4HKBA

Ch67 fab (unbound) from the ch65-67 lineage
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
220
Chain Sequence
b'QVQLVQSGAEVRKPGASVKVSCKASGYTFTDNYIHWVRQAPGQGLEWMGWIHPNSGATKYAQKFEGWVTMTRDTSISTVYMELSRSRSDDTAVYYCARAGLEPRSVDYYFYGLDVWGQGTAVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH67 heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
total genus 39
structure length 220
sequence length 225
chains with identical sequence C, E, G, I, J
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkbA01
1HH9B 1JYVA 1CDJA 2ZCLH 3TCLA 1KTDA 1MRDL 4L5FL 3GJFB 2C3VA 3AC0A 4AH2A 1V5JA 2B7DT 5CAYB 4UV7H 3OKLB 1CVRA 3QCUH 4OZFH 3CFJA 4XPTH 2J8OA 2YHGA 4EUPG 2BVEA 3U0WL 1CFTA 3P73A 2H1PH 4FTVA 5GSVB 3WKNA 4DKFH 1QKZL 3EYQD 3PHQB 2DTML 2GK0B 1V7NL 2C4XA 3V5HA 5M7QA 4J4PD 5LGHL 4F3FA 4F9LC 3WIIL 2LAGB 4Q2ZA 1UJ3A 2ARJA 4PS4H 4G43A 5C0JB 3T3PF 1FO0L 3C8HA 1NEZB 3FN0L 3ILQC 4H88H 4QT5B 1L6ZA 2LQRA 4RRPG 1T0MA 3E3QE 1MF2L 4HIIA 2WQ8A 4G80A 3BKCL 4YFLI 5IMLB 4ZUVA 3C2AH 3HZVA 2HP4A 4ZAKA 1GC1L 1ZA6B 4YX2L 3D3VD 3QNYA 1ROWA 1XAUA 5JHLL 1JF1B 1DDHA 1JPFB 4OZGA 1RUKH 3IB4A 1KOAA 5EC1B 2OTWA 4FQCL 3CZFA 3MXWH 2DMKA 1RZFH 3VXTA 1J1XH 4FN0A 1FLTX 3MJ9L 1P4LB 2A38A 2I26N 4M3KB 4QOKE 3GFUA 4K9EH 2GTWA 2J8UA 4EDXA 1Z6JT 4WWKD 3AS3A 5CKGA 5GS0H 1QR1A 5F89B 1A02N 3BAEL 3HB3D 1T20A 4MVBD 1J1PH 2I60H 5D70L 2IGFH 1A1OB 1CGXA 1KUMA 1ORQB 4JREC 4NBZB 3PWPB 5B8CC 1DL7H 4PRDB 1TVBA 1MUJA 4P3DA 3KYAA 4EDWL 3D2UB 3SE3A 4MZ2A 5DO2D 4GW5B 1SYVB 1QFUH 3N85L 4KDWA 4DN4H 4X4XA 2VLKB 6FABL 4HBCH 5HHMB 1NAMB 2R2HB 1KCUH 4R2GD 2BSSB 3H9YA 5DVMA 3WN5A 3BI9X 5E8PB 3NCJL 3BYTA 4HUWB 1JZ5A 4Z7UA 1YMHA 5DMYA 2FBJH 5IBLD 3MRQB 4LPUA 5LBSL 5JR1L 1RZKH 2MJWA 1YEFL 2OJZH 2XACC 4J1UA 1MIEH 4YHNA 2FR4B 2P1YA 2VLRA 4RMSA 5GGVL 4IS6B 4MNQD 1MCBA 2ZSVA 5CJXC 1N6VA 5C1MB 5HY9A 4FS0A 3CX5K 3LRSA 3VFOA 4QKXB 2ERJC 3A6BH 4OIAA 4K3DL 2H45A 3RVTC 3P0VH 1UWGL 4P5TB 1YMMB 4V1DD 1JNLH 4JHWH 2DQTL 5FECB 5F96H 2OM5A 4ZUSB 4BKLA 4JY6A 2MQ3A 1FJ1A 1T66C 1BVLB 4S11A 4HQQL 1WJ3A 4K8RL 3HUJF 4ZAKC 3BHBA 4NBYB 2FO4B 2EXYC 3S35X 5HI5C 1H15B 3LZFL 1JZ4A 4FQXA 4Z5RA 4DGYH 3G04A 1DSFL 4AL8H 4GUPA 5A2JH 1NLDL 3DOSA 4W4NA 1CG9A 1CXEA 5D96C 4F2MA 1VSCA 5CHNB 2R2CA 4OF0A 3V6FA 4LSPH 4NKIH 3EAKA 4LLQB 4P59L 2QHRL 3QFDB 2DQFA 3CX5J 1F4XH 1KPRA 4MJ2A 5IFHL 2DYPB 5EBGA 2KQNA 5ID0A 4NQED 3B5GA 3SGDI 1XR8B 1A1NB 1ED3A 3IRZA 1L9NA 2IAMC 3LEXA 3O8XA 4NHUA 4XP9L 3T1FB 5JHDB 3ZHLA 2FEDC 4X7SH 4Y4FA 4P49A 4QOKA 3DIFA 5CHNA 5CP3H 5D6CA 5ADPH 5F9JA 3C6LA 3MUGA 4YZFF 1AQKL 1RIUL 4IBLT 4JB9L 3IT8D 2VSCA 4GKSA 3GMLA 4PG2C 1YN7B 2FEEI 4FQJL 2BOCB 4KRMB 3ULVD 3HMXA 1VFAA 4Y1AD 1B0RB 1QFWM 1NCDH 4QOKB 4TTDC 1MRCH 2H2PD 4BQ9A 1RZJC 1PSKH 1KIQB 4BUGA 2Y36L 4M62H 4NM8L 4OZIA 1NGQL 4O2FB 2AK4E 3VI4F 5AZEH 4JHAL 1FIGL 3WJJA 1KF9B 1Q38A 5KW9H 4N1EA 3RWEB 3LN4B 1N59B 4Z7UE 2IAMD 4F9PA 5I1GL 2C3HA 4U1LB 5JPNA 1H0DB 3CDCA 3BZ4A 5JXEC 2BVQB 1OAUL 1WC7A 2M2DA 2VLRE 4JZJB 4APQA 4F15B 3MLVL 1F13A 2OTPA 1HHIA 3DSFL 3PGCB 1CICC 1WBZA 1Q1JL 1S9VB 2WIIA 4I77H 4KC3B 3MREB 4HLZH 1AQDB 3PABB 5I1IL 5HHOA 1I3GH 3B8SA 4CMHC 2R29L 4X6CA 5HTSA 3PV6B 5D2NA 2GJ6D 3OB8A 2HT3D 2Q7YA 2EYTA 4P5TC 5EZIH 4O51A 4PGEB 1CD8A 2QSTA 3CVHL 3P9MB 4WWKC 3X3GL 1MIMH 3OL2A 3P4NA 5ESVB 5KSAD 1F58H 2QSVA 2XOTA 2FWOA 1DQJB 3DHMA 3ZO0A 3PGDB 4HXBH 3WLBB 3O41B 4QRPA 1A22B 1S9VA 4YC2B 2A6JB 1RUPL 3BXNA 5BXFA 3VGAC 4OZGF 4PRHE 1HNGA 5LAXB 5JA8B 3W0WA 3FQRA 5DD1H 5T1LD 5GXBB 4HS8H 2XFXA 3VFMA 1YEGH 3UXFA 3FQTA 1X5HA 4O58L 2VLKD 2VZVA 3OX8A 3O9WA 2W59A 2NY4D 1YEJL 3WO4C 1CLCA 1EGJA 5AAWA 1IKFL 5EZLA 2WBJA 4LIQE 3TIEB 4M93B 2NY0C 4QRTB 2F19L 4F9LA 3E2HC 5SX4I 4Z7WA 2A1WL 3C8KB 3HI5H 3R06B 3MXVL 1BF2A 4JJ5B 5LCVL 4ODVL 1CT8A 1KELL 3OR6A 1YECL 2UZIH 1FGNL 2B0SH 2F5BH 3OZ9L 2EC9U 2LU7A 2LTQB 3IDIB 1U8NB 1J8KA 3KYKH 5E03A 4OCXL 4UDUA 1RMFL 5SX5H 3ZTNH 4M7LH 5HHQA 1TXKA 1U8LB 4LRIC 4EQ2A 2XKUA 2ZP0T 2P49B 4W6XB 4LFHD 5DLMH 1T2QH 2EKSB 3O45B 4PIRF 3VH8B 1XGQB 2OLDA 5TFSH 1D6EA 1IC1A 5K9KB 5HYJB 1TFHA 5GGSB 1LO3H 4FG6C 4HUXA 4K9EC 1F02I 3TO4C 1JE6A 5DJAB 1AY1H 4JFYA 1NDMB 3D1MC 3ARYA 5E2WL 2XIDA 5KJRL 5D1XD 4EN3C 4X9GA 5CSZB 4LLDA 4U1NB 1CR9H 3BP7A 3ZYOA 1B4JL 4ALAL 2YBRA 1AFVL 2I07A 2BX5A 2WV3A 1KT2A 2PTTB 3D3VB 2IAMA 3NA9H 4D94A 1LE5B 4OM1L 1IC4L 1HCFX 3F12B 1QLEL 3D2UD 1CD0A 1W72L 5I1CH 5ESAB 4PJ8B 1R3LA 3WKML 1YEHL 2J6EH 4NQDE 4R2GB 4MGXA 3ARUA 4HFWA 2WMPA 4PJ7F 1CGSH 1FFPA 2C1PB 1S7WA 3P9MA 2E27L 3V4VH 4XMPH 1QLFA 4H0IA 2FWOB 1DVFA 1EJ6A 1L9MA 1OQXA 2HT4C 3EUUA 1A14L 4OLWH 3SEPA 2GJ6A 4KUCD 5I1KH 3VGHA 4JQIH 4BKLB 4ZUSA 4X6CE 4KQ4H 4Q6IC 5I8EB 4C56B 1NLBH 3HPJB 4OSUL 1RHFA 3TNMA 1A2YA 4AMKH 5AAMA 1DQLL 3TT1H 1ES0B 3BP4B 4KAQL 1I4FB 4G43B 1JHLL 4Q9BA 4JM2F 1L0QA 4LBEA 4P5TD 1X5JA 3HAEB 4PG9B 4KFZC 1MHHA 3QDJD 1KYOJ 5C0IA 3W0WE 5JZ7D 2ZCHL 1IGTB 2CKNA 5BRZB 1Z2KA 5T5FH 4L8SA 2UWEB 2Y5TA 2D4FA 1J1OL 3O3DA 2WAHA 4MDIB 4M6AA 1DBKH 2GY5A 4C56A 1KTRL 3MV8A 4Y5YB 3HPJA 1ERNA 5D7KE 3BD3A 3VMNA 1NAKH 3QDGD 1CN4A 4ZPTA 1MHPH 5GGRA 4HIHB 4OLUH 4P2QB 3WBDA 1AD9A 5EA0L 4PJGA 