EB7A 3AYEA 2R061 3OBAA 4S2GA 1UO9A 3WQ0A 1CGPA 3TRSB 3IDBB 2WN3A 2JENA 2ZX0A 1S0DA 1W0OA 4I0AA 3URFA 1AX1A 4A3XA 4I3PA 5CG9A 4K1YA 3NW4A 3PVNA 5A3TA 3NRUA 3OYWA 3KF5A 3T4HB 1DFQA 2XMLA 1JOJA 4NWWA 2A71A 3AZXA 2RS12 3OJBA 4N9HA 3H3LA 5LBCA 3SQOA 3LPGA 5DAQA 1S0CA 1BK0A 1AR83 1WD3A 1YJKA 3M3IA 4IE0A 2BERA 5A1LA 3IPVA 4K20A 4E8DA 3O1TA 1KDKA 2YU2A 5CFCB 1BEV2 2MEV3 3MW4A 1OD3A 4LXLA 1MR5A 4IE6A 1IG3A 3QH7A 1UF2C 1OOPC 4P9JA 1ULOA 4W6WA 1SBFA 1F15A 5EQUA 2ET1A 4EN8B 1PO11 2A3WA 3TYJA 2OQ6A 4NPMA 4UFMA 3ORJA 3UJOA 3VBRC 3AP9A 1JI6A 4LNVA 1KJLA 4H7LA 4AFMA 1CONA 4OLLA 4FFIA 1JH5A 2QDNA 4BM8A 4FTEA 2ZZQA 2XXZA 3GHNA 4AW7A 3N35A 3O1UA 1BVP1 3Q8BA 3VKMA 4M3CB 4BJ0A 1OH4A 4XFAA 1CAXB 3TN93 2PQQA 2ZAAA 2NMNA 2QTWB 2PHDA 2TNFA 4KG0A 5HCHA 3WUCA 5ACA3 4XFBA 3JXSA 3QBQA 4C0BA 5A33B 4O7XA 3HR9A 5ABJB 4YVSC 2WS91 4BQ4A 1HKDA 1YFYA 2MEV1 1U5ZA 4LKDA 3ZSMA 4JKMA 4YFZA 2OZ6A 5C5UA 2GU9A 5AC91 2J1TA 1FOD3 1GQHA 2W92A 4OMDA 3RI8A 2ZMLA 5F6KA 1H8TA 2CY6A 2Q1FA 4META 5FMOS 3T2OA 3U75A 2XUMA 4FPJA 2A5ZA 1K3IA 2DCTA 3B7MA 1QOSA 3UGGA 1OLQA 2D6KA 5JOYA 1RUC1 1RB8G 2BJSA 4JHZA 2YGLA 4CXWA 4XZUG 2IVIB 2YFZA 4QM9A 3SMHA 4DIQA 1AUYA 2XKOA 2XDVA 2B8MA 2LALA 3VDDA 4YVWC 5JCTA 3CZJA 3JU9A 4LIUA 3TN91 3OGGA 1RUH1 2WZR2 1BMV2 4LO6B 1X9PA 4CXXA 1WZXA 2DVDA 5C4WC 4EV0A 4FTBA 2OXBA 5A6QA 1WCSA 4HK8A 1PHMA 1H1MA 5EPAA 3TAYA 4HANA 1UZYA 1HDKA 1YQCA 2IZWA 3MW2A 4PQQA 4YW6A 3T0AA 4LULA 1Z7S2 2O8OA 4AXOA 5GLWA 2HWE2 5T5LA 4D8MA 1VMHA 1JUHA 2GNMA 1ZBA2 1EY2A 1ND2C 2HWB2 1QNYA 5E1RA 3WNOA 5FZIA 1LOBA 3I2KA 4HPKB 4JQTA 5FWJA 5FZDA 4GWJA 5FZBA 2WSUA 5C3RA 1KD7A 4OQ9A 5LRSA 3OUHA 2ZXQA 4RFRB 3VKNA 1HRI3 2WNOA 2Y38A 4WVWA 5IWFA 4BCUA 3VUOA 3IKWA 1WW6A 5DZGA 3NJYA 5A3LA 4XUNA 5FZ3A 1S0IA 4AVVA 2PQSA 4BA6A 4XDOA 2PELA 1C57A 1XYOA 2DWRA 1QJX3 2DBNA 1ND3A 4UI9L 2P4EA 4LKEA 5A7QA 1D7PM 1IKQA 1YQ5A 4HN1A 3ZFGC 1EUTA 1DGWX 1GQGA 1HB2A 3MUZ1 4HONA 4TZDA 5FXVA 1ZBE3 5LATA 2IXJA 4O9GA 4XMIA 2WWSA 5KHHA 1DBNA 3IIIA 3HNBM 1LEMA 3SITA 1H0BA 1O4ZA 2ARBA 3OPWA 4CDWA 1C5HA 2FQPA 1D4VB 3E6BA 1HRI1 1JOPA 3AM2A 4A2UA 1LOCA 4RQPC 4FPCA 4WM7C 3VZLA 2BQPA 1PMJX 2JX9A 2R071 4KWUA 2P3IA 5JVVA 4AVSA 2V4VA 1NQJA 5KXCA 2HWF1 1OA4A 3SLIA 2GNDA 1FPN2 2D3RA 4QXHA 2AACA 5F3GA 4XHXA 1W6QA 3AYDA 3ZYBA 1QXPA 1Q3EA 1QJX1 2P6CA 3Q8AA 4AEDA 3LEKA 1YQ8A 2WFF2 4ZXEA 5C71A 1HQWA 2RHPA 2G4IA 4XABA 1X82A 1UKGA 5IJRA 4COWA 1X33A 4V1PA 4MYEA 3E6CC 2VZUA 4IETA 5G05L 1K45A 3ACLA 4HXCA 4IV3C 3N7LA 5CKQA 2W1QA 2VPVA 4NRQA 1W6NB 3WHTA 2ZMNA 1MVEA 5C9AB 1JZ7A 3DPRC 3S5AA 2E26A 3T3YA 4AQ6A 4EWEA 3L2YA 3QOPA 4XCBA 2WO7A 2GZWA 3OGJA 3SNMA 1R092 3O12A 1HN0A 4AYUA 4EWAA 1RUD2 5F5AA 3T09A 2EF6A 1KS5A 2ARXA 1SFYA 2D6LX 2VZ3A 4HETA 4QAWA 5GM0A 1VBB3 4B8EA 4XJ8A 5LCWL 2BW8A 5C8CB 5IAXA 4UWDA 5AVPA 4DPNA 1UU4A 2ZGTA 4AQSA 2HJIA 3RZHA 1V00A 4BXSV 3GBGA 4MXWB 4UT5A 2VE1A 5FZGA 5FKCA 4M01A 1L3JA 1RUI1 2J1EA 1AL23 1V6LA 2K0GA 5I0UA 1YC61 3WY6A 2YC2A 4UBHA 4UBGA 3ZYPA 1AYM1 1S0JA 4HLTA 2JDMA 3UV9A 1CX1A 4QHZA 3DCQA 2YROA 3EXUA 3ZSLA 3W9AA 4Y24A 1APNA 2O8QA 4D7TA 4QDQA 1NLSA 2X5IA 4B29A 2GDFA 2YMZA 2DYCA 3GBFA 1V9U1 1TMF3 5LA2A 2R49A 3MGUA 4Q4V2 3UGFA 4NN0A 4BK5A 4FAHA 5M0TA 1VBB1 5FXXA 3ON7A 4XF3A 3AKPA 2QJVA 1RXGA 1V70A 1WBFA 4MGIE 2IUWA 4HZFA 5FWEA 1JHNA 4Z2AA 4QPGA 1C1FA 2P34A 1O5LA 2VZ1A 2H6CA 4R9DA 2H0BA 2W94A 1PIV2 1J3QA 5BNQA 4CEYC 4QQLA 1AL21 3VD9A 3AJZA 3CL1A 3O0XA 3S5QA 3WNPA 5EP9A 2D44A 2D98A 1OVPA 2V73A 5FAXA 1I5ZA 1WMEA 4QHBA 5FYZA 4AI9A 4GH4A 3LEMA 5FFOC 4E9KA 2WKKA 1PGW2 3TBDA 5FY7A 2VMEA 2JB4A 5FMOL 1S4CA 1Y9GA 3J8F1 1LNSA 4GALA 2CU5A 4O65A 5LBFA 1GR3A 1GNZA 4LT5A 5F8PA 2WNVA 5FOJB 4JTOA 2Q5TA 5K7PA 5JUVA 1NCQB 1UY3A 3ME2A 2DU1A 2OQ7A 3PMEA 4YW5A 3ZVXA 2AC1A 3A7QA 3K2OA 5CB7A 3KM5A 1UX7A 3PURA 3H42B 4ASLA 3U10A 4BXFA 5I0SA 4NMIA 5J1XA 2ARCA 1ONAA 1S2EA 3LA3A 4PBOA 5HCFA 4DRVA 4FFFA 4IGOA 2R042 5FZOB 1N1SA 4ZU7A 5DZFA 1NZIA 1K5MA 1NG0A 1ENXA 4WZCA 1SFNA 1XQNA 1GU3A 1PK6B 3JBG3 3LSDA 4P9XA 1CJPA 1Q8QA 1V6JA 2UY8A 1L7LA 2WWJA 3OG2A 3UKVA 3UT0A 2Y8KA 3KQRA 2X05A 2JDAA 2UU8A 3N9QA 3AC0A 3KF3A 5FMCA 2WQ8A 1QQP2 5LY1A 5IK7A 4ZXKA 1U5XA 3TNQA 4IEZA 3ZYJB 3ZN5A 3MIFA 3VL8A 3ZXAC 1Q5OA 1H4HA 3M1HA 1JZ3A 3THCA 3CMGA 5JPMB 2V72A 3OYWB 1D4M3 4XUPA 3IAPA 2ZACA 2VR4A 4Z2WA 3LWCA 1ACCA 2JG9C 4JGZA 2DCZA 2JDUA 2XH6A 5T5JA 5L7OC 1R1A2 3AKRA 1O3QA 5JI7A 2HWC1 4XOGA 4YM2A 3M8LA 4D7YA 4F8AA 3IPVB 4OHXA 3QACA 2FCTA 4L11A 1UIKA 3ZN4A 3CJXA 4KBZA 3KCXA 2VAUA 1UOGA 2XVGA 4HSJA 2Q1ZB 1W99A 5CBLA 4LHLA 3S30A 2RS13 2VMGA 5DAXA 4AGRA 4C1WA 3TEZA 1M4WA 4QB1A 1UL9A 3FL7A 4LORA 1UU5A 1SCRA 2P1BA 4COVA 2RS31 4CDXA 2R30A 4UYBA 3SXWA 3RNSA 1O6UA 4A7ZA 1CAUA 5A80A 1BEV3 4ARXA 4BWOA 2Y0IA 3JCIA 3C7HA 3M4FA 3B93A 4JZRA 1UYZA 4OI0A 1BXHA 2QQOA 4Q8KA 1XE0A 1SEFA 