4HKBB

Ch67 fab (unbound) from the ch65-67 lineage
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
204
structure length
164
Chain Sequence
SALTQPPSVSVAPGQTATITCGGNNIGRKRVDWFQQKPGQAPVLVRFSDSNSGTTATLTISRVEAGDEADYYCQVWDSDSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAETTTPSKQSNNKYAASSYLSLTCQVTHEGSTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH67 heavy chain
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 164
sequence length 204
chains with identical sequence D, F, H, K, N
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkbB01
4HWUA 1NGXA 4D0CA 1G7MB 1T5WB 2ZPKL 3U4EA 5CHNB 1I9RH 3B3IA 5IIEA 3O4OC 1XGPB 1CL7H 5HYQA 1MRFL 3GK8L 4JFEB 1UYWL 4CADB 3C6SB 5HHQB 2ZUUA 1MAJA 2YPLB 3IYLW 3U6RB 5IEHB 3D48R 1GYAA 2ZG3A 3GMPA 5J6HA 1I85A 4M8QA 2VLRB 4KK5D 5C0BE 1QFOA 1FDLH 4Y88A 3MX0A 4OLZL 3SCMB 4PJDE 1NAMB 1YY9C 4YFEA 1EH9A 5AWNL 5AG9A 3QZWG 4ISVA 4J3OC 2I9TB 3MYJB 2VL5B 5E8EA 5IHBA 1XGTA 1TNMA 3A6OA 1GGBL 3IF1B 1T22A 3TVMD 2CGRH 3QQ4A 4J2XA 4QY8B 2F19L 1M71B 2OCFD 5J1AA 2HTKC 3OR7B 4OZ4B 1Z3GH 5I8EA 3SDXB 1I1AB 3RIFF 2E3VA 1FIGH 3WNOA 1FBIL 1MELA 4D94A 4HK3J 4XAWL 5B3NA 1S5IH 4QRRA 3QBTB 1AI1L 2I25N 3KYNB 3MCKA 3VFGL 3WXVL 1NBZA 4EI6A 3TT1H 3FCTA 1YY8B 2CMRL 4PR5A 1DFBL 4HIIA 1LEKB 4KVCH 2HT4D 5D2NC 1OWRM 2M1KA 1CLOH 3K3QA 2PR4H 3MLXH 4X7FC 4RGOL 1INDL 3BQUA 4YHOH 4G9FE 4PJ8C 5F6HI 4HKJA 4TTDC 4OAWB 2AEPH 1RZJL 3DSNA 3ALPA 1S3KH 4FQPA 4RMRA 1FG2A 4L3ED 2X4QA 1A1MA 1VKXB 3NCFB 4F8TA 4I5BB 3PL6D 1P2CB 3GSXB 2E27H 3HR5A 4Q6IA 5IHZA 5ACZA 3T65A 4RAUB 1R24A 3HLAA 1S7WB 4YDLC 3QIBD 2LTQC 3RWEA 3VGAB 3MV9B 1UACH 2EDBA 1SYVA 4JEGB 4WO4C 5FYJH 3WDHA 2YC1A 3V7MA 4LCUA 4FQHA 1TIUA 5IMKB 1IGML 1TJHH 3BGMB 2QSCL 3MOBL 1U8NB 4RWYH 3HNSL 5C0CA 1NSNL 2VIRB 4LQFH 2OR9L 4ZSOE 5E24E 5IJKA 5JW5A 1A4KB 1MVFA 1G7IB 1NUNB 4OF5A 5I8CA 2OJEB 5L2JB 3D9AL 4NQVB 1Q1JL 5CINH 4PTTB 4Y19B 5E8OB 3EJZD 4BKLA 3E2HC 2Q8BL 5D2NA 5E6IB 4F7TB 4OF7A 3NIDF 1NC2D 4R4FH 3EYOB 3S37X 5DVKA 2J4WH 3VWJD 1L7IL 4F7CA 5HDLA 1IM3A 4FABH 5EFIB 2VN7A 4JO3H 5F9DC 1CR9L 1OGTA 3S5LA 3TBWB 3NZ8A 3RPKA 1OPGL 3QI9C 2DJUA 3CVHA 2G5BB 1DLHA 4YBQD 5J11C 3ARDA 3E1F1 3V0WH 5B3JE 4J6RH 5HGBB 1WC7A 2A74A 1MIEH 2F54A 2RIKA 5IM7B 1I9JL 1OGAD 3MV9E 3HMXH 2HKFL 4ZFZB 4Y2DD 3RU8L 4HK0A 1A6VH 1CE6B 3D3VE 4ZXBB 4YNYA 2N1KA 4WO4A 4QCIB 1WBZA 5KS9A 3EO0B 3T0XA 5TQ0L 1KJMB 1FL6A 5SX4I 1CGXA 1MJ8L 1LO3L 5SWZD 4W68A 4Z78A 1QFPA 3VGFA 2CRMA 2ZUQB 1IGTB 2OL3L 2OXHA 3BPNB 2UVFA 3H9SD 3VA2C 3FFDA 3L9RB 3UJIH 4JPWH 1LE9B 5JHDE 4N0RA 3A67H 5ISZB 4AEHL 2VUOA 3IETA 3WDJA 4Y4HD 4M5YL 4QNPE 1A6WL 4LSTH 5IVNA 2A6IA 5D1QC 4V1DE 2VDPL 4MNQB 1MCPH 5D6CA 2G75A 1T7ZA 4L8CB 4X7EC 3JSSA 3O6LL 3CUPB 3WCYA 2AJ3B 1EDQA 4JE4B 3BRFA 4R7NB 1II4E 3REWA 3E3QC 4XNUL 3VD3A 2XXCB 4KK8C 1K9TA 3I75B 4DZBB 1V05A 1VHPA 2NW3A 4H0IA 2WBKA 2ORBH 3RBGA 5GRUH 3SKMA 4EOWL 1MFNA 1QEWA 4HQQH 4OF0A 3VDBA 3NFSH 3T08A 4MAYD 2Q76A 4M62H 1P7QB 3RUGE 3EUUA 1UVQA 2C1PA 1AR1D 2XWBB 4K7PH 3SDAD 1FZKA 2AJXH 2RCSL 4R96A 1UH2A 5GPRA 3AXLA 1OTTD 3L3DA 1NEZA 3GI8H 3SKNB 4AG4H 4U05A 2OJZL 1QO3A 5LGJB 2JTDA 3EYUL 1HIMH 4NO2A 5EPMA 3IDXH 1YPZB 3WFBL 4FP8H 1BECA 3RGVD 3S35X 3I3DA 3IDYB 4PJAA 5HI3C 1HDMB 3MLZL 3LHPL 3QFDA 1KG0B 5IEKB 4MJ5A 3P9LA 3QUYA 3GSWB 2BY2A 5I66B 2ERJC 3TA3A 5HPOA 5C0GB 4ZUVA 3SGJC 3PIQA 4MNQE 2AJZA 2DWEA 5KSBB 1IM9D 3I6LD 5D1QA 3F7VB 2JB6A 4Y4FA 3SDDA 3NA4A 4UT7H 3CH1A 2IGFL 1DQQA 1KJ2L 5IR1A 2CKBL 3VXOB 2EH8H 3DV6B 2YSSB 3F6IA 4DOHB 1EO8L 2J12B 3NOIA 2UV3A 2GJ6D 2VLKD 3O6ML 4QEGA 4P5KB 4X7DC 4CNIB 5IFJA 1JWMA 4JQXC 4AQOA 4XP9H 1PVHA 1TMCB 1FNAA 1EERB 2YXMA 2FECL 2FWOB 3MREA 5FYKH 2XKNB 4WDIB 1MFBH 5DJ2B 1NMCB 1RJCA 2CQVA 2M26A 2IAMD 3O11B 4YDIH 3BKJH 4NO0B 1YPZE 2DB8A 3VRIB 3KPNA 4K7FB 4KRPB 1A0QL 1NGXB 4D0CB 1A22B 3U4EB 1BGXL 4XWOC 2NY5C 3FO0H 3B3IB 4TVSa 5IIEB 1FFRA 4R2GD 3GMRA 1RSFA 3IKCA 4WUKL 1Y6KR 2EE3A 2FEDD 1LP9E 2E7LC 5HDQL 1ACZA 2VZSA 4B7IA 5HYFA 1KGCD 5JTWA 4J12A 2DQUL 5J6HB 3RX8A 4M8QB 4LEXL 1BQLL 1FHGA 4LVOC 4GLRI 3KPPA 4PV8A 4Y16B 4DJMA 3C5SA 1O0VA 4Q9RL 4L4JA 4UUJB 1EZVX 3JWOC 2LU3A 4ISVB 4PY7A 1FN4A 2EE9A 5I8OH 5E8EB 1UXWA 1XGTB 3HMXA 4M9PA 2XTJC 4RDQF 1T22B 1FGVH 4Y1AE 4XPAH 3BMWA 2FD6L 2CRZA 5FYJU 3V4UH 2ICWI 4P2OA 3S36L 4QYOA 1MCDA 1DBAH 5J1AB 3KPSD 2MHAA 3SE3C 4YHKH 5I8EB 3U9PH 4MJ4A 1ZHKA 1GH7A 2BNRA 2DWDA 4ODVL 2B39A 2FX7L 4UIMA 4K71C 4DGIH 1NCAH 2VXQL 1MCRA 4QRRB 1CT8A 3Q48A 1SY6L 4HKXA 4LGSB 4EUPG 3G04A 1J0ZA 3QQ9D 2B1HH 3MCKB 2OXGA 1NBZB 4EI6B 5CEXB 3FCTB 3GBMH 4XAKD 1AKJA 2GT9B 2IC2A 2HFFA 4HIIB 2E7LA 2XQBL 1X4ZA 3KDMA 3MYZA 3QPQC 2XNAB 2H32H 1CDUA 5HY9A 1DBJH 1RIHL 2PYFA 3D69A 1G7PA 4I3SL 1NFKA 5CUSH 2ID5A 3DRQA 5D72L 3BQUB 2IWGA 3GHBL 5MHSE 5C08A 4HKJB 4DKFL 4PS4L 1IQWL 1MFEH 1ONQA 2WP3O 5KS9F 3O9WC 3W81A 5JA9A 1FG2B 5CSZB 2X4QB 5FEBA 1A1MB 3MBEA 4ZFGH 2X1WL 1ZWIA 1CZ8H 3A6BH 3HR5B 4P59H 2LVEA 2I27N 5DJ0A 4Q6IB 4B5EA 4P4KC 2JJSA 1GJIA 5L6YL 5ACZB 1SJHA 4MD5A 2O5XH 4WCYL 4F58H 1P4IH 3HLAB 3S9DB 4KHTH 1AXIB 3RWEB 1ZGLA 1SYVB 1HYSC 4FQXC 4GMTH 1NL0H 3VXNA 4LCUB 4FQHB 2UYLA 4HWBH 2NXYC 5JHLH 