4HK8A

Crystal structures of mutant endo- -1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
b'TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVQGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 52
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hk8A00
1YNAA 4S2HA 2JICA 1OLQA 4HKWA 3WQ1A 3WXPA 2DFBA 1OA2A 4HKOA 2BW8A 2NLRA 3MFCA 3AMQA 2F6BA 1KS5A 1H8VA 2B42B 1OA4A 3VHOA 3AKPA 3WQ7A 1BVVA 2NQYA 1XXNA 1UU6A 3WR0A 4H7MA 3VL8A 1T6GC 2QZ2A 2JEMA 3VL9A 3AMPA 3VHNA 1XNCA 1BK1A 3WP4A 3VZKA 1HV1A 2BVVA 4S2GA 3EXUA 2BWCA 2DCJA 2C1FA 2D98A 2DCZA 1XNKA 1XNDA 3VZMA 4XQDA 1OLRA 3MFAA 3VZLA 4NPRA 3MF9A 3VLBB 3B5LB 3VZNA 1W2UA 3VHPA 3VZJA 2DFCA 1BCXA 1NLRA 1AXKA 2Z79A 1ENXA 1REDA 1XYNA 1H0BA 1F5JA 1H4HA 1UU5A 5K7PA 3M4FA 3RI9A 3ZSEA 4XQWA 1H1AA 3VGIA 1HV0A 1TE1B 3HD8B 2VG9A 3WX5A 2B45X 1C5HA 1XNBA 2DCKA 3RI8A 3WY6A 3AKSA 3AMMA 2QZ3A 3AMHA 3WQ0A 5HXVA 1HIXA 1PVXA 5K9YA 1QH6A 3LGRA 4XQ4A 4S2DA 3AKRA 3WP3A 3MF6A 1IGOA 5EJ3A 2VULA 3WT3A 2BWAA 3AMNA 3WP5A 1H4GA 3AKQA 4HK9A 2VUJA 1XYPA 3VZOA 1UKRA 2VGDA 1QH7A 2B46X 2DCYA 3AKTA 2D97A 1UU4A 3WP6A 1M4WA 4S2FA 3LB9A 1XYOA 4IXLA 1C5IA 3B7MA 3O7OA 1KS4A 1REEA 4HK8A 4HKLA 2JENA 1REFA 4XPVA 1OA3A
chains in the Genus database with same CATH superfamily
1H8TC 1O3TA 1FMD1 1A3KA 2QQVA 1H8TB 1YRZA 2JICA 3U4XA 3UYJA 2XOMA 3TEWA 1GNHA 2VOWA 1RUF1 2VZ1A 4P5HA 3JXSA 4UBHA 5GZEA 3HNMA 3WG3A 2K0GA 4K9SA 4LORA 1T6BX 2YC4A 3PU8A 1LGBA 5FBZA 2BV4A 2CWMA 2DYCA 1GZWA 2E53A 4YGEA 5E16A 4NUBA 2R7EB 2XH6A 5DG2A 3VDAA 5ACA3 4YLZA 1JYTA 2A5ZA 1DHKB 2BGOA 3E97A 4K8FA 4KBBA 3N3HA 1EPWA 3PURA 4CDXA 1W6QA 2XJRA 2DF7A 5BNNC 5BNNB 1AYM3 5F6LB 2C24A 2QFEA 4QKDA 4Q4W1 2RMU1 2NMNA 3I3QA 3N9QA 2WABA 2WFF1 3FBYA 3TRSB 2WWUA 1R082 4DNYA 3RSJA 4Y1YA 2AEYA 2R061 1F15A 4K1YA 5LBFA 3VZKA 3BIEA 3RVHA 3EJKA 1PGSA 3OEBA 4ZPIA 1VRH1 4GMP0 4QPWA 2ZMLA 4GJYA 2V72A 3UNPA 1LHOA 4NIDA 2CL2A 5T5PA 3CBNA 1R083 3BPZA 4NAOA 4PIYA 3ZN4A 1OKOA 2D6OX 4BB3A 4P9YA 1U0AA 2Q4SA 1YEWA 2VPVA 3GYDA 2CGPA 4A7KA 3FZ3A 4JCKA 4GWJA 2JKBA 1IKQA 4BCUA 2VTXJ 4BHPA 1TNFA 2ET7A 2QQKA 1AR73 1BEV3 3M3QA 3N9MA 2PQQA 4IE4A 4MGZE 3R0RA 1I9RA 4AE2A 4Q4Y3 2G9FA 1ASJ3 5HXMA 4D7YA 2BGCA 2DURA 1DCSA 3K4ZA 4SBVA 4AFBA 3BALA 4CP9A 1YFWA 2I45A 3T0BA 3CL1A 1JZ2A 1C5HA 2VW0A 3WDTA 2Y33A 2F17A 3QH6A 3WF3A 4KGGA 3PNAA 4DXRA 2WS91 3U11A 1FMD2 1OLME 1HRI3 2GP3A 3HQXA 4FXKB 1FOD3 1AYN1 2GMMA 1H2KA 2RDRA 3AL5A 1RUF2 4Z2WA 4DQAA 4LHKA 5KR7A 3WF1A 1NOVA 4E8DA 2JE8A 1UX6A 2XBO3 3WNKA 1NQJA 1Q8SA 5JR2A 2K46A 2YHJA 1ZZ7A 4LNVA 5FYCA 3WOGA 2RS13 3VD9A 1H2LA 3URFA 1OKQA 2JDYA 3HJRA 5FPLA 3JD71 4AEDC 2E6VA 3WW1A 3IBMA 5FK8A 2B46X 4AEDB 1IG0A 3NV1A 2JDKA 1CESA 1GWKA 1KGYA 3LEGA 3P5BA 1V6LA 2XWBB 5A7OA 1MACA 3M2MA 5C4WA 3UKTA 2VBDA 4C0BA 4Q4W2 4CPBD 1KEXA 5FY1A 4XFBA 1C8NA 3POGA 2WFF2 5CAZA 4HK8A 3POSA 4DINB 4D94A 5I93A 4QX2A 1PGL1 2R062 4O9EA 1RUH1 4FXGB 1WCDJ 2VR4A 4CCMA 2FDHA 2VTXA 2P3JA 1CN1A 5LA0A 5ISLA 4BLIA 1VRH2 3AJYA 3QD6A 4GB31 4Q4W3 3ZN5A 2RMU3 1SEFA 2YYOA 2Q8CA 2WFF3 3GNEA 1IPKA 2AREA 4CDWA 1RTVA 3MFCA 4KI5M 4NRPA 4RYDA 1GWLA 3MW4A 5C71A 2ENRA 1WMFA 2VC9A 5FLIA 2TEPA 5A1FA 4AL9A 1WKYA 1TQ5A 1VRH3 5JI9A 2IXCA 2QBXA 2B9VA 5CA6A 3AM2A 4NHKA 1CAUB 5T50A 2W08A 2JKXA 3IPVB 3A7QA 4BXFA 3I8TA 3J7LA 2QQNA 3KT4A 5KC5A 4JKLA 5T3NA 4DY5A 4KGQA 5FZ8A 2WWSA 1QEXA 5JAXA 3V0BA 4I3GA 4QB1A 5CFDA 3ZSKA 1OVPA 3WCSA 1HV1A 1NCQC 2WN2A 4QQHA 1JZ4A 4CCKA 1NCQB 2JG8C 2AENA 1QOSA 2PELA 2WS92 1MPXA 2VCCA 3BCWA 2JG8B 3Q8BA 4N43C 4RR3C 2PAEA 1AYN2 3T30A 4ZXKA 2ARAA 2FCTA 1POQA 3MBWA 3ZN6B 3SH3A 4COZA 1JN2P 4R8HA 4A2UA 3AFKA 3I2KA 2CDPA 2PHWA 1UY4A 4E4ZA 1X82A 3QBQA 1F5JA 3TOJA 1VBB2 2BNOA 2ORXA 2QQUA 3C2UA 3JD72 2WT1A 3AXEA 3FX3A 3MV01 5F5AA 5H9PA 5JXIA 4TSVA 5A3UA 2ZGQA 2UU8A 2DWRA 3I2JA 5C9AA 1H30A 2VG9A 4KQ7A 4NRQA 4AQ2A 4FPHA 2B45X 3SCFA 1UPIA 2DCKA 2DU1A 1W9YA 3MICA 4XCAA 2RJ2A 1PGL2 3D5OA 4JGYA 1U5YA 1W6MB 4YG6A 5GLZA 5EJZB 1Y4WA 3KV9A 1IS3A 3AYDA 3OGVA 4QQOA 3MEPA 3ZSLA 1PZ7A 5JOXA 1LU1A 5KHJA 4GB32 1PVC1 5HCFA 2VUDA 2EIGA 3QLQA 3ZYPA 4BDVB 2F4LA 3VHRA 1QGLA 2H6CA 4GALA 2X10A 2RG4A 2EXKA 4IE5A 1RUH3 1UKRA 2GN7A 2RDNA 3KMHA 4PQQA 1LAJA 1XOYA 3POIA 4V2VA 2J1AA 3N9PA 4GAZA 3PL0A 2J1RA 4LJHA 4IGPA 5FZDA 1W2NA 4DZGA 3U37A 2DDUA 2RJLA 2WO2A 1GP4A 4YGCA 3WP6A 5A3MA 5F37A 1S2KA 1BHGA 5LRSA 2DVBA 2P17A 5KXDA 4XMIA 4FO9A 3UGHA 4FOWA 1ND3A 1OI6A 2J1TA 2VZRA 2WLPA 1UMZA 3KCYA 4KWKA 5JUVA 1RUC1 2JDAA 2RS31 1VBC1 1QXJA 1UZZA 1G9CA 4KNCA 1GICA 1X33A 4IEPA 2E51A 5FZFA 3TYJA 4A4AA 5APAA 2CWSA 2P5BA 2WINB 4XMAA 5FYVA 5CFCA 4YGDA 5F5CA 3R6SA 1W8FA 4PLMA 2E9QA 2WNVA 3Q8AA 4RS5A 5L7OA 5JOWA 4G9SB 5DUUA 1J58A 4Y22B 4LO8A 4OHWA 1BK0A 1ENRA 3OYWA 3D6EA 3WQ7A 2HWD2 3AKPA 2ZEWA 4BQ3A 1MVQA 2YBKA 3H9AA 1SMVA 3M3OA 3ZFGA 2EAKA 1IZ3A 4TN7A 3VL8A 1J3RA 3VKMA 2Y0OA 1E5HA 3S6PA 5HI0A 3NNJA 2ZX0A 3FBMA 4O61A 4BIFA 3V0AB 3AMPA 3F95A 4INDA 3RMYA 4AK3A 4I01A 5GLVA 2ES3A 3FFQA 3LSDA 2VBPA 2AH2A 1YQ8A 3LDKA 3MPBA 5LWBA 5DXDA 4D7SA 2R042 2JDHA 1FPN1 3RZMA 2ZGLA 1NQDA 1SG3A 1VLNA 4M3CF 5A7WA 2IC1A 4WBBA 