3BODA 3I97A 3ZDVA 3ZFFA 4CU7A 1BCXA 4XF4A 3T1MA 4LLOA 3WLUA 4E4ZA 2SBAA 1UY4A 3AMQA 4RA0A 1AR82 1POV0 3EQEA 2A3YA 2BVBA 4GXLA 2ZGOA 4BH9A 4E4HA 3F95A 4RGAA 1FMD2 2BU9A 2VO5A 4CVUA 3HNYM 1I1EA 3T08A 4MG2A 5GZCA 3UNPA 3JB8A 3TOJA 5JOZA 4XQWA 1DG6A 2RS11 1HXS2 5BNNC 2GALA 1H8TB 4EN9B 1ZZCA 1DQ1A 2V4AA 2ORXA 4E2SA 4H3WA 1SLAA 4KH9A 1DQ6A 2R16A 2W0XA 1BEV1 1NOVA 3LF7A 4XHBA 4OHZA 1ZZBA 2OUJA 2UY9A 4AEKA 5JZGC 1U5IA 3VDDB 3CJIA 4XE9A 3BN6A 4M0HA 2JDHA 2W52A 5I0RA 4Q4Y2 3T4VA 4D6QA 5GALA 4ATFA 4C90A 1OF4A 4OHVA 5K0UA 2D6OX 3MIHA 3KWVA 4PF1A 5FYYA 3O1PA 4QXBA 3KT4A 4CDUC 2VVDA 4ZZ5A 4C0HA 3P3PA 5FYBA 5IK8A 3N9NA 3LOBA 1TME2 4QQ2A 5FY9A 1FOD2 3WQ7A 2VNRA 3BALA 2WZR3 1OKQA 2CNAA 4P9GA 5EJZB 1UMIA 4Q1RA 2D6PA 1MQTA 2NP0A 3DGTA 4IGQA 3RMYA 4IL7A 1J1TA 1UPSA 1W8TA 1OLRA 4LBOA 1X8EA 1Z7S3 3UETA 4BQYA 3PVEA 2HWE3 4Q4W1 1GNYA 1EV13 1BQPA 1ZBA3 2HWB3 3K77A 3PUSA 4FXGB 4R9AA 2VH9A 5LW9A 5FZ0A 3WG1A 4MGTA 1QJY3 4CDQA 1SPPA 2BNNA 3I2GA 4MADA 2GC3A 1W04A 3MPBA 1ND3B 3WG4A 1VBD2 4E2GA 2QQPA 4QGLA 1S55A 4Y26A 2VW0A 3VL9A 4Q1PA 2P3KA 5LBEA 4WM8A 5IVEA 3H8XA 3WV6A 2VULA 2WZR1 4PHZA 3GCXA 5FV3A 3O1RA 4QPYA 4AL9A 2B4KA 2QQJA 1RL3A 1XU1A 4MHUA 4XBLA 2KXLA 4CDWB 4CPBA 1ASJ1 1D2SA 2XVKA 3ETPA 1OQEA 3DXTA 3DYPA 3OPZA 3KLSA 1XNTA 1RGSA 1YFWA 5GLUA 2HWE1 4QXCA 1W6PA 3V56A 3VBUA 3RMXA 3VLBB 2BPA2 3MPPG 4LO4B 1URXA 4I0BA 2HYKA 4HKOA 5K4LA 3S0MA 2PAKA 5LRRA 2W46A 4A4AA 4FPFA 1W6QB 5EYXA 1AF9A 4YZ5A 1CN1A 3ZFEA 4AEDB 2G9ZA 2FZ1A 2XJPA 4PQ9A 2YBSA 4QHOA 3PJYA 4EJRA 5FMBA 4JKLA 1IS5A 4PI0A 5FPBA 3U4XA 3SCHA 1FPN3 2RM22 1U12A 2BUKA 1LB2A 4NIGA 3ETQA 1IKPA 5FYTA 1VIWB 1WCKA 1QJZA 2Z4FA 5H9QA 5A70A 1AVBA 1COV1 4AWDA 4JGYA 4NWVA 2WFF3 4QGMA 3PLQA 1SHWB 2PTMA 4PDWA 3BTZA 3N9PA 1GZCA 3V65A 3WG3A 3WDYA 1XOYA 4QDSA 3HOBA 4DXZA 3HAGA 4XFGA 5IK4A 1EPWA 3ROUA 4QU1A 3USSA 2PXJA 4TLGA 1LHUA 4Z92B 3VDCA 2OA2A 4OYUA 1YNAA 4BZ4A 2DF7A 3HMYA 3U14A 4Y22A 1WA4A 2RJKA 4RS5A 4ZONA 1DF0A 4Q29A 3HBKA 3E97A 3WOGA 5IK5A 1NAEA 2YDEA 1XBFA 2ZCWA 4LK7A 2E7TA 1R093 2KM2A 3VDAA 3UKTA 4ATEA 2CHHA 1Q43A 1W0NA 5FY5A 3ZM8A 1VRBA 3MHZA 2HBTA 4Q2FA 4W6YA 3DN7A 1FPN1 2R1DA 3JQXA 2AGSA 3CBNA 3IDEA 5FK8A 5F37A 1XYPA 4OMCA 5ERLA 1NY71 3WW2A 2EIEA 4Y5Z0 2OT7A 5DABA 3VHOA 1LU1A 3CNAA 3AFGA 2RR11 3OEAA 4FQ4A 2X5IB 1BK1A 4L9BA 4INDA 4OFGA 4CP0A 5F32A 2PN5A 4DUVA 3W59A 5CFCC 4Z07A 4IEUA 5GKAC 5L9RA 5F2SA 4B3NA 1W8OA 1W03A 4XJZA 3WINE 2BZDA 1RUF2 2ZGLA 4JCKA 5JSPA 2AH2A 2TUNA 3GZTB 4RGGA 4D7SA 1Q8VA 3IAQA 4LE3A 2K46A 4QPGB 2R0FA 3TEWA 4FOQA 3BUCA 3EBRA 2ZEXA 4OVEA 3ZSJA 5IVFA 1RUD1 3O1OA 1G9CA 4YRDA 2GMPA 4A6SA 1W8UA 4Q4V3 2VD7A 2HEVF 1RHI2 4FO9A 4QPIA 4FOVA 2WZPP 4CRQA 3RGBA 3CO2A 1POQA 4IE5A 2VMDA 4CUGA 2PHFA 5FO7B 5C3SA 4GH4B 3ENRA 1H9PA 5ABJC 1C8M2 3S7IA 3OY8A 5T50A 3WR0A 2RV9A 1TMF2 1VRH1 5T54A 3S57A 5FZCA 4RL7A 3KVBA 2VTFA 3K51A 2WNVB 1EP0A 1Y43B 2RDQA 4HT1T 4XXPA 3WDUA 1REFA 5JDBA 1Y4WA 1O5UA 2WO3A 4QU2A 2JG8A 3ZIXA 1DQ5A 1GWKA 1W2NA 4ZS2A 4AI2A 3N7KA 4JRLA 4ZPIA 2BTVC 1VB2A 1OD5A 2JE7A 2VZQA 2KD7A 2Y34A 4LBJA 1F2NA 3S6PA 2AUYA 3U1XA 3VZJA 2YHJA 4CCKA 4YM0A 1X36A 3A22A 1OPOA 1PGL1 4G9SB 4E8CA 3VHRA 4FPGA 4BPZA 4P02B 4XW3A 2EICA 1K5MB 4V2WA 5FREA 1UZVA 4XACA 2BWAA 3POGA 1UPIA 1PIV1 2XJUA 4HMZA 3LDRA 4AF9A 4EN7B 2P6HA 5LZ6A 4QX7A 1HN1A 3GJAA 2YFUA 3NKGA 1B35A 3KMHA 4IV1A 4PI2A 3BB6A 3UGHA 3VD4A 3DF0A 2R043 1CAVA 1LAJA 3WNLA 2BNMA 2QDRA 1BBT1 2NMOA 2QZ2A 1AXZA 2D3PA 1PGW1 2W1SA 4FAGA 4DFSA 1R1ZA 4JGZB 2GNTA 4OZXA 3H7YA 4FOWA 1LCLA 1OI6A 1QJFA 1WLCA 3BIWE 1PZ9A 5IVYA 2D5FA 1F8VA 4LKSA 4Q4X1 3IB3A 2EIBA 2MPFA 4W6XA 5KWRA 3B3QE 1ZVFA 5DUUA 4AAPA 2PHRA 2Y6JA 1QDOA 5EYYA 5FY1A 4P9IA 2W9XA 2VOKA 3JBG2 4IXLA 3H8OA 1IS6A 1KFUL 2DDUA 1DZRA 1RUE2 1VLNA 1GP6A 2W08A 3AP4A 3IWZA 4FPOB 4LHNA 5FO8B 1ZZ9A 1DU3D 2A7AA 2EAKA 5F3EA 1R1A3 2F4LA 3B69A 3RWNA 2E6VA 4CDXB 4MX3A 3ALQA 3MW3A 3OGRA 1ST8A 2RDRA 1CAUB 1DLCA 1SLCA 1O3SA 3RPQA 5FR3A 1ZZ7A 2QQMA 3RG0A 1S0BA 2ARAA 3PDQA 5F5CA 3ZFFB 2CL2A 3NV4A 1QHDA 2W1UA 1A3KA 3FHAA 5FZ8A 1L7QA 1QQP1 5LEKA 5A3NA 1CWPA 1FV2A 2WAOA 2VBDA 3B5LB 2XHNA 4M4PA 1RMU2 1QOOA 1H2KA 3AP5A 4Z8BA 1QJEA 1JODA 3VBFA 4LJHA 4BQ3A 1R082 2JDPA 4Q0UA 3SEPA 3V0AA 2HH9A 3AVRA 4YFWA 3SISA 3UL2A 1F31A 3Q8EA 4BYYA 3NWKA 1R1A1 3WW1A 4Y1UA 4KI5M 1E57A 1VBE2 1A78A 1WCQA 3J26N 5BNPA 1VBC1 1FMD3 5DPNA 3LEGA 4KQ7A 3CDZB 2ZJCA 2WYFA 5C9AC 5I91A 2XONA 2VU9A 1ZX5A 2ORZA 3CJIB 1OHFA 4DS0A 2HWD2 1HXS3 1VB4A 2ZA9A 1GZTA 3UJQA 1QNWA 1QY4A 2ZEZA 3AMPA 4XMAA 1BKZA 2IC1A 3NNLA 5GLZA 5FY0A 1G9BA 4Z1VA 5K0UB 1D2QA 3SEEA 1V6IA 4QGNA 5GZGA 3J9SA 1YJLA 1IQAA 3R4SA 2ZEWA 5D1IA 3KVAA 5FOBB 2NLRA 1ZA7A 5C8CC 3ITQA 2IFRA 1J59A 1US2A 2RMU2 1H6XA 4W8JA 4Q4Y3 3BPSA 3POBA 4IV3A 1DIWA 4UFLA 4ES8A 1MQTB 1AR81 1JYXA 2AEYA 3BU0A 1UNBA 2EIGA 