4XRCA 4LARL 1DVFA 3C60D 5HJ3A 4ZNCD 3CLEL 4MQXC 5BV7H 2DM2A 5C0CB 3IVKA 5JW5B 5J13B 1A9EB 5I8CB 1ZT1B 3O8XD 4EZMA 4BKLB 1IQDA 3AFLA 1J8HA 1VEOA 2QADD 1XIWC 5GS1B 2R29L 4M3KB 1MIMH 4LLUA 1HH9A 2HKHL 2F53B 3QA3B 1IM3B 1OGTB 3PE9A 3O9WA 3S5LB 4R6UA 3NZ8B 1VGEH 4PRHE 3WKMH 3CVHB 5I71C 1DLHB 1LD9A 1HKLH 1S7TA 3ARDB 1I1FA 4NRXB 1BIIA 3E8UH 1WC7B 2A74B 2VZVA 5A2KH 4PJAF 2F54B 4H0HB 4HK0B 2UWEE 1E4XH 4YNYB 2Y6SC 4LPYA 4JN1L 1WBZB 5KS9B 1XMWA 2IFFL 5JR1H 3NABH 5JZ7D 3QDJA 3KYAA 5F72S 4Z78B 2R2EA 5I1EH 3FFDB 2DIBA 5HDBE 1E6OL 4DWHA 3T0AA 5F93C 5JXAL 4N1EA 3IETB 5D2NE 4A2LA 1EHLL 1XCQA 4MXVF 4OLVH 1AFVL 5HHVH 3L7EB 2DLEA 2P24A 2R0WH 2ZJSL 2A6IB 3IDMA 4MYWB 2FX9L 1IGIH 3B9DA 1G7JB 4JKMA 5B38G 1YEJL 4R4BA 3RWDA 1NCWH 2XN9D 1K85A 3V5HB 1MI5A 3UPRA 3REWB 1XF4B 1KFAL 1EBPA 3U79A 4P46A 1XF2A 2NZ9D 1OAZL 2NW3B 1QRNA 1IC5H 1P5VA 4P9HC 2CO7B 5TF1L 4JFHE 2Q76B 4PGBA 2BZDA 3GSUA 1UVQB 1FZKB 4R96B 2IH1A 3L3KA 5ALCH 2ZP0T 4WHYG 5EU6A 3L3DB 1NEZB 5KVEL 2VABA 1QFUH 1EFXA 1RJZB 2EYSA 2GQHA 4I2XA 4WW2A 1MFCH 1QO3B 4LVEA 4E41E 3P40A 4TVPH 5EPMB 3ESVF 5HYIA 4HSQA 4NUJA 3P11H 1YEEH 5A43C 4PJAB 2NY2D 3VD5A 1E4WH 3QFDB 2NY1B 4MJ5B 4N9GA 3P9LB 4G43A 3QUYB 4G8GD 4IRZL 1QBLL 2H32A 3TA3B 1AY1H 4IRJD 1X5LA 1N8ZA 2NTFA 2H9GA 4N5UA 3PIQB 3BPOB 2AJZB 3QIWB 1M6OA 1YEHH 2JB6B 3LOWA 4Y4FB 1WFOA 3SDDB 4CMHB 2WUCL 3CH1B 3MLRL 1DQQB 5IR1B 4NBXB 1J9CT 4HIXH 4LPXA 2NYYC 5FO9A 3DXAD 2HN7A 2D2OA 5IFJB 1JWMB 3T3ME 5M7QA 1KACB 2XA8L 3NTCH 3O6KL 4GH7B 1CG9B 1JGDA 4DZ8A 1JF1B 2VQUA 3AS0A 3DVGB 3MREB 3IFPA 4JZNA 1CFVL 2WWKO 3D18A 1NDGA 1YN7A 4TSBH 3KPMA 3CLFH 3ORJA 1EXUA 4MA1B 3TBYA 1U3HB 1FVCA 1GC1L 3BYYA 5DFVC 4HWNA 2CXKA 2DTML 3KPNB 5F3HA 3ARYA 2NR6C 2FCBA 3LKRA 4U2ZA 3ZKSD 5IW1A 3PNWA 4M6OH 1MAML 1D9KC 5KSAB 3HC4L 3CSBA 3QEUA 5C0IB 4QOKE 3ARUA 3GMRB 5HBBA 4U1IA 3IKCB 4AEIH 4K3EH 4KJPD 3UP1A 3VFMA 3ARQA 5GIRB 1TZGL 3OAUL 3VXMD 2VWEC 1MCOL 1J18A 4KK9C 1U91B 5LQBL 1F4WH 3BX7C 3SKJH 2VLMD 4XZUA 5D7LD 3CFEA 3ZO0A 3CZFA 3BN3B 2V2TA 1FE8L 3DTXA 3KPPB 1X5YA 3RA7H 4M93C 5LCVH 2XZAH 3RJQB 4JFXA 1BAFH 2XWTA 2BSSA 4YHMH 4HCRA 1OTUC 1LNUB 1WFTA 35C8L 4KJQC 2WUBH 4PY7B 1FN4B 4WV1C 1PKOA 1EBAA 1RUMH 3CAFA 3VXUA 3X13B 2DLFL 2ITCA 2VR4A 3H0TA 4L4TA 4OGAD 4RQQA 4P2OB 1FCCA 2EYRB 4QYOB 3GSVA 2MHAB 3D85D 4X6CE 4OT1L 3RBSA 1FZMA 1ZHKB 3ULVH 2BNRB 2DWDB 4OLUH 5BVPH 5M95B 3ME0A 4UIMB 4WTZG 3U48A 1ROWA 2VXUH 4QGYA 1B0WA 1CT8B 4HKXB 4UOW1 3JUYA 1D9KA 3S96A 2V5SA 1DCLA 2XRAL 1GCFA 4KGJA 3NPZB 4MZ3A 1AO7A 1HZHH 2J1KA 1U8PA 2W91A 4L5FL 1AKJB 5DMGC 4EKXA 1LO0L 1D5ZB 1LILA 4IS6B 3TBSB 1U0QA 3KDMB 3QDGE 2C3WA 3ZDYF 3QB7C 5FYLL 3GMMA 4RMSA 1UM4L 5HY9B 1KCUH 4JM2D 3GIZH 3GM0A 2PYFB 2XICA 3D69B 1G7PB 2FGWL 4JLRA 3OV6A 3FHQA 5C08B 2L7JA 1ONQB 1WBYA 5FGSA 1B0RB 3DSFH 1RZKC 1JWSB 3QCVH 4KGLA 1OM3H 3MBEB 2OMNA 5C0RH 1ZWIB 2HWZH 2UZIL 2A73B 5DJ0B 1G0DA 3TO4D 3ZKMD 3CFBB 3EDFA 2X1OA 2LE9A 4MD5B 4G6FD 3DI2B 3K7UA 3W2DL 1AR2A 1IGYA 3NN8A 1ZGLB 1VEPA 3ECBA 4G7VL 5E9DD 3VXNB 2X4RB 3UYRL 2BNRE 2UYLB 4JDVA 4Q0XL 3DO7A 4XRCB 5DD1H 3TGXA 1DVFB 3KXFA 3VD9A 5HJ3B 4UTAL 1F4HA 5H37G 4OZFH 5F9WB 4XPBL 1DEEB 5D70L 4M7LT 3QUZA 2FB4H 4YZFF 3IVKB 5IWLA 2P5WB 5EWIH 1RFDL 3D39A 1XEDA 2BRRH 1KIRA 2P5ED 3FN0L 5H94A 2ZOKB 5JNYA 4FFWD 4I0PD 1N4XH 1QA9A 1CFSA 4UTBH 2B1AH 3KYOA 4LSRL 3WYRA 3FHAA 5I1KH 3QWQB 1WBXA 1JGVL 5CS7A 3GEWB 1CI5A 1B2WL 5T1LA 5KVFL 4LLUB 5FUZL 1HH9B 4PJIF 4LCWA 4FZ8L 1PDKA 4I77H 2DQFA 5GRVK 1T6WA 2ESVD 3M07A 4KK5C 4OCXL 3BDBA 1KXQE 1LD9B 1S7TB 1I1FB 2XTJE 4OF8A 2PF6A 1BIIB 4MZ2A 4PJHE 4PB9L 3O81A 5IB4A 3OKOA 2CDGA 4NZRH 3UTSA 4C56A 3HKFA 4GS7C 2HT2D 3T2NH 2VLJD 1J1PL 1AQKH 3GMOA 3EYSH 3TVMC 5MEOA 5B4MD 1P84J 1F02I 2G60L 4R26H 5FHBL 2CR3A 4X6DA 2DKMA 3BE1H 3C2AH 3TN0D 3IDUA 2R2EB 1GIGH 4IDJL 3BW9A 2FO4B 2RAMA 3PWVB 1BQHA 3LKSA 4MA8L 4JG0L 5EORH 4HS8L 4WFHD 1XCQB 1J8HE 5E8DH 3MUZ1 3DETD 4JDTH 2P24B 1SHMA 3HPLA 4OKDA 4XMKL 3IDMB 3U0WL 3DYOA 3EJYD 2HT4C 3IFNL 4NZUH 2VXVL 4HMCA 1PG7H 1QTYT 3FQWA 5EU7C 1MI5B 3TZVD 3VXRD 2VDML 3TV3H 4GMSH 4XP1H 2H2PD 1XF2B 2GTZA 1R3LB 1A7QL 3C08H 2FLRT 1TQCC 3TESA 4OZGF 2I9LA 4GUPB 2NY6B 3MXVL 5IROC 4YHLH 1F13A 3ULUH 4PGBB 3HFML 3GSUB 3PL6C 2Y72A 2DYPD 3FB6B 4M6NL 3R06A 4MB3A 3RJDA 3FT3A 2IH1B 3L3KB 4HLZG 4XTRD 5SV4A 2JJTA 2SEBA 3ALXA 4YHIA 1DBBH 2GUOB 3TVMA 3ZZ1A 2MKWA 1EFXB 3QDJE 3QIBC 2D9CA 1HEZA 3ULSA 2EYSB 4ZO9A 4I2XB 4WW2B 4GG6A 1D3CA 3B5GA 4YXKL 2IQ9H 3W39A 4NUJB 4G6AD 1QSZA 1T89A 4P2RD 2ED7A 1F4XL 4NNPH 5T3XH 3C5JA 1W2KT 4DK3A 5GZOD 5FXCH 2ZKHL 2DQJL 2H32B 5F3BB 3BGFB 4S1SL 1EIBA 4ONHA 5EIIA 5C07D 1N8ZB 2NTFB 4GO6B 4FTVD 2H9GB 1CLYH 5HHXH 1A7PH 4PJFA 5DDHB 4OCRL 4EXPX 3VD4A 3GFUA 1M6OB 4W4OC 4Z18A 3EJZC 4NQCA 4OLWL 5L2KD 1Q94A 1MI5E 4KDTC 4YLQT 3GJFH 1EEZB 2MQ0A 4MJIE 4TYUA 1AGCA 4IJ3B 2NY3B 1IEHA 1U95A 4M6ML 1QRNE 5DRNA 4LVNC 3VWJC 3KG5A 3NAAH 1HINL 3EFDL 1VSCA 4DZ8B 2GKIA 2CXGA 2PTUA 2V2WA 3QHTC 4JZNB 1ZVYA 4ZYKA 2W0FA 4YBQC 3D18B 1A7NH 4XVSH 1YN7B 3QAZB 5EU6E 3KPMB 4NWUL 4GRLA 4U1HA 3LEVL 3TBYB 1FVCB 1OCWH 4Y2DC 3FRPG 4BZ1H 4LLMA 4OZFA 5IQ9B 1S7RA 4WGVB 1FH5H 4ORGA 5F3HB 1G9MC 3ZLQC 