4HKFA

Crystal structure of danio rerio mec-17 catalytic domain in complex with acetyl-coa
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
181
structure length
170
Chain Sequence
PYDLNALFPERISVLDSNLPLPQVTTVIDELGKASSKAQQLPAPITSAAKLQANRHHLYLLKDGEQNGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tubulin N-acetyltransferase
publication title Molecular basis of the acetyltransferase activity of MEC-17 towards alpha- tubulin
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 47
structure length 170
sequence length 181
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4hkfA00
3VWDA 2D4PA 4ZBGA 3T90A 1QSMA 4OLLA 3V8IA 1NMTA 3F8KA 5CNPA 3OWCA 2HQYA 3TT2A 4AG7A 2ZW6A 4NXYA 2X7BA 4AVBA 2ZW5A 1CJWA 2B5GA 2FT0A 4XNHC 4Y49B 4M3SA 1M1DA 2H5MA 3TE4A 4UWJA 2PSWA 4MHDA 1M44A 1BOBA 5C88A 1K4JA 3GYAA 4XPKA 3D3SA 4KOXA 2GE3A 1OZPA 2Y0MA 1Y9WA 4QUSA 2DXQA 4KOYA 4HNWB 5HMNA 5F47A 2ZPAA 3K9UA 4KOSA 4KVME 4EVYA 3CXSA 4JLYA 1M4DA 2B4DB 4B5PB 2R7HA 2O28A 1Y7RA 2OB0A 4K30A 3ZZIA 4IF5A 5F48A 2J8NA 2Q4VA 1LRZA 3TOAA 2VXKA 4L8AA 2PR1A 3BLNA 5H86A 2QECA 4KOVA 4II9A 4BMHA 4E0AA 1YX0A 5KTDA 4QBJA 1VKCA 1BO4A 2OZGA 1N71A 4KOTA 4FD4A 3PP9A 3PGPA 1WK4A 1IYLA 4R3LA 2WPXA 1VHSA 4R3KA 1MJ9A 2I00A 2Z11A 3R9FA 4CAVA 3TOBA 3JUWA 3QAHA 5EBVA 1I1DA 4KUAA 4AVCA 2VZZA 4KVXA 2G0BA 3RYOA 1NE9A 3C26A 3BJ8A 4KUBA 4H6UA 3D2PA 3FIXA 4CRZB 1QSOA 1XF8A 2Q4YA 2OU2A 4UWIA 3I3GA 5JQ4A 1L0CA 1KUVA 2EVNA 5IV0A 2PRBA 2R1IA 3EC4A 3CXQA 4LX9A 2OZHA 2F5IA 3GKRA 3EXNA 2FCKA 3PZJA 4R87A 1CM0A 3FYNA 3MGDA 4FD5A 3F0AA 4CAWA 3FBUA 1YVKA 2R8VA 3P2HA 5GCNA 1Q2CA 4KORA 1KUXA 3LODA 4M85A 4PSWA 1Z9UA 1SQHA 1YK3A 2D4OA 4XPLA 5ISVA 1MK4A 4XPDB 2Q0YA 4KVOE 1QSRA 4PK2A 4IUSA 5F49A 2PR8A 3UY5A 3S6FA 3S6KA 3S6HA 