1ZRDA 5I8TA 1QGLA 3B02A 3AB0A 5T5PA 1DGRA 4G4FA 4MGQA 5IHRA 3ES4A 5HPOA 1RUJ2 3NVCA 5AFBA 1TME3 4B1LA 5EFUA 2IVJA 5JMOA 4P9LA 2HBUA 1HXS1 2Q4SA 3DV8A 2FMDA 1JYTA 4LO5B 3ZXGA 4CDQB 2WQ4A 4EN0A 1MS3A 4XDPA 2CGPA 1SPPB 5EJ1B 4QB2A 4FPYA 3NNFA 4N53A 5CNAA 3RS6A 1W2TA 1BHGA 4JHTA 2J42A 1DZTA 4YZ3A 2XJQA 2NZ9A 4R9BA 4YWAA 1W9YA 2QFEA 1OH3A 1L7RA 4GMP0 4WM8B 3KV6A 2VZSA 4Q4Y1 1YRZA 1RVF2 4XDQA 4KBBA 1XSRA 5ACA1 1UYXA 2UWAA 3HQXA 1UOBA 4Y20A 2ET7A 2HEYF 4QB6A 4TN7A 3E1F1 3WVJA 1OMIA 3PU8A 1Z0HA 2YXSA 5IFTA 3CU7A 4DB5A 4BQ1A 3LZZA 4GJYA 1VBD3 1F9KA 1S2KA 4H7MA 4JDNA 3WF0A 5HBAA 1FOD1 3NJXA 1W6PB 3VBUB 3WCRA 1EV12 1QJU2 1MS8A 4YZ1A 4MGYE 2P5BA 4NRMA 5LASA 3R6SA 1KFXL 1MEC2 1RUOA 1QJY2 2Y6LA 5EJ3A 2A6YA 4OCTA 3R4UA 3OEBA 1T6BX 1LHOA 2QQUA 3ZFEB 1YIFA 4U2AA 1U5YA 3TB0A 5I0TA 1HQLA 2D43A 3OUJA 5FLJA 3INAA 4CTEA 1B09A 1SMVA 2B9VA 1UOJA 5JXGA 1NCQC 4DXTA 2WO2A 5A6XA 5B4XA 5L73A 3MV11 4AVTA 4FT8A 1MZEA 4JGYB 4D0QA 1MACA 1GBGA 2JDYA 5F39A 1JZ5A 4E27A 1VAKA 4MHRA 5F9TA 1T2XA 4IDZA 4MH0E 4PDWB 4ORFA 5EV7A 5D21A 4CEWA 2GMEA 5ANNA 4RD7A 4LE4A 3Q9OA 4XUOA 2RM23 4QQPA 3IIAA 4BQXA 1PK6C 2GH8A 2ZEYA 4D6SA 1KQRA 2VMCA 4Y22B 1W2OA 5D8AA 2IXKA 4OQ8A 4YARA 2K9ZA 4IE4A 4ISRA 4RS5B 2AR6A 1ZZ6A 2BNOA 4KL1A 4DY5A 3LD8A 4XUTA 5FYMA 1QIQA 3ZKYA 1DP0A 2C26A 1MS4A 2B9UA 4NPLA 2Q8CA 1A6CA 3ZN6A 1AZDA 4CCMA 1W0PA 3AYAA 2CGOA 4GULA 3FFZA 3V64A 4GJZA 1QF3A 4AI8A 3E6DA 4HL0A 3BGAA 1AR92 5FZAA 1NCRA 1RUNA 4ZU4A 1ZRIA 1YUDA 1OFSA 4LITA 5FUNA 2WFPA 2EXHA 4SLIA 2FHRA 5KC6A 4KWLA 1ZBE1 4P08A 3MIGA 4LHKA 2QQNA 3IBMA 2K2SA 2W47A 2RM21 1DQ4A 1EYBA 3IMMA 3PMSA 5FLIA 3SCFA 2V5DA 1F35A 4XF0A 1MZ6A 3AJYA 2N7GA 1S1AA 3HIFA 4Q0SA 3TEXA 1NA1A 3RJRA 4JKKA 3C7OA 2DU0A 3J7LA 2VUCA 4CXYA 1H6YA 2ZGPA 5IFPA 3B00A 1JYIA 1O7FA 5FPVA 1JBCA 3N7JA 4N43C 2D5HA 2OPWA 5JR2A 1RUF3 4CU6A 2OX0A 1JN2P 4QPIB 1OC1A 1VBA3 4FOYA 1SDDB 1UN1A 3TWIA 4JX0A 3VZOA 3WSOA 3DL3A 3SCGA 1IHMA 3D8CA 2WLPA 5A7WA 2CWMA 3ACGA 5J3UA 4BQ2A 4X8PA 1GLHA 3C2UA 3OY8B 1W2AX 4JRAA 4MO3M 5AVAA 3VZKA 1KS4A 1RHI3 4IEXA 5JOXA 5DAWA 5APAA 1H8TC 4IE7A 4J6GA 5I8SA 3MF9A 2FMYA 1KITA 3PUHA 2G9FA 4C1XA 1O4YA 1QMJA 1Y3TA 3WDWA 5C7GA 1UX6A 1NLQA 1C8M3 2JG8B 4P9YA 4PIXA 3JQWA 4R52A 1VR3A 3I4IA 4QMAA 2VNGA 5FRAA 3B01A 3HQUA 3VDDC 4P5YA 5TSWA 4Q0PA 2BOJA 1PO23 4QX2A 1YYNA 1CJDA 4CA9A 3CIHA 2ZGMA 2JEMA 1VAMA 3OGSA 1N1TA 3T2QA 2WNUA 5J98B 2XKPA 2ZX3A 1CQ9A 2VOTA 4JQRA 5FMDA 5BNNA 2I45A 4MGKE 3T0BA 1RJ8A 4K8RB 1E5IA 5DUWA 3ZKUA 4HG6B 1RHI1 1CVNA 3POSA 1B35B 3J7MA 4IV1B 1LESA 4QKDA 2R6QA 4HFSA 4Y5TA 5FXWA 1CAVB 5FDBA 2VZRA 4IEWA 3C7FA 1AJKA 4XFCA 1BVVA 3KV4A 3BPZA 5JXHA 1TMF1 2GSYA 4NPRA 2Y26A 5T5OA 2CV6A 3UK9A 2BGOA 5JXJA 2XQXA 3H1WA 1G9DA 3ATGA 1WW5A 3NAPA 4L92A 2PHTA 2VXJA 4XTMA 1OPMA 3EJKA 1TEIA 3MICA 2QE3A 3MFCA 1AR72 2B5HA 2VCAA 3FWEA 1ND3C 5C6CA 5KC5A 3PUIA 5A6YA 1JMUB 2BBAA 1ALYA 2V09A 4MZUA 1ZREA 3WF4A 1ENQA 4LBQA 3BVCA 3BOPA 4OUEA 5FZHA 3H50A 1WD4A 4GMP3 3MEPA 1LKNA 5FP8A 4LA3A 5LEJA 1WWYA 4QX5A 3VBHA 1C4RA 2Y33A 1OKOA 1DYOA 3WNNA 3POEA 3THTA 4FXKB 3M3EA 4CDWC 4URAA 1WUVA 2XB6C 1VMJA 3ZYIB 1XNDA 3P3NA 1RUE3 2J7MA 3GHMA 4FVVA 2JJ6A 3AMMA 3NQHA 5J37A 1GZWA 4QPWA 2H6BA 2WWUA 2OS2A 1REDA 5FY8A 3KV5A 2W91A 2O1QA 2W39A 4KGGA 1NT0A 3NMBA 4AG4A 4YLZA 5DXDA 4E4SA 1QH6A 3VBSA 2VZVA 3VBFB 2NQYA 2ZKLA 1OQDA 4AEDC 4NAMA 5KHJA 3I3DA 3V0AB 1HB4A 4C91A 2FDGA 4IEPA 3ABZA 3C3VA 4Q0QA 1CZSA 1OBNA 1YIPA 4GMP1 3HVDA 1RUG2 2UWBA 5BNPB 1LOFA 2R062 3O14A 3MLJA 1RMU3 2BDRA 3KGLA 3VKFC 1XXNA 4COZA 2DUQA 2VM9A 5HXMA 1ODNA 1PGSA 3JBG1 4TXWA 4PBPA 5E88A 3ZDSA 1R083 5J36A 5F5IA 4XQDA 5LA9A 1RUE1 2VMIA 4X6QB 4AGGA 4N7IA 2YPJA 2OIIA 3I2DA 4LUMA 1FXZA 5FY4A 5DAVA 5CG8A 1IG0A 1VBE3 5K8SA 2CDOA 3A23A 1T6GC 4Y1VA 2OYZA 4BQ5A 5FPAA 5A1AA 5LWBA 4E4DX 3AP7A 4LPLA 2ZMKA 2QNKA 4AOCA 3I54A 1D4M1 3RZZA 3ZIWA 4NHYA 2HWD3 3CHXA 3ZXFA 3NKTA 4XBNA 2J1VA 3NO8A 4IV3B 4A41A 2XG3A 1YEWA 2VQ0A 3WF3A 1PZ8A 2IXIA 3O0WA 5DAPA 3WW4A 4A3ZA 1PO12 2Y64A 3VBOA 3RSJA 1ULPA 2XJVA 3IT8A 3DEMA 2AZ5A 2JD4A 3C8XA 3HT1A 3K75B 3LFIA 4Q5OA 4NR1A 2VZOA 3RYRA 3K4DA 4LEJA 1R081 4BOWA 2VG9A 2RMU3 3BYWA 1EAH3 1US3A 4YW2A 5C3PA 1I6XA 2X5IC 4YGEA 3ZXJA 4GQ7A 2DCKA 1PX3A 3AXEA 5H9RA 2VOWA 1VBE1 2VW1A 2X53S 1KGYA 2Q8DA 1V6OA 2C4XA 3APBA 5FZ7A 5CFDA 2GH2A 3ZPYA 5FZ9A 2JE9A 4LR4A 3VKOA 4AEMA 4EYUA 4N53B 1DDLA 1UCXA 3LGRA 3OBZA 4FCAA 1RUJ3 2LRPA 3LA2A 1RC6A 1LTEA 2VBBA 3EMRA 4CE8A 2QKDA 2WS92 2CAUA 2HWD1 2WRAA 3N3HA 3PVBB 3IDAA 3ST7A 4QPGC 3D0SA 2X09A 3WDTA 3V0BA 2ZKNA 3LPFA 1NE4A 4D69A 5AC92 5F5QA 5CKMA 4Y20B 3IM0A 2XBO3 4BK4A 5B2GB 4M3CE 4I0WB 4Y4YA 1SZBA 4CYDA 4ZY9A 1XYNA 2VCCA 2A6ZA 2BOIA 1NX9A 1RUC2 5DG2A 1IOAA 5DQ0A 3JD72 5L36A 1M06G 1NYWA 3ELNA 2ZGSA 1RVF3 2WBKA 1W3XA 3D82A 3VZMA 3WEZA 1GANA 3A21A 4ET7A 