3TZVC 4DKDC 2IQ9L 2ICWB 2E9WA 4I4WA 4MXWL 3WFHA 2A77H 5KVEH 1Q9KB 5DD5H 4AM0A 1DBJH 4RWYH 1CDUA 1F6AB 3T4YA 4ELKB 3GMPB 3QUZD 4FQHA 4UUJA 3OJMB 3IGAA 1JPTH 4PJFA 2YKLH 3QULA 2F53D 4LSTH 3V7AE 4K94H 4HFUH 1HQRB 3NH7L 5IESH 4HIEB 3MV7A 4DAGL 4KVCH 3RGHA 1KN4L 3M17A 5JMOC 5CSBA 1JMZA 2NY3B 1KFAL 3MV11 3OKMB 5IOPA 3QJFA 2APVA 3RTQD 2HH0H 5D7JA 4N1CA 4XVJL 5A2FA 4J7RA 1HWGB 2CXGA 3QUKB 2MPAL 3D5OF 5DUBA 1MPAL 5T3ZE 5IV2B 1F5WA 2AAVA 3MRFB 3ARWA 2YD5A 5JOFB 4LPWA 3VRLF 4K8RC 4PGZA 1CLYL 2A9NL 1UA6H 3PHOB 3OF6D 5F6HI 5IFJB 1BFVH 4X6BB 4HKXB 3HR5B 2NY0D 2FL5A 2APBA 4GW5A 3Q2CA 4PJEF 3HE7A 2IG2L 3FB7A 3EO9L 4IRJA 3JV4B 4ZTPH 3VFGL 4NQCE 4UV4H 4OV5A 5EN2B 1GAFL 3QNYB 4JFDB 2Q86A 4IOIA 4HX1B 3O8XD 3AM8C 1PZ5B 2ITCB 3KJ4C 4YHLL 4HV8A 1CFNA 1U6AL 2XG5A 2OK0H 4PJAB 4DKAA 3E6FB 4N8VG 2XRAL 1QFOA 3NIDE 4M61B 5DZOA 1UEMA 1NBYA 1F3DJ 5F21B 3QA3B 4L8CB 2B39A 3RX5A 3CFJB 4KQ3H 4JDTH 1AGBA 1IM3B 4HKZB 2PF6A 4KMLB 5JIHA 1YNLL 5T5NG 5F6IB 2GT9A 3D85A 1XGPB 3PWLA 4E41E 1A6UH 1PKQA 4N8PA 4Y2DC 1J5OH 2I9TB 4U1IA 1S5IH 3IAQA 3QHZL 1RHHA 3BOVA 4K3HA 3F7PC 4ZDHB 1UENA 1I7UA 1T0MB 2X5PA 4MJ5A 4HH9B 5IW1A 4XCFH 1FYTE 3QPXL 4UT6H 4KI5E 4N8CH 3R8QA 3O4OC 3T77A 1VACA 4OCWH 4EN3A 4PGJA 3VG0H 1BOGA 3S88H 4ODBD 3G6AB 3S3PA 4U1KB 4YDKL 4WW2C 3VE0A 3LPWA 3SO3B 5ACZB 2ICWJ 4WW1A 3C87A 5EOQL 5DHXB 4P57B 4UINH 4ZPTB 3F58L 3OAZH 5E2VH 3G08B 4M1GH 3GSXA 3S37X 1IGIL 2XN9E 4OQ1A 4DEPC 3AS2A 1N26A 4CJ0A 1NFIA 4GKZB 1JFQL 1FAIH 1NUNB 1ZXQA 4ODXA 1AC0A 4C56E 5EO1A 3C5JB 4Y19B 4R9HA 1IGYA 4XGZA 3BW9B 3DSNA 3DVNA 1S7RB 2VDOH 3O6KH 4OCRL 3VW3H 3NPZB 3JTTB 5IW3A 1MWAL 4P3CH 3SGJC 4PJCE 4XCEA 4LKCB 5EIIA 2VIRA 4N0UB 2YUWA 5ADOL 2NCMA 1TDQA 4WGWB 5IFAL 2P5EB 5C71A 4JO1H 2APTA 4PJFE 1N3NB 3ULVE 4I3RL 1PDKA 3MLUH 1QSFE 4QHUB 5L0QC 4MX7B 1GC1C 1QACA 1XIWC 4NQXB 3VA6A 4KHTL 3UTZA 3FT4B 5JPMB 1YA5A 4X6DB 4BFIB 1AJ7H 1PY4A 4Q0XH 1K6QH 4PB9H 1I1AD 4HKXA 1MFNA 5EIQA 1NCAH 5BOZG 2AEPL 4OZGE 4RGNE 3VXUD 2CLRB 5FUCE 1SJEA 4G8FB 5HHPB 4S10A 4MD5B 5IB5A 4NN6B 4JRXE 4OLXH 2NY3D 1OSZB 3K80A 3VXRA 5F7LB 1MCWW 5FEBA 4HKBA 2ITCA 4F58L 1Q72L 1JRHH 3NAAH 5IQ7L 2YBRB 5FF6A 4K3EL 3SCMC 2ED9A 2P46B 2YMXL 1M7DA 3I02B 2VLLA 2H6PB 4ZAKD 2CRMA 3PQYA 3NOIA 2BRQA 4TVSa 2R8SL 5E6YA 4KRPC 1CCZA 1GSMA 2V7NA 1CDBA 4GBXA 2PN5A 4J3WA 5FAAA 4LLYA 5KSBE 3TZVB 1JWSA 3IXAB 5ETUB 4RAUB 2GSGB 1VFMA 3O8XB 1DQQA 4M9OA 5LGHH 3I02A 2NTSP 3ARSA 3NABL 4IJ3B 5D7JC 5A16A 1VKXB 5GZND 3SE3C 1I1YA 1WZ1H 2Y7QB 3RWIA 4Z78A 1D5XA 4WIQA 5CP7A 1H3WM 2BNQD 4C59B 5HGBA 4QO1A 1KBGH 4I3SL 1VEMA 3FRUB 2PXYB 1SBBA 4JM4H 2X4TA 1HHJB 1RFDL 3K8MA 4XPAH 3LSOA 5EORH 2R15A 1RY7B 1TCMA 3SKJH 2IANB 4EXPX 4MYWB 1QA9A 3VD3A 1OP3K 1AGFB 1PBYA 1MCPH 2AJXL 1S7SB 2BNRD 2JELL 3MBEC 4GOSA 4NNXB 4XNXL 3GSVA 4ZD3L 1EEZA 1NEUA 5HHMD 5BXFB 3BVNA 4F7CB 3BW9A 4NJ9L 3T0VA 2ZUVA 1FNSL 5HVGB 5CD5C 2NQCA 2XN9A 1SBSL 5L2KE 1RZFL 3WUWB 5I9QB 1OAQH 3HR6A 4HH8A 3K4ZA 1XCTB 5DJYA 3I75A 3AS0A 4D9RE 3IU3A 2H41A 4WUUD 3FONA 3FQUA 3KPMB 4B7IA 1NEZG 4GXUM 5CZXD 3CNKA 3N1PC 3P2TA 3CVIL 1NJ9A 1BQUA 3BVNB 5E4IA 4WI4A 3MLZH 12E8L 4PRNB 3P9WB 2G5RA 2AQ1A 4HBQA 3Q48A 4WWKB 4G5ZH 1LO0L 3E8UH 1FGVH 15C8L 1AGEB 1FZKA 2F74B 5FO8A 3N1FC 2BCKB 4M00A 3DROB 3NACL 3FAWA 4PJAE 1AQDA 5ID1A 3KS0H 5T1KB 1M7IA 2JCCE 3RI5K 2FX7H 4TUOB 2QSQA 4GW1A 4XP5H 3A67L 3KPMA 1RIHL 1M7XA 3ORJA 2EIBA 3HNTH 5EDXA 3UYRL 1MF2H 5SV4A 3TBSB 2YXMA 1RULH 1PQZB 1CXIA 5D71H 1WWWX 5CJ8A 1LE9A 3C2AL 5HVHC 2EYRA 2HN7A 4FRWA 2GY7B 4QXGH 1FN4A 3FO9A 3LKSA 2X4QA 4JFHE 1GC1H 3DV6B 2MSPA 3TFKC 1MUJB 3ECBA 3OAYK 3BGMA 5IVZA 43CAB 4MJ4A 1A6ZB 4MD4A 5DJ6B 3RTQB 2V7NB 1HZHL 1AGCB 3ARFD 3HZYA 4IRSC 1I1FB 1XCQA 3KWWA 3PUCA 3DXAD 5DMKA 2F54A 4QRUB 1L4IA 3VWJC 2X89D 3BP7B 3GK8H 1ONQB 1YEKL 3PQYE 2B1HH 2RBLA 3CDFA 3KXFD 4ZS7L 4Z7VA 2YD9A 4GH7B 2X4RA 4JRWA 5TE6H 3DO7B 2BJMH 2R39A 1BLNA 4JKLA 3BO8B 4OQTA 5CP7B 2FGZA 4JR9H 4JFFB 3MOQA 2R0ZL 5F1IB 2OSLB 5L9DL 2QLVB 5GS0L 5IQ9A 3B2VH 4YFLF 1DN2A 5INCB 3LN5B 5DMKB 1QSEA 5ID0B 1Q94A 4ZMAT 4NRZB 1B0GB 1RUAL 2EYTB 3MRGA 5CGYC 3JV6A 3TBVB 3SCMB 4G8IB 2AK4A 1S5HB 1WCBA 3TZVD 5FO7B 3BQUB 1CFVL 1WT5A 5CJ5A 1JHKL 4IHOB 1I9RL 3P77B 1PYWA 1G7IB 2CQVA 3KNBA 3MRJB 4LVOB 3B6SB 1F11A 2LVEA 3D39B 3F7QA 1NLDH 3L5WA 4HK0B 1EFXD 3WUWA 3N85H 1NC4A 3WHXB 1KLGB 4DVBA 4I0PD 5DJYB 3TVMA 1QTYT 4GAGH 3L3OA 5H2BB 2IH3A 4KUZL 1IEHA 1IM9D 4MQ7B 3T3PE 1DJSA 3WCYA 2PYED 1S5HA 3EOYG 2QHRH 4JKKA 3FONB 3FQUB 3SO3C 4AIXA 3IAPA 1RZKL 3VXMA 1C1EL 1NGYB 1YPZB 1WEJH 5DRZB 3BEWB 5HHVL 4D0DB 1P9MA 3QSKB 3MJ8A 5ANMA 3MZTA 5JNYB 4PGCB 5FYJH 5D1QA 4Y5VA 4X7SL 1MCEA 2HFFA 1A7NL 2J4WL 5I74C 3AREB 3N0PB 3ARRA 5FHAH 3V6OC 2QQNL 4G9DA 3D48R 4I18B 3ARXA 3G9VA 3RNQB 1ZGLA 2B20A 3EYSL 5DTFB 2DIJA 3T8XA 1H0DA 3EFFA 1FFPB 2C1PA 3TM6A 1U8QA 2YR3A 3DARA 1NDGB 5I0DA 4YR6A 2XG4A 3G5YA 1MHCB 1HYSC 4O4YH 4JEGB 1RIVH 1WZLA 2EYSB 5C6PB 1E6JL 2B2XH 3ECBB 1JL8A 2FGWH 2R4SL 1G7PB 5HHOB 5FKAB 5F6IC 2DLTA 4WCYH 4NM8H 3KHOA 2XTJD 3RGVB 1G6VK 5DJCA 1MCSA 3UROR 3EOAB 4WI5A 5AZEL 4MMZC 2NR6D 4OV6F 5E56A 1C5DB 3EDFA 4AL8L 32C2A 5BV7B 2DJSA 5H8DA 4NN7B 5IG7A 