3LKRB 4OZGB 4NHCL 5IOPA 1JIBA 3PNWB 1NDMB 1EFQA 1ZA6A 3QEUB 3GIVB 4U6HB 4YEFA 4JRXD 5BW7A 3MR9B 1MQKL 3QZWA 4ODUA 4U1IB 4HAGA 1CXLA 4C55A 1E6JH 4MB5A 5IBTL 4RZCA 1N26A 3BPLC 3W11D 2P7TB 3T8XA 4QRSB 3F58H 5IVXA 3DUUA 4OF6A 3TO2A 3BWAA 2OLDA 4U4BA 2DQGL 4LRNL 5FHAL 4L9DA 4XZUB 3B9KB 4Y4HC 4O4YH 5F7KC 1ZT4A 1JHLH 3GO1L 1OQOA 3CFEB 4ZPVA 1TPXC 2APFA 3SGDH 2V2TB 3DTXB 1RV6X 1V3LA 4L29A 4JFXB 4O58L 2XWTB 1NGZB 4KRNA 2BSSB 2FX8H 4M3JA 1Q0YL 4ZOAA 4XC3L 3RY6C 3IRZA 1ZAGA 2C3GA 4P57B 5JMRA 1CLZH 3VXUB 5LGKA 2ITCB 1S7UA 1QD0A 4LGRB 6FABL 3H0TB 3NH7H 1JPFA 4YQXL 3CFIC 4UIKH 3GSVB 3FO1A 3ROLA 4MAYC 3HG1B 3GJEB 4FQJH 5CBAA 4PJEF 5DVMA 1FZMB 1AR1C 1MCQA 2LV4A 3SDAC 5D6DC 5J6GA 5C3LD 5JQ6H 5D1ZD 1OTTC 1JWUB 5FM8A 2VXTL 5LGHL 3E6HA 1T0PB 3S96B 5J4MA 4DQOH 1OSZA 2NW2A 5SWZA 4KKNA 3SO5A 1U8PB 4K94L 3RGVC 1JRHI 3UEZA 25C8L 4NN5C 5DF0A 4UDUA 3GMMB 4HH9B 3FTGA 3K8LA 4OJFH 1UB5A 5BRZD 1NGPL 2HAZA 1ZA3A 4JLRB 3TPUB 1R3KA 4Q74A 2V5MA 5C86A 3ET9F 4HFUH 3MRGA 1WBYB 4KQ3H 4JRYD 5E2TH 2AXJA 1CGYA 1T66D 4OGYH 5E4IA 5T5NG 1RVFL 3CC5A 4OCYL 3V6BR 2QQQA 4HF5H 4J4PA 4X6DF 4XMLL 4L4TE 1SJVA 2B5IB 4YDJA 3T0ED 3BKCL 3OXSA 1T21A 3PHOA 3FJTA 1IGYB 3NN8B 3KS0J 3VWKA 2MFNA 2J5LB 3ECBB 4K9EH 3WIHL 4NO3A 2R0KL 4FZEL 2EO1A 4JDVB 4ZFOA 1F58L 3DO7B 3AB0B 3SDAA 1QLRB 3KXFB 3RWJA 1QBBA 3LQAC 2IAMC 2ZPKH 2HJFA 2ICWA 3WKNA 1CU4L 5L7XL 2ITDA 4F7MA 3QUZB 2AEQL 2BFVH 1AO7E 4OIIL 1P4BL 5I0ZA 5CEZL 3D39B 4BK4A 1KIRB 3RUGF 5H94B 4G7YL 4PP1C 4P3CL 3UXFA 4GBXD 1JPSL 2X44D 2VWEE 4B50A 1XF5A 2PKDA 2VRAA 3CDFA 4R2GC 1QA9B 3PDGA 1FFNA 5E1AA 3KYOB 5BMFL 3VFVA 2FEDC 3WFCL 1WBXB 5CJXC 2KUTA 5I1LA 5T1LB 1NCBL 2A6KA 1OAUH 1E27A 5AWNH 3IS0X 3ULVF 2DQFB 5IVZB 5A16A 4I4WA 1KXVC 3HE6B 3PUCA 3RWFA 2DBLL 4LSVL 5EUOA 2N56A 2GJ6A 2VLKA 4EUPH 3SO3B 2K7PA 2BHUA 3FOMA 4ZTOL 4KI5D 3OKOB 3UTSB 4C56B 2F19H 3SHSA 4WEBL 3PJSA 1U8KA 4OFIA 1NC4B 4X9GA 1NLBH 1BFOA 1AGDB 5MEOB 4RBPH 5DRWA 4JPVL 4XAWH 3I6GA 3S88L 1IC7H 2PTTA 4M03A 1AI1H 4X6DB 5D7SL 3O4LD 4XBPA 5F1SA 4I9WE 3BW9B 5MERA 4N5ED 2ZSWB 4WU5B 4ZUTB 5GS0L 4LKXA 5EZOL 1DFBH 4G6JH 2NY4B 1BQHB 3LKSB 5HPMA 3QQ9C 3MLSL 1ZLUH 1FYTD 1RZFL 3AM8C 3QQNA 4NCDA 4YFLF 3HPLB 3IJSA 1INDH 4G42A 3G08A 4RFNC 3S4SA 4YFDB 5CJXA 4LCWE 1U6AL 1A1NA 1UZ6E 2CDFA 4WU7B 3V0VA 2VZTA 1U8MA 4UT6L 3ARXA 2JJVA 3EOYG 4F2MA 2GTZB 1BP3B 3N1QC 1QNZL 5DUBA 3ZL4H 3HN3A 3GJFK 5IB1B 1YNKH 4WJ5A 2I9LB 4OBSA 5DA4A 4Z77A 4EI5D 3PHQA 3QHZH 1CXEA 1BJ8A 3L7FA 3R06B 5TGBA 3FT3B 2XOTA 2NY5H 5KBNC 1IGMH 4JZOA 1WCQA 3U30B 3MOBH 1HEZB 3ULSB 5EBMB 4GG6B 3WNKA 4JANB 2ZCKL 3W39B 1NSNH 2V2XA 3RX7A 2OR9H 4OGXH 5KAQG 2DLIA 4TSCL 3P9MA 4PJBF 3C60C 1N0XH 1Q1JH 1I1YA 3C5JB 3L1OH 2Q8BH 5AYUH 5EIIB 3RWHA 1DN2A 2Q1EA 1FRGL 1IGJA 1SQ2N 5MI0B 1NANH 4PJFB 3O8XC 4QWWD 2FIKA 3FQRA 1PJ9A 1L7IH 4NQCB 3JWOH 1C7SA 1Q94B 4Z7UF 1J88A 1GRWA 4CRPA 1E4KC 1AGCB 4K8RD 1S78C 1CR9H 3PDDA 3VFOA 4MA3A 3UPAA 4JQVC 1U95B 5DRNB 2E6PA 2BOCA 1WCBA 1MH5A 2ATKA 1IZJA 2JELH 2V2WB 3HHRB 3QXDB 3WO3B 1I9JH 2HKFH 3NGBB 4YC2B 3RU8H 4ZYKB 2W0FB 1I9IL 5ITFA 5I76B 2PYEA 5DMJB 4PRNA 3MPCA 5CSGA 5F7NC 3RWCA 1JTTA 4GRLB 4U1HB 4ZS7H 5EOQL 3KJ4B 5TQ0H 2OTWA 5HHOD 4B53A 1IILE 4KXZH 5DMKA 1RZ8A 1MJ8H 3ABZA 4LLMB 4OZFB 4L8SC 1S7RB 4MA7L 4ORGB 3QRFM 2OL3H 4N8VG 4QLRA 4WFGD 5HGAA 5JZ7C 1ZA6B 2NPLX 4NQDD 4M1DL 4G5ZL 3JTTA 3QZWB 4ODUB 5DVOA 1T80A 4Q9QH 4M5YH 5F21B 1IJ9A 5BS0D 3I3EA 4RZCB 3T8XB 3O3BA 2YKLH 5IVXB 3BWAB 3GMQA 1WICA 3ULUF 3O6LH 4JO2L 1ZT4B 3QDAA 3VGBA 4UBDC 4XI5D 5EU7E 1GGIH 4PJBB 4XNUH 1NFDF 4WHYH 1H3PL 4L29B 5E6ZA 2R0ZL 2YRZA 3SE8H 5C0AA 3MV7D 4J1UA 4JQVA 3DURA 1N64H 5ERWA 4EUPA 4ODBD 1QSFA 2R8SL 4LOUD 5AZ2H 2GSGB 1MF2L 5KTEL 2NZ9C 2Z93A 5EH1A 1S7UB 8CGTA 5CLTA 3W9EA 1RK0A 2RCSH 1LWRA 3QO1A 1JPFB 5K59E 3FO1B 3LN5B 1VENA 1J87A 3QFJD 4NCC1 5CBAB 2EXYD 1NMBL 2OJZH 2ADFL 2FH6A 1MHPL 5IESH 4ZFFA 5J6GB 3WFBH 4Y8DC 6CGTA 5DMYA 4HUVA 4XNMA 1I7ZA 3BSZL 1NFIA 4DCQA 5H35A 3E6HB 3WS6A 3LHPH 4X83A 4LAQL 2BX5A 3VI3E 4XGZA 3BVNA 1B9ZA 4MLIA 2HVKA 1OSZB 4PREA 3H9YA 2NW2B 1YQ2A 2R69L 2ICES 1D7FA 1IAMA 2QL1A 2UWEF 2NY2C 5IVXE 1KN4L 5C0BD 5FGCB 4UDUB 4NBZB 1O7SA 1OSPH 3FTGB 4X0KB 1UB5B 1KJ2H 2CKBH 4IRJC 1ZA3B 2IF7A 4PLKD 3UMTA 3QNXA 1EO8H 5C3TA 4AM0B 3O6MH 3LQMA 4R8WL 1PSKH 5CKAA 1CGVA 3HPJB 3MRGB 4JY4A 4A2MA 4AY0A 3GHEL 5F7HA 1TJGH 3CC5B 1SMAA 1H0DB 1BOGA 2CK0L 5DEGB 4MNGE 4XP4L 5I1HL 4YDJB 2AABH 3OXSB 1AHWC 1T21B 3PHOB 2EEDA 2YBRA 1UA6H 2WAHA 5CGTA 1HQ4A 3VWKB 43CAA 1CFQB 1L7TL 5E2VL 2IANA 5ACMA 1PGRB 4NO3B 1TQBC 3H3KA 2BVEA 4FXKA 4ZFOB 1R3JA 4JFED 3RWJB 5EO1B 2HJFB 2YPLD 2KL6A 1PKQA 2P43B 3OJ2C 2ITDB 4F7MB 1L4IA 5SWZE 4HIJB 4RBPK 4UILH 1ETZA 4OZHA 3TPKA 3QT2A 2VLRD 3H9SE 3CDGA 5FGCE 1OAQL 3AS2A 1XF5B 5E1AB 1UWGL 3SCMD 43C9A 2GHWB 5DUPL 3R4DA 2DQUH 3VFVB 1WAAE 4MQSB 4LEXH 1BQLH 3ZT6A 3GJFB 3LKOA 3PABA 3RVUD 4HPOL 3HA0A 1I8LC 5I1LB 3EO9L 2VJXA 2ATPA 1ZLUK 2A6KB 1E27B 3BP4A 5A16B 2VDRL 4I4WB 3JBG7 3K1KC 1YEFL 3HRPA 1T2QH 4P2QA 3RWFB 3OGCB 4S11A 4OZIF 3PP4H 4EQ2A 1I1AD 5HGGS 4BFIA 2GJ6B 3MUGA 5EBLA 1MREH 3DX9A 1WWBX 5SX5H 5AD0A 3FOMB 4H1LG 3S36H 1AHWA 3NCBB 1X6NA 