5CEHA 2ERFA 3JB4C 5CZKA 3WW3A 1RUH2 1I9RA 5CYYA 2A75A 2WABA 3D3AA 5L9VA 1PVXA 1KEXA 3FBMA 4XYXA 4BDVB 3K48A 4AHYA 5E89A 5FCCA 4AVBA 2WNVC 1QJU3 3DKWA 1UXXX 3FLPA 4TYSA 2Z2SB 1MEC3 1F5FA 1K5JA 3D5OA 1WCUA 4FPLA 4NHKA 1OFNA 1AXKA 2FBEA 1CESA 4NHXA 2W3JA 1TG7A 1HJGA 2ATFA 4BIFA 3SKVA 1UY1A 4PCRA 3ZYHA 3RZJA 2WA3A 4UFJA 1KXGA 1N47A 4GWNA 4WV8A 4CEWB 1JYVA 3SH4A 5A3UA 2BBVA 2XOMA 1BMV1 4RYDA 3IMNA 4CP2A 5D8AB 4RN5A 5FP4A 4W50A 4NO4A 2HEWF 2B39A 2VECA 4CSWA 2A70A 3H1MA 4YYOA 4DO0A 5KHIA 1IGOA 4WZFA 1QKQA 1Z7S1 1GZ9A 1OA3A 5GZFA 1EV11 1ZBA1 2HWB1 1LHVA 2VVFA 3ZN6B 2R7EB 1MEC1 1QJY1 4Y1ZA 1NXMA 2QQKA 3N7MA 4N7UA 5BXXA 1NCRB 3SKJE 4FP2A 4P14A 1I5PA 1RINA 1XNAA 3GM8A 2CGNA 2Q0AA 3MYXA 4JGZC 1LOEA 4GZ9A 4JV4A 1PVC3 1YO8A 4M4RA 4XC9A 4FPKA 2C0ZA 4N9IA 3PIJA 5AFEA 5F7UA 1DYKA 3L2HA 4A45A 2VNOA 2VTXA 4XUQA 3ACIA 5BNOC 1AR93 3FN9A 2VMFA 1C1LA 3HN1A 3WXPA 5K9YA 2HWF2 3KT7A 2XR4A 1JYCA 1H8VA 5BYNA 1CAWA 1NA1B 2UWCA 4M3CF 5IW0A 2BFUS 3FX3A 2W2IA 1JS9A 1SLLA 3QLQA 1JZ8A 4CDXC 4E2QA 3K4ZA 4YZ2A 3DECA 3OPTA 1A8MA 3LA7A 5HXVA 1LOAA 1W8FA 2JXAA 4CZSA 1TZOA 3SC7X 1PZ7A 4BQWA 4RHV3 4WVMA 2OUHA 1CIYA 2VJXA 2Y6GA 1KJRA 1FATA 2DFBA 4COYA 2VOXA 2I2SA 2C6SA 1OA2A 3ZFFC 3D0JA 2ZGNA 4TSVA 5FP3A 1J58A 2SLIA 2QCSB 3ILRA 4QX8A 4AI1A 1LHNA 3H3UA 4LHSA 5C3OA 4H55A 4OUSA 5HV0A 1AYN2 5FLHA 5A7WB 4HOOA 1DLLA 2FDFA 2EXJA 1WW4A 1QXJA 3MO4A 1JU3A 4XJUA 4CCDA 1AR91 4ARYA 4FP3A 4IEVA 4NIAA 1YXWA 4RR3A 3AX4A 3PTYA 5FO9B 2WFF1 4WVZA 5FPXA 4PF5A 3OBTA 3OOXA 3LCPA 2ZGRA 3GBWA 3ECQA 3GJBA 2RDNA 5LY2A 1WMDA 4YG3A 3KS7A 4PIYA 4Y1XA 4YNIA 2JDZA 1R64A 4FBFA 3RZKA 2D6NA 2FCUA 3PTRB 1ZRCA 1UYYA 2OPKA 1VBA2 3FC0A 3UESA 3LE0A 2YGMA 2IWGB 3OF1A 4A44A 3RJ2X 1GSLA 1R091 4HVQA 1AYM2 4IQPA 2C5DA 3AK0A 5K0UC 2D7FA 3K3NA 4HKLA 2WNUB 4TWTA 2PAMA 1WLDA 2TEPA 5BNNB 4M0NA 4XURA 3WT3A 4XQ4A 4K40A 1Y7BA 1J1LA 3AFKA 2PMWB 4ZKTB 3MF6A 2PYTA 4IESA 1V9U2 4YSFA 1RYYA 1UYPA 2BVVA 4KWJA 3RDIA 1G86A 4LBLA 1H9WA 1MS0A 1MQTC 2W87A 4A6OA 2EALA 5C3QA 1CIWA 4QKBA 1OOPA 2AYHA 2WR9A 1C8NA 1HV1A 3GXUA 3KD4A 3WDXA 2E33A 2WINB 3VBRA 5FZEA 2XWJB 1PO22 3R0RA 1GOFA 4LIVA 3NAPB 4FQZA 3C7GA 5FYSA 2DVAA 2BEOA 5FK7A 5A7SA 4LBMA 2BRTA 4CDQC 2DCJA 3I3QA 4B7EA 5FXZA 4XILA 1JTZX 4AE2A 1F4HA 4GWMA 2Q8EA 1A8DA 4Q4V1 5CA6A 1LEDA 4LBQB 2R0HA 1LHWA 2JD9A 3RRDA 4AQTA 4EE2A 4WM8C 4LK6A 2A6VA 2PLV3 4YVSA 2F4PA 4O61A 3ZXEA 3FJSA 3VBHB 3TNPB 3Q8FA 3CEWA 4AVCA 5FJHA 4X8NA 1AR73 1UU6A 1OT5A 1FI2A 1AJOA 2XL7A 4NUBA 4PLNA 2CDPA 2LUWA 3Q8CA 4K7JA 2J1RA 2BGCA 4ES9A 3PUAA 4AK3A 4UFIA 1PMIA 1GZWB 3VBUC 5L19A 4I3GA 3K3OA 4LA2A 4DUWA 3R05A 3FLRA 2YY1A 1S0GA 2E31A 4RFT0 4L2NA 3WD5A 5J48A 2VQUA 4ZS3A 1HIXA 4YVWA 2Q8OA 3VBSB 3B9IA 1CX4A 2YG0A 3ZFEC 5FUPA 4KMQA 2QBXA 5LBBA 5GZEA 1UW8A 2W95A 3ZMNA 5C4WA 4DXSA 3SHRA 4Q26A 5T3NA 1SACA 2AEZA 2G1MA 2Y6HA 4AVAA 4JGYC 4QXKA 1XNKA 1ND2A 1E5HA 2E7AA 4PDWC 2G9GA 3O1SA 5A7PA 5CIRA 4HK9A 4QD2A 5GLTA 5T52A 2MNGA 1RUG3 2FD8A 2XGXA 3P5BA 2R063 2R041 1DGRN 3QCWA 4DQAA 4XETA 2XLAA 4HKWA 2JECA 4RS5C 3BU7A 2B42B 3MIBA 4IERA 4OUMA 3U07A 5I93A 5JSRA 3SH3A 2WDBA 4Y5SA 3PVOA 4DOUA 3RZLA 3ZYGA 4LKFA 4XPVA 1O8PA 2B46X 1TNRA 4I30A 1ENRA 2FDHA 4NIDA 2Y0OA 3OD0A 3LEIA 5KXBA 1W8WA 3AKSA 4S2FA 3T1LA 2BV4A 3VBOB 4OI2A 2Q1MA 1SBDA 3ZFGA 2CAVA 1YQ2A 3LSEA 2RS32 3FMGA 4UW6A 4DEQA 4JDMA 2FZ2A 4MGZE 4LUKA 1GQPA 3AKQA 4YG6A 3IZOA 4EQVA 1LGCA 3F2ZA 5JPNB 5KXEA 2UYBA 3OCPA 1RXFA 5FBJA 2OKXA 5CFDB 2QZ3A 1PO13 1CZTA 4Y4RA 5JIUA 4CU8A 3HBZA 1JHJA 4RQPA 5FQ0A 2BFUL 2GAUA 1MS5A 3EYPA 4LMFA 4WM7A 3RI9A 1GYKA 2YC0A 5IATA 4KGQA 5F3IA 1PNGA 1JW6A 4PJYA 1Y9MA 1NZCA 1SLIA 3AZWA 3V0BB 2ENRA 3O5SA 1UIJA 1C28A 3KV9A 1SG3A 5IVBA 1VJ2A 3AZZA 3R4DB 1W8ZA 2ZBJA 2E53A 1IS4A 2YBPA 2JE8A 3IDCB 3O0VA 4K8FA 4QPIC 5FBZA 3ZO0B 3ZXDA 4K9SA 1AR62 1JU4A 1D0GA 2WS93 3W5MA 1EAH2 3D6EA 3J4UH 1LRHA 4GB32 3FE5A 5FJKA 4BU2A 2VTXJ 2VUDA 5AC93 1FT9A 3DPRA 2PA7A 4QDRA 5H9PA 1FMD1 3P6BA 3GZEA 1W90A 4K21A 4IEQA 2WZEA 1SLTA 2IXLA 3HEIA 4I02A 1I3HA 2E51A 3JUUA 3MBWA 1RUC3 2UYAA 3NJVA 3USUA 4K6BA 1AXYA 1HB3A 2CWSA 3JD73 5A32A 2DVGA 4UW5A 4BB3A 2ZX4A 4N43A 4X6RB 2JG8C 3KHCA 4QWNA 2XBO2 5A1FA 5C33A 1RUH3 4DMIA 5C8WA 4F7ZA 3A4UA 3MFAA 2YC4A 4EZ4A 1WMFA 3G6JB 4LBNA 2D40A 1K12A 4LBQD 4U36A 4DRRA 4R4XA 1LODA 1UXZA 5JSOA 3EO6A 4F3JA 1DYPA 5EHDA 5LB6A 3NNMA 3AVSA 5JIAA 1W28A 1N3PA 4UW4A 2A6WA 4YW7A 4Q4W2 4CCEA 3CLPA 3ZYFA 5HI0A 1GKBA 4DEVA 1EPZA 1VPHA 1IPJA 4N8MA 4AHWA 3WP6A 2GN7A 4QM8A 2RVAA 4OULA 3FHIB 1TME1 3I3MA 1B35C 4IV1C 2BWCA 3JD71 4MVTA 4KU7A 1VALA 4XIOA 4UW3A 3WP3A 3ZXLA 2XJSA 1XU2A 4D6RA 2WJSA 2E63A 3NV1A 1XNBA 5A3PA 5JAXA 3MUY1 2JICA 3U37A 1V0AA 3WNKA 1G9FA 1Q8PA 1J84A 2EXIA 3VHNA 2WZ8A 1GWMA 2VUAA 2WUHA 4B4RA 1ASJ2 1J3RA 1SFPA 2JKXA 3KB5A 3QH6A 1OXCA 2VQTA 3FUQA 3JZVA 3WQBA 