4N5UA 5IIEB 5I76B 1GJIA 4I0KA 5HYEA 5FF6B 1S7XA 1YUHA 2DM4A 2DD8L 3Q3GB 1T21B 1X4YA 4JG0H 2PYFA 3TBWA 2NY1C 4U1HB 1MCJA 4LLWA 3HFML 3DX8A 1ZGLP 2VKWA 3UTTE 5MENA 3RDTA 4I77L 4O2EB 4XCCH 4XP9H 4X6FB 4N68A 5KN5A 1TENA 2XNAB 3ALXA 4DTGH 1L7IL 1I3GL 1Z0MA 2BDNL 3MGTB 4X98A 4DKEH 1T20B 3IYLW 1N4XH 4PJ9A 1JYXA 1AGBB 1YJDC 1OP3H 4NQSA 3UYPA 1II4E 4FQJH 2JF1A 5E00A 4AEHL 3BDYH 1QNZL 3NGBB 4NCC2 1BIIB 3I6KB 5C08B 4FFYH 3QUYD 5HPMB 1NCDL 5TF0A 2R2EB 4HJJL 4NFCA 3QUXC 5KVFL 4HK3N 1JYNA 1A1MB 1CGWA 1MEXH 5DD1L 1IAIM 3STZA 5JOPE 4J3OC 4MA3B 5LJYH 3BZEB 1TQBC 1ZS8B 1I3VA 3O3EA 4UIMB 3JWOL 3OHXB 3UJIH 3P30L 1IGTA 4O58H 1OT2A 4JHAH 1Y18A 3EYOB 1W0WB 3BWAA 5JO5A 1EA9C 4AIZB 1IKFH 5GJSL 4JVWA 2BY2A 3W0WB 1OWRM 2DQDH 3QEHB 4IOFC 5I73B 2IQAA 5ILTH 3QWRD 1VPOH 2A74B 5F3HA 3CK0H 3IXTB 3C5ZD 2PO6C 4KXZI 5E0QA 3VWKD 2YPLA 5KVDH 3SDCC 5GGTH 5ICXB 3HAEH 3WN5C 2UZIL 4LLVA 3SBWC 1T5XB 1H5BC 3QJHA 3LKRA 1GXEA 1BZ9B 4EI6A 3VFUB 2HKFH 4XGZB 5KSBF 4RFOL 5IK3A 3KGRA 5C0EB 1AE6H 1BQLL 3GBLA 3KYKL 4GRWB 4PJBB 5I1IH 1ORQA 3NIFE 1SJHB 3V8OA 1FNLA 5FYJU 3RIAK 4A2LA 1E4KA 4DJMA 4Z7QE 2R29H 4JRYA 3QDAA 1SVZA 5D9SA 3GMMB 3MRDB 5HSFA 4B53A 2BVTA 2GK0A 4KK5C 3SDXA 1CDCA 4Z77A 4Q9QL 1MREH 1F58L 4JY5L 1FIEA 4LHUD 4JO2H 3LN9A 4HJGB 4Y8AA 3ET9F 4XC3H 1CXHA 1LO3L 1G0XA 3FL7A 1AY1L 4P2QE 4G3YL 5KJRH 3T0DA 2VLJB 4AZ8A 3GB7A 2VH5L 1UM6H 5F71A 1UM5L 2CH8A 3GM8A 1NCCH 4LU5L 1I3RB 3GIZH 3OF6A 2BC4B 3FQXB 3MCKA 4HS6B 4ACPA 1DDHB 1CZ8L 3G08A 4N0FB 4LPXA 4HX1A 3I2CL 3RVXD 1WFTA 3V7MA 4DW2H 3O4LA 1RJLB 3DO7A 2ZG3A 2NXYC 3UTTA 1KELH 1Q9WB 3KPTA 4M61A 1A7PH 5MENE 2B0SL 3VH8G 3U30B 3GO1L 1MWAB 4P9MH 1FPTL 4AIOA 2BNQE 2X70B 3MA9L 2E7MA 3RVXC 2G75A 5E5RB 4X5LA 5EOCL 1KCSH 2HG5B 4PJAF 4WU5A 1CU4H 5EH1A 4DFIA 4WHYH 4JGUA 3GJEB 4LCUA 4S1RH 3PWJB 4G6AC 1FNHA 2EDYA 4L4VE 3RBSA 1HHHB 5C0FB 1BQHA 3GMPA 4NO0D 4LLAA 2Q3ZA 3R1GH 5ACMA 4FQPA 3UTZB 5CEXA 2PCPA 4PBVC 1GH7A 1G9ML 2PW1B 3TO2B 4JVPA 4LASH 3P4LA 3BPNB 5E2WH 1Z5LA 4BYHA 3IFNL 3NCBB 3BH9B 5DD3L 2X44D 4I13B 1J8HB 3QJHB 1HHHA 5C0FA 4OAWA 1GYAA 3EW3B 1A6AA 3GI9H 4OM1H 2IQ9H 5F7UA 2VAAB 3D39D 4ZOAA 1N6UA 1DBJL 3WSQH 4RWYL 2YPLE 5E99L 1YEHH 1VGKA 2J6EL 4IOFD 5DK3A 1DP0A 2HFGL 1UC6A 1CGSL 4LSTL 4N0UA 1I7TB 2HT4D 3NH7H 4OTXH 1CE6B 3BGFC 5GISH 3SDCD 1A3LL 5F9OH 1MAJA 1MQ8A 2ZNWA 4RMRA 5TF1L 3HRZA 1KFAH 4MAUL 4PRNA 2P45B 4CKVX 5C0JA 3D25A 4JRYE 5BJTB 4ZS6D 3SKOB 5K9OA 3QUMH 4JANB 5JPMA 4KV5E 1FFRA 3WLBA 3JWNC 3SQOL 1N5AA 2DL9A 4C56D 4Q7DA 4AMKL 5DQJB 2WIMA 3D2UA 2NMSA 4R4BB 3A6CH 1U42A 1RK1A 4MQXD 1AKJB 3DO3A 3D85B 5DJDB 4D0CA 2WWMC 3GJFH 3FRUA 3MMEA 3H3PH 4WJ5B 4R4FH 1WFUA 5E94B 3DUHA 2IH1A 1I8MB 4S0SD 1GOFA 1FZMB 5FYKL 1BQSA 4CN1A 1RD6A 1NFDA 4PJCA 4PD4K 2R9HC 2AQ3A 3MO1B 4JZNB 4BZ2L 3RVWD 1KCKA 4YHLH 4YHML 4MNQE 1JWUA 3E6HA 4PJHB 5FYKD 3STLA 4PLKC 2MHAA 4HUNB 5SX5K 3RNKB 3ZE2E 2A77L 1MCWM 5F9AC 2R56L 2NY6D 1WK0A 3GSXB 4HF5H 4X8JA 3KPRE 4E0RB 3D87B 4PGEA 1ZV5A 2VNCA 1U8HA 5IHUH 1YNLH 4Y2DD 1X5LA 5MI0C 5D6CB 3I85A 3ZKQD 1YYML 4C58B 3QHZH 2W0KA 2VB5A 3BJLA 1KB9K 1A1OA 4JRXA 2PW1A 3BP6B 5I30H 4MCYB 2EKSA 3O45A 3VXRE 2CGRL 3VGFA 3TP4A 4HZLA 4DGIL 5GGVY 2HH0L 4YIQA 4PTUA 4NN6C 5SX4H 2MPAH 3RBGA 4NP4H 1NBZB 4ETYA 4Y4KC 3VRJB 3VXQB 5I1JH 4RFEA 2FSEB 1T22B 1CLYH 3BZEA 3TBTB 5B38B 1BEYH 1C08A 1K8IA 3T2OA 1F11B 4ONOA 1JFQH 4F8QA 2JCCB 4M7KH 4KKLD 2N1KA 3UJJL 2RCSH 2EDXA 5J11C 1KSRA 4UV4L 5CS7A 4R97B 5KSBA 5JOPD 4QCIA 3L9RB 1OTTD 1S9KC 4EVNB 2DJUA 1LEKB 4F9PC 2VDOL 5HYSA 3O6KL 3RTQA 5T3XD 3LDBC 3M1BA 3TV3H 4ZOEA 1H9VA 1U6AH 4WDIA 1LDPL 1IQDB 3QDHA 3O2DL 2PYEA 4U6HA 1MLBB 3LHPH 4WV1A 2X89A 2P5WB 4JO1L 2J8UF 3ULUF 2PNDA 1F4YH 3SDYH 3PQYB 3KPRB 4L4VD 2KH2B 2ATPB 3GMNA 4CN4A 3RWCB 2QKIA 3ZLQC 3C6LC 1EO5A 1ZGLB 3PIQB 4YGVA 3WS3A 2FATL 2IEPA 1HXMA 3VWKB 1A21A 4XCFL 2UVFA 3MRMA 4V1DE 3V7AG 3W9EB 4PLNC 2IH1B 3MLRH 3BH8A 3VFWA 2IBBA 2L7UA 5T1LA 4LOUC 4PFEA 3G6DH 1GHFL 1U8IB 5JHDD 4YHOL 1HHGA 2Q8BL 3GBML 4ZAKB 3LKOA 1TIUA 2B5IC 3QDGE 3EDEA 2A9ML 3L6FA 5DD6A 3GRWA 1ZAGA 3U4EB 1NFDE 1TTUA 43C9B 4OM0H 1K3ZA 2R8SH 1S7WB 3L1OH 5L88H 4XRCA 1UJ3C 5C0CD 4IMKA 5LGKA 4YK4C 3O4LB 2F54D 1JV5B 4WO4B 1YPZA 2GEEA 3B3IB 3FO2A 4NQUA 4PJ8C 4JM2A 1OOAA 1F3JA 5ADOH 1RJCA 1JNHA 2R4RL 4W6WB 4ZO8A 1U3YA 1WZKA 5CIPH 4LP4A 1OL0A 3ZKNC 4D0BA 3WFCL 2QL1A 1W8NA 2CLZB 2VITB 1B0GA 1KIUA 2DQEH 1EHXA 5GS1B 4ENEC 3VFTB 4X5XB 5E95B 5ITFB 3WLWC 1S3KH 2KZWA 5EPMB 1K6QL 4PB9L 4HG4J 1U8LA 1D9KC 3C09C 5I1EH 4RGOL 1D9KB 5CZVH 4ZFGH 2BCKA 5A2KH 4OF8A 4OLXL 1I1CA 2YSSB 1DR9A 4KJPD 3OR7B 5GGSA 4NJ9H 3BD5A 1A1MA 1S9XB 1FNSH 1KXVC 1QD0A 3EOAA 1DUYA 1JRHL 2VZOA 3NAAL 3RFZC 2OJEB 3QQ9D 4GRLD 3KLAA 2YMXH 1WWAX 1ZVSA 4KPHL 4Z7WB 4FFZL 1LE9B 2VDLH 1KT2B 2PTTA 1ND0A 4XXCA 2J3SA 2RGSA 5C8JA 3CVIH 1NBYB 4U1HA 2WIIB 3RVWC 2MCPH 5C0GA 3DXAA 4G5ZL 1KGCD 4M1CD 4X6DE 15C8H 1LK3H 1JRHI 1ZLWH 5K93A 1G7QB 3TIDA 3K7UA 2V9QA 1FAKT 2GSIA 2XWBA 1VGEH 2D03L 3B9KC 3GNML 2FX7L 1XF2B 3A67H 3INUL 1SJHA 5CBEA 3QUYC 2ZUTA 3HNVH 4JPKH 1KBGL 1RULL 2DWDB 2Z31A 4ELMB 2XICA 3MBED 4H1LB 1MSPA 3VXME 4ZS6C 5FCUL 2Y06H 4NNYA 1MCPL 3SPVA 