5J48A 4M3CA 4BQ1A 2PHLA 3DF0A 1UNBA 3LD8A 4YWAA 1S0BA 4YZ3A 4OULA 1AX2A 1QXRA 4AI2A 4DO0A 5F3CA 1EV13 5FZKA 1AXYA 3EO6A 4LEJA 2HBUA 3B5LB 2VZTA 3MIGA 5GLUA 5EFUA 1SDDB 1UMHA 2JDUA 3FMGA 1FAYA 3GALA 3K77A 2HKXA 4AYUA 5BYNA 1E5IA 3CEWA 3DXUA 4BJ0A 4UW4A 1H4HA 4CP2A 2CU5A 1RL3A 1AHSA 3GXUA 1LKNA 2YC0A 3THDA 4B8EA 3RZKA 1PVC3 2A7AA 3VN4A 3RI9A 3RRDA 1W6OA 2VMHA 3KLSA 1R092 4M4RA 3TN91 5FUPA 4A6SA 5LW9A 2JDMA 1K42A 5DUVA 3T08A 2QZ3A 3T0AA 3USUA 4ONUA 3VV1A 4FAHA 3PHMA 1LR5A 1ODMA 1RUC2 4OLLA 2RS32 1VBC2 2RV9A 1NUKA 2B8MA 3VBHA 5FYMA 3OTFA 3OY8B 2K9ZA 2VNRA 4LK6A 1RMU1 5FPBA 3B02A 4XJ9A 1ZYBA 4FOVA 1LCLA 5BXXA 2XXZA 1XE8A 3I2IA 1CAWA 1CZTA 1PK6A 3AMNA 3CDZB 3K3NA 2BPA2 3FFZA 2OZJA 4L8QA 1NE6A 4GH4C 1RUC3 2P34A 1VBC3 2RS33 4GH4B 3KM5A 5FZHA 2FCVA 3TNQA 1HB1A 4BZ4A 1SLLA 1UYXA 5LB6A 1O7FA 5C8CC 4GWNA 4YNIA 5C8CB 5J98B 4S2FA 3VBOA 2HWC1 4ZXEA 3H3ZA 5F6KA 3CLPA 4B7KA 4JC1A 4Y20B 4I0AA 1KDKA 5I0SA 2JENA 4W4ZA 3LIHA 4QKFA 2W46A 3PVNA 3E5XA 3WNNA 2FDFA 2PHRA 4UXAA 1X8EA 1P8JA 2RE9A 1FPN2 1DYOA 4Y26A 5IHRA 3C7GA 5CVRA 1QIQA 3ZXKA 4JTOA 4QX3A 4QDRA 2PN5A 3ETPA 2TBVA 2VTFA 3KVBA 4P00B 5F3EA 1DGRA 2W1UA 2Q0AA 1YQ6A 1S0CA 3LE0A 4M01A 4K6BA 4LBQA 2VZSA 5FQ0A 5IATA 1RIRA 1UOGA 4AF9A 3LWCA 4EN9B 3UV9A 3CIHA 4HXCA 2OUHA 5ABJA 4NIAA 1VALA 1FPN3 5JSPA 2B42B 1VR3A 5CKNA 2ZA9A 3AVSA 4D6RA 1VMFA 4HANA 1FT9A 1FNZA 4NPMA 3O1SA 2AUYA 5FZLA 5FPUA 3EMRA 2O0OA 2MPFA 5A3NA 4J1WA 4IL7A 4N8MA 5I8YA 1DQ6A 2VNGA 1DQ1A 4NWVA 3WCRA 3NNFA 1GUIA 3KV4A 1DQ2A 5I0TA 3WP4A 5J3UA 2D44A 2UWAA 1HN1A 3Q8CA 4PLOA 4QKBA 5CB7A 2DVDA 3HN1A 2ZMNA 2E32A 4PCRA 2BWCA 2ZGNA 5FBJA 4B4PA 2WKKA 3PTYA 1XNDA 3TN93 1RMU2 1GP6A 5E88A 1OLRA 1OUXA 1Y43B 3MFAA 4WM7A 3ZPYA 4LLOA 4Z8BA 4K21A 4QKNA 3MIDA 3ZFEC 3ZFEB 4V2WA 4CEYC 4GJZA 5J09A 1GNZA 1BCXA 1K3IA 3O12A 3J8F2 1IKPA 1ACCA 4FPFA 3KV5A 3I3MA 4OUMA 3SCHA 4ASLA 4R4ZA 3RMXA 3NV4A 4FP2A 4UOJA 2QTWB 3PUAA 4Y24A 3DYOA 4A7ZA 3H8OA 4D8MA 2VZOA 3NWKA 3O5SA 1RUNA 3GM8A 1UZVA 4NIGA 3T2PA 3I59A 2HWC2 1HRV1 5FZAA 5D21A 4YYOA 3AZVA 5C5TA 4BQ2A 1XNBA 3ACHA 3DECA 1JZ5A 5JPMB 1IS4A 3RI8A 1VBD1 1XE7A 2XLGA 2QNKA 2JB8A 3JU9A 3VB9A 3GDBA 4CXXA 3OG2A 3VDCA 3ZXJA 3ZDSA 2HEWF 1WWYA 1CAVB 3DKWA 5DAXA 1SFPA 3RGBA 1YO8A 3WQBA 3ZYRA 2W2IA 4I0BA 1N1VA 3CU7A 5I91A 4EWAA 4QPGA 4AAPA 2VOVA 3DV8A 4FPGA 1H4GA 1HB4A 1UW8A 4FI9A 4MXVA 3KZ4C 2WNUC 3ZXGA 3OJBA 1ZBA1 1K5MC 2Y6GA 3SH4A 3FLRA 1MEC3 1K5MB 2QQMA 4PDWA 3WDYA 3VBUA 3ZYJB 2BQPA 1ULFA 4B3NA 1LEMA 4LHSA 3O1OA 1S2EA 4AGVA 5DAVA 2IXIA 2V5YA 3PJQA 4V1PA 4GKYA 2ZGSA 4UW6A 3ZKUA 3B69A 4XJUA 5I8TA 4IXLA 1J3QA 1REEA 3ILNA 5FMBA 3THPA 3U4SA 5IFTA 2OQ7A 1C8M3 4AOCA 4BOWA 2EXHA 4CDUA 1XU2A 3B93A 4UFLA 4QGLA 4YG3A 5FP4A 3N9OA 3UESA 1DIWA 4ES8A 5C3OA 4AVTA 3HEIA 1Y3TA 2XVLA 4UFIA 3O1VA 1HX6A 5LBEA 5FZ6A 3HBKA 2VH9A 4MZUA 3QOPA 5EQUA 1JYVA 1K5JA 3J7NA 3KHBA 1V6OA 4JDMA 4BK5A 2FCUA 1N1TA 3ORJA 1GZWB 1QJY2 3ON7A 4MUVA 4Y5Z0 1EP0A 3WDUA 4CDXC 2QJVA 1MR5A 3IB3A 4QU2A 1KFXL 4CDXB 2JD4A 3ZX7A 1W6QB 2BU9A 3E5UA 3OGSA 4LE4A 3NAPC 4XBLA 4D0QA 4JHZA 4ZU4A 3VDBA 1ZZ9A 3RJRA 3GZTB 3HIFA 4LUMA 3WNXA 5LCWL 2R1BA 1QJZA 3MDPA 5FPVA 3ZR6A 4EN8B 3HNBM 4IEQA 1D2SA 2J42A 4OHVA 2Z42A 2ZGUA 4C90A 3TEXA 5KHIA 1ULDA 3GCWA 1D2QA 2D98A 2PYTA 2ZEYA 3FLPA 4L0PA 3BI3A 1QDOA 5C3RA 5FIXA 3RG0A 5JMOA 1ZRDA 2I2SA 2D5HA 1HRV3 2DUOA 3JUUA 1PNGA 3M3EA 4FPOB 5L9BA 2ADDA 1VBD3 1W2UA 1WLWA 5BV6A 4EYUA 1PIV3 5I0RA 5LA1A 1AX1A 1ZBA2 2VQTA 1XC6A 2MEV1 4JDNA 4Q1PA 1W2AX 5DAWA 3WNLA 3FJSA 1LOEA 3SLIA 3OD4A 4GXLA 1RUI3 3NJVA 4LOSA 4B29A 5A6ZA 3WDWA 1O91A 2HWB3 4BM8A 5A3TA 4XQWA 3BTAA 1UXXX 2XHKA 1ULPA 2VMDA 3PIJA 5ACA1 5J7MA 2L9LA 4PQ9A 5L9RA 5CISA 4UAPA 5KC6A 2XJQA 1OURA 4CVUA 2MNGA 1WA6X 2HWF1 2WZR3 3O0WA 4CP9B 3AMMA 3VKOA 3OCPA 5FXWA 2QQWA 1MQTA 4Q8KA 2J7MA 1ND2C 3I2DA 3LGRA 1I3HA 3UL2A 3TAYA 2GNTA 1YXWA 1ULGA 1AUYA 4Y33A 4BQXA 4COWA 2P3IA 1CR7A 3L9JT 2ZKLA 2Q8OA 4XEZA 5F3IA 4YW3A 5B4XA 2E63A 1VIWB 1D4M3 4BK4A 1B35C 1YJLA 2D7FA 4YFZA 5LATA 1OH4A 4E2QA 2H6BA 1B35B 2ARBA 5CYYA 3W5NA 2OX0A 3AKTA 1MZEA 2D97A 3OOXA 2JE7A 1HLCA 2YV8A 4RQPA 5F2WA 1YWKA 4HVRA 4DEQA 1M4WA 2FQPA 4META 2RR11 4QXKA 1F31A 5C4WC 1WCUA 3H8XA 1WMEA 3UK9A 2YY1A 2VY0A 4P08A 3RQ0A 5C4WB 1SLBA 5J1XA 3C3VA 4E8CA 4Y4YA 3V56A 5A70A 1BXHA 1AR71 1OA3A 4YPJA 3SXWA 1RUJ3 2VZUA 3K3OA 4NHYA 5K0UA 1A8DA 4Q4Y1 4QHOA 4EWEA 1ASJ1 3U14A 2E7TA 1MVEA 1OLQA 4HSJA 4I30A 1DU3D 2HWE1 4Y5SA 5T55A 2PHTA 4LTAA 2BW8A 5JOZA 4ZONA 2R6QA 4LA2A 4DXZA 3VBRA 3GJAA 5C8WA 4CDWC 2BFUS 3EHKA 1JHNA 2ARXA 4YVSC 4E27A 4CDWB 3RZJA 1W3XA 3MIHA 4NHXA 4YVSB 1KS5A 4ZZ5A 1HRI1 5FKBA 4MYEA 4QX1A 4TZDA 1XXNA 1OFNA 2Y6FA 4Y1XA 4YW1A 2XBO1 2YXSA 3IWZA 2RS11 5ACA2 2A6WA 2OZ6A 3SCGA 1CONA 2DVAA 3CZJA 1RXGA 2MEV3 3ACFA 2IZWA 2WFPA 2HWF2 3AP4A 5IWFA 2VJXA 5CFDC 4S2GA 1AYM2 4E9KA 5CFDB 3DCQA 2DUQA 2OA2A 5A33A 3CHXA 3C7HA 3W20A 1WMDA 5LY2A 4NPLA 1LOFC 1RUE1 4QGMA 1F4HA 1W6NA 1JOBA 2O14A 2UY9A 1DFQA 4XCBA 4AQTA 3MF9A 5CKMA 2HWF3 3VLBB 4UWDA 5T52A 2WLQA 2ZX4A 4MV2A 1C4RA 2NN8A 4OZXA 4YM3A 1E5RA 1URXA 2VO5A 1GQHA 2XJUA 3RYKA 5FY7A 3LZZA 1UU5A 