4A42A 4CEYA 4CP9A 4C8DA 4BMEA 1W05A 1X8MA 4OI1A 2P37A 3ZX7A 1UY2A 2WAAA 3WQ1A 1JZ2A 1CAWB 4CU9A 1VBD1 2VUJA 4CCLA 4EWDA 3POJA 5IUQA 4F83A 4YM1A 2VMHA 2ZS6B 4B4QA 1QEXA 4D3WA 1JZ6A 4WVMB 2R073 2ZAHA 4DINB 2VQAA 3LIGA 4NJ4A 2HWF3 1TNFA 4XFFA 1PVC2 3OD4A 3OUIA 2GP3A 3DUIA 2W5FA 2I74A 4QX0A 1COV2 1UWWA 1ZRFA 1ZRRA 4UOJA 5FYCA 5DN2A 1N3OA 2WT0A 2YUEA 3LOIA 5FUIA 3ZR5A 4FI9A 3MZHA 4YW3A 3VBFC 3LB9A 2ZHKA 5JXIA 4AFAA 3QD6A 4MV2A 3IN9A 4RR3B 1ODMA 3MV01 4ISQA 4COUA 2E9QA 2ADDA 1V6KA 3MDPA 3MIEA 4PT6A 1AYN3 3ACFA 4CCJA 4CUAA 5BNPC 4QX1A 3L9JT 1MVQA 3PL0A 5J09A 1ULCA 1HB1A 5A3WA 3POWA 3HNMA 2Z42A 4ONUA 1LENA 4RHV2 2L9LA 1ULEA 2DFCA 1U0AA 4BISA 1WGPA 4ZHNA 4DZGA 5DDJ2 3SH5A 1OUXA 2H0VA 3H1YA 1BZWA 4XCAA 3T2TA 1W9FA 2RJLA 1Q8SA 2WN2A 3RZGA 4UXAA 3VGIA 1D0HA 1YWKA 3A0KA 5I8YA 1NY72 4PIZA 4JAAA 2JDNA 2JG9A 5F6LB 3KZ4C 4QT6A 3RWKX 2RR12 2GMMA 3N9LA 3VN4A 4ASKA 5L7OA 4YPJA 2QQWA 3S7EA 4Q27A 4LLFA 4P9WA 3VV1A 1ULFA 3O7OA 5DUXA 1ZM1A 2P17A 3I7DA 3ZLIA 1O91A 3I2IA 1RUI3 1WLTA 3RQ0A 3J7HA 3N9MA 2E32A 2YV8A 5LA0A 4EN6B 4JVAA 3AXDA 1AYM3 1AYN1 3BOWA 3E5QA 1FNYA 1OOPB 2YPDA 1X9TA 1LGBA 1W8HA 4JTNA 5FPUA 4DNYA 1XB9A 2Y6KA 3TEYA 3VBRB 1UAIA 2WSVA 3I8TA 5H9SA 3AL5A 2ZHNA 2VCMA 1V9U3 1UMZA 2RG4A 2ZX2A 4GA9A 4B7KA 4AZZA 2F17A 3VD5A 1WW7A 3NL1A 5L9BA 1ZNPA 2ES3A 1VP6A 4AQ2A 1MZFA 4N90A 4AFBA 4QQHA 3KCYA 2OW4A 4N53C 1W9WA 2DURA 1WA6X 3DYMA 5IVVA 1DGWA 4I09A 1OVSA 1PMHX 1RUF1 2XWBB 2LROA 4RSUA 1K42A 1VE0A 5HCBA 1GFF2 1PNFA 4YVSB 3U0ZA 1VBA1 4H14A 4I2OA 1BLZA 1VRH2 3FZ3A 5F1RA 1LECA 1NXD1 4XJ9A 2ZGKA 1E5SA 2PHXA 3DYOA 1HX6A 1LR5A 3LQCA 5JOWA 1H4GA 3AKTA 4CPBD 4AI3A 2XPJA 3FBYA 2VCBA 4RGKA 2ZGQA 1UZWA 3I59A 3HT2A 1N1YA 5EZWA 1TE1B 5JWPA 3X29B 2P3JA 2X10A 4Z82A 1CPNA 3J8F3 4ITCA 2OZJA 2W68A 3LFMA 1UKRA 2RS52 5JZGA 2JDKA 3CZUA 3NV2A 3H7JA 1C8M1 4YVWB 3WF1A 1PGL2 1JYNA 1RITA 4LOSA 2J1SA 4S2HA 3THDA 2ZX1A 2BGPA 4XEZA 2ILMA 2UURA 3WX5A 4CCOA 1H2NA 3OB8A 3M70A 1PO21 5C4WB 2C9KA 4XJAA 2PLV2 3ZYRA 2ZPXA 2PHLA 1TQ5A 2VZPA 4CDUA 4D94A 4OHYA 1W9SA 2YB7A 1J83A 1H2MA 2HKXA 5J96B 3POIA 4BIOA 3E5UA 3PU3A 3J8F2 4IUGA 1ND2B 1C5IA 3WG2A 3ES1A 2WNEA 1BBT2 1CZVA 3J7NA 2ADEA 4GKXA 4CEWC 4L99A 3M3CA 4DY3A 1HRV2 2X8KA 2Z5WA 5GLVA 2G19A 2VW2A 2XLGA 1AX2A 5D8AC 1OURA 1UZZA 1W6OA 1FAYA 1NKGA 1YQ6A 1MZ5A 3MLKA 4KWKA 4Q4X2 2QQIA 1O4TA 1IZ3A 2FDIA 5C5TA 3WUDA 2ID4A 1HV0A 3RYPA 3ASIA 1QWRA 1UMHA 4AHZA 1AX0A 1C3HA 2ETEA 2NM1A 2W1WA 5EWSA 1W8NA 1DQ2A 4MLOA 1S2BA 4Y1YA 1NCRC 2HWC3 3ZFGB 3GNEA 2DV9A 5ISLA 5KR7A 1KDMA 2Q30A 2D3SA 3HN3A 3D4KA 1X50A 4J1WA 4AFDA 1DZQA 5IVJA 3POFA 2A1XA 2FDKA 3AZVA 4LO8A 3GYDA 4LO7A 2NPIA 2VZTA 4JDOA 2XL9A 4RQPB 5FQ0B 2RS33 3OTFA 2GC2A 5CADA 4WM7B 1XPWA 1BYHA 2A6XA 2C24A 1TVGA 2D6MA 2LW8A 1NA1C 3C7EA 3PNAA 4GKYA 4YGCA 5KXDA 2EXKA 3FFQA 3W5NA 1O3TA 2P3YA 4BLJA 3BCWA 2VC9A 3MI8A 4YW4A 1X7NA 5CKNA 1W6MA 3AMNA 2KR2A 4YG0A 5LK5A 1W9TA 4NIHA 1REEA 1SCSA 3WNXA 1WLWA 1UD1A 5F3CA 4NHLA 1VBC2 1XE8A 4NOTA 5FZ1A 3VB9A 3LIHA 5BNOA 1HLCA 3RFRA 3U4SA 4YM3A 5EXOA 3HPNA 1FYUA 3O1MA 2GC0A 3DPRB 1RMU1 2B45X 5A3MA 2QQVA 4DXRA 2XQRA 1OF3A 1AR63 3ACHA 4IEOA 4W4ZA 3USUB 4UF0A 1GICA 5A32B 2NYYA 2A3XA 2O0OA 2WLQA 4HVOA 5FKBA 4P5HA 5A6ZA 4GB33 1RIRA 2F6BA 4N43B 1J3PA 4NHMA 3AMHA 5KHKA 3H9AA 1YFUA 4YGDA 5GZDA 1ENSA 1NE6A 1V6NA 2EAAA 4CP1A 4AI0A 3KQ4B 3T0DA 1FV3A 2E7QA 2PFWA 4LBKA 2ZGUA 4XF1A 3T30A 2ZHLA 2GN3A 2MEV2 2P2KA 3OGVA 4QQOA 4CCNA 4OHWA 3ZXKA 1BJQA 3A0NA 4IEYA 2IXHA 1GP4A 1SDWA 2DVFA 2WNUC 3FLTA 3GZAA 3H8UA 3NNGA 3I3BA 4QKNA 3M7AA 1DGLA 3AZYA 3VD7A 3HQRA 2DUPA 2MHFA 4FFHA 3BI3A 4BLIA 1H1AA 4SBVA 1AR61 5CU1A 5IVCA 3OSDA 4A7YA 4A7KA 5CFCA 3H8RA 2RMU1 1EAH1 4Q0VA 2J1AA 1LULA 2PHWA 4GB31 1WBLA 1G6NA 2J22A 4GH4C 3PUQA 1YLLA 1MS9A 4R9CA 4Q4W3 1XJAA 1MPXA 1GMMA 3AYCA 3TN92 4J25A 3VD3A 4XZPA 4YW1A 1ZA4A 1A34A 4FTSA 4XIKA 5A3OA 1QXRA 5ACA2 1RUJ1 4KU8A 1ZZ8A 3NAPC 5FP7A 1DQ0A 2GP5A 2YZ4A 1JZ4A 3VDBA 4GAZA 4CEYB 3I2FA 4LTAA 4M3CA 4CUCA 5LA1A 4CP9B 3DXUA 3HWJA 3VZNA 4CCCA 3NJZA 1CAXA 2XBO1 2NN8A 2Y60A 2ZOEB 3E5XA 4PLMA 4Y33A 2Z69A 4K1ZA 3BTAA 5A33A 2A73B 3LAGA 3KGZA 4TLFA 5FZ6A 5ABJA 3T2PA 3VBHC 5C70A 5JLVA 1ASJ3 4IGPA 4ASMB 1RVF1 1K5MC 1OSGA 2C1FA 2WO1A 4L8QA 4R8HA 3THPA 3ILFA 3N36A 4FPHA 4XF9A 5FZMA 5BUVA 5CISA 1IS3A 3PJQA 3KSCA 5FYVA 3GCWA 4B1MA 3P1IA 3LKJA 4NVPA 3PHMA 1QJU1 3M3OA 2WIIB 2DTWA 2WC2A 2ZABA 3GDBA 3UYJA 3VBSC 4WVVA 1AHSA 4NRPA 4GD4A 4O9EA 2FDJA 4KNCA 5JI9A 1QOTA 1JOBA 5IAVA 1O3RA 1F4AA 3FHQA 3ZSKA 4WBBA 1COV3 1H2LA 1XRUA 5B4NA 1N3QA 1LOFC 4KG8A 2PAEA 3WCSA 1HRI2 1GWLA 1HJFA 5FYHA 1G7YA 5FZ4A 1MS1A 2RDSA 2CTVA 2R072 3W21A 5JMCA 2HYXA 2YU1A 4HVRA 4NROA 4UFKA 1SBEA 2D93A 4J1XA 2VL4A 4HPKA 5FYUA 2LS6A 1HW5A 4TTGA 3BTYA 1YCIA 4EROA 2FCVA 4NE9A 1KRIA 1QJX2 2D97A 1GUIA 2X29A 3NNJA 