1YJDL 2FLBT 4GSDH 2Z91A 4UAOC 4DFHA 1OM3L 3SDDD 3U0PB 1CGVA 2IPKB 3P4OA 3F8UB 5D7SL 1EFXB 5F6HJ 1KG0B 4Z95L 4ZFOB 3V52L 3P11L 3JBG7 3V0WL 4P99A 3QIUC 3QDGA 2EE2A 5MP6H 3EO1A 4XWOD 5DK2A 4HPOH 3Q5YA 2BJML 3RGVC 4H1LA 1G6RA 1J87A 4CW1A 4Y5YC 2XI9A 4I18C 3OKKB 4WUUB 4R7DA 2NXZD 1JN6B 4PJ7E 4FQQA 4LCIH 4DN3L 4UNUA 3O6ML 2YOCA 3CVHA 4PUBH 3CZJA 3X12A 5DUMH 3LEXB 2UV3A 3MRNB 1ETZA 2DI8A 3LKRB 1KJ2B 2ITDA 2HKHL 3DMMC 3FQNA 5E2TH 2CIIA 3CDYA 2XZAH 1A0QH 4NQCB 1G9NC 3IRPX 3K2MC 1MOEA 5ENWB 1QR4A 2FIKB 1T89A 5FGCE 3K46A 1Q9LB 3TO4B 5KTEL 4JFQA 2XPGA 4U2YA 2P24A 3VXSA 3ALPA 5IW6A 2J8UB 2J88L 3MV9B 1U9KA 4Q58C 5FDWA 4JKPL 4UILH 3BRDA 3CFKB 1H3PH 3CXDL 2H2SD 1NGWB 3UYRH 4K7PH 4LBEB 5I19H 2YRPA 4G8IA 5FFLA 4K23H 1HH9A 5DC9B 3GUTA 1XIWA 3TBTA 3TJHD 1A5FL 1NDGA 4HJ0C 4CADA 5E6IC 4OZIB 3A6OA 4X6BA 5CJQH 4IMKC 1C1EH 2H6PA 3IFPA 3PDOA 3REVB 5TDNA 3RWDA 4Y8DC 3ESVF 3DV4B 5JIIA 5FA3B 5HHVH 2EEDA 2BOBA 2P8LA 3LN4A 2UZYB 3T0AA 5FGCB 2B1HL 5D5MB 4LEOA 4LNVA 3QR2A 1EEYB 5DRZA 3TZVA 1FH5L 3L3KB 3ZE0F 3ABZA 1SM3H 1BZ7B 1TVHA 4X6DA 4NUGH 3KYNB 3WO4B 4BFIA 1NAML 4HIEA 1RU9H 1I8LA 1OW0A 1HSBA 4PRPD 1ZT1B 2AJVH 4RMUA 1RUAH 1DLFH 5H94B 5D5MA 2EIDA 3F62A 4XNQB 3K81A 1RHHB 4OT1H 3CSYA 4DVRH 4HKBB 2DLGA 4LCUB 4BSWA 1XF3A 25C8H 2O5XL 2UVEA 1BJ1J 4YBQD 1BOGB 2W9EH 1P84K 1TZGH 2CIKA 4FTVB 3UDWA 5I16B 3C09B 1P4LA 1EMTH 1C5CH 3LVEA 2HFEA 4KK6C 1KB5H 3S6CA 3U6RB 2OX5A 4KKAD 2Z35B 4TSBH 4F3FB 5K9JH 5J1AB 5ACLA 3GRWL 4KY1H 5MERB 1D5ZB 4QYOA 2MWCA 1VEPA 4AQOA 2NPLX 1T5WB 1RURH 4LSUL 4OKVA 5ISZE 2AJZB 5I16A 4BELD 3BWAB 3DURA 4L3EB 5KANG 3MNZB 3FT3A 5J12B 2QQNH 3RNKA 1F42A 4YK4B 1U8KA 3RVUD 4KMTH 2NY5L 1BFSA 1FFOA 2NZ9D 3PDGA 5TPWL 3GSRA 1XGYL 4GG6A 1MJJB 3MOAH 2E7BA 3BDYL 1EJOH 5DS8B 1CE6A 3BSZH 5D7JB 2VQ1A 4O4YL 1X6LA 3QCVH 2ADGB 2KQMA 4JRYD 4EIZC 1I75A 5D93B 4XH2A 2R4SH 2H9GB 2CDFB 2PCPB 2ZZUT 4WCYL 1P4IL 1IRAY 4TVPD 5DSCA 5DDHB 3QPQD 3REVA 3RWDB 1N5YL 4JQVA 4EIGB 1D6EB 4DOHE 5K9KA 2ZCLL 4D2NA 2XN9D 3F7VB 1NBZA 1K2DB 2C1OA 3PG2A 4PRPE 4MA3A 1VPOL 2X09A 4LRNH 4UV7L 3CK0L 3C5SB 1UYWL 3IVKA 3MSPA 3U0WH 1FZMA 4YNYA 4DKFL 1CFNB 3HFMH 3LCYA 3Q6FB 4WEMB 4GAYA 1BJMA 1EERB 4RFOH 4AQ1B 3UC0L 3L3HA 5JW4Q 4ERSH 1AE6L 1BQLH 2CLVB 4PS4L 1LEKA 1IM3A 3G5XA 4NKQB 2NLJB 2Q3AA 4DTGL 4X4XB 4NPYB 4NRXB 5F72S 1FO0A 3F5WB 3NCMA 4H88L 1T89C 4DKEL 4GBXB 2MQ0A 3S9DB 4EUPH 3QQ9C 5FGRA 3IF1A 2ENYA 2R69L 4L1HA 3DVGB 3GKWL 5EB9A 4HWBA 4BJLA 4Q9QH 3TBVA 5JW4M 1A3RL 1K5NA 5IB4B 4Y5XC 2NY7L 1MFBH 3LKNA 4HS3B 3PJSA 2Z8RA 1PG7L 3RPKA 4U1GC 2A6IA 1RUKL 4PJ5E 1JF5A 2E6QA 5HYSG 2ADFH 1MEXL 1S7QB 2VISA 4GS7C 1F3RB 4LHUG 4YO0A 3HLAA 2VH5H 4Y4FD 1T1ZA 3P30H 3HTLX 1WUNT 3PWJA 1AXIB 1F4HA 1EEUA 5GJSH 1CZ8H 3LKNB 4WUKL 3ARGD 5I17A 3TLRA 2F53B 4RGMC 2D7NA 3IDXL 1S7RA 2P8PA 4PR5B 5FDYA 3VI4E 3CDGB 3TVMC 2EZ0D 1EGJL 2YXFA 3EJZD 3S37H 3W82A 1I1AB 4UOW1 4MNGA 5GGRB 4J3TA 4Y4KD 3D69B 3U4AA 4P9ML 2HKFL 2IGFL 1FPTH 2Z4QA 2GJJA 3BGFB 3GZKA 1BD2A 2XY1A 5IVXF 2JJTC 4MQTB 1CU4L 4R6UA 4PLJD 4JFZH 1CGYA 1D5XB 3LQAH 2GFBA 5DF0A 4LSRL 2VR9A 3QISA 1OLLA 1WTGT 5JDJA 1RVFH 6FABH 3LS4L 3ZYIA 3QWRA 5D7IA 4JFQB 2AERT 4GFTB 5K59F 3BFOA 1M4KA 3QIUA 5DUPH 3VXNA 1JPSH 1XGUA 4H5SA 3QEQA 4M6NH 1K2DA 3QG6B 4WY7H 1BD2B 4LDLB 3IFLH 1SY6L 1VDGA 3BQUC 3FT2A 3UZQA 2DQIH 2GKIA 2OJZL 2GQHA 4L9LA 4M03A 1ULVA 4Z7UB 4S1QH 2E3VA 1UM5H 5JW4N 3PHOA 1HHIB 3HC0B 2CK0H 3IDMA 5DJ0A 4NN5B 2P5WE 2CLVA 3QDME 4U7SA 2X6MA 4K3DH 1Y0LA 4OGAD 4HIJA 1W2KT 4MCZA 4OQTH 5FV1L 1UWGH 2NTFB 3GMRA 5E99H 1JNLL 4JHWL 4LSQH 2FBOJ 2WINB 2BNRB 4PJIA 4X98B 3IXAA 1B2WH 1BM3L 4RSVA 4F7MB 1GVIA 5IB4A 1FNAA 5GISL 5LGJA 3QG7H 5BO1L 4NNPL 1WWBX 4LARH 2EH7L 5DD0L 2IPUG 5EOCH 4HKZA 1FLRH 5EU7E 1CGUA 3QUML 4JKMA 4L4TD 5HHNA 2BVYA 5HGBB 4Z9KB 4DGYL 1GIGL 1S7QA 3L7EA 4X6EA 4S1RL 1C5DA 2CLZA 3QRFM 1D5MB 3ESUF 4MXQD 5IBUB 4HHAA 2XQYG 4MNHA 5DQDL 1M71A 4GUPB 2V2TA 5LGJB 4UTBL 2D31A 3H3PL 2P43B 3OXSA 4P59H 3ARVA 2EYRB 2J8HA 1OP5K 1S8DA 5IFHH 2CIKB 1LO4L 1HYRC 3IJYA 4P4KA 1Q9OB 5FV2A 1RK1B 3Q6GL 5F7DB 2W0LA 1KIRA 3RL1B 2HLAB 4RIRB 1F90L 1ZA6A 3DRQB 5BS0A 4BZ2H 5F7FA 1F6LL 2YA2A 3S34H 5DJXA 2JJTA 1FC1A 4U6VL 1V8HA 4MB3A 4XVTH 2Q87A 3AB0B 1XZ0A 3SY0A 1S7VA 4GG6F 1U8JA 2HFGH 3E6HB 1SEQH 1CQYA 4F7TB 2X4OB 4YQXL 4P2OC 4LCWB 1G6RB 4MXVE 1SYSA 3RY4A 5MHSE 5C3LD 1UADC 1YYMH 2AXFB 4JCMA 4G7YL 1Q94B 5JXED 2OCFD 1A3LH 5DJZA 4X80L 4XT1C 1IAKA 2X4SB 1SQ2N 2ICWA 4LMQE 3FO1A 1R6VA 1YMME 5TF1H 1H5BA 5DTFA 3T8XB 1RZ7H 1FV1A 3Q0HA 5CKAA 5HYQB 4UBDC 4R26H 5KANI 1Q0YH 3MV8D 4WO4C 2VYRE 4P9HC 1R0AL 5DVOA 3D39A 5I1JL 4NDMB 1W0WA 4RX4D 5KW9L 4LSSH 3DYMA 2FO1A 2BHZA 3HPLB 4RQQB 2AXFA 1KCVH 4WNQA 4YC2C 3W81A 4TTDD 4YGVB 4R4FL 1ZLWK 1IC7L 3OKEA 3D0LB 1B4RA 4XTRC 1BP3B 4U1LA 1NUFA 5JPNB 3O11B 4P23D 1Q1JH 2IC2A 4P2RE 3HUJB 2QADD 1KENL 3L3IA 5DQ9B 1AXTL 2H2SC 1J7VR 1LDPH 1TJGH 5GGUB 1BLNB 3UBXG 4QRRA 5GRJL 4CMMB 3LHPL 5HYSB 2VABB 2IF7A 4U1MA 2EO9A 4PJIE 2AJUL 3KYOA 3QHFH 4X6FA 2GAZA 5CSZA 4HXBL 5C09A 3I50L 4FQQB 2DM7A 2D7MA 5I1DA 1XEDA 4ZNCD 1M71B 1BZ7A 1MHHB 1DFBL 3S35L 4HS8L 2LE9A 5CBEB 3LQZB 3M8OH 1NC4D 4JFDE 1MI5E 