4I49A 5IX3A 3P2FA 3R1KA 1P0HA 4KLWA 2B3VA 3TCVA 3G3SA 4NSQA 3DSBA 4ORFA 2BEIA 4CAXA 2B3UA 1Z4RA 3I9SA 2FXFA 4DNCA 3QB8A 3CXPA 1S60A 1IICA 2JEVA 2CNSA 1KUYA 4HNXB 1PU9A 4MY3A 1RXTA 2PC1A 2JDDA 2Q44A 3LD2A 2NMTA 3TO9A 4JWPA 2R98A 3IWGA 1XMTA 4YRHA 1IIDA 2WPWA 2VBQA 3NE7A 1I12A 3R9GA 4YGOA 4U5YA 4ONUA 4F0YA 1S5KA 2HUZA 1PUAA 1UFHA 1XEBA 2FS5A 4UA3A 4AG9A 3SXOA 2FSRA 4AVAA 4CRYB 3TO6A 4JD6A 1XE4A 2K5TA 4MY0A 4Y49C 5J8FA 1B87A 3R95A 4L89A 3R96A 4QVTA 4NEXA 3GY9A 1IYKA 1YLEA 2ZW7A 4OADA 4MBUA 1P4NA 2VQYA 3R9EA 2PQ8A 2FE7A 4YFJA 2CNMA 2QIRA 2JDCA 2P6GA 4QB9A 4B5OA 2FIAA 1S7NA 2ARHA 2B4DA 4RS2A 3D8PA 3SHPA 4B5PA 1U6MA 5HH1A 2VZYA 4XNHB 2CY2A 2KCWA 2B5GB 2P6FA 3EY5A 4KOUA 1S7FA 3TFYA 2G3TA 4KOWA 2REEA 2VEZA 1RO5A 3JVNA 3W91A 1S7KA 2P0WA 5I0CA 3WR7A 3DR8A 3B8GA 2VI7A 1Z4EA 2CNTA 4H89A 2Q7BA 4LUAA 2ATRA 5KTCA 1V0CA 1GHEA 3KKWA 4AB7A 3E0KA 3VWEA 1KZFA 1YREA 3T9YA 2GIVA 5E96A 4E2AA 4RI1A 1WWZA 3W6SA 4E8OA 3W6XA 3BJ7A 2B4BA 3F5BA 4JXRA 5DWNA 1YVOA 4QC6A 2Z10A 4UBRA 1Q2YA 2GANA 4JJXA 2ZXVA 1M4GA 3DNSA 2FL4A 3SXNA 1ON0A 2ZW4A 4J3GA 2BUEA 2AE6A 2FIWA 1QSNA 4R9MA 3TTHA 1I21A 1M4IA 1YR0A 4R57A 2BSWA 1QSTA 2QMLA 4HNYB 5FVJA 2OZUA 4H6ZA 5F46A 1MJBA 2IL4A 1J4JA 2BL1A 4U9YA 3TO7A 4KLVA 4F6AA 2AJ6A 4KZTA 5J8CA 3DR6A 4FD6A 2G3AA 2HV2A 5KTAA 3G8WA 2Z0ZA 2P6EA 4XPDC 2Q04A 1Y9KA 3FRMA 3D2MA 3N7ZA 4PSXA 4MI4A 3H4QA 3FB3A 3IGRA 4PV6A 2I79A 5H84A 2PDOA 3ZJ0A 3EFAA 1YGHA 1B6BA 4OAEA 4PK3A 2J8MA 2EUIA 2J8RA 4HKFA 1Q2DA 4GS4A 1IB1E 1S7LA 1XIXA 5JPHA 3FXTA 1MJAA 4MJ8A 4NF1A 3EO4A 1R57A 2RC4A 1FY7A 2A4NA 3S6GA 5IB0A 4CS0B 4NCZA 1TIQA 5C82A 4X5KA 2OH1A 4U9ZA 3FNCA 2B58A 4FD7A 2REFA 1NSLA 5EC4A 2JLMA 5DWMA 2C27A 3DDDA 4JXQA 1S3ZA
chains in the Genus database with same CATH superfamily