1JYWA 1CD3G 2JIJA 4XXAA 4AR2A 2ZTNA 4Q8LA 5E8AA 5FTTC 3VHPA 2JG9B 1V6MA 5L7OB 1W3VA 1UQXA 2DCYA 3U11A 3WP4A 1ZBE2 1F5JA 5FZFA 3U78A 5DDJ3 1VAVA 4XVHA 3UKNA 1E5RA 1H1IA 3ILNA 1PVC1 1YHFA 2TBVA 1IPKA 3KHBA 3I2OA 2GC1A 1P8JA 4G3YC 4H2AA 1GP5A 3KT1A 3VBOC 1GOGA 2XVLA 4Y3OA 4YZ4A 3FUOA 3VKLA 2B7YA 5CAZA 5LK7B 5DMYA 5FPZA 2R32A 1EUUA 1PM4A 2RR13 3H0OA 4XJWA 3WHUA 5SV5A 5FIXA 2XJRA 4B4PA 2RE9A 1YI9A 2O14A 2Z79A 2GNBA 4AGVA 4I01A 5CFDC 4HBNA 3KCCA 2KA3A 1OQ1A 3N9OA 5FPLA 4RHV1 3ZPOA 1S0FA 1XSQA 4NIIA 1Q56A 2CYFA 1NLRA 2EVXA 2V5YA 3CJIC 3B94A 5T55A 4EZHA 2EIDA 3GZUC 1RUD3 4QX3A 3GALA 5DDJ1 4LOTA 4MGSA 4BE3A 1UY0A 5E6HA 1NUKA 3RVHA 1RUI2 3W20A 3NV3A 5BV6A 3NSTA 1XE7A 4CUBA 3BTXA 4XAEA 1O59A 1VMFA 3WF2A 2LTNA 2IFWA 3WDVA 2VGDA 4JC1A 1GV9A 1JXNA 3GGLA 3I59B 2I07B 4M00A 5G04L 4OI4A 1VRH3 4HSLA 4ZU5A 1W2UA 1W6NA 3K46A 5BPXA 1HQNA 1VBB2 1OLME 4URTA 5C9AA 3LDKA 5JZGB 4BMBA 5BY5A 1ULGA 2WT2A 1Z78A 2EA7A 4P00B 4AFCA 3M3QA 3HD8B 2PHUA 2WT1A 4MXVA 3GF6A 1Y9QA 2RJ2A 2DVBA 4S2DA 4CDUB 4GIQA 1AL22 1QDCA 5KHGA 3W58A 3ZOIA 3BIEA 2RS53 4LQRA 5C8CA 3M2MA 5JR7B 1GOHA 3EHKA 4XAAA 1SLBA 1POV3 1RJ7A 1YI7A 1WMXA 2CSGA 5A7NA 3WNMA 2JB8A 5GJ6A 2IXCA 4MXWA 1PIV3 4R4ZA 3DKQA 1OLMA 2LM3A 4AHXA 5SV8A 5IYYA 2R1BA 1IQDC 1YFXA 1AL0G 2WQZC 1CR7A
chains in the Genus database with same CATH topology
4XBQA 1W6OB 1S0EA 2C9AA 2OVUA 3N4MA 3RYKA 1FNZA 2DTYA 1BBT3 4MSVA 1JUIA 5E16A 4PLOA 4XFHA 1PM7A 3WP5A 3WZ1A 1HRV3 1FX5A 4XFIA 1QU0A 1LU2A 3ZSEA 2RS51 2VVEA 3G7DA 3H3ZA 1N1VA 4Q4X3 3POYA 1XNCA 5DUVA 1SQ4A 1POV1 4HN0A 2VOVA 3AP6A 1WCDJ 2YYOA 5CVRA 2PLV1 2JKBA 2XJTA 1NQDA 4L97A 2DUOA 1ULDA 4XTPA 2XLFA 1AR71 2BYVE 4MUVA 2AENA 2WA4A 1G9AA 1LOGA 5DG1A 1GNHA 3MLLA 3MIDA 5DZEA 2ZZJA 4AEJA 1HRV1 2VY0A 4W65A 1W6MB 1QQP3 2QVSB 4BHPA 5KBFA 2AREA 2HWC2 4FPEA 1LJ7A 1QH7A 4FSJA 1NCQA 3B9CA 4K3UA 3ZMOA 5BNOB 1H30A 5HCAA 1G8WA 1ZYBA 5IT6A 1RTVA 2QUOA 1CPMA 3OBRA 5J7MA 1Q8OA 1DHKB 2WL1A 4RR3C 1VBC3 2ZHMA 2XHKA 3CF6E 2VXRA 4YGBA 1PK6A 1LGNA 1D4M2 1RUG1 1W39A 3AYEA 2R061 4S2GA 3WQ0A 1CGPA 3TRSB 3IDBB 2ZX0A 2JENA 1S0DA 1W0OA 4I0AA 3URFA 1AX1A 4A3XA 4I3PA 5CG9A 4K1YA 3NW4A 3PVNA 3OYWA 1DFQA 1JOJA 4NWWA 2A71A 3AZXA 2RS12 3OJBA 4N9HA 1S0CA 1YJKA 1AR83 1WD3A 3M3IA 3IPVA 4K20A 1KDKA 5CFCB 1BEV2 2MEV3 3MW4A 1MR5A 3QH7A 1UF2C 1OOPC 4P9JA 4W6WA 1SBFA 2ET1A 4EN8B 1PO11 2A3WA 3TYJA 3UJOA 3VBRC 3AP9A 4LNVA 1KJLA 4H7LA 4AFMA 1CONA 4OLLA 4BM8A 1JH5A 2QDNA 4FTEA 2ZZQA 3GHNA 4AW7A 3N35A 1BVP1 3VKMA 4M3CB 4XFAA 1CAXB 3TN93 2PQQA 2ZAAA 2NMNA 2PHDA 2TNFA 4KG0A 3WUCA 5ACA3 4XFBA 3QBQA 4C0BA 5A33B 3HR9A 5ABJB 4YVSC 2WS91 1HKDA 1YFYA 2MEV1 1U5ZA 3ZSMA 4YFZA 2OZ6A 2GU9A 5AC91 1FOD3 1GQHA 3RI8A 2ZMLA 5F6KA 1H8TA 2CY6A 4META 5FMOS 2XUMA 4FPJA 2A5ZA 2DCTA 3B7MA 1QOSA 1OLQA 2D6KA 5JOYA 1RUC1 1RB8G 2YGLA 4QM9A 3SMHA 1AUYA 2XKOA 3VDDA 2B8MA 2LALA 4YVWC 5JCTA 3JU9A 3TN91 3OGGA 1RUH1 2WZR2 1BMV2 4LO6B 2DVDA 5C4WC 4EV0A 4FTBA 1WCSA 4HK8A 1PHMA 1H1MA 3TAYA 4HANA 1UZYA 1HDKA 2IZWA 3MW2A 4LULA 1Z7S2 2O8OA 4AXOA 5GLWA 2HWE2 5T5LA 1JUHA 2GNMA 1ZBA2 1EY2A 1ND2C 2HWB2 1QNYA 5E1RA 1LOBA 4HPKB 2WSUA 1KD7A 5LRSA 3VKNA 1HRI3 2Y38A 4WVWA 4BCUA 3VUOA 3IKWA 1WW6A 5DZGA 5A3LA 1S0IA 4AVVA 4BA6A 2PELA 1C57A 1XYOA 2DWRA 1QJX3 1ND3A 1IKQA 4HN1A 3ZFGC 1DGWX 1GQGA 4TZDA 1ZBE3 2IXJA 4O9GA 4XMIA 2WWSA 5KHHA 1DBNA 1LEMA 3SITA 1H0BA 1O4ZA 2ARBA 4CDWA 1C5HA 2FQPA 1D4VB 3E6BA 1HRI1 3AM2A 4A2UA 1LOCA 4RQPC 4FPCA 4WM7C 3VZLA 2BQPA 2JX9A 2R071 4AVSA 5JVVA 2P3IA 1NQJA 5KXCA 2HWF1 1OA4A 3SLIA 2GNDA 1FPN2 2D3RA 4XHXA 1W6QA 3AYDA 1QXPA 1Q3EA 1QJX1 4AEDA 2WFF2 1HQWA 2RHPA 2G4IA 1X82A 1UKGA 4COWA 1X33A 4V1PA 4MYEA 3E6CC 4IETA 3ACLA 4IV3C 3N7LA 2VPVA 1W6NB 3WHTA 2ZMNA 1MVEA 5C9AB 3DPRC 4AQ6A 4EWEA 3L2YA 3QOPA 2GZWA 3OGJA 3SNMA 1R092 3O12A 4AYUA 4EWAA 1RUD2 2EF6A 1KS5A 2ARXA 1SFYA 2D6LX 4HETA 5GM0A 1VBB3 4B8EA 4XJ8A 2BW8A 5C8CB 5AVPA 4DPNA 1UU4A 2ZGTA 4AQSA 2HJIA 1V00A 3GBGA 4MXWB 4M01A 1L3JA 1RUI1 2K0GA 1AL23 1V6LA 5I0UA 3WY6A 4UBHA 3ZYPA 4UBGA 1AYM1 1S0JA 4HLTA 3UV9A 2YROA 3EXUA 3ZSLA 3W9AA 4Y24A 1APNA 2O8QA 4D7TA 1NLSA 2X5IA 4B29A 2GDFA 2YMZA 2DYCA 3GBFA 1V9U1 1TMF3 2R49A 3MGUA 4Q4V2 4FAHA 4NN0A 1VBB1 4XF3A 3AKPA 2QJVA 1V70A 1WBFA 4MGIE 4HZFA 1JHNA 4QPGA 1C1FA 2P34A 1O5LA 2H6CA 4R9DA 2H0BA 1PIV2 1J3QA 5BNQA 4CEYC 4QQLA 1AL21 3AJZA 3CL1A 3O0XA 2D44A 2D98A 2V73A 5FAXA 1I5ZA 1WMEA 4QHBA 4GH4A 5FFOC 4E9KA 2WKKA 1PGW2 3TBDA 5FMOL 3J8F1 4GALA 1GR3A 1GNZA 4LT5A 2WNVA 5FOJB 4JTOA 2Q5TA 5K7PA 1NCQB 3ME2A 2DU1A 3PMEA 4YW5A 3ZVXA 5CB7A 3KM5A 4ASLA 3U10A 5I0SA 1ONAA 3LA3A 4PBOA 5HCFA 4DRVA 2R042 1N1SA 4ZU7A 5DZFA 1K5MA 1NG0A 1ENXA 4WZCA 1SFNA 1XQNA 1PK6B 3JBG3 3LSDA 4P9XA 1CJPA 1Q8QA 1V6JA 2UY8A 3UKVA 3KQRA 2UU8A 5IK7A 1QQP2 4ZXKA 1U5XA 3TNQA 4IEZA 3ZYJB 3ZN5A 3MIFA 3VL8A 