3IJYB 4P4KB 5GRYA 1YEGL 3MLRL 5ESAA 3EZ8A 1RZGB 4HK0A 1NMBL 5C07A 1AC6A 4Z8FL 4OLYH 3O81A 2F19H 1GHFH 3O8XC 5D8JH 3U7YL 1AD9B 1BEYL 3VGEA 2Q8BH 2ESVB 2JTDA 3UTPE 2UYLA 5IB3B 1MFCL 1YY8A 5IMOB 2IJ0C 4OD1H 2DQHH 4YE4H 5D1XB 1W0YT 2A9MH 4X9FA 5DEGB 1FGNH 2F8OA 3VRLE 3H7BA 1J11A 3GI8L 3LKOB 3LRHA 4LCCB 3PL6B 1ITCA 1U58B 5C70A 3MRIA 5ELIA 1ZT7B 4QRSB 3O2DH 5HJ3A 3NFNA 1IAOA 2WZPD 1O0VA 2C5DC 4XCNA 1G9EA 2WANA 3T1FA 3IS1X 1F2QA 3VFUA 4ZUTB 4WO4A 3VFVA 1NANH 4LNRB 1ZLVH 3FQNB 1KTLA 2O61B 3ARFB 2VDQL 3IDYC 5AYUL 1FZKB 3H0TB 3HCVA 3QEUB 5C86A 5FUOL 3VD5A 1G9NL 1K9TA 4XNYH 4TOYL 3GMMA 4X7CC 3ETBF 5CJOL 5DQJA 5EO0A 1QRNB 2CPCA 1CR9L 1AKJA 4JHZA 1QSZA 5HHXL 1OTSD 1YN6B 3MFFB 3SDAA 2A0LD 5IGXL 2MMXA 3BN9C 3O3EB 1DTUA 5CMAB 4JLRB 2GIYA 4JDVB 4LAQL 3G6DL 1KB5A 1PEZA 5TE4L 3VJ6A 1QFHA 2XT1B 2ICES 5F3HB 4BZ1L 1AGDA 2VDLL 3OXRB 2DQCH 4XCYA 3QXAB 5CJBA 5DJ8A 2R2HA 1RAMA 4YHIA 1WIUA 2DB8A 1A14H 4OLWL 1XGPA 5TDPA 3LQAC 3KLAB 2YD6A 5IBUG 5F7EH 4JQIL 5MEQA 1UVQA 2NY4C 4QTIL 4QRRE 1UZ8B 3C08H 5A43C 5BJTA 5I75C 2WP3O 1T5WA 4NGHL 5EU6B 1TTGA 2VLLB 5JQ6H 2D03H 3DI2B 4KROC 3ROLA 4P5KB 1AP2B 3MLWL 3PABA 2M1KA 5C09E 3RI5F 3VDAA 1GGIL 4M48L 3VXRD 4EI5D 1X6NA 3RWHB 1MCDA 4JQXA 5C0BD 4UT7L 1NH6A 1JTPA 3O6LH 4XB7A 2QHLA 4ZXBB 5DMGD 4ZO6A 1WCBB 4H0GA 1MCNA 5ALBL 4BK4A 2J8UE 2FSEA 5JTWA 5CZVL 4ZFGL 1O7VA 5E9DD 3U83A 1ZGLM 5DC4B 1NCUA 5C07E 1Y18B 3EYOA 4OLUL 5KBNC 1J0IA 3RX8A 3U82B 1LEIA 1IMHC 4CNIA 5KVEL 4M1DH 5JIKA 5BS0B 1CICD 4ZYKB 3G5VB 1T4KB 4WTZG 5D1ZA 4XAWH 4U6YB 5FK9A 3RWJA 4CUCA 4M7ZB 3S36X 3QQ3A 3MJ7A 4CVXA 4PGBB 5DFVC 4HIXH 3MRKB 4HFUL 4P23B 4F33A 3GBNL 3FN9A 4I1NB 3GSVB 3UTTB 4CADB 4LDOB 4DAGH 1WT5C 1YMHB 1FL5A 2DAVA 2PTVA 5D5ME 4MA8L 2A83B 1P7QB 1S78D 3BP6A 3QIWA 1A3QA 1U8OB 5E2TL 1LK3L 5HHOD 2NY0B 1V7ML 2VL5A 3KAAA 3P3YA 2NY1B 1MVUA 2AKRB 1WIOA 3HB3C 5DJZB 1OCWL 3DUUA 2VL4A 4R3SB 3MRLA 1OGTB 4MS8D 1B6UA 1MY7A 4GRLC 2H32B 4XB8A 4XHJC 3INUH 5FXCH 5EO1B 1OGAE 2VQ1B 2YRZA 3W9EA 1QSFD 3O2VH 4S1DC 3V95A 1EO8L 1BVKA 2IG2H 4R90H 3VJ6B 5C2UB 3JTTA 4ZTPL 4W70A 5JW4R 4KJWD 3EJYC 4U1JA 1KCRL 4M8VA 2CDEA 4LCWD 5FDWB 3GSNB 4L3CA 1OAKL 1IQWL 1I3RA 3WNLA 4YHYB 1XGRB 1GGTA 3TGXA 4U7MA 5D7SH 1EUUA 43C9A 1FL3B 2VO5A 4B0MM 3RKDC 3TBSA 3OPZH 3DYOA 2W0FA 3CH1A 3B5TA 3V0WH 2VDML 1GPOL 3VD7A 5TQ0L 2AEQH 5T1MB 2B5IB 4MJ6B 3TH4T 1LE5A 3ULUL 5HGHA 4KGJA 5I1LB 2QR0B 4PJ7B 3MRCB 1JUFB 3W5NA 3QP3A 2HTKC 2QADB 1SVCP 4V1DB 1P69B 3H9ZA 1R5IB 4N0YH 3W9DB 4BH7A 3O6MH 4D9QE 4NJAH 2KZ1B 4S2SB 2Y07L 4ZO7A 4XPBH 4E0RA 1QO3B 4ORGB 3HNSL 4UNVA 3GJFA 5FOBA 2R1WB 3L3KA 2PW2A 3WFDL 2W60A 1QA9B 3ARDB 5J8OA 4Z18A 3UBXI 4OLVL 1H8SA 2YK1L 1AO7A 3C6LB 1CFQB 1CL7I 3MGOA 3FOLA 2J88H 4PJDA 4PV9B 3UAJD 4FQ1H 3KLDA 1FAIL 2O5XH 1HINL 4K7PL 4GJTB 3MMEB 1TZGL 2R23B 3L7FB 4YO0B 5D1ZB 1EMTL 2UWEF 1G6RH 2VQUA 1S9XA 4RAUA 5DFVD 1T1ZB 4JFXB 1ITBB 2WQRA 4I48B 4U6XA 4R4ND 3LDBB 4OCRH 4ZXBD 1MWAH 1C7SA 2LV4A 1ADQA 5DXWA 4KY1L 5LWYH 1FL5B 3B6SA 3MA7B 5F9WC 1UB5A 2V9TA 3STLB 3PWVA 1P7QA 3MCG1 1P7HL 1HSAB 1RURL 5IFAH 2VDRH 1MFEH 3ZE2F 3QUXB 2R23A 5E08H 4EVNA 1F00I 4O5LL 4C4KO 2C1OB 2VITA 4XP1H 2V5RA 1AJ7L 2FH6A 5JHDA 1T1YB 3BKYH 3EDDA 1YNKL 2FECI 2WINA 3GSNL 1N7MH 3N50A 3FT4A 2VR5A 2OL3H 1NBVH 2V7HA 3LMJL 1HEZB 4CRPA 3BRFA 3QXUA 5J13B 2ED8A 1NGXA 4XP4H 5FA4A 2HFFB 1K8DA 1N5AB 4Q9RH 4GKSB 1AH1A 4IRJC 5EO9A 2W9DL 4KROB 4PTUB 1IAKB 1OD7A 1OGAA 2ZUUA 4RA0C 3FB5A 4F58H 4GG6B 2Z93B 1PD6A 5DJ6A 1YEDA 3PV6A 1ACZA 1FHGA 4PJXF 5J6GB 2NY6B 3V4UH 5HHQB 3BP5A 3QEQD 5L2JB 5DUBB 2W9EL 5FM8A 3ULVH 5FYLH 3IDJA 2CDFA 3ULSB 2X41A 4LRNL 1IC5L 1KB5L 5HGHB 5DDHA 1UYWH 5E8EA 3TJEH 4G6KH 1IL1B 3GSWA 1UG9A 4JFHD 3O9WC 1JZ3A 3F7VA 4RBPH 2XXCB 1IEBA 1KNOB 4DUWA 2HLAA 4RIRA 4YHIB 4PRHA 2QQKH 3MOBH 3UC0H 4DEPB 3I6GA 3CXHK 4FABL 3V0AC 1IQDA 4UIKL 1QO3A 4Q9CA 1Z9MA 4MSWA 4XC1L 5SWZD 4U1SB 5EBLA 3FCTA 4K2UH 5EFIA 2FJHA 1G1CA 5E8EB 4XPGH 3KXFE 2R69H 4JM4L 3WXWL 1A3RH 3L5JA 3OGCA 3U1SL 3SKJL 1XGYH 2AS5M 5BW7A 4XNXH 4JG1L 1OHQA 1ZK9A 1ZOXA 4UZGA 5IF0A 1RV6X 2JJSC 3KPSA 1T0NA 4U1GB 4P5TA 2ADFL 5T1KD 3TT3H 3RUGA 1JK8A 5T5NF 3EYFB 2O5YH 3QO1B 2FJGA 3U48A 5J6HA 1HH6B 1ZTXL 3PJSB 2GTZA 4GAFB 4OGXH 4XZUA 1DEEA 5D7LE 4QHNA 4I2XE 1LO2L 5ACZA 4EUPB 1IFHL 4CVZA 5TDOA 5IKCA 5C08A 4HCRL 2K9UA 5ALCH 1JNJA 4KVNL 3L9RA 4URTB 1NCBL 1A7BA 4U6YA 2P8LB 1NCWH 2HJFB 3STZB 2E9JA 3S37L 3V5DB 1LO0H 2NNAA 1Y6KR 3OKDB 3U9UB 3MRKA 5BRZA 2QQLH 4EJ1C 3P77A 2HMIC 1G7IA 3OHXA 5E6IA 1MFDH 3JVGA 1BAFH 1J0KA 4N0CD 2DLHA 1PW3A 4J23A 3WHXA 1FDLL 4CVZB 4PGDA 3MRHA 1TJHL 3OR6B 3LQAL 4MWFA 2AJ3A 3VXPB 1NGWA 5DFTA 2CMRH 1LP9A 1NUGA 3B9KA 3VDCA 2IALB 5IB1A 1MI5B 1J10A 3ZZ1A 1BQHG 4Y4HB 4FQHB 4MXQC 1AIFA 4KK8C 3Q1SL 4M93C 4NQDA 4XNUH 1DVFB 2XA3A 4QRQA 3UPRA 3BH8B 5IWLA 4U4BA 2AGJL 5MI0B 3C60D 1X5FA 1T04A 4M6ML 1A7OL 1EBAA 3MRDA 4Y89A 1LNUB 1KJMA 4TQEL 5D1QD 1YEKH 5GZOD 1NMCB 3T0BA 2YD1A 2CK0L 2B4CH 4FXGB 1U3HA 3BP4A 1ZLSL 4L8SC 3KS0J 5SWSB 1ONQA 3KLSA 1LMKA 5LVEA 1FE8L 2BZDA 1HHKB 1RJYA 3PF2A 3KPRD 4M43L 1ZLUK 2DKMA 1PGRB 1F3DH 2VLJA 3B3IA 1B2WL 4AYFA 4Y19E 1XMWA 4L8DA 3FOMB 3PXJA 1G7HB 