2YGWA 3VWDA 2D4PA 4YWYA 4ZBGA 4MFZA 3K2KA 3T90A 3H5ZA 4M6IA 1QSMA 2ZEGA 3V38A 2OR4A 4OLLA 3V8IA 4F9UA 5J1QA 4A30A 1NMTA 3F8KA 2OOTA 3BI1A 5CNPA 3OWCA 1GYTA 3PB8X 5A27A 2HQYA 7CPAA 4P4BA 2JBJA 3TT2A 3PRTA 4AG7A 4ZY0A 2ZW6A 4NXYA 2PRQA 2X7BA 2CXAA 4A31A 4AVBA 2PJ3A 2ZW5A 1CJWA 4A32A 4R76A 4B13A 1KWMA 1VHEA 2B5GA 3FMCA 4JZ0A 4Q38A 2FT0A 2CTCA 4XNHC 4Y49B 1LOKA 4M3SA 1M1DA 2H5MA 4NJRA 3TE4A 2ZEOA 3IFEA 3H8EA 5D8NA 3WC7A 4G1PA 4OP4A 4UWJA 1IOFA 2PSWA 4HPSA 4MHDA 3H8GA 1M44A 3JTKA 3WABA 1BOBA 5C88A 1YQEA 1HEEA 3PBEA 4A39A 1K4JA 3GYAA 4A2ZA 4XPKA 3D3SA 4KOXA 1ZG7A 2GE3A 2GFQA 1OZPA 2QVPA 8CPAA 1Q7LA 2F8HA 2Y0MA 4ZY1A 1Y9WA 4QUSA 4MRIA 1TKFA 4P4IA 3LACA 2DXQA 2ZELA 4KOYA 4MXUA 4ZYQA 3SHPA 2CIJA 3JRUA 4HNWB 5HMNA 5AG6A 4P4DA 3PB4X 5F47A 1M4LA 2ZPAA 3K9UA 4KOSA 4PXDA 1JWQA 2ZEFA 4KVME 3HLPA 4UCNA 4EVYA 3B35A 1YLOA 2PIZA 4R6TA 1LAMA 3CXSA 4JLYA 1M4DA 2B4DB 3D7HA 3KHXA 4B5PB 2R7HA 4MCPA 4B10A 3DLJA 2O28A 1Y7RA 2OB0A 4K30A 3ZZIA 4IF5A 4MFPA 4X3RA 2ZEHA 5F48A 2J8NA 5A28A 1YSJA 2Q4VA 1YW4A 4A38A 1LRZA 3TOAA 2VXKA 4L8AA 4C68A 3CZXA 2PR1A 3BLNA 5H86A 3SJGA 5K8PA 2Z3PA 2QECA 4KOVA 4II9A 4EWTA 2EWBA 4BMHA 1Z8XA 5I4MA 2WUUA 4E0AA 1YX0A 5KTDA 4UEZA 4QBJA 1TKJA 4X8IA 4P4EA 2PIYA 4NGSA 2PJ9A 1VKCA 1BO4A 2GLJA 2OZGA 2Z3NA 4B6ZA 1N71A 4PXEA 2V8VA 4KOTA 1Z8TA 4FD4A 2XEFA 3PP9A 4P44A 1VGYA 3PGPA 4PPZA 3PFOA 1WK4A 3GUXA 1IYLA 4H2KA 4NGQA 2WPXA 4R3LA 3KASA 1VHSA 4R3KA 1MJ9A 1ZG8A 2I00A 4P4FA 4P10A 2Z11A 5G22A 3R9FA 4CAVA 5DS0A 1NSAA 5G21A 4GXHA 3SI0A 3TOBA 3QNVA 2XEIA 3JUWA 3PB7X 5K8NA 3QAHA 5EBVA 1I1DA 2G9DA 4KUAA 4AVCA 3SJXA 1YMEA 2VZZA 3I1UA 4KVXA 2G0BA 5THWA 3RYOA 4CGLA 1NE9A 3C26A 4PXCA 3PBBA 1IY7A 2ZEMA 4NGTA 1ELMP 5K8MA 3BJ8A 1CPSA 2C6PA 4KSAA 4MHPA 4KUBA 4A95A 3B2YA 1X10A 