3ZXAC 1Q5OA 1H4HA 3M1HA 5JPMB 3OYWB 1D4M3 2ZACA 4Z2WA 3LWCA 2JG9C 4JGZA 2DCZA 2XH6A 5T5JA 5L7OC 1R1A2 3AKRA 1O3QA 5JI7A 2HWC1 4XOGA 4YM2A 3M8LA 4D7YA 4F8AA 3IPVB 4OHXA 3QACA 4L11A 1UIKA 3CJXA 3KCXA 2XVGA 4HSJA 2Q1ZB 5CBLA 4LHLA 3S30A 2RS13 2VMGA 4AGRA 4C1WA 1M4WA 1UL9A 1UU5A 1SCRA 4COVA 2RS31 4CDXA 2R30A 3SXWA 3RNSA 4A7ZA 1CAUA 1BEV3 4BWOA 2Y0IA 3JCIA 3M4FA 4OI0A 3B93A 1BXHA 4Q8KA 1SEFA 3BODA 3ZFFA 1BCXA 4XF4A 3T1MA 4LLOA 3WLUA 4E4ZA 2SBAA 3AMQA 4RA0A 1AR82 1POV0 3EQEA 2A3YA 2BVBA 4GXLA 2ZGOA 4BH9A 4RGAA 1FMD2 1I1EA 5GZCA 3JB8A 3TOJA 5JOZA 4XQWA 1DG6A 2RS11 1HXS2 5BNNC 2GALA 1H8TB 4EN9B 1ZZCA 1DQ1A 4E2SA 4H3WA 1SLAA 4KH9A 1DQ6A 2R16A 2W0XA 1BEV1 1NOVA 4XHBA 4OHZA 1ZZBA 2OUJA 2UY9A 4AEKA 5JZGC 1U5IA 3VDDB 3CJIA 4XE9A 4M0HA 2W52A 5I0RA 4Q4Y2 5GALA 4ATFA 4C90A 4OHVA 5K0UA 2D6OX 3MIHA 3KT4A 4CDUC 2VVDA 4C0HA 3P3PA 5IK8A 3LOBA 1TME2 4QQ2A 1FOD2 3WQ7A 2VNRA 3BALA 2WZR3 1OKQA 2CNAA 4P9GA 4Q1RA 2D6PA 1MQTA 2NP0A 3DGTA 3RMYA 4IL7A 1J1TA 1UPSA 1OLRA 4LBOA 1X8EA 1Z7S3 3PVEA 2HWE3 4Q4W1 1EV13 1BQPA 1ZBA3 2HWB3 4FXGB 4R9AA 2VH9A 3WG1A 1QJY3 4CDQA 2BNNA 2GC3A 3MPBA 1ND3B 3WG4A 1VBD2 4E2GA 2QQPA 4QGLA 1S55A 4Y26A 2VW0A 3VL9A 4Q1PA 2P3KA 4WM8A 3WV6A 2VULA 2WZR1 4QPYA 1RL3A 1XU1A 4XBLA 4CDWB 2KXLA 1ASJ1 1D2SA 2XVKA 3OPZA 1OQEA 3KLSA 1RGSA 1YFWA 5GLUA 2HWE1 3V56A 1W6PA 3VBUA 3VLBB 3RMXA 2BPA2 3MPPG 4LO4B 1URXA 4I0BA 2HYKA 3S0MA 2PAKA 5LRRA 4FPFA 1W6QB 5EYXA 1AF9A 4YZ5A 1CN1A 3ZFEA 4AEDB 2FZ1A 2XJPA 4PQ9A 3PJYA 4EJRA 1IS5A 3U4XA 3SCHA 1FPN3 2RM22 1U12A 2BUKA 1LB2A 3ETQA 1IKPA 5H9QA 1VIWB 1WCKA 1QJZA 1AVBA 1COV1 4AWDA 4JGYA 4NWVA 2WFF3 4QGMA 3PLQA 2PTMA 4PDWA 1GZCA 3V65A 3WG3A 3WDYA 4DXZA 3HAGA 4XFGA 5IK4A 1EPWA 3ROUA 3USSA 1LHUA 4Z92B 2OA2A 4BZ4A 1YNAA 2DF7A 3HMYA 4Y22A 1WA4A 2RJKA 4RS5A 1DF0A 4Q29A 3E97A 3WOGA 5IK5A 2YDEA 2ZCWA 2E7TA 1R093 2KM2A 3UKTA 4ATEA 1Q43A 4Q2FA 4W6YA 3DN7A 1FPN1 2R1DA 3JQXA 2AGSA 3IDEA 1XYPA 1NY71 3WW2A 4Y5Z0 3VHOA 1LU1A 3CNAA 3AFGA 2RR11 4FQ4A 4L9BA 2X5IB 1BK1A 4OFGA 4INDA 2PN5A 3W59A 5CFCC 4Z07A 4IEUA 5GKAC 4B3NA 4XJZA 3WINE 1RUF2 2ZGLA 4JCKA 5JSPA 2AH2A 2TUNA 3GZTB 4RGGA 4D7SA 1Q8VA 4LE3A 4QPGB 2R0FA 4FOQA 3EBRA 4OVEA 3ZSJA 1RUD1 1G9CA 4YRDA 2GMPA 4Q4V3 2HEVF 1RHI2 4FO9A 4QPIA 4FOVA 2WZPP 4CRQA 3CO2A 2PHFA 5FO7B 4GH4B 3ENRA 1H9PA 5ABJC 1C8M2 3S7IA 3OY8A 5T50A 3WR0A 1TMF2 1VRH1 5T54A 4RL7A 3K51A 2WNVB 1EP0A 1Y43B 4HT1T 4XXPA 3WDUA 1REFA 5JDBA 1O5UA 4QU2A 2JG8A 3ZIXA 1DQ5A 4AI2A 3N7KA 4JRLA 2BTVC 1VB2A 1OD5A 2JE7A 3U0ZA 4LBJA 3S6PA 1F2NA 2AUYA 3VZJA 2YHJA 4YM0A 1X36A 1OPOA 1PGL1 4G9SB 3VHRA 4FPGA 4BPZA 4XW3A 1K5MB 5FREA 2BWAA 1UPIA 1PIV1 2XJUA 4HMZA 4AF9A 4EN7B 3NKGA 1B35A 3KMHA 4IV1A 3BB6A 3DF0A 2R043 1CAVA 2BNMA 2QDRA 1BBT1 2NMOA 2QZ2A 1AXZA 2D3PA 1PGW1 4FAGA 4DFSA 1R1ZA 4JGZB 2GNTA 4OZXA 3H7YA 4FOWA 1LCLA 1OI6A 1WLCA 3BIWE 1F8VA 1PZ9A 2D5FA 4Q4X1 4W6XA 2MPFA 5KWRA 3B3QE 1ZVFA 5DUUA 5JIUA 2PHRA 5EYYA 1QDOA 4P9IA 2VOKA 3JBG2 4IXLA 1IS6A 1KFUL 1DZRA 1RUE2 1VLNA 2W08A 3AP4A 3IWZA 4FPOB 4LHNA 5FO8B 1ZZ9A 1DU3D 2A7AA 2EAKA 1R1A3 3B69A 3RWNA 2E6VA 4CDXB 4MX3A 3ALQA 3MW3A 1CAUB 1SLCA 1O3SA 3RPQA 1ZZ7A 3RG0A 1S0BA 3ZFFB 2CL2A 3NV4A 1QHDA 5LEKA 1A3KA 1QQP1 1FV2A 3B5LB 1RMU2 1QOOA 1H2KA 3AP5A 4Z8BA 3VBFA 1R082 4Q0UA 3V0AA 4YFWA 3SISA 3UL2A 1F31A 4BYYA 3NWKA 1R1A1 3WW1A 4Y1UA 1E57A 1VBE2 1A78A 5BNPA 3J26N 1VBC1 1FMD3 4KQ7A 2ZJCA 5C9AC 5I91A 2VU9A 1ZX5A 3CJIB 1OHFA 4DS0A 2HWD2 1HXS3 1VB4A 2ZA9A 3UJQA 1QNWA 1QY4A 3AMPA 4XMAA 1BKZA 2IC1A 5GLZA 1G9BA 4Z1VA 5K0UB 1D2QA 1V6IA 4QGNA 5GZGA 3J9SA 1YJLA 1IQAA 3R4SA 5D1IA 5FOBB 2NLRA 5C8CC 2IFRA 1J59A 2RMU2 4Q4Y3 4IV3A 1DIWA 4ES8A 1MQTB 1AR81 2EIGA 1ZRDA 5I8TA 1QGLA 3B02A 3AB0A 5T5PA 1DGRA 4G4FA 3ES4A 1RUJ2 3NVCA 5AFBA 1TME3 5EFUA 4P9LA 1HXS1 2Q4SA 3DV8A 2FMDA 4LO5B 3ZXGA 4CDQB 2WQ4A 4EN0A 1MS3A 2CGPA 4FPYA 4N53A 5CNAA 3RS6A 1DZTA 4YZ3A 2XJQA 2NZ9A 4R9BA 2QFEA 4GMP0 4WM8B 4Q4Y1 1YRZA 1RVF2 4XDQA 4KBBA 5ACA1 2UWAA 4Y20A 3HQXA 2ET7A 2HEYF 3WVJA 1OMIA 1Z0HA 2YXSA 3CU7A 4DB5A 4BQ1A 3LZZA 1VBD3 1F9KA 1S2KA 4H7MA 4JDNA 5HBAA 1FOD1 3VBUB 1W6PB 3WCRA 1EV12 1QJU2 1MS8A 4YZ1A 4MGYE 3R6SA 1KFXL 1MEC2 1RUOA 1QJY2 5EJ3A 2A6YA 3R4UA 1LHOA 3ZFEB 1YIFA 4U2AA 1U5YA 3TB0A 5I0TA 1HQLA 2D43A 5FLJA 3INAA 4CTEA 1B09A 1SMVA 1NCQC 5L73A 4AVTA 4FT8A 1MZEA 4JGYB 1MACA 1GBGA 4E27A 1VAKA 5F9TA 4MH0E 4PDWB 4ORFA 5EV7A 4CEWA 2GMEA 4RD7A 4LE4A 3Q9OA 2RM23 4QQPA 3IIAA 1PK6C 2GH8A 1KQRA 5D8AA 4Y22B 2IXKA 4YARA 2K9ZA 4ISRA 4RS5B 2AR6A 1ZZ6A 2BNOA 4KL1A 4DY5A 1MS4A 2B9UA 1A6CA 3ZN6A 1AZDA 1W0PA 3AYAA 2CGOA 4GULA 3FFZA 3V64A 4AI8A 1QF3A 3E6DA 4HL0A 1AR92 1NCRA 1RUNA 4ZU4A 1YUDA 1OFSA 2WFPA 2EXHA 4SLIA 2FHRA 5KC6A 4KWLA 1ZBE1 3MIGA 4LHKA 3IBMA 2K2SA 3PMSA 2RM21 1DQ4A 1EYBA 5FLIA 3SCFA 4XF0A 1MZ6A 3AJYA 2N7GA 1S1AA 3HIFA 