3GM0A 5T1DH 4OIIL 2KDGA 1CFVH 1JN6A 5DD0H 4FP8L 2WBJD 5MEQB 1MAKA 1T0NB 4ORGA 2R2BA 1GIGH 2CR3A 4JFZL 3U0TB 4LSRH 4X4ZA 4RNRB 3UJTL 1OB1B 5D7LB 1PEWA 3QQ4B 4GAGL 2FB4L 4WO4D 2G9HB 4PJXA 3MJ6A 4KUZH 3WIFB 2UUDK 1P1ZA 4FFWC 2ICWI 4YIQB 5AYQA 3C6SB 2X4SA 4N90E 4NQEA 3U4BL 4ONFH 1WEJL 5C0DB 1WLHA 2FJFB 4GAJL 4CU8A 2VXUL 3IDYB 5EULV 3MFFA 3SDAB 1DUYB 1TPXC 2OQJB 3MCLL 2EE9A 1NUDA 5D7LA 1O5DT 1EEZB 3MR9A 3WNMA 1FL6A 2OR8A 3C6LD 4U6VH 1JGEA 3DRTB 4YFDB 2AXGA 3WNPA 4BQ6A 1MH5B 4OZFB 2VE6A 3LKQB 4LHUA 2QV2A 3LV3B 4PV8A 1EIBA 1SEQL 3NTCH 1Z0NA 3F5WA 4XBEL 2F9BT 2QQQA 2ZSWB 4JFDA 4EXKA 5KVMC 5CEZE 1MI5A 1CDIA 8FABA 5ABDE 4X80H 4JFFD 2FGWL 4NQCA 4QRRD 2B1AL 4FMKA 4J12A 1FRGH 5J11B 1FLRL 3MACL 4AEIL 4EOWH 2W65B 4JZOA 5IMMA 1JGLL 1QBLH 4IRZH 5FA4B 3VFRA 4F7EB 4HS3A 2DRUA 2OBGA 1EO7A 4LCCC 3ZT7A 5C09D 3X17A 5EOTA 2G60L 3AMKA 1NCNA 3AY4A 2DI7A 3JWOC 4NKMA 5BZWB 4J3VA 3O4LD 3VMOA 5AD0B 1M6OB 1D5IL 3NPSC 2UWEE 3PP3H 5B3JF 3QB7C 5F1OB 5D1XC 5H37H 1XF1A 1MCKA 3GMOA 5FKPA 2A6DA 2R0LL 1U3HD 3ZTJG 5TQ2H 2E6PA 1MCCA 4YDIH 4M4RA 3DV6A 4XCCL 3V6FB 3RVVC 4MD0B 1L7IH 1FYTA 4S1SL 4OLEA 2F8VA 4PJFF 3ULVF 5EC2B 2D4DA 3U4EA 1A4JA 2R1YA 3JWDH 2VOTA 4BQ8A 3TA3A 2OR9L 5IJKC 4KHXL 5JXAL 1UB6A 4Y19A 3B9AA 4FOMA 3DURB 3PHSA 5EWIH 2L0DA 4FFYL 3UPAA 1DBBH 1P84J 4HC1A 2GUOA 3RUGF 4GQPH 3MCKB 3S35H 4ZPVA 4D0BB 3NCYP 4LKCA 1IAII 2XZQH 3IETA 3EJJX 3NZHH 1VEOA 5FOBB 5CIPB 4NKDB 1MCQA 1YNTA 4XCNB 1Q0YL 1NEZA 2ILLA 4OLYL 4PP2A 3EYFA 3MBXL 1X5XA 4A6YA 5IW1B 3STBA 1IBGL 4XPFH 3PP3K 3ZYZA 2F5AH 3UBXB 1CD1B 4POUB 4XWGL 3CPLA 1QSFA 2YWYA 4POZC 4P4RA 1WAAA 4NHCH 5E1AB 4AEEA 3ARGA 5IVXA 5CCKL 2AW2A 3EGSA 2DQFB 4WU5B 2GCYA 2KPNA 3NFPA 4LVOC 4HUUB 3SKNB 1R3KA 2NX5A 3I84A 1KENH 1INEH 2BSRA 1TZHB 3VRIB 4CMHB 1BQHB 4NUJB 5D7IF 1TCRB 1UH2A 5GRJH 4BSVB 1R3IH 5E1HB 2V5SA 4O9HH 3MUGB 4JANA 2BP3A 3C5ZB 4F7EA 3S97C 4JY5H 2AJUH 4IS6A 1CK0L 3QHFL 4WI2A 3JV4A 3I50H 3IU3B 5AYUH 1QEWB 4IIQA 5DJDA 1J8HA 4D0CB 2YD4A 1QR1B 3M1BB 4AM0B 3TIDB 4XNQA 1MJ8H 1DFBH 1QLRB 5CBAA 4HHAB 4ONGL 2XWTB 1KIQA 4WV1B 4KTEL 1DQQB 5IGXH 4L1DA 1T83C 3GIZL 5CD3B 1HQRA 4TVPE 4MXVF 2J5LB 3P9LA 4FZ8H 3QXVA 2V17H 2C3WA 3QRGL 4Z8FH 5ID1B 4LAQH 3RWCA 4C83A 1LWRA 2FZ3A 3FQRB 1KJMB 3OKMA 5D8JL 3U7YH 1SJEB 2H32H 3HE7C 2UUDH 2DLIA 2GJZA 4JQVC 4OD1L 3L7FA 3QIBB 5IVOA 4CL7A 2DQCL 2XWTA 4G7VL 5J4MA 5IIEA 1QBMH 1F6FB 3QIWC 4UQ2B 1CI5A 1CG9B 3EFDL 4F2MB 5CILL 1YUHB 4ZFOA 3VFWB 3Q6FA 3DX9A 4YAQA 4FHBD 3MA9H 5B4MD 5HDQH 1BECA 5ESQA 3CU1A 4GXUN 4QTIH 3N1MC 4FQIH 3W2DL 3C08L 1Z9LA 4QXTB 4JJ5A 3SOBH 4DGVL 4PRPB 3S36L 1HWHB 1Z3GH 2HJKB 2Z31C 4XMKH 4LPVA 3W11D 3BN3B 1I1FA 1HILB 1P2CA 1T4KA 3KVQA 5F9WB 3C9NA 3R1GL 1A64A 1YNTB 4M48H 3VXUE 4NBXB 3B83A 2R1WA 3VRJA 3VXQA 2NW3A 5D6DC 4YDVB 5D2NE 4UB0H 3JTSB 5IHBA 3HC3L 4M1CC 1OSPH 4TOYH 1AP2A 2IPTH 5LAXA 5BCAA 4OZFG 5CSGA 5HHXH 1P2CB 3MZGB 2YEZA 3GI9L 2D9CA 2CJUL 4D3CH 3QH3B 4PREB 4TUOA 4J3XA 2D7TH 5HDBE 4R96B 2FJGB 3FFCE 1IEAA 1S9YB 4JM2D 3O3BA 1IT9H 1N0LA 4BZ1H 1BIHA 3QUMA 4P46C 35C8H 2NX5E 4J1UB 1UZ6F 1KLGA 3FFDA 4DVBB 1UXWA 3BIAX 3DETD 2VLRB 5F9OL 1MCRA 1XCTA 4JHBA 3IDUA 3KJ4B 4AT6B 2ERJB 2K3TA 3L5XL 4YUEL 1DBAL 1V7MH 1FNEA 2I25N 3I6GB 4NGHH 4UDUB 4PP1C 4G8EB 4RGMB 2I9LA 2VDKH 3V0VB 4YXKH 2EIEA 2AVGA 5FIEA 4TVPL 3AMLA 4H8WL 2A83A 4PJBA 1ND0B 4PGDB 3GSQA 3VFRB 3O2VL 2IPUK 4G42B 5I8EA 3QNZA 2VXVL 4U3XA 3MRBA 1EHNA 2BFVL 4MAYB 5I1AA 5C0AE 5A3ID 3UPRB 1E4XL 1QSEE 3BQUA 1F45A 1JYWA 4Y4KB 4GXVH 2CDGB 5FB8A 3RWGA 2P7TA 4LLMA 5FYLE 1M1SA 4M1DL 3FOLB 2V9RA 4HF5L 3U7WL 3BEVA 2AEQL 1I8LC 1OW0C 4ODHH 3ZTJH 3H3BC 5IHUL 5EOCJ 1M05A 5JHDE 1U3HB 4LGSB 4OB5H 4KWUA 3UP1A 1JWMA 3TYFA 5KSUB 2MKLC 4GKNB 1A47A 5FGSA 1J05A 2EECA 3T4AA 4R7NA 1C16A 1UKSA 4WI8A 2IWGA 4NJAL 4CJ1A 3CZFB 1RJLA 5M95B 1MVFA 2UZXB 4LLWB 2ARJQ 5F9JB 3DX8B 1QFPA 1E4WH 4XMLH 3WXVH 5INDB 5B3NA 2NY2D 5KAQF 2AV1B 3CAFA 3SE4A 2YK1H 2X42A 2GJ6E 5KN5B 2EDOA 5KSAA 5JDSB 3D9AH 5GS1C 4GMTH 5D1ZD 4X4YB 2VQTA 1CLOL 4K3JH 4L8BB 1HIMH 4HWZA 1HINH 1I9JH 1WBYB 5F88B 1EO8H 1DQJA 5F1NA 2RCSL 2H3NB 4ZFFB 1A7QL 4P46D 4HUVB 1KXTB 4N8VB 1X7QA 2VZSA 2Q6WB 1F3JB 1VESA 1KB5B 5DSCB 1MLCA 4G6JH 1IQWH 4BA8A 4KTYA 5ITBH 2VC2H 1N6QL 3RY6C 1K85A 3N9GL 1M7IB 4G6AD 5IKCB 3C60A 2DQJL 1ZSDB 3EBAA 4GBXD 5C0BA 1GPOH 5TQ0H 2FECL 2RHEA 5E08L 4IOIB 4LHJB 1FL6B 4JPVH 3BZ4B 4HUVA 3ZHDA 4XP1L 2Q6WA 4HGKC 2IBGA 1WC7B 2Z31D 3ME0A 1U2CA 1HK6A 1CS6A 1GGBL 5JNYA 1XGTA 2FATH 1HDMA 5TGBB 1N7ML 3HZMB 3OB0K 3HUJE 3K2UL 1TQCC 2YPLB 4OFVA 1IEBB 2VDNL 3QAZC 2BOBB 2C26A 4ZSOB 5DT1H 3AB0C 1T5XA 1JVKA 4Q9RL 3IF1B 3B9KB 4OLVH 2VLRD 1VA9A 4R2GC 1UQSA 3M07A 5GRWA 3HA0A 4F15C 4D8PB 3WEXB 1EFQA 5J1SC 3GHBH 1FZOB 3F7YB 1LEGB 4POYA 3MFGB 4K7PX 2PXYD 4I0PB 2LU4A 2D3VA 3QIWD 5HYJA 1UM4H 4K7PY 5HBBA 4UQ3A 3RL2A 4GW1B 3L1OL 4Z6AT 1M05B 5L88L 3TJEL 3BT2H 5DFWH 4XXDB 2NX5D 3MJ9A 4HGWB 5TH2B 2QEJA 1UWXH 4EQ3A 3MJGX 1PQZA 5B39G 5LQBL 1C16B 4WWID 3IDJB 3VFSA 4PJCB 2HRLA 5SWSE 2ITDB 2XQYK 3R8BB 3SY0B 3K8KA 1MFEL 1T80A 5ESQB 2R0KL 3TVMD 3MV8B 1H3VA 3BESR 3NCEB 1LP9E 4O5LH 4ONHA 2MFNA 5JLZA 5MENB 1EHLH 4WFFE 