5EV7A 4AR2A 3IDEA 2LTNA 3IAPA 5EP9A 1W8ZA 2VE1A 4P9GA 2BOJA 3ITQA 1H9PA 1A78A 2YUEA 2EAAA 4Q2FA 5G04L 3U78A 4OI1A 4AEMA 1OH3A 3N4MA 4MADA 2YC2A 4TWTA 1NG0A 2G1MA 5C9AC 5F1RA 5FYTA 1JOPA 1H6XA 5IW0A 5C9AB 5K4LA 2HEVF 2ZAHA 4YZ4A 3GBGA 4FOQA 2UYBA 1AR72 1BEV2 1GQGA 1GANA 1PM7A 4JGYC 5FZ3A 4F7ZA 2P37A 4JGYB 4Q4Y2 3WP3A 1ASJ2 3MF6A 4IGQA 1VBA1 2AC1A 4IV3A 1A8MA 2UURA 2RR13 2V5DA 2WQZC 3WW4A 2HWE2 2BNNA 4J6GA 1KXGA 2B9UA 3AB0A 4Y1ZA 4QM8A 3S5AA 1R1A3 4LHLA 1QDCA 3VD5A 4X6QB 1RYYA 4UBGA 4OFGA 1FATA 1HRI2 2VGDA 4DIQA 1FOD2 3MZHA 4I09A 4L11A 4RGAA 2HWE3 3TB0A 4ES9A 4ZS2A 1DQ4A 2QQOA 4FAGA 2Q1ZB 1U5IA 2D5FA 2A3WA 2XKPA 2XBO2 2XUMA 2G9ZA 4X6RB 1ALYA 1SBDA 2A3XA 3C8XA 5GALA 3HMYA 1G8WA 1JW6A 3HR9A 4A7YA 1NT0A 3B7MA 2RS12 4BYYA 4XYXA 5FY5A 3PVOA 4G3YC 1REFA 3GBWA 2C5DA 2VXRA 1ND3C 1SACA 5JIAA 4JQTA 4MGIE 1RC6A 1ND3B 1X9TA 3S7IA 1MZ6A 1RUOA 2CNAA 2WAAA 5JXHA 3POBA 5KHHA 4CUAA 1XB9A 3BOWA 4BE3A 2QDRA 5CFCC 1W03A 4I3PA 4YW2A 4L92A 4Q4X1 4IDZA 4XE9A 5CFCB 3RJ2X 4LBLA 4WV8A 1H1IA 4RS5C 2WNVB 2BVBA 2DBIA 4RS5B 5IVYA 3WSOA 5KHGA 2JWPA 2GU9A 5L7OB 1CX1A 1GFF2 4MG2A 5FAXA 2ZGTA 1DZTA 4XBQA 3OYWB 2RMU2 5E8AA 3TEYA 2CV6A 1DYPA 1RUE3 4A42A 2QUOA 2OYZA 3KT1A 3ZFGC 4K7JA 3KQ4B 3ZFGB 3UGGA 4TYSA 2R49A 5KXBA 1XPWA 3OBZA 4YW6A 3IT8A 2DCTA 3IMNA 4XTMA 1HQWA 5FYHA 1BZWA 3K51A 4Y1UA 1ULCA 3PU3A 4FPYA 1QJEA 1YIFA 2DCJA 3N7JA 1O5UA 3ZMNA 1GOHA 1VBA2 4P5YA 1OBNA 2WO1A 4DUVA 5A7WB 4O9GA 2Y64A 3B01A 4FPLA 4M3CB 3T4HB 4KH9A 4QB2A 2WZEA 3KD4A 5FMCA 3ZYIB 4AHWA 4N7IA 5DZEA 4QHBA 3E6DA 3KGZA 1AXKA 1SHWB 1UF2C 1JUIA 1REDA 2EALA 4LQRA 2FDKA 3S7EA 1VBA3 2NPIA 2ZJCA 2EXIA 4YFWA 5GZDA 2GN3A 1YHFA 1CQ9A 3TNPB 1CZVA 1HXS1 3J7HA 4DXSA 4OHZA 4MSVA 1UZWA 1H1AA 1N3QA 1YLLA 2V09A 1HV0A 3ME2A 4R9BA 5FY8A 4CCDA 2XL9A 1LGNA 1W6OB 4FOYA 3RYPA 3O1UA 2DVGA 3BODA 4X8PA 3POJA 2PAKA 3PVBB 2ZZJA 2UYAA 2IFWA 3LDRA 2OT7A 3JCIA 4LBMA 5JR7B 1APNA 1O59A 5FO9B 5HBAA 2IXKA 4GULA 4AVCA 5DDJ3 5IJRA 3WW2A 1GQPA 3USUB 2N7GA 3LQCA 3OF1A 1RVF1 4W50A 2VMIA 3UKVA 1Q43A 2W47A 4KG0A 3SITA 4URAA 4Y3OA 3H3UA 4LK7A 2WDBA 3OGJA 3VBHC 5A80A 3VBHB 4FQ4A 4XF9A 1PK6C 3AKQA 1IPJA 2ZTNA 3PMSA 4OCTA 4Q4X2 3U75A 1CAWB 1PK6B 3A4UA 5LBBA 4CSWA 1XYPA 2JB4A 1BLZA 2VU9A 1W39A 2XGXA 4XIOA 5FY9A 5BPXA 4CXYA 1OLMA 2QVSB 3ZXFA 1O5LA 3OGRA 4OI0A 4PHZA 4PIZA 4AGRA 3OBAA 2G19A 3SEEA 5I8SA 1EV11 4QXCA 1PMHX 4KMQA 4Q4X3 5IK4A 3V64A 1CWPA 3VBOC 1RUH2 5FOBB 3SNMA 3VBOB 1ZX5A 5F7UA 4IEZA 1WCSA 1U5ZA 1E5SA 2Y6HA 5DPNA 4BU2A 4LITA 1NXD1 4FCAA 1DBNA 4XUNA 4E4DX 4A41A 2ZGOA 4D3WA 2JG9A 2CAVA 4QDQA 4Q0SA 4LXLA 1S0GA 2CY6A 1KD7A 4IV1A 3T2TA 3UT0A 4Z92B 4UI9L 3IMMA 3R4SA 1O4TA 1VMHA 1LHVA 1W0NA 2NLRA 2ZACA 2XR4A 1F35A 4XFGA 4B1LA 1PGW1 2VCBA 3RDIA 1S2BA 3DKQA 2CTVA 5HV0A 4YM2A 4TTGA 3B00A 3SQOA 2DU0A 4LBQB 5FQ0B 3MIBA 5ABJC 3MYXA 3OB8A 4NIHA 4AXOA 4I0WB 1KQRA 5ABJB 1NA1A 4P9XA 5D8AA 5FXVA 3VD3A 1BMV1 3JZVA 2B7YA 3S0MA 1ZVFA 4AFDA 3TBDA 1HXS2 3ABZA 1VAMA 1X36A 2YGLA 5EPAA 1YFXA 2W95A 3JBG1 2ZX1A 2D6KA 3FE5A 1LRHA 4CUGA 2VZQA 4G4FA 4HBNA 2VUAA 4QGNA 1GZ9A 2GP5A 2C9AA 4EQVA 1Q56A 2IXLA 1AVBA 1JS9A 1VMJA 3H50A 5E6HA 1WW4A 3EB7A 1W9WA 5GZCA 1HXS3 2E7QA 3FHAA 2VAUA 4M0HA 2E33A 2ZABA 4XTPA 4CE8A 2GDFA 5IVBA 2YGMA 5F5QA 3U0ZA 1DQ0A 4WM7C 2W0XA 1BBT3 1NY71 3LFIA 3S30A 5A7PA 4WM7B 5A3LA 3OBRA 4IE0A 1QOTA 4RHV1 3DGTA 2XJTA 1JODA 4U36A 1RVF3 3C7FA 1WW7A 2JDZA 4H2AA 4AZZA 3KCXA 4JX0A 3M4FA 4Q4V1 3T1LA 1FYUA 2ZEZA 3H1MA 4JQRA 4QX5A 4AEDA 3AP6A 1EV12 1NZCA 4OZOA 2YROA 3MPPG 3FWEA 3N7MA 1WD3A 4Y4RA 5JCTA 1J59A 1UAIA 4MGKE 5JXGA 4DOUA 4I02A 1A34A 1W9SA 1UXZA 3I59B 2BBVA 1O8PA 2MHFA 3IIAA 2GH2A 1UKGA 4OQ8A 1PVC2 3RS6A 4LKSA 2R30A 3NNGA 4QD2A 1QHDA 5BNQA 1N1YA 5FV3A 3N9NA 1VRBA 3DPRA 1SPPA 2D43A 2J1VA 3TEZA 2BWAA 5FYZA 2WNOA 3PUQA 2RM23 2Z4FA 1U12A 2OW4A 4QPGC 3NQHA 1DGWA 3T1MA 1JZ3A 4EZHA 2LRPA 1PGW2 4QPGB 4P02B 3DUIA 1NZIA 2IWGB 5LZ6A 5DZFA 1GKBA 4RL7A 1WLTA 3W21A 5FPXA 4PDWC 3PUSA 4WM8A 4WVZA 1BMV2 4PDWB 1UU4A 3NNMA 2E26A 3W9AA 5FMDA 2RS51 3O14A 1JTZX 1XBFA 1UD1A 2KA3A 2YBPA 4OHXA 2Y26A 1S0FA 3MI8A 4XFAA 2JDPA 3EBRA 1VJ2A 3O7OA 4XF0A 2BGPA 4F83A 1W8HA 4LO6B 1D0GA 1LNSA 4XW3A 2BZDA 2TUNA 2V73A 5IK8A 2FDIA 2XB6C 4CDUC 1GSLA 3KS7A 3RPQA 1GR3A 1SFYA 4CDUB 4N53C 3SEPA 3NRUA 2BNMA 5AVAA 4N53B 2TNFA 2PHUA 4E2SA 4IEXA 1UL9A 2PHDA 4HLTA 5FYBA 1S1AA 2G9GA 5C3PA 2UY8A 4N43A 3JBG3 1LHUA 1MS5A 2P2KA 4RR3A 5F2SA 2X53S 3GGLA 3USSA 1QNWA 3SKVA 4DPNA 3K75B 4ZKTB 3VUOA 1DZQA 3POWA 2CGNA 4QT6A 1NY72 4PBOA 5IK7A 2D6MA 1CIWA 2KR2A 3JQXA 4IQPA 1Y9QA 4QDSA 2DVFA 3AZWA 4IGOA 1YCIA 3ZFFA 1CAXA 3LKJA 3O1RA 4UFKA 3UGFA 1Z7S1 4JHTA 1PO23 3M7AA 2ZGRA 3ACGA 3AFGA 4H55A 1JI6A 5FZBA 4P14A 4A3XA 4XJAA 2YZ4A 4PBPA 5A3PA 1XNCA 1BK1A 3HWJA 3Q8FA 4RHV3 1F9KA 1MEC1 4Q0PA 3ACIA 4RSUA 1ZRCA 2G4IA 3MW2A 2Z5WA 1AR91 2O1QA 1UOFA 1O6UA 2B4KA 4BQYA 4AW7A 4UFHA 4Q4V3 3WDXA 4Z82A 3VBSA 1VB4A 1YFUA 1QXPA 1VE0A 3WHUA 3KVAA 4ITCA 3H8UA 3C7EA 5A1LA 1C8M1 1DGWX 1UIJA 3ETQA 2R0FA 2HEYF 1OQEA 5ANNA 3PMEA 1S0IA 1NLRA 2HJIA 2YG0A 4DXTA 2Z79A 4MLOA 1GZCA 1UYYA 2ZGPA 1ZBE1 1UPSA 1DGLA 