5F97E 2OP4H 1FJ1A 5C70A 3PJSB 1U8KB 5AYQA 4JR9L 5SWSA 4X7SL 1BFOB 1G6RL 4JFPB 3CFCH 3D5OF 4NP4H 2FX7H 4ODVH 2VXQH 3ZDXF 3I6GB 2OL3A 2PTTB 1SY6H 1P6FA 1I9RL 3MO1A 5DD0L 2CRIA 4XBPB 5EG6C 2VISA 1CL7L 4L3AA 4LKXB 5DI8A 3L5IA 2XQBH 5HPMB 5I6XC 4U1NA 2EEAA 1RUPH 1JNNL 2Y25A 3BPCA 2AJYL 1TDQA 4I3SH 1X7QA 5EDXA 3IJSB 4G42B 3G08B 5EIVA 3V6OA 3FB7B 1WFUA 5I73C 3S4SB 3WSQL 3LY6A 3VXMA 3I6LE 1I8LA 1IQWH 3BZFB 3C9NA 2HRPL 3FOLA 2DQDH 3WO4C 2QLVB 2CDFB 3H3BC 4XNQA 3V0VB 1QSEA 3MRHA 1U8MB 3GSQB 5DQ9B 5D7LA 4UAOC 4XCFH 1MFDL 4DEPB 4F2MB 3QNYA 1F6FB 3NACL 5EUOE 2GJ6E 2VLKE 3QUKB 2X4PB 1FV1B 3HC0A 4Z7OF 5DUBB 4WCYH 3HCVA 3MGTB 1I7TA 1TETH 2C3HA 1U8HA 2ZUTA 4HX1A 2BP3A 3PHQB 4R7DB 4LPWA 4N68A 3L7FB 3TO4C 3ZKMC 1Z3GL 5TGBB 5F88A 2YA1A 3PWUA 4JZOB 3UPCA 5D7IF 4U1GC 3V5KA 1S5IL 4HUNB 4Y19D 4LPVA 3CLEH 1NGYA 3KPLB 5E6ID 5DYOA 5B22A 5CMAA 2OR8A 3P9MB 4YR6A 4OLYL 3G5YA 1Z9MA 1I1YB 4WUUA 1OB1A 4KVCL 4EIZC 5DSCA 3RWHB 3DI3B 5KVDL 2PR4L 1SBSL 1T83A 1IGJB 1KJ2A 3MLXL 3DGGA 2CKBA 4D8PB 2EKJA 2R29H 1BD2A 4I0PC 4YHOL 3KPRA 1OW0A 3FQRB 2HKHH 4YHZH 3H3PL 3VGGA 1KGCE 2AEPL 3RIAK 1T20A 4KRMB 4JM2A 3ZTNL 1S3KL 5DA0B 3VFOB 3QUXA 1RHFA 5CJ5A 4NPYA 2BOCB 4N0UA 1MH5B 4S2SA 4ZXBD 3VFSB 1UQSA 3CDCA 2ATKB 4FXLA 1GOFA 5CKGA 2DL9A 1KYOK 5LG1A 4OFKA 3KJ6H 1HH6A 2CLRA 5ITFB 4AYFA 2QQKH 4OM1L 2PYEB 1UACL 4JN1H 4PRNB 5GS0D 1C8PA 2IFFH 1OP3K 1TZHA 2OTWB 1F3RB 3LEXA 3OKKA 4MB4A 2HT2C 5ISZD 5DMKB 5A40E 2R2CA 1RZ8B 2RR3A 4LCCC 3KPSE 4JO1H 1JNHA 4RWYL 5FF6B 3PDOA 3X3GH 5B4MC 5HGAB 1E6OH 2EECA 5T3ZE 4MNQD 1EHLH 5I1JH 3TN0C 3MRJA 5JW4M 2JCCA 4WHTB 3BUYA 5E08L 3TNNA 3ZDZE 1LDSA 2ZJSH 1PQZA 3O3BB 3GMQB 1AGEA 3ZE0F 1YEJH 1Q9WA 1ZLSL 2J4WL 4N0YL 3BZDA 5GGTH 1H5BC 2G9HB 5DJDA 3SDCA 1V3MA 4LQ1A 3DETC 3P4LA 2ADIB 4UDTA 2P4AB 1DE4A 2Z92A 4HLZH 3WLBA 2QADB 1P7QD 3EJYC 3NA9L 1MFAL 3NFPA 4WTZA 5C0AB 4J1UB 3D2UA 3DURB 3MRRB 5ERWB 4RAVA 4EUPB 4AK1A 8FABA 3TZVC 4TOYH 4O5LL 3NIGF 1QSFB 4J6RL 4JRWA 1ZLWH 1MHCA 2ED8A 5DJYB 2H2PC 3VRLF 2PYEE 2Z93B 4H26A 5C6TL 3AMLA 1SJEA 2EE2A 3W9EB 1H3WM 1PX4A 1A6VL 3QO1B 4R97B 4PLNC 4JREC 5KVEH 2YD9A 5ESVA 3DO3A 1MJUH 4LIQH 1H8NA 1SY6A 1GOHA 4LPUA 4N8CH 4XTRC 4XNMB 3Q5YA 1I7ZB 4HUVB 1DR9A 2MJWA 4G8EA 4O02L 3E6FB 4DCQB 3BZEB 4K2UL 2OK0H 5H35B 4LDLB 1S7SB 4NQTA 4XGZB 3BVNB 4PREB 4IRZH 4KY1H 1JNJA 5F7MC 5EOCH 4G6AC 3BH8A 5C0EA 2WIMA 1N6UA 4LSTL 4PFEA 5H2BA 5D96C 2AAVA 2H1PL 5I0DA 5GZOC 2WUCH 3MLRH 1MJJA 3WJJC 2X09A 2D9QB 3VFRA 4O2FB 4BQ9A 3O6KH 1CDHA 1QSFE 4LCIH 5GRUL 1WZKA 4HQQL 4KZDH 2E7CA 2Y36H 3JV0A 4CU6A 4M62L 3P0YL 4NO0D 4CU8A 3ZKXB 2NNAB 3L3GB 4KRPD 4LVHB 2AJXL 3TH4T 2YBRB 4KPHL 3RIAF 43CAB 1GC1H 4ELMF 5C2BL 3GI8L 1UJ3C 1B6UA 4JPKL 2IANB 3KPOA 4AG4L 2DBJA 5DK2A 2DQEL 4AEEA 5C0FA 2C1OA 2DTMH 5IMOA 5SX5K 1R3JB 4HMEA 1CE1L 1FL5B 4RGMC 4ZDHA 3BEVA 1MAMH 4Z0BH 1PKQB 1DL7H 1HK6A 2PW1A 1MCHA 1NH6A 2A83A 1SEBA 1ETZB 1PFCA 4WFFD 4JAMA 2GJJA 3OGOE 3OAUH 4RX4D 1FFOA 5MHSD 1MCOH 4NZDA 4Y16D 3MUY1 43C9B 4WWID 1T2JA 4UT7L 4DKDC 3LKOB 4GXUM 2P8LA 5DRXB 5C07A 2EH8L 3PABB 3RHWK 4RDQG 2ZNXA 2EC9U 3IDIA 2Q3ZA 1UKTA 2ATPB 4HGKC 2XN9E 1F4YH 3BP4B 4FQ2L 35C8H 3CK0H 1KNOA 1LDPL 5I30L 5CGYD 1BPVA 2J2ZA 4P2QB 1JGLH 5F7UA 3LKQA 4BFIB 3MUGB 3UBXG 1FFPA 5EBLB 5FYKL 1LEIA 3DX9B 5MEPB 1NCNA 5AD0B 3BH9B 4QRRD 1G0YR 1ND0A 4U7KA 4ETQA 1FJ1B 1QBAA 3QJFA 4NN6C 4YDIL 2OX5A 5SWSB 3OL2A 3L3OA 1UJ3A 2QEJA 3BKJL 2Z8SA 4BFGA 3KLSA 1F6AA 5L8JB 1KEGL 3MFFA 4YE4L 4IEFB 1WJ3A 2OL3B 3QXTA 4JPIA 1PKQE 2EDDA 3FZUD 4PY8I 1D6VH 4D2NA 3MO1B 4XP5L 4XVUD 2XRAH 4IOSD 3ROOA 4OZHE 2VISB 1A64A 4LDEB 2J8UA 4O2CA 4DK6A 5D1ZC 4L5FH 3FT2A 5DI8B 3BQUD 3JVGC 2IPKA 2BVUA 4ELMB 2MTPA 4U1NB 2YD1A 4NFBA 5FYLH 3VU2A 3HI5H 4OCWH 3TLRA 4Y89A 4G8GE 4JRXA 1X7QB 2FGWH 2Q6WA 5FM5O 4IMKA 1GPOL 4OUUA 3GGWA 2FEEL 2ZG2A 5D8JL 3C9NB 3FOLB 1LO2L 4TPRL 5CP3A 4XNQB 1QSEB 3MRHB 1CDIA 1CXIA 5D7LB 1YMMB 2MSPA 3T3PE 2J88L 2UZIH 3DXAE 1QLFA 3C09C 3ARFB 3HC0B 3TC9A 4FFZL 5IVOA 3HCVB 3W2DH 1T66C 1I7TB 5MEQA 4GRWE 4XPAL 1U8HB 4HX1B 2HFTA 3V4UL 2VAJA 3HE7C 1WT5A 4G7VH 4NO5A 3QWRA 1DBAL 5E6YA 3BDXA 3B6SA 5C0CD 5F88B 4YHKL 1PEWA 3PWUB 4I8DA 2VZOA 4QHLA 3FN9A 3V5KB 1NCAL 1SEQL 4UTAH 1MWAL 4Q6YA 5GSRA 4XPBH 1U3YA 5FIEA 4NQEA 3FN3A 3BD4A 5FFLA 2VDOL 2VE6A 5CMAB 1RFDH 1CGSL 3FN0H 5D1ZA 3GBML 1IVLA 5A2FA 4YR6B 3G5YB 4WUUB 1FIEA 1OB1B 1BJMA 3RTQB 3REVA 4HIHB 1JGUH 4DVBA 2F53D 2EDKA 3SQOL 5ANMA 4LSRH 2B20A 1VADA 4X5WA 1KJ2B 2HFEA 3VXTA 3DGGB 2CKBB 2C4FU 1CVRA 1BD2B 4NZJA 3KPRB 3VXME 4CN6A 3ARDD 3HZYA 1FNFA 4PJ7F 1T20B 1QSEE 2BNQD 2VLME 5I16B 2I60L 4JM2B 5D7LE 3FRPA 2F54D 4JFHD 4YWGH 1J12A 4Y5YA 2YEZA 3QUXB 4OCXH 1G9NC 4KAQL 3U2SA 1CICA 4N0UB 4ZFGL 1EMTH 4P5MA 1UQSB 4PB9H 1I3GH 1P4IL 3RRQA 1HH6B 4KHTL 1J1PH 1MPAL 2CLRB 3EO1A 3ZE2E 3RHWF 4RIRA 4PJCE 4GMTL 1BZ9A 1RK1A 4KI5C 1HOCA 3T0EA 4HWBL 5JHLL 1P53A 1TZHB 4OLEA 3ILPB 3LEXB 5FHBH 1ZLWK 5DHVH 3PGCB 4Q9BA 4WRLA 1JNHB 3RPIA 3O2WH 4C59B 3I2CH 2QKIA 5BV7L 2VLLA 4IDJH 3PDOB 1R6VA 2N7BA 4WUUE 3P0GB 1JE6A 4JG0H 4HS8H 3RVXD 3MJGX 3T09A 3MRJB 4M1CC 2JCCB 3OG6B 1X3DA 5IBUB 1G7HA 4N5EC 3TNNB 4RMTA 3LH2H 1PQZB 4XMKH 3U0WH 