4H6UA 2V8DA 3D2PA 4Z65A 3FIXA 4UIBA 3IEHA 5D29A 1QSOA 4CRZB 1XF8A 2Q4YA 2OU2A 2PJ5A 1Y0RA 3KZWA 4UWIA 4WJBA 3I3GA 4W9YA 3D7DA 5JQ4A 4NFRA 1L0CA 1KUVA 2EVNA 1DE4C 3D7FA 5IV0A 4NGNA 2PRBA 2R1IA 3EC4A 3CXQA 1Z2LA 3CDXA 2IQ6A 4LX9A 2OZHA 2F5IA 3GKRA 4M6HA 2CTBA 2FCKA 3EXNA 3PZJA 2PJ6A 1CM0A 3IO1A 4R87A 3FYNA 3MGDA 4FD5A 2RB7A 3F0AA 4CAWA 3FBUA 3IIBA 1F57A 1YVKA 5IB9A 2R8VA 3P2HA 2I3CA 2IJZA 5GCNA 1Q2CA 1ZG9A 2BO9A 2FVGA 4KORA 4A37A 2AFUA 1KUXA 1X12A 3LODA 4M85A 2O4HA 2PJCA 1Z9UA 2HB6A 1SQHA 1YK3A 2ABZA 2D4OA 1ELLP 1MK4A 2PJ4A 2PJAA 4IK2A 4XPLA 5AG5A 4XPDB 3S9MA 1BLLE 1BPMA 2Q0YA 2QYVA 4KVOE 3D67A 2WYRA 1QSRA 2J9AA 2PJBA 4IUSA 4MHZA 4PK2A 5F49A 2PR8A 3UY5A 1R43A 3S6FA 3S6KA 4PXBA 1CP7A 4PSWA 3S6HA 4I49A 5IX3A 2NYQA 3N5FA 3P2FA 1TKHA 1CX8A 4TNUA 3R1KA 1CG2A 1P0HA 3RAMA 4OIDA 2RFHA 4KSIA 2ZEDA 4KLWA 2B3VA 3TCVA 3G3SA 4NSQA 3DSBA 2O53A 4ORFA 2BEIA 5EMIA 4CYQA 4CAXA 4UEEA 2B3UA 2EK8A 3TC8A 1Z4RA 3I9SA 2FXFA 4DNCA 4NGMA 2WZNA 1ZO0A 3NH8A 3QB8A 5JGFA 2Q51A 4C7IA 3CXPA 3QAYA 1S60A 1IICA 2JEVA 2CNSA 1KUYA 2F7VA 2ZOFA 4HNXB 1PU9A 4MY3A 1RXTA 2PC1A 2JDDA 2Q44A 2DPSA 3LD2A 2NMTA 2QJ8A 4NJQA 3FVLA 4P6YA 4UCPA 4PQAA 3TO9A 4CYOA 4FWUA 5K8OA 4JWPA 2R98A 5F09A 3PEIA 3IWGA 4OC3A 5HVHA 1CBXA 1XMTA 2PE3A 4FBEA 4OC1A 4YRHA 1IIDA 1XJOA 2WPWA 3ISXA 2VBQA 3NFZA 1H8LA 1I12A 3NE7A 3R9GA 4YGOA 1FNOA 4RN7A 4U5YA 3NH4A 4ONUA 5G1ZA 3B3WA 4F0YA 2BCOA 2XEJA 5HXDA 1S5KA 2HUZA 1PUAA 3GB0A 5HVGA 1UFHA 3B3CA 1XEBA 2FS5A 4UA3A 4AG9A 3SXOA 2FSRA 3HUVA 4AVAA 4CRYB 3TO6A 3B3TA 4JD6A 1XE4A 2K5TA 4MY0A 4ZX8A 4Y49C 5J8FA 1B87A 4AXVA 1LFWA 4Q7AA 3R95A 3V7ZA 2Q4ZA 4K3NA 4L89A 3CPXA 2EO8A 3DGVA 4ZI6A 3R96A 5LYLA 2C6GA 4QVTA 4NEXA 3GY9A 1PYTB 2PCUA 2POKA 1IYKA 1QMUA 4CGNA 1YLEA 2PJ2A 1HDQA 4UF4A 2ZW7A 