3M70A 1OXCA 3ATGA 3TN92 2NMOA 3RZZA 2CDOA 1OQ1A 2WO7A 3HNYM 5FZOA 5KWRA 1C3HA 3AZXA 2OPWA 3HD8B 1PZ9A 1DP0A 1V6NA 1CVNA 2LROA 3NVCA 4BISA 1US2A 3PLQA 4HETA 5JZGA 4HT1T 3H42B 1AJKA 1L7QA 1Q8PA 1W9FA 4TLFA 3WY6A 5IT6A 1Q8OA 4WVMA 1WLDA 2YFZA 3SKJE 1QH6A 4XQ4A 2FHRA 1EUUA 1MQTC 1R1ZA 2AGSA 2GC1A 2RS53 4B7EA 1MQTB 3OEAA 4XXPA 4PIXA 1JYIA 2F4PA 3MLLA 4NR1A 3WF4A 1DLCA 2W91A 3I3DA 4ISRA 4LR4A 5KXEA 1ULEA 3WZ1A 3V65A 4A3ZA 2X29A 3WNPA 5FMOS 3JB4C 2JDNA 2Q1MA 2Y38A 2UWCA 4YZ5A 4AGGA 4XURA 4QQLA 5IUQA 1GU3A 1N3OA 1L7LA 4YW4A 4LMFA 1L3JA 3P1IA 1OOPA 4RQPC 1UOBA 2PQSA 1DGRN 1PIV1 1X9PA 4RQPB 3VD7A 3FL7A 2EXJA 5IVCA 3I49A 5FP9A 1LU2A 1MEC2 4M4PA 4OYUA 1RUI1 4MXWA 4KL1A 5EJ3A 5EXOA 5CG8A 1OVSA 1ZNPA 3LEIA 5FZ1A 2HWB1 1GP5A 2WA3A 1HW5A 1TVGA 1MS0A 2VCAA 2A6YA 3BVCA 3PIGA 4HVOA 3JQWA 4QPYA 4S2HA 5T5LA 1NCRA 5FR3A 1Z7S3 5K0UC 3E6CC 5K0UB 5DUWA 1WW6A 3DYMA 1OF4A 5CEHA 1X50A 5LEKA 1HKDA 2Z2SB 5A6XA 4BPZA 2WZR1 3WF0A 3L2YA 2ARCA 1MS1A 4LBNA 1C8M2 1O4ZA 1W6PA 4RA0A 3I3BA 1AR93 1NXMA 2XJVA 2P3KA 4FFGA 2AZ5A 1MS3A 3S57A 1OPMA 2RDQA 3NJZA 4JRAA 3VDDC 1V9U3 3ZYBA 3VDDB 2YFUA 4EZ4A 1OQDA 1JXNA 2XKOA 1UWWA 4FFFA 5EWSA 4HPKB 3ZXDA 3CF6E 4A44A 2JEMA 3VKNA 5J36A 5LA2A 3AXDA 2YMZA 3AYCA 3E1F1 3S5QA 1LHNA 1D4M1 4L2NA 2IFRA 3VHNA 4XBNA 5IVJA 3O1PA 4OI2A 3PDQA 3N35A 1ZBE3 2C4XA 4XACA 2R1DA 1I1EA 1RB8G 4OVEA 5H9RA 2RDSA 3OD0A 3I54A 3AJZA 1BJQA 4GD4A 1VAKA 2DCZA 1XNKA 2C26A 4U2AA 4LHNA 3ZVXA 4QXHA 5A33B 1STMA 1W8OA 3VKFC 1LEDA 3IM0A 3KQRA 1W6NB 2ORZA 2Y6LA 1RUJ1 5FTTC 3WNMA 5JIUA 4AHZA 2XONA 1ZZ6A 4NVPA 5JWPA 2YB7A 2SLIA 1JYCA 1TEIA 1YI7A 2YDEA 1HRV2 5LA9A 3ZSEA 1SLIA 4CCOA 2VOXA 4EN7B 5H9SA 1VBD2 4UF0A 3BGAA 4HZFA 1PIV2 1WGPA 2PLV3 3I7DA 3MV11 4FSJA 2ZS6B 4P9JA 5LASA 4NROA 3J9SA 4FQZA 3AMHA 2P6HA 1HIXA 1RUI2 4TLGA 1TG7A 2VMFA 2WL1A 2YU2A 1YFYA 1QJU3 1LECA 2HWB2 4HFSA 3SC7X 1LTEA 4QX0A 3OPWA 3ZXLA 1CJDA 1IOAA 4OMCA 2W87A 4IV3B 3NMBA 5ANQA 3A23A 2JXAA 3IKWA 1VBE3 1OD5A 2WZR2 4URTA 3BPSA 2ZHNA 1N3PA 4F3JA 3KGLA 4CZSA 4UW3A 1POV1 1V6KA 3BKZA 1NLQA 5A7NA 3Q9OA 4IEYA 4P9WA 3THCA 4CU8A 4AVBA 5LEJA 4TXWA 1LJ7A 4OI4A 2VXJA 4A6OA 4YG0A 4BA6A 4RFT0 4AHXA 1Q3EA 4AEKA 3QH7A 1J3PA 2Y60A 4YW5A 3BTXA 5K8SA 4YVWA 4D6SA 3ZYHA 1JYNA 1DQ5A 3IDBB 4LO7A 1OF3A 3WUDA 1D4M2 4IERA 5CZKA 4FP3A 4LBOA 3GHMA 4XFIA 4XJWA 4KWLA 2FMDA 2W52A 5AC91 3AYAA 1UYPA 5DMYA 1EUTA 5IVFA 2W68A 3U1XA 2R0HA 2XDVA 5EZWA 5FPAA 4AFMA 1I5PA 4XF3A 3UETA 4MGTA 3WXPA 3DEMA 1S55A 3I4IA 3NV2A 4MGQA 4ORFA 1E57A 3HPNA 4QB6A 4KWJA 1AR61 3FUQA 4LOTA 1DLLA 1V6MA 2KM2A 2DBNA 5FKCA 2J22A 1RUJ2 2W1QA 4WVWA 5IAXA 3PJYA 4IE6A 4YRDA 1LOGA 4CEYA 1TME3 4GWIA 4HMZA 1Q5OA 1ZM1A 1UU6A 4XUOA 4H7MA 3LA2A 1R1A1 5F9TA 2XQRA 2QZ2A 4LUKA 3GCXA 4D6QA 3K48A 1HJFA 2ID4A 4XDPA 1RUG1 5FZIA 3TWIA 3POFA 5FWEA 4MH0E 2UWBA 2XPJA 2WQ4A 2PAMA 5JXJA 4QAWA 1UQXA 5LRRA 4NOTA 2PTMA 2EA7A 2NYYA 4LA3A 5SV5A 4BQWA 4EN6B 4QX7A 1UCXA 3BIWE 3IZOA 2QQJA 4W6WA 4EN0A 4KU8A 2MEV2 3EQEA 4JKMA 5F8PA 5JI7A 5LY1A 4NJ4A 3KF5A 4DRVA 1H0BA 2WNUA 3AZYA 4IW3A 4RGKA 4IEVA 1K5MA 1AJOA 1H9WA 3FN9A 5FP3A 1YUDA 2W5FA 1RUD3 3R4DB 1Q8QA 2WSVA 1HQLA 2VMEA 3LA7A 3V0BB 1NX9A 1POV3 5A7SA 1J83A 1ENSA 1LOBA 5EJ1B 3SMHA 4BMBA 2PMWB 3I3EA 5DZGA 1MZ5A 4IUGA 5BNOA 1PVXA 2I74A 5AC92 3LAGA 4N9HA 1GYKA 1JU3A 4YM1A 5BNPA 4CUCA 5CG9A 2WJSA 3KHCA 1V0AA 3RWNA 3O0VA 5FOJB 2DV9A 3B9CA 2P3YA 2W9XA 3AL6A 4CDQA 2Y0IA 2VW1A 3F2ZA 3J4UH 4K8RB 3D0SA 1HDKA 1C28A 1XSQA 2BEOA 5FK7A 1M06G 5FPZA 5L73A 1UY2A 5AC93 1AR62 4ZHNA 1PZ8A 5BY5A 3AP5A 3VKLA 4FPJA 1A6CA 4CP1A 5AFBA 2FD8A 2RR12 1W90A 2FBEA 1MS4A 5FZCA 3AP9A 4SLIA 4CPBA 3DXTA 1HB2A 4W8JA 4W6YA 1JYXA 4I2OA 5C33A 4IETA 1R1A2 2VECA 5CBLA 3H0OA 1T2XA 1AR63 1LODA 4D7TA 1H2MA 3FLTA 2VVFA 1KS4A 3NAPA 2VQ0A 2ZBJA 5GLWA 1FV3A 3CJIA 2Q30A 4NHLA 5GZFA 1SLCA 1RUG2 1FI2A 1GNYA 2WN3A 3ZSJA 2AEZA 4Z2AA 5A32A 3GZEA 2WZ8A 4CEWA 4PI0A 3HAGA 2Q1FA 3VBFA 2YBSA 3P3NA 4C1WA 5CU1A 4P9LA 2JG9C 5KXCA 2JG9B 4Q8LA 4IV1C 4DUXA 2PA7A 2DFBA 2YPDA 3N9LA 4R9DA 5F3GA 4IV1B 2Z69A 3I2GA 5I0UA 3WG4A 1RUG3 4ARXA 2X5IA 2OKXA 1EYBA 5DDJ1 2NM1A 1W2TA 5FYYA 2EVXA 4EJRA 4LT5A 1G9AA 5FREA 2PHXA 4MHRA 3U10A 2RVAA 1NA1C 1PO11 1W04A 5D8AC 2QKDA 1NA1B 5EYYA 2WYSA 5D8AB 2CSGA 4RD7A 1WZXA 4LULA 2VNVA 1JU4A 5C3QA 2QQIA 1ZRRA 4XFHA 2VBBA 1BYHA 1CJPA 4J25A 4GZ9A 3R4UA 4QQPA 1JYWA 2ERFA 3FHQA 1UY0A 4JGZA 3KWVA 1SBEA 4IEWA 5FY4A 3HBZA 1RUE2 1YC61 4CP0A 3AP7A 4HN0A 2GAUA 2JX9A 4BQ5A 3W59A 1FXZA 5FZMA 2WNVC 1QY4A 2B39A 3ENRA 3M3IA 5L7OC 1ND2A 2D6NA 1W8UA 1WA4A 2NZ9A 3K4AA 4AI9A 2WSUA 4XQDA 4DEVA 3VZLA 3UKNA 4L97A 4NN0A 2ZMKA 4XHXA 4JTNA 2AACA 2EIEA 5JDBA 1ONAA 3C7OA 1G7YA 2BERA 2WNEA 2BRTA 2D3RA 2GNBA 1IS5A 1XU1A 1RHI1 1NYWA 2ADEA 5IVVA 4LO4B 4YSFA 3WD5A 3Q8EA 1RGSA 4FTBA 1B35A 2HH9A 2BTVC 4OUEA 1FMD3 5EIYB 3DL3A 4H7LA 1VBB1 2H0BA 1RUF3 4NE9A 2Q8EA 4QPIA 3WX5A 3MUY1 1WD4A 1SFNA 2BYVE 2A6ZA 3POEA 3AKSA 5GLTA 5M0TA 3I2OA 2WT2A 3A22A 4CA9A 4NMIA 3EYPA 4NHMA 4S2DA 3T09A 5FXZA 3OUIA 2WUHA 2WWJA 5FZEA 3CJXA 1JZ7A 3WT3A 4CCNA 1JBCA 4RGGA 2ZX2A 3FC0A 5FDBA 3BUCA 5FUIA 3DPRC 4COYA 1RXFA 4JKKA 