1U8QA 2VITB 4AL8H 4CW1A 2UUDH 4NFCA 2FBOJ 1AGEB 4NNXA 1OLLA 1Q9WB 4NNYB 4GBXA 2BC4B 2PCPA 4H25A 5DJDB 3SDCB 5E0QA 2VDMH 3KYMA 1DE4B 4HC1H 2Z92B 3FRUA 4ZS6C 2QR0A 1CD9B 3NFPB 1Z9LA 2P46B 3D2UB 3WKML 1A7QH 4RAVB 1HKLL 2H26A 3UO1H 3MXVH 5JORB 3TH2T 1FYHB 1MHCB 3FONA 5GRJL 3ARRA 4H26B 1SJEB 3LD8B 1P1ZA 5FDWA 3IJHA 4PJ7B 4ZQKA 2DDQL 4WGWB 3QUML 4MDJB 5DEZA 5ESVB 2HMID 1JTOA 4F15C 3F8UB 3WDIA 4EI5C 2NY1D 3NABL 1F2XK 3QUYD 4YXKH 5E9DE 3TA3D 3UBXI 3CX5K 4LCYB 5IB2A 1MCSA 4G8EB 5F9OL 1MUJA 2NXZB 3QIWD 2HLFD 5I19H 4LFHG 1LE5B 1A9BA 5D1XA 3SDDD 4Y4FD 1CLCA 2JCCE 3ZKQD 2DQJH 2KBGA 3A6CL 5HHNB 3O4LA 3RI5K 3P4OA 5F6HJ 4ZTPL 4RNRB 3EDKA 1AJ7L 5D7KE 3WLWD 4X80L 5JOEA 1IGIL 1I1RA 4KC3B 1MJJB 1S9VA 4JHZA 1FYTA 2YD7A 2B0SL 2EDRA 3VXSB 4P5TD 4QWWC 3VFRB 1H8SA 3QCUL 4YGVA 3VDCA 1QG3A 1YYLL 5FYJD 3SJVB 4ALAH 1HINH 3SBWA 2E6JA 4K8RC 5GSVA 2BMKA 1XR8A 2W65A 3EOAA 4FN0A 3RY4A 1U3HD 1YEGH 2ESVE 3U0TA 4JGUA 4OFYA 3MNVA 2Q87A 1Z2KA 1CL7I 3LMJH 1Z0NA 1CF8H 4FMFA 1L6ZA 2WIIA 4U7SA 5ALCL 5KSAD 1N3NA 1HHHB 5C0FB 1QFUL 3KPOB 4EI5A 5DK2B 2VLJE 3EHBD 2C1OB 1JPTL 3O2DH 3WS3A 4DFHA 1IAOA 5IMOB 5F89A 4ZDHB 3BEVB 4IIQB 1OT1A 1NCTA 3P11L 1YJDL 3QEHA 3R0MA 2F9BT 3WUZA 2PW1B 1MQKH 2A83B 5DURB 5F9JB 4K55A 3AY4C 2HP4A 2IQAA 2OTUA 2ZCLH 4JAMB 3BJLA 1AY1L 2YA2A 4JFDA 4QXUH 4YGAB 1FFOB 1H15B 4ORZC 1UM6L 2DQGH 4LRNH 4WFHE 1JFQH 3V7AG 2WWMD 2YWYA 5ESAA 3U1SL 4RCAA 4KKCD 5JDSB 1KTRL 2P8LB 1JGEA 1JUFA 3IDIB 1RULH 2OSLA 4HIXL 1ZSDA 3IDNB 1ZMYA 4O58H 4FQIH 3LDBB 2XWJB 5I74C 3O6FA 3UAJC 5DZNA 4XI5C 4P2OD 4YO0B 1EJOL 3LS4H 3LKQB 2XIDA 5J8OA 3GDBA 1FFPB 3L3IA 3K46A 6FABH 1LEIB 5I17A 1YECH 3NVQA 4WTWA 4ZAKC 1A5FL 3MC0A 1ND0B 4ETQB 3CPLA 4LOUC 4F33A 3IJYA 2W59A 3G9VA 4XNZB 5HSFA 3N9GL 3L3OB 1INEH 1XFPA 4JZJA 1WWAX 1ZHNA 1AKJD 4LBEA 4JPIB 2VXTH 2FSEA 5KSUA 4M6OL 3DJ9A 1PY9A 3U7WL 2EXYC 1IZKA 2QQNL 4M1GL 3ROOB 3T0VA 1U3JA 2J8UB 4O2CB 4K94H 4QRPA 3SGEH 3PP3H 3FT2B 5MP6L 1BIHA 2IPKB 1FNEA 4P2RE 2AK4A 5C08D 2BNUA 1C08B 1QYGH 3L3HA 2IADA 4JRXB 4BQ6A 1F4WL 1NGPH 2Q6WB 1UCBL 4NM8L 5C07E 5KN5A 3MBED 4FTVE 4OUUB 3GGWB 2X4TA 4L9LC 1VGKA 4IHOA 4OD3H 3BZ4A 1BAFL 2MWCA 1KEML 1RVFH 2Z9TA 3IXAB 4PLKC 3VDAA 1I1CA 4RAHA 4XH2A 3RI5F 5FGBA 4D0BA 1QLFB 3ZYOA 3IRPX 4FFVC 1RUML 3OMZA 2XPGA 3RAJL 1ORQA 4U33A 1DVFD 5MEQB 4PRPA 3L95B 2IPUK 5FM5M 4X4YA 4A6YL 1JPGA 1T1XB 1VDGA 4NO5B 3B6SB 3OPZL 2R0KH 4Z76B 4FZEH 2XG4A 1HQRA 2P5WD 1F58H 3V52H 3QJHA 4QHLB 5T33H 3GRWL 2VXUL 5GSRB 5GZND 1U8OA 5L7XH 3QFJA 2AEQH 4NQEB 4P3DA 2J8UE 3QHFL 1P4BH 5HI4C 2VE6B 5CEZH 2VQTA 4ODWB 1RIVH 1FPTH 1FAIH 2AW2A 3M17A 1VFBB 3MJ9L 4IM8A 4G7YH 4ZUSA 2VDNH 4P3CH 1IL1B 1JPSH 1JHKL 2OS7A 3REVB 5HYSA 4DVBB 1B0GA 4JRXE 2BOBA 5ANMB 5BMFH 1VADB 1KCUL 4X5WB 3B9AA 3GIZL 2HFEB 3WFCH 3TIEA 1WV7T 5C0DA 4ENED 2DOCA 3SCMC 4X9IA 3GZKA 5F7LB 1FVDA 3FMGH 2VXSH 4XCEA 4Y5YB 2YEZB 2UUDK 3DSFL 4LMQE 3U2SB 3BP7A 1CICB 2DBLH 1OM3L 5C0RL 4DN3H 3QDMB 2HWZL 4N8VA 4LSVH 3WD5L 2BVTA 4PG2A 4O00A 5ESQA 2GSIA 3CIQA 4ZTOH 3WFDL 3NFNA 4WEBH 3TBVA 3UTOA 3EO1B 1I1AC 4RIRB 5T5NF 3G5VA 4W6XB 3T77B 4Z7NF 4JPVH 5B8CA 4PRIB 1OVZA 3Q1SH 4YBLB 1RK1B 3T0EB 5BOZG 3S88H 3SOBL 5DD1L 5CHNA 4GQPH 5DRZB 5D7SH 3RPIB 2ZOLA 2VLLB 1XGPA 1KUMA 2MOVA 2KH2B 3I9GL 4M7LL 5EZOH 1VA9A 4LP4A 2BRRL 5HHQA 3IAGC 2YPLA 1IAIM 4FQLH 4JKKA 5ANME 1WISA 5K33A 4G6KL 1G7HB 4WHCA 1MI5D 1N4XL 1RZFH 2AXGA 4PGEA 1U8QB 3MRDA 3TBTA 4CW1B 4NNXB 1BVLB 1U6AH 4Z8FL 1Q9LA 4GBXB 2PCPB 4H25B 3VMNA 3THML 3SCMA 5BRZE 2OI9B 2QJDA 4I77L 3KYMB 2NY6D 3LN4B 3BISA 2QR0B 5JW4Q 1EAJA 5CLWA 3ZHDA 2GAZA 1AXTH 5JXEA 1A14L 4JRYE 5HVGB 3PWLA 4HZAA 4XCYA 4QY8A 3B2VL 4NZRL 3FONB 2X40A 3VGAC 2EDFA 1P1ZB 1WAAF 3IJHB 1AQKL 2V6HA 5KZCB 2VYRE 2RBLA 4ZQKB 5TJWK 5LAXA 3T0EE 1RJLB 2VOTA 4U6TA 1FNLA 3GKWL 4P23A 4PJ9A 3CH8A 2ZCKH 3BE1L 5IT2L 3C2AL 5IB2B 1MUJB 2K3TA 4AH2A 5BOPA 5CZVL 4ZO7A 1F3JB 2RB8A 5CCKL 1A9BB 5D1XB 1LEKA 4URTB 5EORL 5DVLA 1FRGH 3B43A 3P4OB 4EDXA 4JDTL 3K4DA 2NY3D 1S7XA 4LAJH 4I13B 4POUB 2W0KA 3MODL 2VZ3A 1CCZA 1ZV5A 4M43L 2GCYA 4NZUL 1S9VB 1FNSL 1U2CA 1T1ZA 5IP4A 3WE6A 4NJ9L 4GMSL 5I1AA 4YGVB 1JMXA 4MSWA 4I5BA 3GSXA 1EA9C 4RISL 2AV7A 5GSVB 2BMKB 1XR8B 2W65B 3BP6A 1HKFA 4H88L 3U0TB 2Y7QA 1I9IH 2R4SH 4YHLL 3ULUL 4ZXBC 2W38A 1Z6JT 3PWPA 3LRSA 5GQBA 3WIHA 1DQDL 4XX1G 1MEXL 4KV5E 1XT5A 2WIIB 4KI5E 3C8DA 4OBRA 1N3NB 2DL2A 3PQYA 4BZYA 2L4OA 1IAOB 4MA7H 1XGYH 4UINH 5F89B 4OCLC 2ZUQC 2IQ9L 4PYHA 5GS0C 3BPNC 2FEEI 3PXHA 4NQXA 4M1DH 4N8PA 3U9UA 2OJEA 4F8QA 4NNPL 1R3HA 3TYGL 4LRIA 1A21A 3B9KD 5E8OA 3MQIA 4M48L 4PTUA 2IQAB 2OTUB 3O4LE 5E6IA 1XF3A 3VH8A 4C57C 4JFDB 2FO1A 2J8OA 4TUJA 2EZ0D 3OBAA 5HHXL 4H1LA 5KAQF 3U83A 4D9RD 5E56A 4JO2H 5ECJE 1FYTE 5ESAB 3PP3K 2FHBA 5JW3H 5TDPA 3ELAT 2RFXA 4KQ4L 1JUFB 3GSOB 4WNQA 1H3PH 2X7LA 3VXUD 1ZSDB 3EOBA 5FAAA 2R0ZH 3TBWA 5LXGH 5D2LF 4KDVA 3O6FB 4ZOBA 1WTLA 1CDJA 3DBXA 3NAAL 2R8SH 3HG1D 2Y4SA 1MF2H 5IM7A 3L3IB 5I17B 3WJLA 3WN5C 5DJXA 1A7NL 2J8HA 3BDYL 4XVSL 4Y4KA 2DN7A 5A2JH 1P9MC 3CPLB 4F33B 2UZXB 4QTHA 5CILL 1CD0A 5DHVB 1NMBH 2ADFH 3G6JF 2X4SA 1MHPH 4JZJB 4BZ1L 2AI0H 1ZHNB 4Z7VA 3BSZH 4LBEB 3IDYC 