4N0FA 1KCLA 3GSOB 3U1SH 3MV01 4RGOH 5D2LA 5IWLC 2VDPL 1NBVL 3RKPA 5KS9A 1MNUH 3U36A 2ZSWA 3GUTB 5IHZB 1ZT4A 4WFED 5CEZD 3S8WA 5E6IB 1U3ZA 4OCLC 1ODAA 3J7HA 1MWAA 4PJ8D 5D93C 2O5YL 4KJWC 4NWTL 1YZZA 1OQOA 3C60C 3PWUB 3M17B 4OGXL 2KUTA 3MUZ1 4HWBH 2FEEL 5L8KB 4HUXB 2ZPKH 2RQ8A 3D0LA 3Q5OA 4PJEB 2OQJA 2DBLH 4KZEL 3ROOB 1HH6A 1JIBA 2GTZB 3QCUL 4Z7OE 1ZEAL 5ICYB 1DN0A 1NCWL 1CD1A 4KRLB 4TRPH 5D72H 3S5LG 1XF4B 5FKPB 3TC9A 4ETQA 1Q9LA 4WHTB 5E6ZA 3VFNA 2EYSA 5DHYA 5B4MC 2DJ4A 2OL3A 5D2NC 5C0BE 1V7NH 2JJUA 4GW4A 4XBGA 5DRNB 1AGDB 3KJ6H 4QTHB 3WFEL 4HUUA 4P2QA 3WYRA 1QBBA 2VIRB 4UIKH 3NN8B 1FBIL 3WS6A 2WBKA 3P0YL 5ICXA 4P46B 5BRZD 1VADA 4K2UL 3QDJB 1OTSC 4JPWL 3MNVA 3RJDA 1A6PA 4XAKE 4D0DA 3K74B 3WXWH 3C2SA 4XAKD 3CGTA 3J8F7 1UB6B 3EHBD 1J88A 5GGQH 4XNZC 2FD6L 4Y4HD 2F8XC 1OM3H 5E7BA 3PWPD 2X10A 4P46A 5HHPA 1FNGA 2G75B 5TE7L 4LPCA 4M8QB 2E8ZA 3TT3L 1EEYA 1A7OH 3P11H 5F93C 4FXLA 4R0LC 1U8QB 1X5KA 4C57C 5K9QI 4G6MH 4YDJA 2RJMA 4M7ZC 2DM3A 5IMOA 4HPOL 1MRDH 4PJ9B 1I8KA 3FB8A 2OP4H 4K9EL 4E41B 4KVNH 4FZEL 4OCSH 1KJ2L 4Y2OA 2LABA 2H1PL 3C6SA 5EC2A 2AJSH 3I75B 5SWSA 1A0QL 4LLYB 3RPIB 1IAOB 4P23A 2D2OA 4KJYA 3VWJB 5EZLB 5T1DL 1QP1A 4KV5F 1T21A 1EPFA 1I9IL 4FP8H 1IGYB 4GS7B 5I17B 3ZKXC 1Q9WA 4JAMA 4JKPH 4UILL 3WD5H 4JRXD 1H3PL 3CXDH 3BZDA 2FIKA 3KPOA 3G6JB 4N9GA 2F15A 5BV7H 1VGKB 5EIIB 2EIZB 3RZWA 3BKCH 1XH3B 2AKRA 5LKNA 4YBQC 5IMKB 5KS9E 4QGTA 1OGTA 5JUEL 4HKJB 4PJEA 4RMVA 5JR1H 2DMCA 4PJ5B 2H3NA 1BREA 4JQXC 3IAGC 2EXYD 3T77B 5L6YL 1BGXH 3MRFA 4FFWD 3HE6A 4M6MH 1GZPA 3QI9D 1RK0B 3WIFA 4TQEH 3UX9B 4GAYB 1KLFA 1DLHA 4YBLB 2B4CL 3DGGA 2YEZB 3WS6C 6CGTA 3NN8A 3LOWA 5FM4A 4KTDH 4NN5C 4PG2A 3S3JA 43CAA 5DVNA 3SKNA 4KKBC 3L5HA 4NRXA 3P0VL 1SM3L 1FE8H 4L3EE 5L2KA 2ADJB 2R0WH 1NFKA 2X4UB 1VCAA 3T2PA 5C6TL 4TTGA 4XBEH 3CLEH 3BAEH 1EH9A 1J0HA 1DLFL 3TYGL 4K8RH 2H8PB 2R9HD 4I9WE 5D70H 3C5ZA 4QRRB 5EU4A 5EU6A 4LLUA 1KPUB 5CEZL 1GOGA 1FNFA 4LAJH 3LV3A 5I18L 4OT1L 4APQD 4BH7B 4OCNC 1T7YA 1OGAB 2IMNA 1QBLL 4IRZL 3TPUB 4HFWB 3MRRB 1FNEB 2FO4A 2Y23A 25C8L 4RGNC 3UJTH 4Q97A 3TJHC 5AZ2H 3LB6D 2G60H 1QFUL 8CGTA 3C9NB 1AI1H 3RHWF 1VFOA 4EI5C 3ZDYE 2FB4H 2Q76A 4LSPL 4XVSH 1VENA 1XT5A 3KPRA 1I1YB 3NIFF 3RWIB 1EAPA 5J13C 2ZCKL 3MLSH 4Z7QF 5LBSH 1PX4A 3B4NA 1ZHBA 4LQFH 1YEFH 3GSWB 1R3JB 4ONFL 1MIEL 2V2XB 3TNMB 2VXUH 5EZOL 4NZDA 3LRSB 3VFOB 1FG2A 2ZUXA 4YDIL 2J2ZA 5GGVH 3BMVA 3OBAA 5DK0A 4N5EC 2Z91B 5IBTH 2QTEA 4GT7A 1XR8A 5E94A 3F6IA 5GS2H 1KYOK 2A6DB 3ULUE 3A6BL 2Z8VC 2IAND 4JY6B 4QHMA 3ZKSD 2NY5H 1J86A 2F54E 4YHKH 3BPLB 2NY2C 2ZUSA 5D2LF 5E9DB 3DX6A 4YHYC 5TPWH 4DZ8B 5IR1A 4IIQC 1J8HE 5F96L 3W39B 1I1AC 2D7QA 5JXAH 3IJSA 4Z7VE 1UXWB 2GTWB 3MYJA 1H8NA 5KSUA 3TYFB 4GKNA 1YN7A 3VMPA 4YHPB 1OWWA 4NSKB 4OF5A 4K94C 5I71C 1T1YA 1KIPA 2XZQL 2PO6D 3AUVA 1N5YH 4QHMB 5EU5A 1J0JA 3NZHL 3JVGC 1AIFB 1LGVA 4L3ED 4QRQB 5B8CA 2HFTA 4PRID 5INDA 1NGXB 3GMQA 1XIWD 3OGOE 2FRGP 3T09A 2DDQL 4XPFL 3RVTD 3BPLC 3KPNB 4NKIL 1LNUA 1DVFC 4YPGA 1D5IH 3OG4B 5F8QC 2AABH 2QSCH 2ZOLB 2R0LH 5TQ2L 4DUVA 5MHSD 3L5IA 2PUQT 3BEWA 4IDJH 3ULSA 5DO2C 3GMQB 1F8TH 2P5WD 4FFVD 5EZJA 3ARGB 4KGLA 2P7TB 2XZCL 1AQKH 1RIUH 4PPTA 1E27B 4CU7A 4P5MA 3QI9B 1MIML 1EXUB 2WLZA 5ANME 4XVUC 4WJ5A 1EDQA 5D6DA 5DD6B 4KKBD 2IALA 5IB1B 4OFIA 1PG7H 3TCLB 2VZTA 3QBTB 1RUPH 5EWIL 4F7PB 3LKPA 1MRCL 4PBXA 3LS5L 3KPQA 1RZJL 5SV3A 4ZUUA 4RAHA 5L8JB 4H8WC 1WBXA 1XF5B 1NGQH 3ZL4L 5AWNH 4OJFH 4ZFOL 5INCA 1HILA 1YEJH 3FFCA 1F4AA 1D9KD 2V17L 4KH2A 3HMWH 3KPSB 4WUKH 1CIUA 3BP5B 3GSUB 3EYVB 3KPLB 3T04D 5F3BB 3GDBA 3MBXH 2EDHA 5FYJE 1IBGH 3MX0A 3VWJD 4APQB 4ODSH 1C12B 3MXVH 4U6XB 1P7QD 4HH9A 3O3AA 4NHCL 4JFEA 3I3EA 4TUKH 4CVWA 4NZRL 1OTTC 1VACB 1KEML 1YECH 3SE9H 4Z7OF 4U1KA 3MUHL 3ES6B 3LY6A 1AD0A 1QBML 3CC5A 4ELMA 2YN3A 1MCLA 5CILH 2DQGL 4LCWA 1D5BB 4NC1E 4I9WD 2WWKT 2DIAA 1U95A 4HC1H 4FQIL 5DYOA 3NZ8B 1I4FA 3W2DH 3VWKC 3PL6C 4DGVH 3TEUA 1Z3GL 1ED3B 4PGBA 4XXCC 1R3IL 5IJVB 2J12B 3T3ME 3CVHH 4Y1AA 4EKXA 4OGZA 1T2QL 4YWGL 5EUOA 4J4PC 2E7HA 3DX7B 4IM8A 1CK0H 1JPSL 3FHQA 3CMOH 1YDPA 4X0KA 3RL1A 1CVSC 3R0MA 3FFDB 1BF8A 2WP3T 5HVFB 3HC3H 4JDZB 1X9QA 3G5ZB 1BVZA 2BOCA 4HZAA 3T0XA 1MJ8L 5T1KA 3BPNC 4ZXBC 2R2EA 2X1QA 1IM9B 3FB5B 3ARPA 5DJXB 4S1QL 1NDMA 3QUYA 2W38A 1HNFA 4OUUB 2K7PA 2PYEB 2NY5C 4U6HB 2VERN 4JRXB 3ZHKA 5BVPH 2UY6A 2EDLA 3WKMH 4HWEL 2AXGB 1L0XA 3HI5L 3V8CA 5E8DL 4ZO9A 1IT9L 3FTGA 3S4SB 3CCHA 3HHRB 4P2RB 5DGQA 1U3HC 35C8L 4XMPL 1BM3H 3ARBA 3WE6A 4XXDA 4RFEB 1QYGL 5JXEA 3O3UN 3EFDH 2QJDA 5DMIL 3KWWB 4TUJB 2BNRA 2X9YA 3WMSA 5HDQL 2EH7H 1HXYB 1B9ZA 4OCXH 5MEPB 4KK9C 4IRSD 3FCTB 1X3DA 4O00A 4J2XA 1NLBL 1FYHB 1EBPA 2ORBH 1JUFA 4PD4J 1JZ6A 4G6FB 1NGZB 4OD3H 2CRZA 1BFOB 3SDXB 4JFYB 4ZPVB 4S2SA 4UTBH 4LSVH 1LVEA 4R7DB 4IMLB 5E8NB 4W6YB 5F3BA 1I8IA 5CIPA 4UB0L 4U3CA 3BKJL 2VXVH 4EZMA 4LEXL 1J1OH 1FFQA 1MFAL 3UEZA 1DBKL 4WFHE 2CRYA 3F7YA 5J12C 3H8NA 2OMBA 4WFHD 4BQBA 1MHPL 2DL2A 1E4XH 2IMMA 1ACYL 1IVLA 4NQVB 4OKDA 1IC4H 2V2WA 3BMWA 4Z7NF 4MXWH 4CDGC 3WFZA 3BUTA 2D7TL 4JFED 4NYLB 3PL6A 1A9BB 3PWUA 1PKQB 3LSOB 4WI6A 3NFPB 3SE8L 2YPKB 3L3OB 4JFEE 