4XABA 3DPRB 1SPPB 2XJPA 2ZOEB 4CU7A 4CYDA 3LFMA 4R9AA 2WZPP 3VD4A 2E7AA 3ZO0B 5DDJ2 2VMGA 2VQUA 1AL21 4YVSA 4XVHA 3FHIB 4GMP1 2R063 3LIGA 4MGSA 4B4QA 4AFAA 5HCAA 1ODNA 1L7RA 4FTEA 1PO12 2WBKA 3MLKA 2E31A 2WR9A 4WM8C 1GMMA 4Q1RA 3I2FA 4LKDA 1BBT1 4N7UA 1BKZA 4WM8B 3E6BA 3QCWA 3NSTA 2QQPA 1XYOA 4DY3A 5FWJA 1SQ4A 1ZA4A 2C6SA 3D0JA 4LBKA 2W1SA 3UJQA 5JPNB 1F8VA 4H3WA 3N7KA 1H8TA 4XETA 1HN0A 1DG6A 2R071 3CKHA 4XPVA 4CU9A 4XC9A 1W8NA 1PO13 5GM0A 3H7YA 2EIBA 3ASIA 4CTEA 4XUQA 1F5FA 3N36A 4PT6A 3CQOA 4LIVA 5HCHA 3WF2A 4BWOA 2FZ2A 3LPGA 2VVEA 3MLJA 1JMUB 1KDMA 5GZGA 2VVDA 2Y8KA 1XQNA 2DTYA 4AWDA 2JECA 3ZIXA 4N43B 4RR3B 1Q8VA 1LOFA 3K46A 4YM0A 5A3OA 5HPOA 3CO2A 3HT1A 5FYIA 4COVA 4NRMA 4ZS3A 1OPOA 2BOIA 3MUZ1 3WV6A 1H6YA 2ET1A 3D82A 5BNNA 1RHI2 3LCPA 4AQSA 2ZHKA 3O0XA 3RZGA 1BVVA 4AI1A 1LOAA 2WS93 2RM21 1OC1A 1T6GC 2BFUL 2DUPA 2HWD1 2WIIB 2X09A 4M3CE 4XUPA 5ERLA 3ZFFC 3ZFFB 1CAXB 4D69A 1AYN3 4MHUA 4XOGA 3OSDA 3BU7A 5L19A 4XAAA 1O3RA 4P9IA 1KJRA 1PM4A 1RHI3 3ST7A 3ES1A 1O3QA 2RJKA 1UY3A 3CMGA 3NKGA 2BP6A 3IDCB 4FPEA 3EXUA 2V4AA 3OUJA 2VNOA 3A21A 3RNSA 2V4VA 4PJYA 4AAXA 2R041 4AQ6A 1VBB3 2Q5TA 2D3PA 3JD73 2LW8A 2EIDA 3K2OA 4UFJA 5AVPA 3VBSC 3H8RA 2YPJA 1Y9GA 1PX3A 5TSWA 3BU0A 3VBSB 2XLFA 1O8SA 4KBZA 1TNRA 4MVTA 1JZ6A 1G9FA 1KFUL 1V00A 1IS6A 3OPTA 5T54A 3WVJA 5FFOC 3ZYFA 3VHPA 1ZZBA 5A7QA 3THTA 3A0KA 5F32A 2BUKA 4YZ2A 3LA3A 1AL22 4DRRA 4XUTA 1FX5A 3LSEA 1AL0G 2QCSB 2Y6KA 5JOYA 4R4XA 2WT0A 3LDBA 1D4VB 2XVKA 4L9BA 3VGIA 3ZMOA 1OT5A 4W65A 1BBT2 4GB33 1GOFA 1TE1B 3APBA 3NW4A 2LM3A 3IN9A 1J1LA 1ZRFA 4MGYE 1LOCA 5FZOB 3T2QA 1DDLA 1F2NA 1R091 5HV4A 4K40A 4O7XA 1AL23 2W3JA 1RVF2 5DQ0A 5JZGC 1QU0A 4GMP3 5HXVA 3SISA 5JZGB 2R072 1PMJX 3NO8A 1PO21 3G6JB 4QM9A 3ZLIA 4UT5A 1PX4A 4K1ZA 4UFMA 1V6JA 2D6PA 1JH5A 3NNLA 4WVMB 1HB3A 2D3SA 2OS2A 4ARYA 1RITA 1W0PA 1C1LA 1Y7BA 2XLAA 1RJ8A 1RINA 1WMXA 2LUWA 3WP5A 4ZZ8A 2VUJA 5FZ7A 2R073 2VOTA 1LHWA 1N1SA 1WBFA 1ZA7A 1YQCA 2CHHA 3T0DA 4XDQA 4XXAA 1QH7A 3LEKA 3ECQA 1W9TA 4FPKA 1AR81 2O8QA 3GF6A 3FUOA 3H7JA 2VMCA 4AVAA 2NP0A 5G05L 3T4VA 2FZ1A 2RM22 3MO4A 3GBFA 4YGBA 1OOPC 4PI2A 4AI3A 1EPZA 1AF9A 1OOPB 3LB9A 1C5IA 1XRUA 4ATEA 2OPKA 1PMIA 1IG3A 3U07A 2XWJB 4HKLA 2WAOA 3WEZA 3HOBA 3D3AA 4GWMA 2B5HA 4HONA 1D0HA 3ZR5A 3RFRA 4K3UA 1W0OA 3MIEA 3HVDA 4MXWB 2HWD3 1NCRC 1ZZCA 3M3CA 3DN7A 2J1EA 1NCRB 4XAEA 1C57A 1MS9A 1OA2A 3M8LA 1OD3A 4XJ8A 3AZZA 4OQ9A 3B94A 2ATFA 2PFWA 1N47A 2C9KA 3ELNA 5JVVA 4BQ4A 1B09A 1LENA 1GZTA 1X7NA 2A6XA 2VZVA 4Z07A 3VBUC 1QOOA 2CGOA 2GMPA 3L2HA 3VBUB 4YZ1A 1H8VA 1W6PB 2I07B 1CIYA 1OA4A 3BYWA 4J1XA 3HN3A 1CAUA 1PHMA 3VHOA 1F4AA 1ULOA 1VP6A 4YW7A 2LS6A 1I5ZA 2R043 1W99A 3IPVA 1CGPA 2W94A 1VPHA 3JBG2 3DYPA 4QMAA 1LESA 1JUHA 4JRLA 5DABA 5HCBA 5LK7B 4A45A 4NWWA 4WVVA 3VL9A 4FFIA 1W2OA 4E4SA 3ILRA 1QWRA 4R9CA 1NLSA 4XFFA 3WINE 3WLUA 1NCQA 3NJXA 5D2AA 2JG8A 1XNAA 3LF7A 1OHFA 2BVVA 1UZ0A 1QNYA 2HLEA 2GALA 1EY2A 1PO22 4X8NA 5D1IA 3ZN6A 1QKQA 5IVEA 1HQNA 4OHYA 3KT7A 1Z78A 2ZHLA 1XJAA 3VZMA 4RHV2 4AVVA 3G7DA 4NPRA 5FYSA 3MIFA 2A75A 1R093 1SCRA 1CZSA 3T2OA 2JE9A 4Q27A 3J7MA 4IEOA 2JJ6A 2XG3A 4Q4V2 4IESA 1AXZA 1COV1 2D93A 3ROUA 4Q0VA 1QJFA 5B4NA 4CCEA 1G9BA 4HG6B 4JV4A 2WC2A 1AR82 3J8F1 1LB2A 2QDNA 3KV6A 1IQDC 2GC3A 3OPZA 4LKEA 5FZ0A 2OUJA 5C7GA 2ZXQA 4FBFA 2ZKNA 1WCKA 2A3YA 4NAMA 3WUCA 3INAA 1W6MA 1V9U1 4UF0B 3POYA 1US3A 3HT2A 5DG1A 1AR83 3SHRA 5K9YA 4FFHA 4DUWA 5C5UA 1PNFA 2XUEA 2WO3A 5EHDA 1DYKA 4GIQA 2D40A 2OQ6A 1Y9MA 3LEMA 2SBAA 5FP7A 1QMJA 4ET7A 4B1MA 2ZGKA 1CX4A 1XSRA 4XF4A 4ZY9A 1MZFA 2ZCWA 3GZUC 1JOJA 4HK9A 2XJSA 4WZCA 4XZUG 5IFPA 3H1YA 4LO5B 1I6XA 1IQAA 2BJSA 1W05A 2HBTA 5A6QA 1ENQA 4MX3A 5FO7B 4KWUA 5FY0A 3AK0A 3RZHA 4LKFA 2RS52 1BQPA 4ZU5A 3WG2A 4DMIA 2AR6A 2DCYA 2CYFA 1OFSA 1NE4A 5E89A 4BH9A 5CNAA 4MOAA 1JHJA 5LBCA 2PXJA 1GLHA 1S0DA 5C6CA 2GMEA 2OIIA 3RYRA 4NO4A 1CPNA 1ZZ8A 4YVWC 3LOBA 4YVWB 5FLJA 2QE3A 4ASKA 4JZRA 2KXLA 3ILFA 3I97A 1V6IA 3OBTA 4Y5TA 2KD7A 5FZ9A 4F8AA 3ZXEA 2X8KA 2YU1A 3N7LA 4HKWA 2A71A 3WQ1A 4XHBA 5C70A 3WG1A 5B2GB 2XQXA 2ZEXA 3KCCA 2PLV1 4XF1A 2A73B 1GBGA 3B3QE 1QQP1 4Y22A 1H1MA 1JZ8A 5DAPA 1LGCA 1QJU1 3AMQA 1EAH1 5GKAC 2FMYA 3ZKYA 3MGUA 1Z0HA 5IAVA 5IK5A 1Z7S2 3MHZA 1COV2 1VB2A 2CAUA 5A3WA 3WR0A 2NQYA 1TMF1 1QJY1 1VBE1 4Q29A 1UIKA 4CEYB 1WW5A 3V0AA 5JSRA 2ZPXA 1KRIA 5F39A 1AR92 1OSGA 3B9IA 1RMU3 2GZWA 1K12A 2XHNA 1WCQA 3OUHA 1LULA 4XJZA 1J84A 4AI8A 4UW5A 2ZGMA 1V9U2 1COV3 1GOGA 1POV0 5CADA 2Y6JA 2DTWA 1ST8A 1SDWA 4QXBA 1VAVA 3J8F3 4ISQA 3I2HA 3H3LA 3RZLA 1XNTA 4MO3M 4Q5OA 4EROA 2C1FA 4ZU7A 4KU7A 3VBRC 4NIIA 3W58A 3VBRB 4LIUA 3AX4A 2VCMA 3R05A 4LBQD 1G6NA 5T5JA 3A0NA 3P6BA 3VZNA 5SV8A 2WRAA 1O3SA 1ZBE2 1XE0A 2HWC3 2Q8DA 5I0DA 3PTRB 4YARA 4Q0UA 1IHMA 3GHNA 3O1MA 4ATFA 1XYNA 4KG8A 5K7PA 2GNDA 1DF0A 2VQAA 2WNUB 3T3YA 1TZOA 4UYBA 2FDJA 3LPFA 2JD9A 1YI9A 2ZZQA 2WYFA 2XMLA 3ZPOA 4XILA 3IDAA 3ZSMA 3NKTA 4CU6A 2VD7A 5F5IA 1TME1 3D4KA 1YIPA 1SCSA 1W06A 3HQUA 4QQ2A 3ZIWA 2IXHA 3ZDVA 4CCJA 2IVJA 5H9QA 2IUWA 3OY8A 5BNOC 4B4RA 5FO8B 2HYXA 4M0NA 5BNOB 5LK5A 5BNPC 1IGOA 