2VDQL 4HWEL 4TUKH 3CXDL 2D7TH 2FSEB 5J3HD 5KSUB 3L9RA 4RGNB 5DC9B 4LL9A 3Q6FB 5ISZA 1CD1A 5JOFB 2R69H 4QRPB 4HKZA 1ITCA 4JFDE 5CEYA 4ODTL 5KOVC 2QV2A 1E6JL 1FNEB 1KN4H 2AK4B 4BSVA 5IV2B 3L3HB 3F58L 2IADB 4LK4A 3CUPA 1IC1A 2AJ3A 1JHLL 5KN5B 5BZDA 4OIBA 3MRCA 1MSPA 3C6LA 2X4TB 4YAQA 1VGKB 4IHOB 3BZ4B 5D93B 4CGTA 3H7BA 3GHEH 3WL9A 4PPTA 4XH2B 4W81A 5F7EH 2A9ML 3N06B 4D0BB 4Z7QE 1HN1A 4Y5VA 2AS5M 1CLZL 2B4CC 1A1OB 4XP4H 5I1HH 2XPGB 4TVPD 1NMCC 2YPKB 3KXFD 4PRPB 5F1IB 1EHNA 4X4YB 3HC3L 4UIKL 3SKNA 1JPGB 5E2VH 3W0WB 3QUZD 4XHQA 1JHTA 2DRUA 1HQRB 1CK0L 3D39D 4KRPC 4I9WD 3V6FA 3QJHB 3CXHK 5JQ6L 1MHHA 3MRIB 4XP6L 1U8OB 5HHOE 3UTTA 2DF3A 3QFJB 4APQA 2LFGA 4QRPE 5I66A 1A3LH 4ESKA 2DQIL 4GT7A 3M17B 5T1KB 4ZUSB 4WFGE 1FC2D 2EC9T 5C0GA 5T1LD 4NQDE 5A3ID 5HYSB 1UWGH 2PXYB 1B0GB 5CD3A 2BOBB 5DUPH 3L5WB 1I85C 4ONOA 3UROR 3HE6D 5BS0E 3TIEB 5D5MF 3FFCA 5C0DB 5F1NA 3EO9H 4Y16C 1E4XI 4P5KA 4LP5A 4TQEL 4HFUL 5AG8A 2A6DB 3PGDA 4G80A 2VDRH 5E2TL 4XCEB 3DMMB 3UTSD 4C56D 1F11A 15C8L 1YEFH 4X8JA 4LSPH 2P8PA 3BP7B 4NZTL 1NC4D 4N8VB 1T5XA 1HHIA 2CLVB 3MV7E 2GSIB 5ALBH 1IE5A 5CGYC 1FCGA 4X99A 3O11A 1MCFA 2O26U 4X7SH 2ZUWA 4E42B 2KZWA 1G6RH 4ZODA 4LU5L 5DO2D 2NY4D 4PJ5B 3D0VA 3QFJE 3M1BB 5DD0H 3WFEL 2ZOLB 2BFVL 4Z7WE 2Z31A 3MLYL 4CN1A 3FZUC 1PY4A 4XVUC 1JNNH 2YPVL 3AREA 4H8WC 2AJYH 4K07A 1LVEA 2AXGB 4PGEB 5IQ7H 3BQUC 2DLGA 3MRDB 5F7FA 4WI3A 3J8F7 2DM4A 4OZFG 5DS8A 1GSMA 2NTSP 3WSQH 4HUKB 4RX4A 1OAXL 1Q9LB 2HG5A 3PV6A 2HRPH 3MA9L 4Y16A 3DHMA 5DLML 1OAUL 1MFDH 4K3DL 4UUJA 1GOGA 4AMKL 3NACH 5IF0A 2GAZB 1T1WA 3QEGL 4Q6IC 1IKNA 3ULVD 3PWLB 4XCYB 5D5MB 5HHMB 1BZQK 5GISL 3DRTA 1BQUA 2Y5TA 1NLBL 5LAXB 5EU4A 4WY7L 2APBA 3BKYH 1AIFA 2DMBA 4P23B 4PJ9B 3SGKA 1IC7L 1LO4L 4I1NB 2YD5A 5IJKC 5J13C 2BVPA 3T04D 4JFEE 2C4FT 4AH2B 5CEXA 2L0DA 1ERNA 2GT9A 3WV0A 4OLYH 2YPLE 3HS0A 4G6JL 4NQCD 3QH3A 3UTQA 2XNAA 3T0WA 5KVDH 1V3KA 1SBSH 1A6TA 4EDXB 4PUBL 1S7XB 4NFDA 4NQSA 2VLRE 4U0RB 2DLTA 5HHPA 3H3PH 1JI1A 4ACPA 2GCYB 3BT2H 4PIRF 1ZS8A 1T1ZB 1EZVY 1QHPA 3ZTNH 4G6MH 3WE6B 4HGWB 5CSZA 5I1AB 3HAEH 4EN3D 1W72H 4MSWB 3TJEL 3ARDC 5DHYB 5TE7H 4GRLD 2AV7B 2YUVA 4Z7VF 3BP6B 3ZL4L 1YMHB 3NIFF 1YNKL 4WEUD 2Y7QB 5HHME 1UC6A 2K7QA 4LSDA 1U41A 4OM1H 1DN0A 3QHZL 1KB9K 3OKYA 3LRSB 3PWPB 5FV2A 3GNML 3SDXE 3MBXL 1QLEH 1F97A 4I18A 2W0LA 1V5JA 2HRLA 4M8VA 4XWGH 2NY5L 4NGHL 2C7UA 3PQYB 2CDEB 1F3DH 2F8VA 1KYOJ 1P7KA 5HVHB 4KKBD 1UKQA 4OGXL 4NQXB 1A9EA 4X6BB 3H9ZA 3U9UB 1ZT1A 1N0XL 1R3HB 4OV5A 4GRWF 3L1OL 4PTUB 4YDVB 2BCKA 5AYUL 5E08H 1XF3B 3VH8B 1YNLL 2ZSVA 4OQTH 3UBXA 5E99L 3MRBA 2VZ1A 4TUJB 3RVXC 4H1LB 5CIPH 5GS1A 1ZLSH 4N0YH 1ZHBA 2F53A 3QA3A 3JWOL 5TDPB 2RFXB 2G5RA 4WNQB 3VCLA 2X7LB 3LRGA 3EOBB 3NA9H 1MFAH 3DBXB 2LVCA 4O5LH 4NRXA 2VR9A 1HWHB 2BNQA 2JELL 4HPYH 4KDWA 1BX2A 5C6TH 3PWPE 4DAGH 4MQ7A 1T1YA 3S36X 1U3ZA 1Z9SA 2E7HA 1R0AH 5DJXB 1G6RA 4Y4KB 1XGRB 4LHUG 1FO0L 4ZS7L 3PQYE 4QTHB 2X4SB 1CWVA 3U36A 2Y07H 3QQ3A 4Z7VB 1OHQA 4KVNH 4RFOL 4M5ZL 2HMIC 4O02H 4K2UH 2NY1C 1ZTXL 3QUYC 4Y19E 1UB6A 1CD1B 3KVQA 5DK3A 3TA3C 3GMLA 5EA0H 3CSGA 3LVEA 1CFNA 4HKZB 4Q9QL 5CEYB 3UJJL 5DHXB 3L7EA 3BPOC 4BSVB 3QIWC 2HLFC 4KKLD 4S1RH 2H1PH 4PJCF 2YKLL 3SDDC 4Y4FC 4IRSA 1G7JA 4CMHC 4KROB 1GHFL 4YFLI 1FNHA 1G9NH 3V5HA 5BZDB 3MRCB 1GGIL 4J4PD 1AC0A 1XF4A 3WLWC 3C6LB 3ULUD 4YAQB 1FNGA 3T2PA 1VEMA 5J12B 2X10A 3SE8L 4N0FB 3H7BB 3WL9B 1N64L 4CVZB 4Y2OA 4JHBA 3VWKD 4P99A 3MLTA 1REIA 1XH3A 4Y5VB 3P0YH 2PUQT 5AZ2L 2MQ3A 3S4SG 4KH2A 4MA1C 4KPHH 3VFWA 3LQZA 2JJUA 1U3HC 4HZLA 5F96H 5C2BH 2DI7A 4U2YA 4JPKH 2DQEH 5T3XD 1RJZA 1JHTB 5KOMC 1CE1H 5IESL 3V6FB 5D7JA 1CXHA 5F44A 4CJ1A 1MHHB 1MCNA 4EVNA 3UTTB 1YEDA 5F1OB 5ISZE 1E0OB 3EHBC 4APQB 3DV4A 4Z5RA 3BN9C 3QEQA 2V17L 4W4NA 3ZE1E 5L9DL 1F00I 4L1DA 3UTPE 1KTLA 3QIWA 5CD3B 1OSPL 4NKIL 5K9KB 4M7KL 3RZWA 1J05A 3OB8A 5AAMA 4F9PA 5F8QC 3FFCB 5F1NB 2E6QA 1C7TA 2WWMC 4HUXA 3UTZA 5GGQL 1PSKL 3PGDB 4G80B 3MGOA 4FQ2H 4R0LA 5EZLB 4CDHA 4KKCC 2D31A 1F11B 1LDPH 3NIDE 1NBYA 2EDHA 4KMQA 4X8JB 1CG9A 1TJGL 4JM4H 2VUYA 2P8PB 1JF1A 4OB5L 3DVGA 5KG9A 1T5XB 4P5TA 1HHIB 5L88L 2AABL 4P2OC 1H3XA 3DLQR 4WI2A 4XXCA 4X99B 1UA6L 1P69B 1U3HA 4R90L 3CCHB 3K2MC 1KCRL 4P3WA 1KEGH 4YE4H 3SEPA 4E0RA 3MFGB 3D0VB 3UTTE 4YX2L 5KSAA 4XP5H 5C0IA 4R3SA 4FNLL 4O9HH 1TITA 4LSUL 1L9NA 2HLAA 4UILL 4FQCL 4XVJH 3ZHKA 4MJ6B 2Z31B 5GIRA 5KSBE 1MHEA 3AREB 1CTNA 1U91A 4OM0L 5I1DA 4EXKA 4HMDA 1GPOH 2WQRA 2NZIA 3FFCE 5DS8B 5JPMA 4DOHE 2MCG1 2JLLA 1A6UL 4TUOB 3VMOA 5D8JH 1KJ3L 2HG5B 3PV6B 3MTRA 4K8RH 4P9HL 3S34H 1LO2H 4TPRH 2CSPA 3JV6A 1FORH 4U7MA 4V2CB 1LNUA 3MBEC 3F12A 2J88H 4KTDH 5MENA 5IF0B 3G9AB 5CP7A 1T2QL 3F7PC 1T1WB 1T03L 2DTSA 3X13A 4FFZH 2JJSC 2JE8A 3PP4L 2NMSA 1XGQA 1MREL 5HGHA 4ONFL 4PV9A 3VFUB 1KPRA 2EYRA 4JFZL 2OP4L 3DRTB 2Y5TB 4I0KA 3OG4B 3K4ZA 5EU4B 1S9KC 1Q9KA 1DVFC 3CFCL 4NP4L 1R3IL 5CGMA 1SEQH 1AIFB 1MWAH 5T3ZD 4S1DD 4YDKL 5F9WC 4MGXA 3B4NA 4JJ5A 5ID1B 3KLHD 3HTLX 2VDOH 2BVPB 4LEOB 1HNGA 2P1YA 4PD4K 1CGSH 4OGZA 2OQJB 1D5ZA 4IS6A 3RZCB 3T2QA 3HS0B 3TBSA 1ZXQA 3QH3B 3UTQB 3SQOH 1RUPL 5DQJB 2XTLA 1CDGA 1A6TB 2DLHA 2GY5A 1TENA 