3CSYB 5H2BA 1WBYA 4ODHL 1G7LA 3ZE0E 1HI6A 4JCLA 4RISH 1XF3B 4Y16A 3VXSE 1JPTL 3CFBA 4KJQC 2EXWD 4OB5L 1G7MB 2P4AB 2ESVD 3BPCA 3LH2H 4LCWE 4YHZL 4NCC1 1FVDA 2NY6C 1X7QB 1P7KA 5JO5B 1U8IA 2VAAA 3QYCA 2HA1A 3DYPA 4EI5A 4KZDH 5ANMB 4Y19D 2D0FA 4PR5A 3QFJB 3O4LE 4ZUWB 1J18A 3L5XH 4XBGB 5I8CA 3MRHB 4O2EA 5B21A 3OKNA 4YUEH 2DYPA 4KDVA 4XVJH 4WFGE 1NFDF 4XMLL 5J3HD 4R26L 3WXVL 1G7JB 1IM9A 3O6FB 2R2BB 1INDH 2APFA 2JJVA 5C2BL 2Z4QB 4NKDA 3WIHL 4L9LC 1YN6A 1OF2B 5DEGA 4H8WH 4ZTOL 2BNUA 3HRZB 5F7MC 2WM0A 4OFPA 3G6JA 2HT2D 4N9GB 3ZDZE 4AY0A 2Y9RT 4LCCA 4IRSA 4MLSA 5GS0C 3GMLB 1BFTA 3TA3D 3WUWG 4G8GE 2FL5B 4PJGB 2QBWA 2R1XA 5A1AA 2FZ3B 4G8GD 3PWPE 3QXAA 1UGNA 3H2WA 2VAJA 1TJGL 3UTOA 1W72B 4WFFD 4UUJB 1CXLA 2X7LB 1RUML 1ZHKB 5DHVA 4FMFA 1AR2A 4ODWB 5I66A 2Y5EA 3GB7B 3IDMB 2YC1B 4JPVL 5DJ0B 4WFEE 2XV6B 5EO0B 1A6UL 4KI5C 5D2LE 2DN7A 1J5OL 4NFBA 2BNRE 4JFDD 3GMRB 4P2YA 5J9PA 2EC8A 1NCTA 3OKOA 1UKQA 2VDNH 4UT6L 2Q8AH 5CINL 4OCWL 3MUJA 1ZHKA 1HQ4B 4P9HH 5B38G 5L2KD 2OTWB 4YDKH 2MQCA 3PP4H 2D7OA 1WITA 3ARDC 2E5EA 5TGBA 1QPPA 3P9LB 4O2CA 3F58H 3QQ4A 1UA6L 1KGCE 4R4BA 3O2DA 1WV7T 2CO6B 3GHBL 1BFVL 1CLOH 1HIML 3QXDB 5TDPB 2DQHL 4YE4L 1R5WB 1BX2A 1L7TH 2C7UB 1UM4L 4NO0A 3MV9D 4Y16C 5FM5M 3VFGH 1YEIH 1G0YR 2QADC 1GAFH 3MJ7B 4FXKA 4A6YB 4MHHI 1U3JA 1N2RB 5MEOA 5I8KH 1FVDB 3UBXA 4P5KA 1BVLA 3SGKC 2OK0L 2OXGA 4KI5D 1TTFA 4DCQA 3DVNB 5IVXB 2NW2A 3JUYA 2BC4A 4MQSB 4HPYL 3OKNB 3TVMB 3CUPA 4GRLB 3T2QA 1J0YA 3VD9A 2I9TA 5GS2D 3WL9B 1QOKA 1FFNB 1KXQE 2BSRB 4KHTH 5JQHC 2NZIA 1EFXA 2VDQH 4FQ2L 3BIKA 3RZCD 2PETA 2N7BA 1CDGA 5MEOB 2X4UA 3BDXA 4Y1AB 1G9NH 3ULVC 1Q0XL 2APWA 4J8RA 4F7CA 1UCBL 2YA1A 4WENB 4ETQB 3ARFA 2O61A 2VDPH 4Z76A 5D1QB 3QPXH 3EO0B 5GS0D 1SYSB 1K4DA 3BZFA 5SWQA 5E8OB 4RWHA 4XI5C 1QRNA 5J1TC 3FRPG 4U05A 4LMQI 3ZYJA 4UU9B 4NZJA 1ZLUH 2VUOA 5HVWA 1F2XK 5TE4H 4LSDA 5I0ZA 5HGGS 5CBAB 2Y4SA 2CKBB 4FTVE 4M02A 4LKXA 2X7LA 4WU7A 1QSED 1NSNH 3PWPA 4QEGA 4LLMB 3VXUB 2VL5B 2DIBA 5GHWL 3SQBA 4X7EC 4MB5A 4WHCA 3VW3L 3OKEB 2GJZB 1B0RA 4IOSD 4JN1H 5GRUL 5HGDA 2Q86B 1ZE3C 1QRND 4MJIE 2YZ8A 3WFEH 2E6JA 4HXAL 3IJHA 2OI9B 5H35A 4QT5A 5ICYA 2X4PA 3MLWH 3P0YH 4I3RH 5C0CE 5MEPA 3WNNA 1GGIH 3ARDA 2J7LA 1QG3A 2PYFB 2RFXA 3TBWB 3GSQB 5E9DA 3U2SA 1Y0LB 5FYKU 2PYEE 4Q0XL 2C4FT 5DC0A 3CFCH 2NLJA 1FVEA 4Y2DA 5HGDB 3FFCD 2GAZB 2EDRA 5CZKA 1MNUL 3SJVE 1JPFA 4OZGB 1T1XA 2EEBA 3BKMH 3ZDXF 3HAEG 4NO5A 4MAYA 4U7KA 3VWJA 1CIDA 5ITFA 5F7KC 5TE7H 3PGCA 3LRGA 3X13A 1SBSH 4BH8B 3VD4A 1Q72H 5IQ7H 1OAQL 1C5BL 2EICA 1A9EA 4V1DA 3ARZA 4LIQH 4P0DA 4BM7A 5E2UL 3EYQC 5GIRB 3DJ9A 1HHGB 1T3FA 4X7FC 5I2IA 5D7IB 5JA9A 3X3FH 4HIXL 2YSSA 3GBNH 3EHBC 4PJ9D 4S1DD 5IF0B 2ZKHL 2DBLL 3TN0A 5BV7C 5FHBH 4FQXB 4Z5RB 2LU3A 3C8DA 2CUMA 5DHVH 1YY8B 4MA8H 2D31B 3U9PL 4TRPL 5D72L 4E42A 5EBMB 1JP5A 1VKXA 4ISVB 1T7ZA 3DGCR 4RDQG 2BSED 3KJ6L 3NACH 5JW5A 5FUZL 3NABH 3HG1A 4G9FB 1JPST 1I9IH 2FYYB 1WZ1L 1SJVA 2VZUA 3QNXB 4P2OB 5ISZB 3CDGA 4HAGA 5DRXA 1RIHH 2IBZY 5DR5H 3U7AA 4YXLH 3AFLA 5T3XL 3TH2T 3WD5L 3B5HA 3ZMRA 1TNMA 1RJZA 5E5UB 1INQA 3I3DA 4R90L 4KJQD 1YEDB 1YMMD 5D71L 3OKDA 4XPAL 1J9CT 3U9UA 1BZ9A 4EI6B 3QO0A 1UWEL 4G6FD 4TYUA 4M6OL 4FNLL 4LKXB 4QXGL 1KCRH 3IKCA 1BD2D 1U8JB 4PY7B 2AJXH 3HI6L 5GGQL 3QZWB 2ICEA 1QRNE 3LKPB 5CD3A 1I9EA 2NY1D 5T33H 4JY4B 3KDMA 3UTSB 5DRWA 4X5WB 3ARDD 4RMQA 5L6YH 3QPQC 4NT6B 2ADIB 1FVCA 2D7PA 4RBPK 4L4TE 4OBRA 4X99A 4NPYA 4YGAB 1CF8H 1CLZL 5DVLA 5IHLB 1FZJB 3GK8L 4G6ML 4OF6A 2KKQA 2DTSA 5AD0A 3SPVB 3DVGA 5TE6L 2JB6B 4KTDL 4P4KC 2Q76B 1GRWA 2OP4L 3PGFH 4EEEA 2R0WL 3HS0B 3ZKND 2HWZH 1Z9OA 4FZEH 3MLZL 4OCSL 12E8H 5I73C 3B2VL 4K07A 1OY3B 3FTGB 4QCIB 2A6IB 3E8UL 3FQWB 2AJSL 4MJIA 3CLEL 1R5IA 4QXTA 5F70A 1JCKA 3WLWD 1U91A 3NPSB 3L6FB 1JWMB 5CEZH 4LLDB 4NQDD 5F1SA 3VU2A 5DYOB 3WIHA 1ADQH 5I18H 3DLQR 5GS3A 5D4QA 5FGBC 3MRGB 3QUXD 3DXAE 3QIBC 4R8WL 4XP5L 4PJDF 1OAXL 4FQ1L 3HNTL 2O5ZL 2HN7B 1JK8B 1FN4B 3FO9B 3LKSB 3S96B 3EJYD 5AZ2L 5BV7L 5BVJB 1A9EB 4CU6A 1T6VN 4I0PA 4JM2B 3RJQB 3EOTL 1OPGL 1E4JA 1G6RL 3SE4C 5IB2B 3SJVA 4UMGA 3VCLB 3ZDZF 3L5WB 5I75B 5JUEH 5HY9B 1UT9A 3TNNB 2Y25A 4X6EB 4EN3D 5BMFH 1OAZL 4LQFL 3NIGE 1QQDA 1UJTA 5HDOA 2JK5A 2HLFC 1BGXL 2AQ2A 1HZHH 3BQUD 5EZOH 2ZUYA 2X4RB 1XIWB 3QWQB 2VDRL 5IEKB 1IILE 5EU5B 4HEPG 5FYJL 2XA8L 3QFJE 2AV7B 5IJKA 3NIDF 1A7NH 2J4WH 2DLEA 1CE1H 3PWVB 4P4RB 3EO1B 1AD0B 2VKXA 4PJIF 5CUSL 1XGQA 2JJWA 3EYSH 4JR9L 4YHKL 4JVUA 4GRLA 3R4DA 1B6DA 5L9DH 3UMTA 3QG6A 3BH9A 3G04B 4AT6A 4OZIE 3RIFF 3LMJH 5C07D 3O9WB 2H2PC 3RUGB 5C6TH 1VADB 5IEKA 2W91A 3TYGH 3RAJH 5IJVA 5JW3L 3HG1E 1T7XA 2Z8SA 4J6RL 1E6JH 4KI5F 2EDDA 5IT2L 3EOBB 4AH2B 3HE6D 2ICEB 2HAZA 4ODTH 1JHKH 4M9PA 1I9RH 4X7DC 4LK4A 1KULA 3CFIC 3TFKD 1A6VH 2ATPA 3GMNB 4HIJB 3QIBD 1G7JA 4G42A 1MRFL 5DEZA 1LD9A 5C0RL 1AI1L 5FYLL 5DA4A 2DDQH 1F6AA 3VXMB 2E7CA 3H9SB 4ELME 5HHOE 4LCYB 1S7TB 2ZCKH 3MLSL 2VLKE 4BSWB 1E4XI 4L4TA 3ZT6A 2V5YA 3MBEA 2N56A 1TETH 5T1LB 4MWFB 5F7WC 5DRNA 1E4KC 4IDJL 2X4NB 1RZGA 4YBLC 5IBTL 1VFAB 3CFEB 4JFFE 4Y1AE 1RPQA 3NVQA 4QRPE 5FHAL 3EYVA 3RY6A 3QIBA 2VN7A 2C4FU 4OFKA 3VG9C 4OF3A 4GMSH