2H0VA 1MS8A 2VULA 5BNPB 4R52A 4N53A 4CCCA 4C0HA 2PLV2 4LPLA 5DUXA 1RJ7A 3ZOIA 4E2GA 4CDQC 3PUIA 1WBLA 2P6CA 4RFRB 5FP8A 2VUCA 1QQP2 3BB6A 3SH5A 3P3PA 3HQRA 4CDQB 4GH4A 2P1BA 3O1TA 1J1TA 4IEUA 1SLTA 5T5OA 1W28A 2GNMA 1QJU2 1YQ2A 1EAH2 5FXXA 5JSOA 1UYZA 4Y1VA 1UOJA 3PVEA 4FVVA 4W6XA 5C3SA 5C8CA 1BVP1 3WNOA 4ASMB 5FJKA 1UO9A 4BLJA 2OVUA 2W39A 1TMF2 1VBE2 1CD3G 1QQP3 5DAQA 1HJGA 1SZBA 4Y20A 2BBAA 1S0JA 2IXJA 3WDVA 4DB5A 2R16A 2D6LX 3BOPA 5EYXA 1EAH3 4JDOA 5KHKA 1G86A 3ZM8A 3CJIC 2HYKA 2JIGA 4IV3C 3NAPB 3CNAA 3CJIB 1YNAA 1QJX1 2P4EA 1TMF3 1QJY3 5A32B 1ZRIA 1RUD1 4CEWC 4GKXA 3VBFC 4CEWB 1W8TA 3H1WA 4FPCA 4BXSV 4N90A 4XIKA 3VBFB 5KBFA 2VZPA 2ZHMA 1IPSA 3LOIA 4HKOA 4IE7A 4XZPA 5FYUA 4E4HA 2BDRA 2AYHA 5L9VA 4EE2A 5J96B 2X5IC 5J37A 2F6BA 4XDOA 1NKGA 3GJBA 3KB5A 5FCCA 2X5IB 3E5QA 4AFCA 2ETEA 2LALA 1WLCA 1GWMA 2PHFA 2FDGA 5FRAA 5JMCA 1FV2A 1V70A 3UJOA 5FZGA 4Q26A 4K20A 2C0ZA 1K45A 4JAAA 4JVAA 4HN1A 5GJ6A 1UMIA 5FJHA 4Z1VA 1YQ5A 3MW3A 5E1RA 1KJLA 4OUSA 5AFEA 2W1WA 2ZX3A 5FZ4A 3RWKX 1TME2 2IVIB 4AG4A 4JGZC 1FNYA 3ALQA 4QX8A 4JGZB 3ZXAC 1ZBA3 2VOKA 1W8WA 1C1FA 2R32A 1SBFA 3J26N 3X29B 4M00A 2A1XA 1S0EA 2GH8A 1NAEA 1D7PM 1DZRA 1AYM1 4C91A 5L36A 2A6VA 4BMEA 4DFSA 3OGGA 5A1AA 3ZFEA 3D8CA 4GQ7A 3WW3A 4C1XA 4LBJA 1ND2B 2A70A 2QQLA 3AVRA 4QWNA 3BTZA 2W92A 1CPMA 4C8DA 1AZDA 4CUBA 4PF5A 3KSCA 3VZJA 2DFCA 2ZAAA 2WQ8A 2X05A 3IIIA 4O65A 1ENXA 1X8MA 2OXBA 5DN2A 2ILMA 4L99A 4AEJA 3IAQA 4HSLA 2VM9A 2XL7A 3PUHA 4AI0A 1W3VA 3QACA 4XFCA 1R081 2VZ3A 1QF3A 2Y34A 4EV0A 1YYNA 2O8OA 4QPIC 1ZREA 3NL1A 1SLAA 4QPIB 1UY1A 2WA4A 3WQ0A 3M1HA 4QHZA 5CIRA 4COUA 4LLFA 3AC0A 1UZYA 2J1SA 1CAVA 3AYEA 1AX0A 4WZFA 1QJX2 4CCLA 1G9DA 3ES4A 3AKRA 5FLHA 1RUD2 1GV9A 5JLVA 1BEV1 1U5XA 4GA9A 4Q0QA 3ACLA 3GZAA 2JIJA 1OUSA 3K4DA 4RN5A 4LE3A 4EWDA 4DS0A 4BIOA 1WUVA 4HL0A 5IYYA 3NJYA 4AVSA 1YJKA 2EF6A 1QJX3 1UX7A 3VZOA 3WHTA 2XVGA 1S4CA 1R64A 2RHPA 4AHYA 4FTSA 1O4YA 1UN1A 4H14A 2J1UA 3JB8A 4OMDA 3W5MA 1OMIA 4HOOA 3ZYGA 5A6YA 4HVQA 4N9IA 3VDDA 1H2NA 4CRQA 3BTYA 1FOD1 2EICA 5CKQA 5FUNA 2GC2A 5BUVA 2K2SA 2VW2A 3NV3A 5FMOL 4HPKA 2VL4A 4FT8A 3BN6A 1KITA 4PF1A 2GSYA 4QU1A 4CXWA 3KF3A 2GC0A 3CZUA 4PLNA
chains in the Genus database with same CATH topology
1H8TC 1O3TA 1FMD1 1A3KA 1H8TB 1YRZA 2JICA 3U4XA 1GNHA 2VOWA 1RUF1 4P5HA 4UBHA 5GZEA 3WG3A 2K0GA 4K9SA 1LGBA 5FBZA 2CWMA 2DYCA 1GZWA 2E53A 4YGEA 5E16A 5ACA3 5DG2A 2XH6A 4YLZA 2A5ZA 1DHKB 3E97A 4K8FA 4KBBA 3N3HA 1EPWA 4CDXA 1W6QA 2XJRA 2DF7A 5BNNC 5BNNB 1AYM3 5F6LB 2QFEA 4Q4W1 2RMU1 2NMNA 3TRSB 3FBYA 2WFF1 1R082 4DNYA 3RSJA 4Y1YA 2R061 4K1YA 3VZKA 3EJKA 1PGSA 1VRH1 4GMP0 2ZMLA 1LHOA 2CL2A 5T5PA 1R083 3BPZA 4PIYA 3ZN4A 2D6OX 4P9YA 1U0AA 2Q4SA 2VPVA 3GYDA 2CGPA 4A7KA 3FZ3A 4JCKA 2JKBA 1IKQA 4BCUA 4BHPA 1TNFA 2ET7A 1AR73 1BEV3 3M3QA 4MGZE 2PQQA 3R0RA 1I9RA 4AE2A 4Q4Y3 2G9FA 1ASJ3 4D7YA 2BGCA 2DURA 4SBVA 4AFBA 3BALA 1YFWA 2I45A 3CL1A 1C5HA 2VW0A 3WDTA 3QH6A 4KGGA 3PNAA 2WS91 3U11A 1FMD2 4FXKB 1HRI3 3HQXA 1FOD3 1AYN1 2GMMA 1H2KA 1RUF2 4Z2WA 4DQAA 4LHKA 1NOVA 1UX6A 2XBO3 1NQJA 1Q8SA 4LNVA 2YHJA 1ZZ7A 3WOGA 2RS13 1H2LA 3URFA 1OKQA 3JD71 4AEDC 2E6VA 3WW1A 3IBMA 2B46X 4AEDB 3NV1A 1CESA 1V6LA 2XWBB 1MACA 3M2MA 5C4WA 3UKTA 4C0BA 4Q4W2 4XFBA 1C8NA 2WFF2 5CAZA 4HK8A 3POSA 4DINB 4D94A 5I93A 1PGL1 2R062 4O9EA 1RUH1 4FXGB 1WCDJ 2P3JA 1CN1A 4BLIA 1VRH2 3AJYA 3QD6A 4GB31 4Q4W3 3ZN5A 2RMU3 1SEFA 2YYOA 2WFF3 3GNEA 1IPKA 2AREA 4CDWA 1RTVA 3MFCA 3MW4A 2ENRA 1WMFA 5FLIA 2TEPA 1TQ5A 1VRH3 5JI9A 2IXCA 5CA6A 3AM2A 4NHKA 1CAUB 5T50A 2W08A 3IPVB 3I8TA 3KT4A 5KC5A 5T3NA 4DY5A 4KGQA 2WWSA 5JAXA 3V0BA 4I3GA 5CFDA 3ZSKA 3WCSA 1HV1A 1NCQC 4QQHA 1NCQB 2JG8C 2AENA 1QOSA 2PELA 2WS92 3BCWA 4N43C 4RR3C 2JG8B 2PAEA 1AYN2 4ZXKA 3ZN6B 3SH3A 4COZA 1JN2P 4R8HA 4A2UA 3AFKA 2PHWA 4E4ZA 1X82A 3QBQA 1F5JA 3TOJA 1VBB2 2BNOA 3JD72 3C2UA 2WT1A 3AXEA 3FX3A 5H9PA 4TSVA 2ZGQA 2UU8A 2DWRA 5C9AA 1H30A 2VG9A 4KQ7A 4AQ2A 4FPHA 2B45X 3SCFA 1UPIA 2DCKA 2DU1A 3MICA 1PGL2 3D5OA 4JGYA 1U5YA 1W6MB 4YG6A 5GLZA 1IS3A 3AYDA 4QQOA 3MEPA 3ZSLA 1PZ7A 5JOXA 1LU1A 5KHJA 4GB32 1PVC1 5HCFA 2EIGA 3QLQA 3ZYPA 3VHRA 1QGLA 2H6CA 4GALA 2EXKA 1RUH3 1UKRA 2GN7A 3KMHA 4DZGA 3WP6A 5A3MA 2RJLA 4YGCA 1S2KA 5LRSA 2DVBA 2P17A 5KXDA 4XMIA 4FO9A 4FOWA 1ND3A 1OI6A 2WLPA 1UMZA 3KCYA 4KWKA 1RUC1 2RS31 1VBC1 1QXJA 1UZZA 1G9CA 4KNCA 1GICA 1X33A 4IEPA 2E51A 3TYJA 2CWSA 5CFCA 2WINB 4XMAA 4YGDA 3R6SA 4PLMA 2E9QA 2WNVA 4RS5A 5L7OA 5JOWA 4G9SB 5DUUA 1J58A 4Y22B 4LO8A 4OHWA 1ENRA 3OYWA 3D6EA 3WQ7A 2HWD2 3AKPA 1MVQA 3H9AA 1SMVA 3M3OA 3ZFGA 2EAKA 1IZ3A 3VL8A 1J3RA 3VKMA 2Y0OA 5HI0A 3S6PA 2ZX0A 3FBMA 4BIFA 3V0AB 3AMPA 4INDA 3RMYA 4AK3A 4I01A 5GLVA 2ES3A 3FFQA 3LSDA 2AH2A 3MPBA 5DXDA 4D7SA 2R042 1FPN1 2ZGLA 1NQDA 1VLNA 4M3CF 2IC1A 4WBBA 5J48A 4M3CA 4BQ1A 2PHLA 3DF0A 1S0BA 4YZ3A 4OULA 1AX2A 1QXRA 4AI2A 1EV13 1AXYA 3EO6A 4LEJA 5GLUA 3B5LB 3MIGA 5EFUA 3FMGA 1FAYA 3GALA 4AYUA 2HKXA 5BYNA 3CEWA 4UW4A 1H4HA 4CP2A 1RL3A 1AHSA 4B8EA 1LKNA 2YC0A 1PVC3 2A7AA 3VN4A 3RI9A 3RRDA 1W6OA 2VMHA 3KLSA 1R092 3TN91 5DUVA 2QZ3A 3USUA 4ONUA 3VV1A 