2WBWB 4WFFE 3VMPA 4NQSB 4HCRL 4GKOA 5HHPB 2IEPA 3BUTA 3V2AR 4OLXH 4MCZA 1ZS8B 2DQDL 2CK2A 2I60H 3O2VL 4Y5XB 4NC2B 4OUOA 4N1CA 4DVRH 1H9VA 1B0RA 4FA8A 4KAQH 1IRAY 1JWSA 4XCFL 4ENEC 3GKZA 3VFNA 5K93A 2PYED 5JIPA 2A73A 1RU9H 3CFBA 1QOKA 2E9JA 5GRZA 1TETL 1MPAH 5IMLB 3PWNA 1XGUB 5AUMB 1DN0B 2UY6A 2Y9RT 4NKQB 2FHFA 2HFGH 1ES0A 2X4RA 4I18B 5DMIL 5EZIH 3QRGH 4QRRE 2YD6A 2C7UB 3GM8A 1OD9A 1P7KB 1DEEA 3EJJX 3H9HB 2Z8VC 1HXYA 2P5WA 2WW8A 2IPTL 3SGDI 3MJ7B 1OAKL 2I07A 1F8TL 2ZOKA 5C8JA 4OV5B 1NUGA 3V4PL 1DSFH 5GGSB 3V6ZA 4BQCA 2IBZY 2BCKB 4UNUA 2V5YA 2ZSVB 3RWIA 3UBXB 4H5SB 3MRBB 1UKSA 3O3EA 5C0AD 5EBWA 1UJTA 1ZHBB 2V9QA 1DJSA 4YHZL 1GGUA 2APWA 1HCFX 1QSFD 2WP3T 3P2TA 3MMEB 3VCLB 4P46C 1BFTA 1JZ7A 3KNBA 2UVEA 4F37K 1GL4B 4E5XA 1KTDA 3SE4A 2NY6C 1P7HL 2BNQB 4NN7B 4YK4B 2EH7L 3P77A 3B83A 1BX2B 5GRJH 4UU9A 3KJ6L 2MMXA 4MQ7B 1T1YB 4KJYA 2QQKL 2DDQH 3RWGB 3QUMH 1G6RB 1B4JH 1WK0A 4JJHA 5FCUH 5TH2A 3MV8A 4C4KO 4WW2C 2IBGA 3U36B 3F7YB 3QQ3B 4JO1L 5C0CE 2AKRA 5F9OH 4DGVL 3X3GL 2FO4A 3BOVA 7FABH 3PWVA 1UB6B 4PJGF 3A6CH 2DS4A 3GMLB 3BGFC 4OKVB 5BXFA 5I1JL 1CFNB 4HG4J 5I9QB 3B9VA 1PBYA 4WWKA 4ZTPH 1AJ7H 3EZ8A 4X80H 2FATL 1ZANL 3CX5J 1BFVL 4IRSB 1FSKB 1A47A 5GJSH 2F53E 5GGTL 1RZKL 5FKAA 1NPUA 3GSNL 2B0SH 4DUXA 4IJ3C 2NY3C 5GHWH 5EU5A 1DLFH 1ZOXA 1E4JA 1KC5L 1FNGB 2FBJH 2YRPA 3QCUH 1N5YL 1YYLH 2G2RA 1D5IH 4FG6D 4QXTB 1WSST 1R3LA 4ZNEA 4J8RA 2BNQE 5FYKU 2Y23A 5DTFA 1Q38A 2VDLH 2F54E 3MLTB 3IGAA 4GUPA 4NRYA 4TOYL 4ZPTA 1XH3B 2IAND 2P47B 3OQ3B 1K4DB 2LAGB 4PJIA 5I15L 3QAZC 2NX5B 3FL7A 3FB6A 1JYWA 5KS9E 3WBDA 3VFWB 3LQZB 4J3UA 4V2BA 4HZLB 5E2JA 5FA4A 2GUOA 3RKDD 5D71L 1MJUL 2DIJA 4NT6A 4LIQL 1JPTH 1NAKL 2AXFA 2HTLD 4TRPH 2CUHA 2QQLH 5D7JB 4W6YB 4N8CL 1YJDH 4DTGL 4EVNB 2OK0L 1YEDB 3DV4B 4Z5RB 5AZEH 2OZ4L 3QEQB 4KY1L 5F3BA 3SPVA 5EOCL 4DUVA 4KJWD 4HDIA 1MCJA 3T4YA 1KTLB 1WQVT 2WM0A 3IDJA 1UM6H 3OF6D 2XXMB 5DDHA 3B9KC 3BESR 1J05B 4U1KA 1INQA 3U1SH 2X9XA 1EEZA 3LIZL 3BXNA 4P2QD 2WBJB 3MNWA 4HGMA 5E00A 5ADPL 3HAEB 4HUXB 3UTZB 4R0LB 3MGOB 2D31B 1NBYB 4PJXA 1EJOH 3C8KA 2F5AH 4LCIL 2E8ZA 3NCJL 4WW1A 3MLWH 2BVQA 5KG9B 4KZDL 5SWSD 4P5TB 2Y36L 4GQ9L 2DIAA 2FYYA 5JMOC 4DW2L 2FJGB 1A5FH 1RZGB 5B39A 3QPQD 4HWBA 3D0LA 3N9GH 2JB5L 1D6EB 3RL1A 1EV2E 5IQ9A 3DUSA 2RQ8A 4PJAE 4OZGA 4F37F 4E0RB 3MCLL 4Y8AA 1NDMA 2PETA 4MD4A 4Z0BL 3U7WH 2QQNH 3GIVA 1DL7L 4R3SB 4U6HA 4M1GH 2ZWLT 1ADQL 3MR9A 1KENL 1G1YA 2HLAB 1WEJH 5MP6H 3P4MA 2VKXA 3LAFA 4TSAL 1MHEB 2P7TA 1X44A 1U9KA 3LRHA 4QRSA 1TCRA 3Q0HA 1GZQA 3HB3D 4J3WA 3VI4F 3O0RH 4G3YH 3VGHA 1UCBH 1QSED 1KB5L 3B9KA 1WGOA 4NM8H 1BFSA 4WHDA 5I1DB 4AIXA 1YMMD 5JPMB 4P0DA 2J6EH 4IDLA 3ARFD 3ARGA 3LS5L 3AU1A 4MXVE 3IDGB 1NGZA 1X4XA 3JV6B 1KEMH 3OKDA 1LK3H 1F4YL 2R2HA 3HE7B 1L0XA 3WEXA 5TE6H 4MQXD 3F12B 1K2DB 3CK0L 5MENB 5IBUG 4P57A 5CP7B 1JGLL 3HUJF 1DTUA 1LEGA 3RAJH 2B5IC 2EDJA 5FYJE 1XGQB 3BMVA 2XKUA 3RDTA 1F45A 2YN3A 5HGHB 2WWKT 4PV9B 3QUMA 1DDHA 4DKEL 1KPRB 2ADGA 2LABA 2J5LC 5AEAA 4A6YH 4Q2ZA 2R0LH 3OPZH 3HG1A 3V95A 3GJEA 4WI4A 4P2CG 5K9OA 3N1MC 1Q9KB 3AB0C 4K3JH 1A6AB 1I8KA 1UGNA 3LKNA 1NANI 3ESUF 3GRWH 4YPGA 1JWUA 4WUUD 4QHNA 3RTQD 4JJ5B 3QUZC 1D6VL 3QHFH 5IWLC 5CJ8A 3HMWH 3MJ9H 4G9FA 3V8OA 1BD2D 3T4AA 1R5IB 5L0QC 1Q0XH 3KPRD 1BEYH 1JHKH 5JA8B 1QBMH 4HH9A 3CMGA 3HI5L 4OCWL 5DK0A 2R2BA 1YNTB 4MWFA 4DN4H 5FECA 5I1GL 2IBZX 4NBYB 5ADOL 3QUXD 1VPOL 4J3SA 3TPUA 1P84K 3MA7B 2A2QT 4NSKA 4DKAA 5A3IC 4MCZB 5ITBL 3HE6C 3MUJA 3ZMRA 4LLWA 1EX0A 1Z9OA 4KXZI 4OI7A 3VFNB 3WD5H 4NHUB 2O5ZH 3DUHA 3SO3C 2H45A 1OLZA 2DM3A 3MJ8B 3WFDH 3OJDA 5E2WL 3PWNB 1ULVA 5CAYB 2BXZA 1G9ML 1ES0B 4X4MA 1BOYA 2ENYA 5C6WH 5T1MA 3SOBH 1QLRA 3OB0H 1PX3A 3BO8A 2FLBT 3DWTA 1J5OL 2MPAH 4RMWA 4L8BA 1RZIA 2PO6A 2X1PA 1HXYB 3I9GH 4KHXH 4M7LH 5DO2C 3O3DA 2NY4C 2I07B 5D7KD 1BREA 4JN2B 3CFJB 1TJIL 2FZ3A 5C8JB 3V6ZB 3SDCD 1F2QA 5C09B 4PJEA 3VXQA 1HHKA 4G6KH 1JGUL 4AT6A 2EDTA 1HILB 3OZ9H 4U3XA 4QKXB 3RWIB 2D0GA 1JZ5A 3QIUB 5LKNA 2X41A 3O3EB 5EBWB 5C08E 4Z8FH 3D2UD 4YH6A 3HI6H 3THMH 2KKQA 4P4RB 3STZB 2R23B 4ZUUA 4PG9A 5IVZA 2KQMA 4YWGL 3HE6A 4KMTH 3VRJB 4YUEL 4GG8A 3KNBB 3MOAH 1EMTL 4C54A 1A14H 4H0GA 4E5XB 1H3TA 1KTDB 3B2VH 2VC2L 1CIUA 3P77B 4P48A 2CJUH 3VE0A 1I3GL 3CU7A 1T0MA 4UU9B 4ETYA 5HYJB 4KJYB 1IARB 1NC4A 4QXGL 2JJTC 3ULVC 4X9FA 1AGDA 2NXZD 3V7AE 5TH2B 4XVTL 3GKWH 3MV8B 3U30C 4HD9A 3NCYP 1A3QA 1QHOA 1N6VA 5IT2H 3TFKD 2AKRB 1T89C 3O2WL 2NYYD 2P5WE 3I2CL 1A6ZA 5CZVH 1JMZA 4POZD 5CCKH 2ZSWA 4WU5A 4ZUTA 1JI2A 1Q72H 4U1MB 5HTSA 4X6EB 4MD0A 2GI7A 4ERSL 1X5HA 1XR9A 5BXFB 2XZZA 1NKRA 4WWKB 5MI0C 3Q3GA 2FECI 2A6JA 4PJXF 3VXSD 3LH2L 4JB9H 3MODH 4AL8L 4M43H 3SJVD 2C4XA 1JL8A 5BZWA 1FNSH 5FKAB 4WU7A 3VD7A 2BHYA 5J1SC 5EU5B 4M9OA 2J3SA 3RUGA 4HC1L 4NJ9H 4NIKB 3ZDYE 1RY7B 4HFWB 2G2RB 3DARA 5FYKE 4RISH 3B8SA 1H8OA 4ELKB 1KULA 4J8RB 4GAJL 5IB1A 5DTFB 3UO1L 5LWYL 4H88H 4NRYB 4ZPTB 3IGAB 3NGBC 4M7ZB 4O2EA 4YC2C 3WNLA 1DQDH 4PJIB 1OF2A 3LQAL 4GRLC 1MEXH 2WMPA 3KJ4C 2WK2A 5FA4B 3MACH 4NT6B 1MWAB 1RJYA 2IH3A 4BZ2H 4PJDF 5EBMA 5DURD 1U8LA 2AXFB 4JANA 1YC7A 5TFSH 1I7RA 1EUTA 4BQBA 3BEWA 3WHXB 3MJ9A 