4Q0SA 1NA1A 3RJRA 2DU0A 2ZGPA 3B00A 1JYIA 1O7FA 1JBCA 3N7JA 4N43C 2D5HA 1RUF3 4QPIB 1JN2P 1VBA3 4FOYA 1UN1A 3TWIA 3VZOA 3DL3A 3SCGA 1IHMA 3D8CA 2WLPA 5J3UA 2CWMA 4X8PA 1GLHA 3C2UA 3OY8B 4JRAA 5AVAA 3VZKA 1KS4A 1RHI3 4IEXA 5JOXA 1H8TC 4J6GA 5I8SA 3MF9A 2FMYA 1KITA 2G9FA 4C1XA 1O4YA 1QMJA 1Y3TA 3WDWA 1UX6A 2JG8B 1C8M3 4P9YA 4PIXA 3JQWA 4R52A 1VR3A 3I4IA 4QMAA 2VNGA 5FRAA 3B01A 3VDDC 5TSWA 4Q0PA 1PO23 1YYNA 1CJDA 2ZGMA 2JEMA 1VAMA 1N1TA 2WNUA 5J98B 2XKPA 2ZX3A 1CQ9A 4JQRA 5BNNA 2I45A 4MGKE 1RJ8A 5DUWA 1RHI1 1CVNA 3POSA 1B35B 4IV1B 1LESA 2R6QA 4HFSA 1CAVB 5FDBA 4IEWA 1AJKA 4XFCA 1BVVA 3BPZA 1TMF1 2GSYA 4NPRA 2Y26A 5T5OA 2CV6A 3UK9A 3H1WA 1G9DA 3ATGA 1WW5A 3NAPA 4L92A 2PHTA 4XTMA 1OPMA 3EJKA 1TEIA 3MICA 2QE3A 3MFCA 1AR72 2B5HA 3FWEA 1ND3C 5C6CA 5KC5A 4MZUA 1ALYA 2V09A 1ZREA 1ENQA 4LBQA 3BOPA 3H50A 1WD4A 4GMP3 3MEPA 1LKNA 4LA3A 5LEJA 4QX5A 3VBHA 1C4RA 3THTA 4FXKB 3M3EA 4CDWC 1WUVA 2XB6C 3ZYIB 1XNDA 3P3NA 1RUE3 3GHMA 4FVVA 2JJ6A 3AMMA 5J37A 1GZWA 2H6BA 1REDA 2O1QA 2W39A 4KGGA 4AG4A 4YLZA 5DXDA 4E4SA 1QH6A 3VBSA 3VBFB 2NQYA 2ZKLA 1OQDA 4AEDC 5KHJA 3V0AB 4C91A 4IEPA 3C3VA 4Q0QA 1YIPA 4GMP1 1RUG2 2UWBA 5BNPB 1LOFA 2R062 3O14A 3MLJA 1RMU3 3KGLA 3VKFC 4COZA 1XXNA 2DUQA 1PGSA 3JBG1 5E88A 4PBPA 5J36A 3ZDSA 1R083 4XQDA 1RUE1 2VMIA 4X6QB 4AGGA 4N7IA 2YPJA 2OIIA 3I2DA 4LUMA 1FXZA 5CG8A 1VBE3 5K8SA 2OYZA 1T6GC 4Y1VA 4E4DX 3AP7A 2ZMKA 2QNKA 3I54A 1D4M1 3RZZA 3ZIWA 2HWD3 3ZXFA 3NKTA 4XBNA 3NO8A 4IV3B 2XG3A 2VQ0A 1PZ8A 2IXIA 3O0WA 3WW4A 1PO12 3VBOA 3RSJA 2XJVA 3IT8A 2AZ5A 2JD4A 3HT1A 4NR1A 3RYRA 4BOWA 4LEJA 1R081 2VG9A 2RMU3 1EAH3 4YW2A 1I6XA 2X5IC 4YGEA 3ZXJA 4GQ7A 2DCKA 3AXEA 5H9RA 2VOWA 1VBE1 2VW1A 2X53S 3ZPYA 1V6OA 3APBA 5CFDA 4AEMA 2GH2A 2JE9A 4LR4A 3VKOA 1DDLA 4N53B 1UCXA 3LGRA 4FCAA 1RUJ3 3LA2A 1RC6A 1LTEA 2QKDA 2WS92 2CAUA 2HWD1 3N3HA 3PVBB 3ST7A 4QPGC 3D0SA 3WDTA 3V0BA 2ZKNA 1NE4A 4D69A 5AC92 5F5QA 4Y20B 3IM0A 2XBO3 5B2GB 4M3CE 4I0WB 4Y4YA 4CYDA 1XYNA 2A6ZA 1RUC2 5DG2A 1IOAA 3JD72 5L36A 1M06G 1NYWA 3ELNA 2ZGSA 1RVF3 3D82A 3VZMA 1GANA 2ERFA 3JB4C 3WW3A 1RUH2 1I9RA 2A75A 1PVXA 3FBMA 4XYXA 3K48A 4AHYA 5E89A 5FCCA 4AVBA 2WNVC 1QJU3 3DKWA 3FLPA 4TYSA 2Z2SB 1MEC3 1F5FA 3D5OA 4FPLA 4NHKA 1OFNA 1AXKA 2FBEA 1CESA 4BIFA 2ATFA 4PCRA 2WA3A 1KXGA 1N47A 4GWNA 4WV8A 4CEWB 3SH4A 2BBVA 1BMV1 3IMNA 4CP2A 5D8AB 4NO4A 2HEWF 2B39A 2VECA 2A70A 3H1MA 4YYOA 5KHIA 1IGOA 4WZFA 1QKQA 1Z7S1 1GZ9A 1OA3A 5GZFA 1EV11 1ZBA1 2HWB1 1LHVA 2VVFA 3ZN6B 1MEC1 1QJY1 4Y1ZA 1NXMA 3N7MA 4N7UA 5BXXA 1NCRB 4FP2A 4P14A 1RINA 3MYXA 2CGNA 2Q0AA 4JGZC 4JV4A 1LOEA 4CP0A 1PVC3 1YO8A 4FPKA 2C0ZA 4N9IA 5AFEA 1DYKA 3L2HA 2VNOA 5BNOC 1AR93 1C1LA 3HN1A 3WXPA 5K9YA 2HWF2 3KT7A 1JYCA 1H8VA 5BYNA 1CAWA 1NA1B 2UWCA 4M3CF 2BFUS 3FX3A 3QLQA 1SLLA 4CDXC 4E2QA 4YZ2A 1A8MA 3LA7A 5HXVA 1LOAA 2JXAA 4CZSA 1PZ7A 4RHV3 4WVMA 2OUHA 4COYA 1KJRA 1FATA 2DFBA 2VOXA 2I2SA 1OA2A 3ZFFC 3D0JA 2ZGNA 4TSVA 1J58A 2SLIA 2QCSB 3ILRA 4AI1A 1LHNA 3H3UA 4H55A 4OUSA 1AYN2 5FLHA 1DLLA 2EXJA 1WW4A 1QXJA 4XJUA 1AR91 4FP3A 4IEVA 1YXWA 4RR3A 3AX4A 3PTYA 5FO9B 2WFF1 4WVZA 5FPXA 4PF5A 3OBTA 3LCPA 2ZGRA 3GBWA 3ECQA 1WMDA 4YG3A 3KS7A 4PIYA 4Y1XA 4YNIA 2JDZA 4FBFA 2D6NA 1ZRCA 3FC0A 2OPKA 1VBA2 2YGMA 2IWGB 3OF1A 4HVQA 3RJ2X 1GSLA 1R091 1AYM2 4IQPA 2C5DA 3AK0A 5K0UC 2D7FA 4HKLA 2WNUB 4TWTA 2PAMA 1WLDA 2TEPA 5BNNB 4M0NA 3WT3A 4XQ4A 4K40A 1Y7BA 1J1LA 3AFKA 4ZKTB 3MF6A 2PYTA 4IESA 1V9U2 4YSFA 2BVVA 4KWJA 3RDIA 1G86A 4LBLA 1H9WA 1MS0A 1MQTC 2EALA 1CIWA 1OOPA 2AYHA 1C8NA 1HV1A 3KD4A 3WDXA 2WINB 3VBRA 2XWJB 1PO22 3R0RA 3NAPB 4FQZA 2DVAA 2BEOA 4LBMA 4CDQC 2DCJA 4B7EA 4XILA 1JTZX 4AE2A 4GWMA 1A8DA 4Q4V1 5CA6A 1LEDA 4LBQB 2R0HA 1LHWA 3RRDA 4AQTA 4WM8C 2A6VA 2PLV3 4YVSA 2F4PA 3ZXEA 3FJSA 3VBHB 3TNPB 3CEWA 4AVCA 4X8NA 1AR73 1UU6A 1FI2A 1AJOA 2XL7A 4PLNA 2LUWA 4K7JA 2BGCA 4ES9A 4AK3A 1PMIA 1GZWB 3VBUC 5L19A 4I3GA 4LA2A 3R05A 3FLRA 2YY1A 1S0GA 4RFT0 4L2NA 3WD5A 5J48A 1HIXA 4YVWA 2Q8OA 3VBSB 3B9IA 1CX4A 3ZFEC 5GZEA 1UW8A 3ZMNA 5C4WA 3SHRA 4Q26A 5T3NA 1SACA 4AVAA 4JGYC 4QXKA 1XNKA 1ND2A 2E7AA 4PDWC 2G9GA 5CIRA 4HK9A 4QD2A 5GLTA 5T52A 2MNGA 1RUG3 2XGXA 2R063 2R041 1DGRN 3QCWA 4DQAA 4XETA 2XLAA 4HKWA 2JECA 4RS5C 3BU7A 2B42B 3MIBA 4IERA 4OUMA 3U07A 5I93A 5JSRA 3SH3A 3PVOA 4DOUA 3ZYGA 4XPVA 2B46X 1TNRA 4I30A 1ENRA 2Y0OA 3OD0A 5KXBA 4S2FA 3AKSA 3T1LA 3VBOB 4OI2A 2Q1MA 1SBDA 3ZFGA 2CAVA 3LSEA 3ZN4A 2RS32 3FMGA 4UW6A 4JDMA 2FZ2A 4MGZE 4LUKA 3AKQA 4YG6A 1LGCA 5JPNB 5KXEA 2UYBA 3OCPA 5CFDB 2QZ3A 1PO13 3HBZA 4RQPA 5FQ0A 2BFUL 2GAUA 1MS5A 4WM7A 3RI9A 1GYKA 2YC0A 4KGQA 1PNGA 1JW6A 4PJYA 3AZWA 1NZCA 1SLIA 3V0BB 2ENRA 3O5SA 1UIJA 1C28A 1VJ2A 3AZZA 3R4DB 2ZBJA 2E53A 1IS4A 3IDCB 4K8FA 5FBZA 3O0VA 4QPIC 3ZO0B 3ZXDA 1AR62 4K9SA 1D0GA 2WS93 1EAH2 3D6EA 3J4UH 1LRHA 4GB32