4FAHA 3PHMA 1LR5A 1RUC2 4OLLA 2RS32 1VBC2 2B8MA 3VBHA 3OTFA 3OY8B 2K9ZA 2VNRA 1RMU1 3B02A 4XJ9A 1ZYBA 4FOVA 1LCLA 5BXXA 1XE8A 1CAWA 1PK6A 3AMNA 2BPA2 3FFZA 2OZJA 4L8QA 1NE6A 4GH4C 1RUC3 2P34A 1VBC3 2RS33 4GH4B 3KM5A 3TNQA 4BZ4A 1SLLA 1O7FA 5C8CC 4GWNA 4YNIA 5C8CB 5J98B 4S2FA 3VBOA 2HWC1 3H3ZA 5F6KA 3CLPA 4B7KA 4JC1A 4Y20B 4I0AA 1KDKA 5I0SA 2JENA 3PVNA 3E5XA 2PHRA 4UXAA 1X8EA 2RE9A 1FPN2 4Y26A 5CVRA 3ZXKA 4JTOA 2PN5A 2TBVA 1DGRA 2Q0AA 1S0CA 4M01A 4K6BA 4LBQA 5FQ0A 1RIRA 4AF9A 3LWCA 4EN9B 3UV9A 2OUHA 5ABJA 1VALA 1FPN3 5JSPA 2B42B 1VR3A 2ZA9A 4HANA 1FT9A 1FNZA 2AUYA 2O0OA 2MPFA 4J1WA 4IL7A 5I8YA 1DQ6A 2VNGA 1DQ1A 4NWVA 3WCRA 5I0TA 5J3UA 1DQ2A 3WP4A 2D44A 2UWAA 4PLOA 5CB7A 2DVDA 3HN1A 2ZMNA 4PCRA 2BWCA 2ZGNA 4B4PA 2WKKA 3PTYA 1XNDA 3TN93 1RMU2 5E88A 1OLRA 1Y43B 3MFAA 3ZPYA 4WM7A 4LLOA 4Z8BA 4K21A 3ZFEC 3MIDA 3ZFEB 4CEYC 5J09A 1GNZA 1BCXA 3O12A 3J8F2 1IKPA 4FPFA 4OUMA 3SCHA 4ASLA 4R4ZA 3RMXA 3NV4A 4FP2A 4A7ZA 4Y24A 3NWKA 3O5SA 1RUNA 3I59A 2HWC2 1HRV1 4YYOA 3AZVA 1XNBA 5JPMB 1IS4A 3RI8A 1VBD1 1XE7A 2XLGA 2QNKA 3JU9A 3ZXJA 3ZDSA 2HEWF 3DKWA 1CAVB 1YO8A 3ZYRA 4I0BA 1N1VA 3CU7A 5I91A 4EWAA 4QPGA 2VOVA 3DV8A 4FPGA 1H4GA 4MXVA 1UW8A 3KZ4C 2WNUC 3ZXGA 3OJBA 1ZBA1 1K5MC 3SH4A 3FLRA 1MEC3 1K5MB 3ZYJB 4PDWA 3WDYA 3VBUA 2BQPA 1ULFA 4B3NA 1LEMA 4AGVA 2IXIA 2V5YA 3PJQA 4V1PA 4GKYA 2ZGSA 4UW6A 3B69A 4XJUA 5I8TA 4IXLA 1J3QA 1REEA 3ILNA 3THPA 1C8M3 4CDUA 4BOWA 2EXHA 1XU2A 3B93A 4QGLA 4YG3A 1DIWA 4ES8A 4AVTA 1Y3TA 2XVLA 1HX6A 2VH9A 4MZUA 3QOPA 1V6OA 4JDMA 1N1TA 1GZWB 1QJY2 4MUVA 4Y5Z0 1EP0A 3WDUA 4CDXC 2QJVA 1MR5A 4QU2A 1KFXL 4CDXB 2JD4A 3ZX7A 1W6QB 3E5UA 4LE4A 3NAPC 4XBLA 4ZU4A 1ZZ9A 3RJRA 3GZTB 3HIFA 4LUMA 3WNXA 2R1BA 1QJZA 3MDPA 4EN8B 4IEQA 1D2SA 4OHVA 2Z42A 2ZGUA 4C90A 5KHIA 1ULDA 1D2QA 2D98A 2PYTA 3FLPA 1QDOA 3RG0A 1ZRDA 2I2SA 2D5HA 1HRV3 2DUOA 3JUUA 1PNGA 3M3EA 4FPOB 5BV6A 1VBD3 1W2UA 1WLWA 1PIV3 5I0RA 1AX1A 1ZBA2 2MEV1 4JDNA 4Q1PA 3FJSA 1LOEA 3SLIA 3OD4A 4GXLA 1RUI3 4B29A 3WDWA 1O91A 2HWB3 4BM8A 4XQWA 3BTAA 2XHKA 5ACA1 5J7MA 4PQ9A 5KC6A 2XJQA 2MNGA 2HWF1 3O0WA 2WZR3 3AMMA 3VKOA 3OCPA 1MQTA 4Q8KA 1ND2C 3I2DA 3LGRA 1I3HA 3UL2A 3TAYA 2GNTA 1YXWA 1ULGA 1AUYA 4COWA 2P3IA 1CR7A 3L9JT 2ZKLA 2Q8OA 4XEZA 4YW3A 2E63A 1VIWB 1D4M3 1B35C 1YJLA 2D7FA 4YFZA 4E2QA 2H6BA 1B35B 2ARBA 3AKTA 1MZEA 2D97A 2JE7A 1HLCA 2YV8A 4RQPA 1YWKA 4HVRA 1M4WA 2FQPA 4META 2RR11 4QXKA 1F31A 5C4WC 1WMEA 3UK9A 2YY1A 2VY0A 3RQ0A 5C4WB 1SLBA 3C3VA 4Y4YA 3V56A 1AR71 1BXHA 1OA3A 3SXWA 1RUJ3 5K0UA 1A8DA 4Q4Y1 4EWEA 1ASJ1 2E7TA 1MVEA 1OLQA 4HSJA 4I30A 1DU3D 2HWE1 5T55A 2PHTA 4LTAA 2BW8A 5JOZA 2R6QA 4LA2A 4DXZA 3VBRA 5C8WA 4CDWC 2BFUS 3EHKA 1JHNA 2ARXA 4YVSC 4E27A 4CDWB 3MIHA 4YVSB 1KS5A 1HRI1 4MYEA 4TZDA 1XXNA 1OFNA 4Y1XA 4YW1A 2XBO1 2YXSA 3IWZA 2RS11 5ACA2 2A6WA 2OZ6A 3SCGA 1CONA 2DVAA 2MEV3 3AP4A 2IZWA 2WFPA 2HWF2 5CFDC 4S2GA 1AYM2 4E9KA 5CFDB 2DUQA 2OA2A 5A33A 1WMDA 1LOFC 1RUE1 4QGMA 1W6NA 2UY9A 1DFQA 4AQTA 3MF9A 2HWF3 3VLBB 5T52A 2WLQA 2ZX4A 4MV2A 1C4RA 2NN8A 4OZXA 4YM3A 1URXA 1GQHA 2XJUA 3RYKA 3LZZA 1UU5A 5EV7A 3IDEA 2LTNA 4P9GA 4Q2FA 1H9PA 1A78A 2YUEA 2EAAA 4AEMA 4OI1A 3N4MA 4TWTA 1NG0A 5C9AC 5F1RA 5C9AB 2HEVF 2ZAHA 4YZ4A 3GBGA 4FOQA 2UYBA 1AR72 1BEV2 1GQGA 1GANA 1PM7A 4JGYC 4F7ZA 2P37A 4JGYB 4Q4Y2 3WP3A 1ASJ2 3MF6A 4IV3A 1VBA1 1A8MA 2UURA 2RR13 2WQZC 3WW4A 2HWE2 2BNNA 4J6GA 1KXGA 2B9UA 3AB0A 4Y1ZA 4QM8A 1R1A3 4LHLA 1QDCA 4X6QB 4UBGA 4OFGA 1FATA 1HRI2 2VGDA 1FOD2 3MZHA 4I09A 4L11A 4RGAA 2HWE3 3TB0A 4ES9A 1DQ4A 4FAGA 2Q1ZB 1U5IA 2D5FA 2A3WA 2XKPA 2XBO2 2XUMA 4X6RB 1ALYA 1SBDA 2A3XA 5GALA 3HMYA 1G8WA 1JW6A 3HR9A 4A7YA 3B7MA 2RS12 4BYYA 4XYXA 3PVOA 4G3YC 1REFA 3GBWA 2C5DA 2VXRA 1ND3C 1SACA 5JIAA 4MGIE 1RC6A 1ND3B 3S7IA 1MZ6A 1RUOA 2CNAA 5KHHA 3BOWA 4BE3A 2QDRA 5CFCC 4I3PA 4YW2A 4L92A 4Q4X1 4XE9A 5CFCB 3RJ2X 4LBLA 4WV8A 1H1IA 4RS5C 2WNVB 2BVBA 4RS5B 5KHGA 5L7OB 2GU9A 1GFF2 5FAXA 2ZGTA 1DZTA 4XBQA 3OYWB 2RMU2 5E8AA 2CV6A 1DYPA 1RUE3 2QUOA 2OYZA 3KT1A 3ZFGC 4K7JA 3ZFGB 4TYSA 2R49A 5KXBA 3IT8A 2DCTA 3IMNA 4XTMA 1HQWA 1BZWA 3K51A 4Y1UA 1ULCA 4FPYA 1YIFA 2DCJA 3N7JA 1O5UA 3ZMNA 1VBA2 4O9GA 3B01A 4FPLA 4M3CB 4KH9A 3KD4A 3ZYIB 4AHWA 4N7IA 5DZEA 4QHBA 3E6DA 3KGZA 1AXKA 1UF2C 1JUIA 1REDA 2EALA 3S7EA 1VBA3 2NPIA 2ZJCA 2EXIA 4YFWA 5GZDA 2GN3A 1YHFA 1CQ9A 3TNPB 1HXS1 4OHZA 4MSVA 1YLLA 1H1AA 1N3QA 4R9BA 2V09A 1HV0A 3ME2A 2XL9A 1LGNA 1W6OB 4FOYA 3RYPA 2DVGA 3BODA 4X8PA 2PAKA 3PVBB 2ZZJA 2UYAA 2IFWA 3JCIA 4LBMA 5JR7B 1APNA 5FO9B 5HBAA 2IXKA 4GULA 4AVCA 5DDJ3 3WW2A 3USUB 2N7GA 3OF1A 3UKVA 1RVF1 3S0MA 2VMIA 1Q43A 4KG0A 3SITA 3H3UA 3OGJA 3VBHC 3VBHB 4FQ4A 4XF9A 1PK6C 3AKQA 1IPJA 2ZTNA 3PMSA 4Q4X2 1CAWB 1PK6B 3A4UA 1XYPA 2VU9A 1W39A 2XGXA 4XIOA 5BPXA 2QVSB 3ZXFA 1O5LA 4OI0A 4PIZA 4AGRA 5I8SA 1EV11 4Q4X3 5IK4A 3V64A 3VBOC 1RUH2 5FOBB 3SNMA 3VBOB 1ZX5A 4IEZA 1WCSA 1U5ZA 1NXD1 4FCAA 1DBNA 4E4DX 2ZGOA 4D3WA 2JG9A 2CAVA 4Q0SA 1S0GA 2CY6A 1KD7A 4IV1A 3T2TA 4Z92B 3R4SA 1O4TA 1LHVA 2NLRA 2ZACA 4XFGA 1PGW1 3RDIA 1S2BA 2CTVA 4YM2A 3B00A 2DU0A 4LBQB 5FQ0B 3MIBA 5ABJC 3MYXA 4AXOA 4I0WB 