4H8WH 3N50A 5BW7C 3MRKA 3TYGH 4LASL 2AXHA 5I19L 5E95B 4M48H 2H41A 3OSKA 1PLGH 4J3TA 5HVWA 4KKBC 2D4FA 4PRDA 3SPVB 4U3HA 4HDIB 3T4YB 3IDJB 1MVUA 3CSPA 4YZFE 4U1KB 1INQB 2A1WL 2CPCA 2I5YH 3DPBA 4LLYB 3BXNB 4KQ4H 4RRPG 3MNWB 5E00B 4ODSL 4JHAH 1VCAA 4CU7A 5DFWH 4ZNEE 4ALAL 3EOTH 5DFTA 4CVUA 4PJXB 3MRLA 1I3UA 3C8KB 4JGJA 4WW1B 2BVQB 1YEGL 3QXDA 5JOPD 1DANU 4PJIE 3IFOA 3BRDA 2FYYB 4EN3A 5I76A 3LMJL 3BDYH 1CF8L 2EDOA 3QCTL 5B39B 5BO1L 3D0LB 3FQNB 5CILH 3K74B 1GXEA 4I2XE 1SM3L 3RL1B 3V4VH 4AENA 3O2DL 3QXWA 3IB4A 2R1XA 1LP9A 5BV7B 2V9RA 3DUSB 1G9EA 4HWEH 2VDQH 3EYQD 1IAIH 3CXDH 5KSVB 4MD4B 1MJ7H 2VSCA 4XT1C 5K9JL 1DQLL 4NDMA 5EUKA 4LKCA 2X4UA 4H20L 4GSDL 3JWDC 4ODTH 4XC1H 2Q86A 3DIFA 2ZCLL 3P4MB 3MRFA 1HWGB 5I18L 5K9QG 4QXUL 1F6LL 2BSRA 5F70A 1TCRB 1GZQB 4YHYB 5BQ7A 1JFQL 5EO9B 4GJTB 3CVHH 2Z0BA 4ZOCA 1TTFA 2CUMA 5BJTA 4PJBA 4KKLC 2IMMA 1X5GA 3ARGB 1RULL 3QR2A 1QSVA 3AU1B 3QPXH 5TQ2H 1T04A 4FQIL 1UXSB 3QWOA 3OKDB 4QF1B 2R2HB 3WEXB 2HA1A 4J4PC 4GXVL 3FB5A 2A9MH 3QWRD 3ULUC 1N7ML 3LS4L 1LEGB 2GSGA 1BBDL 1UH3A 3RDTB 2E9IA 32C2A 1YECL 1DDHB 3ARTA 3QUMB 4Z7UA 5BVJA 3VWKC 2ADGB 3HC3H 4Q2ZB 3LN5A 5J06A 3FAWA 4NQED 5K9OB 1CK0H 1INEL 4E9LA 2Y06L 3ARBA 1P5UA 1UH4A 2QSTA 3VG0L 1I8KB 4AZ8A 4OZGE 5TDNA 3LKNB 1T7WA 1FP5A 4YPGB 4XP6H 4PLJD 4QHNB 4X6FA 1UT9A 2XA3A 2R9HD 5B3JF 2DQIH 5GGVL 4G9FB 3T4AB 3OB0K 1GGTA 1T7XA 2DQTH 3QULB 3NPSB 3SKUD 4LNRB 3CXHJ 1EVTC 1QYGL 5DK0B 2R2BB 4X0KA 4MWFB 2VB5A 5FECB 4KK6D 3P30H 3C5ZA 1WUNT 1G7LA 1T6VN 2ADJA 1IEBB 1CICD 4HJJH 1KPVA 3QDMD 4NSKB 4YXLL 4W6WB 3DHJA 4AM0A 3UCRA 4TQEH 4D9RE 4F9LA 3HPJA 4OD3L 15C8H 2QSVA 4FQQA 4LLWB 3RKPA 1BMGA 1H0DA 4NZTH 5GRWA 3VXUE 2BDNL 5DEGA 1IGCL 4QNPF 2ED9A 4PRID 5E4EB 3NCYS 4WFED 5I75B 3OJDB 4I3GA 1NFDA 4PRAA 3HG1E 1L0YA 1A7RL 1CFQA 1HSBB 4ZSOB 2VH5L 1BWMA 5T1MB 4GKSA 4LU5H 3V52L 3L5XL 4XMPH 5EO1A 5T33L 3BO8B 4X9HA 3DVFA 3QO0B 3WIIL 3WFEH 1HHGA 3EDDA 2ZCHL 3KYKH 4L8BB 1RZIB 2PO6B 4HIJA 3EYVB 3X12A 3OR6A 1RIVL 1FPTL 1VACA 1FAIL 3MLYH 3O3DB 5CWSA 4QHUB 2FZ3B 2VDNL 2YPVH 4ODXA 3VXQB 4PJEB 2O5YL 4HW6A 1HHKB 5E8NB 3VFTA 3LZFL 4AT6B 2VL4A 4Z0XA 4G9DA 4PRHA 4XX1E 3GJFA 5J9PA 3D1MC 1OAXH 3MA9H 4LHUA 2XFXB 5DLMH 5TPWL 4ZUUB 1MOEA 4PG9B 3FMGL 4K3DH 2NY0B 2VXSL 2UWEA 4AMKH 4DEPC 3D3VB 4GG8B 3OGCA 3QEGH 3RNQB 5KZCD 4TNVK 4OQ1A 5HGDB 4DN3L 2XV6B 3ZE1F 1IKFH 1S8DA 3QG7L 7CGTA 1TXKA 1J1XH 5I1IH 4GW1A 3VE0B 5GISH 1T0MB 2F5BL 1UWXK 1N5AB 3VA6A 4X4ME 1WWWX 4TVPE 1AGBA 4WY7H 2IPUG 4JFPA 4L3CA 1EVUA 3KXFE 1KLUB 4PY8J 3Q1SL 5JHDB 4GXUN 5D1XD 1T3FA 4M00A 1LO4H 2OR7A 5FYLD 3VW3H 3K8MA 5DD3H 2E9WA 1A6ZB 3D39E 5IFAL 4V1DB 3IFLL 3EKCA 4PJ8A 1A4JB 2D03L 4S1DC 3HRZA 4MD0B 4PJEE 3KLHC 3GUTB 1XR9B 4FQLL 1RD6A 4D3CL 1I75A 4J3XA 1K3ZA 3TH3T 3Q3GB 4PUBH 2A6JB 3ZKND 3MUHL 4KUZL 5F6IB 3BAEH 3FB7A 1TVHA 1YPZF 5BZWB 5A2LH 3A0OA 5F7WC 3BZFA 4BH8A 5DD5L 1KN2H 3H42H 2ZZUT 3GSQA 5DQ9A 3RUGB 2P48B 4OFYD 4WIQA 1CS6A 2WV3A 5K9QI 3PG2A 2CH8A 5FB8A 3ARZA 3TJEH 1IGFH 2YA0A 3QUKA 2X4PA 1JVKA 1FV1A 4U1LB 1AXTL 1LP9F 3MRQB 5KSBF 2VNCA 3MGTA 3UTSE 4C56E 3M45A 4O2EB 3E0GA 1K8IA 4JQIL 5F8RC 1V8HA 4E41A 4A6YB 4R7DA 4K9EC 3GNMH 3F5WA 3MBXH 3CDYA 1OF2B 4XHJD 4NGHH 1JTPA 5ENWA 2RGSA 5IJVB 1RJYB 4X6DE 5J1TC 2IH3B 1OD7A 4OZIA 2YRLA 1U8LB 3KPLA 3MRPA 5CD5D 1I7RB 3FQXB 3GBNL 1K3IA 4JFDD 1KB9J 1VERA 3BEWB 3B9EA 1RUKH 3MRKB 3QISA 4MNHA 2C3VA 1ZEAH 3BIKB 2AEWA 3VG9B 3VXPA 4PRDB 1YNLH 4KUCF 5E99H 3ARSA 3EGSB 2YZ1A 4ONGL 3UX9B 3QI9A 4D8PA 1MVUB 3HNVH 1DQJA 3O6FD 5C6PB 3B2UD 1Z5LB 1J86A 5FKPA 3X17A 1GVIA 5DR5L 1AC6A 2QADC 4HBCL 3OKEA 5ABDE 4FRWA 3WN5B 3QYCA 3VFSA 2XQYG 1IBGH 4K7PY 3MRLB 4JVPA 5HYSG 5DJZA 2A0LD 5I8KH 1YDPA 3IFOB 2R4SL 1O7VA 4QXWA 4EN3B 2HJKA 3MLUL 1LMKA 4R97C 3ULVE 3LB6D 1J0YA 1FO0H 1R5VA 2QSQA 4QOKA 4RGND 2AP2A 4GG6E 1C5CH 1RURH 4M7JL 4AENB 4QRPD 2R1XB 1LP9B 4UINL 1XGYL 2WSKA 2BY0A 4RFOH 4M5ZH 4TNVF 5DVNA 5FF6A 2XZQH 4GKZA 2AK4D 3WS6C 4F3FA 1ZTXH 4UB0H 4NDMB 2AK1H 1DQML 4QHKJ 5EUKB 4LKCB 2X4UB 3J7HA 4WHTA 4XBEH 3UJJH 1BJ1H 3ZYJA 3DIFB 4LSSL 2Q86B 2YR3A 5D7IA 3MRFB 4PJFE 3ETBF 3EDEA 2BSRB 3N85L 4NQCE 1GHFH 5BQ7B 3STBA 2A9NL 1RZJC 5ILTL 2JIXA 2G9HA 1SMOA 2ADIA 5GS2D 5BJTB 1E28A 5JW3L 4PLOB 2OMBA 5C9KA 4Y1AB 1T04B 5LXGL 3MRRA 3QWOB 1OY3B 4PRPD 3G6DH 4EBQL 3H8NA 1M7XA 2Q7NA 3FB5B 4OCMC 1OP3H 4X6CA 3W0WD 5DJYA 4D9QD 1ORSA 2B2XL 3ZKXC 4FG6C 3CSYA 4LVHC 32C2B 4Z7UB 1KF9B 4PP1D 1F42A 5BVJB 2YK1H 3JWNC 4G8IA 5HYQB 2R56L 4P49A 1JZ6A 3ARBB 1G84A 2AI0L 4GAYA 5T1KD 5TDNB 2VZUA 3SGJA 3QDGA 5JLZA 3RKDC 2D7QA 1O5DT 4TUKL 3E6FA 2D7TL 3BZEA 4X6FB 1QKZL 3OTTA 2PXYD 3GMPB 1S7SA 3S37L 2HTLC 2V17H 5L9DH 4JQXA 4NKIH 4M7KH 3DMMD 2GIYA 3C5ZB 5A2IH 1G7LB 2ADJB 4PJBE 5KW9L 4KJWC 5E1HB 1KPVB 3QSKB 1D5XA 4LDOB 3QQ4B 4O2FA 5GGQH 2M8XA 5HDBF 4FQQB 1DBKL 4X9BA 4OB5H 4NM4H 5F7EL 2X89A 2VKWA 3FKUS 4OI8A 4CL7A 4PYGA 5L88H 5IFHL 4Z7UE 1MY7A 2NNAA 3L3GA 4PJ5D 4F57L 3VJ6A 2GK0A 1H3UA 1NFDB 4PRAB 4R90H 3ZSSA 5SWQA 2EICA 3O4OB 4OCNC 4FQ1L 2Z91A 2X9YA 1KCRH 3R0NA 4PR5B 1FL5A 4GKSB 1NLDL 4QO1A 2LQRA 4PB0L 3WUWG 4YX2H 2X4NA 4FNLH 1HHGB 1BLNA 4LSUH 1FZOA 4J23A 3WMSA 1QPXA 3X12B