1KQRA 5ABJB 1NA1A 4P9XA 5D8AA 1BMV1 3JZVA 2B7YA 1ZVFA 4AFDA 3TBDA 1HXS2 1VAMA 1X36A 2YGLA 1YFXA 3JBG1 2ZX1A 2D6KA 3FE5A 1LRHA 4G4FA 4HBNA 2VUAA 4QGNA 1GZ9A 2C9AA 1Q56A 2IXLA 1AVBA 3H50A 1WW4A 5GZCA 1HXS3 2E7QA 4M0HA 2ZABA 4XTPA 2GDFA 2YGMA 5F5QA 3U0ZA 1DQ0A 4WM7C 2W0XA 1BBT3 1NY71 3S30A 4WM7B 5A3LA 3OBRA 1QOTA 4RHV1 3DGTA 2XJTA 4U36A 1RVF3 1WW7A 2JDZA 3KCXA 3M4FA 4Q4V1 3T1LA 1FYUA 4JQRA 3H1MA 4QX5A 4AEDA 3AP6A 1EV12 1NZCA 5JCTA 2YROA 3MPPG 3FWEA 3N7MA 1WD3A 1J59A 1UAIA 4MGKE 4DOUA 4I02A 3I59B 2BBVA 2MHFA 3IIAA 2GH2A 1UKGA 1PVC2 3RS6A 2R30A 4QD2A 5BNQA 1QHDA 1N1YA 3DPRA 2D43A 2BWAA 2RM23 1U12A 2OW4A 4QPGC 3T1MA 1DGWA 1PGW2 4QPGB 3DUIA 2IWGB 5DZFA 1GKBA 4RL7A 1WLTA 5FPXA 4PDWC 4WM8A 4WVZA 1BMV2 4PDWB 1UU4A 3W9AA 2RS51 3O14A 1JTZX 2KA3A 1UD1A 4OHXA 2Y26A 1S0FA 3MI8A 4XFAA 3EBRA 1VJ2A 3O7OA 4XF0A 4F83A 4LO6B 1D0GA 4XW3A 2TUNA 2V73A 5IK8A 2XB6C 4CDUC 1GSLA 3KS7A 3RPQA 1GR3A 1SFYA 4CDUB 4N53C 2BNMA 5AVAA 4N53B 2TNFA 2PHUA 4E2SA 4IEXA 1UL9A 2PHDA 4HLTA 1S1AA 2G9GA 2UY8A 4N43A 3JBG3 1LHUA 1MS5A 2P2KA 4RR3A 2X53S 3USSA 1QNWA 4DPNA 4ZKTB 3VUOA 1DZQA 3POWA 2CGNA 4QT6A 1NY72 4PBOA 5IK7A 2D6MA 1CIWA 3JQXA 4IQPA 1Y9QA 2DVFA 3AZWA 1YCIA 3ZFFA 1CAXA 3LKJA 1Z7S1 1PO23 3M7AA 2ZGRA 3AFGA 4H55A 4P14A 4A3XA 4XJAA 2YZ4A 4PBPA 1XNCA 1BK1A 3HWJA 4RHV3 1F9KA 1MEC1 4Q0PA 4RSUA 1ZRCA 2G4IA 3MW2A 2Z5WA 1AR91 2O1QA 4AW7A 4Q4V3 3WDXA 4Z82A 3VBSA 1VB4A 1YFUA 1QXPA 3WHUA 4ITCA 3H8UA 1C8M1 1DGWX 1UIJA 3ETQA 2R0FA 2HEYF 1OQEA 3PMEA 1S0IA 1NLRA 2HJIA 2Z79A 4MLOA 1GZCA 2ZGPA 1ZBE1 1UPSA 1DGLA 3M70A 3ATGA 3TN92 2NMOA 3RZZA 1OQ1A 5KWRA 1C3HA 3AZXA 3HD8B 1PZ9A 1V6NA 1CVNA 3NVCA 3PLQA 5JZGA 4HETA 4HT1T 1AJKA 3WY6A 1Q8PA 4TLFA 5IT6A 1Q8OA 4WVMA 1WLDA 1QH6A 4XQ4A 2FHRA 1MQTC 1R1ZA 2AGSA 2GC1A 2RS53 4B7EA 1MQTB 4XXPA 4PIXA 1JYIA 2F4PA 3MLLA 4NR1A 4ISRA 4LR4A 5KXEA 1ULEA 3WZ1A 3V65A 2X29A 5FMOS 3JB4C 2Y38A 2Q1MA 2UWCA 4YZ5A 4AGGA 4QQLA 5IUQA 1N3OA 4YW4A 1L3JA 1OOPA 4RQPC 1DGRN 1PIV1 4RQPB 2EXJA 1LU2A 1MEC2 1RUI1 4MXWA 4KL1A 5EJ3A 5EXOA 5CG8A 1ZNPA 2HWB1 4HVOA 2WA3A 1HW5A 1MS0A 4S2HA 2A6YA 4AVAA 3JQWA 4QPYA 5T5LA 5K0UC 1NCRA 3E6CC 1Z7S3 5K0UB 5DUWA 1WW6A 1X50A 5LEKA 1HKDA 2Z2SB 4BPZA 2WZR1 3L2YA 1MS1A 4LBNA 1C8M2 1O4ZA 1W6PA 4RA0A 1AR93 1NXMA 2XJVA 2P3KA 2AZ5A 1MS3A 1OPMA 3VDDC 3NJZA 4JRAA 1V9U3 3VDDB 1OQDA 1JXNA 2XKOA 5EWSA 4HPKB 3ZXDA 3CF6E 5J36A 2JEMA 3VKNA 3AXDA 2YMZA 3AYCA 3VHNA 5J37A 1LHNA 1D4M1 4L2NA 2IFRA 4XBNA 4OI2A 3N35A 1ZBE3 2R1DA 1I1EA 1RB8G 4OVEA 5H9RA 3OD0A 3I54A 3AJZA 1BJQA 1VAKA 2DCZA 1XNKA 4U2AA 3ZVXA 4LHNA 5A33B 3VKFC 1LEDA 3IM0A 3KQRA 1W6NB 1RUJ1 5FTTC 5JIUA 4AHZA 1ZZ6A 4NVPA 5JWPA 2SLIA 1JYCA 1TEIA 1YI7A 2YDEA 1HRV2 3ZSEA 1SLIA 2VOXA 4EN7B 5H9SA 1VBD2 4HZFA 1PIV2 1WGPA 2PLV3 3I7DA 4FSJA 2ZS6B 4P9JA 3J9SA 4FQZA 3AMHA 1HIXA 1RUI2 2WL1A 1YFYA 1QJU3 1LECA 2HWB2 4HFSA 1LTEA 3ZXLA 1CJDA 1IOAA 4IV3B 2JXAA 3IKWA 1VBE3 1OD5A 2WZR2 4URTA 2ZHNA 1N3PA 4F3JA 3KGLA 4CZSA 4UW3A 1POV1 1V6KA 3Q9OA 4IEYA 4P9WA 4AVBA 5LEJA 4BA6A 1LJ7A 4OI4A 4YG0A 4RFT0 4AHXA 1Q3EA 4AEKA 3QH7A 1J3PA 4YW5A 5K8SA 4YVWA 1DQ5A 3IDBB 4LO7A 3WUDA 1D4M2 4IERA 4FP3A 4LBOA 3GHMA 4XFIA 4XJWA 4KWLA 2FMDA 2W52A 5AC91 3AYAA 2W68A 2R0HA 5EZWA 4AFMA 4XF3A 3WXPA 3I4IA 1S55A 3NV2A 4ORFA 1E57A 4KWJA 1AR61 3FUQA 1DLLA 1V6MA 2KM2A 1RUJ2 4WVWA 3PJYA 4YRDA 1LOGA 4CEYA 1TME3 4HMZA 1Q5OA 1ZM1A 1UU6A 4H7MA 3LA2A 1R1A1 5F9TA 2QZ2A 4LUKA 3K48A 1RUG1 3TWIA 4MH0E 2UWBA 2XPJA 2WQ4A 2PAMA 5LRRA 4NOTA 2PTMA 2EA7A 2NYYA 4LA3A 5SV5A 4EN6B 1UCXA 3BIWE 4W6WA 4EN0A 4KU8A 2MEV2 3EQEA 5JI7A 4DRVA 1H0BA 2WNUA 3AZYA 4IEVA 1K5MA 1AJOA 1H9WA 1YUDA 1RUD3 3R4DB 1Q8QA 2WSVA 1HQLA 3LA7A 3V0BB 1POV3 1LOBA 1ENSA 3SMHA 4BMBA 5DZGA 1MZ5A 5BNOA 1PVXA 2I74A 5AC92 3LAGA 4N9HA 1GYKA 4YM1A 5BNPA 5CG9A 2WJSA 3RWNA 3O0VA 5FOJB 2DV9A 3B9CA 4CDQA 2Y0IA 2VW1A 3J4UH 3D0SA 1HDKA 1C28A 2BEOA 1M06G 5FPZA 5L73A 5AC93 1AR62 1PZ8A 5BY5A 3AP5A 3VKLA 4FPJA 1A6CA 4CP1A 5AFBA 2RR12 2FBEA 1MS4A 3AP9A 4SLIA 4W6YA 4I2OA 5C33A 4IETA 1R1A2 2VECA 5CBLA 3H0OA 1AR63 1LODA 4D7TA 1H2MA 3FLTA 2VVFA 1KS4A 3NAPA 2VQ0A 2ZBJA 5GLWA 1FV3A 3CJIA 2Q30A 4NHLA 5GZFA 1SLCA 1RUG2 1FI2A 5A32A 3ZSJA 4CEWA 3HAGA 3VBFA 3P3NA 4C1WA 5CU1A 4P9LA 2JG9C 5KXCA 2JG9B 4Q8LA 4IV1C 2PA7A 2DFBA 4R9DA 5I0UA 4IV1B 2Z69A 3WG4A 1RUG3 2X5IA 1EYBA 5DDJ1 2NM1A 4EJRA 2EVXA 4LT5A 1G9AA 5FREA 2PHXA 3U10A 1NA1C 1PO11 5D8AC 2QKDA 1NA1B 5EYYA 5D8AB 4RD7A 4LULA 1ZRRA 4XFHA 1BYHA 1CJPA 3R4UA 4QQPA 2ERFA 4JGZA 1SBEA 4IEWA 3HBZA 1RUE2 4CP0A 3AP7A 4HN0A 2GAUA 2JX9A 3W59A 1FXZA 2WNVC 1QY4A 2B39A 3ENRA 3M3IA 5L7OC 1ND2A 2D6NA 1WA4A 2NZ9A 2WSUA 4XQDA 3VZLA 3UKNA 4L97A 4NN0A 2ZMKA 4XHXA 4JTNA 5JDBA 1ONAA 1G7YA 2WNEA 2D3RA 2GNBA 1IS5A 1XU1A 1RHI1 1NYWA 4LO4B 4YSFA 3WD5A 1RGSA 4FTBA 1B35A 2BTVC 1FMD3 3DL3A 4H7LA 1VBB1 2H0BA 1RUF3 4QPIA 3WX5A 1WD4A 1SFNA 2BYVE 2A6ZA 3AKSA 5GLTA 2WT2A 4NHMA 4S2DA 3CJXA 3WT3A 1JBCA 4RGGA 2ZX2A 3FC0A 5FDBA 3DPRC 4COYA 3DPRB 2XJPA 2ZOEB 4CYDA 4R9AA 2WZPP 2E7AA 3ZO0B 5DDJ2 2VMGA 1AL21 4YVSA 3FHIB 4GMP1 2R063 4B4QA 4AFAA 5HCAA 4FTEA 1PO12 3MLKA 4WM8C 4Q1RA 4N7UA 1BBT<