2Q7SA 4OIWA 4OADA 3FEDA 2BOAA 3FEEA 1P4NA 4MBUA 4MFQA 4ZY2A 2VQYA 1AMPA 3R9EA 2CF4A 2PQ8A 4CYNA 2FE7A 4CGOA 4YFJA 2CNMA 4Q36A 2QIRA 4MFKA 3GIUA 2JDCA 2V8HA 2AFMA 4C2YA 2P6GA 3WT4A 5LRGA 4IHMA 1TXRA 4QB9A 1IOIA 2FIAA 4B5OA 1DTDA 1S7NA 2ARHA 2B4DA 2ZENA 3D8PA 1UWYA 1IU8A 2AFXA 3NE8A 4OKOA 1U6MA 4B5PA 3KI9A 2V8GA 2YNCA 2VZYA 3CT9A 2Z3MA 3FJUA 4LQGA 4XNHB 5HH1A 2CY2A 4CAFA 2KCWA 2B5GB 1XRYA 2P6FA 3EY5A 4KOUA 1S7FA 1R3NA 2YNCC 4P4JA 4UEFA 3TFYA 4RS2A 4GM5A 3VH9A 2G3TA 4NGRA 1LCPA 4UCMA 5CPAA 5ISVA 4KOWA 3H8FA 2GREA 2ZOGA 2REEA 2VEZA 1RO5A 3A9LA 3JVNA 4DYOA 3W91A 1S7KA 2GLFA 3IC1A 4MCSA 4EMEA 4A94A 2P0WA 3LWUA 5I0CA 3RBUA 4BD9A 3WR7A 3FECA 1VIXA 4JYWA 1AYEA 4EFDA 3D4UA 3DR8A 3B8GA 2VI7A 2ODFA 2V77A 1Z4EA 3FH4A 4R8FA 5ELYA 5CBMA 2JBKA 3IU1A 4FUUA 1QQ9A 3K9TA 2Z3LA 4DUKA 5AG4A 4BBHA 3KR4A 4CGPA 2CNTA 4H89A 2Q7BA 4LUAA 3T8WA 2ATRA 5KTCA 4OMEA 3KGQA 4MHNA 1CPXA 1V0CA 2ANPA 2Q43A 3GLJA 3SJFA 2NSMA 4A33A 1GHEA 3KKWA 2C1CA 4AB7A 3E0KA 3VWEA 1KZFA 1YREA 3FX6A 1ARLA 2JEWA 3T9YA 2GIVA 5HVFA 4KS9A 5E96A 4C2ZA 3B3SA 1VHOA 1ARMA 4RI1A 4E2AA 5AG7A 3D66A 1WWZA 3W6SA 4CPAA 4E8OA 1HDUA 2Z3OA 3W6XA 4B12A 1F2PA 3BJ7A 1ZLIA 2B4BA 4ONWA 4F8ZA 2AFOA 4KSFA 1TF8A 2AFZA 3F5BA 4JXRA 3KQXA 5DWNA 3VATA 5JH9A 1YVOA 4QC6A 2Z10A 3CPAA 4UBRA 1Q2YA 1XFOA 3KR5A 2GANA 1Z5RA 4JJXA 2ZXVA 1M4GA 2FL4A 3DNSA 3SXNA 1ON0A 2ZW4A 2GU2A 4J3GA 4B11A 3TX8A 2YNDA 2PJ8A 2BUEA 2AE6A 1JQGA 2FIWA 1QSNA 4P45A 4R9MA 3TTHA 1I21A 1M4IA 3IWWA 3WC6A 1YR0A 3VARA 4FAIA 1Y7EA 2EBJA 2DF5A 1PCAA 3MN8A 4R57A 2BSWA 1FT7A 1XBUA 1XMBA 1OBRA 3PFEA 4LQ6A 1ZLHA 4O23A 1QSTA 2DPTA 2QMLA 4NGPA 4HNYB 5AGEA 5FVJA 1AUGA 2OZUA 4H6ZA 5F46A 1MJBA 2IL4A 1J4JA 2AFWA 2BL1A 3KL9A 3B7IA 4U9YA 3BHXA 3TO7A 3B3VA 4KLVA 3PB6X 2PVWA 4F6AA 2AJ6A 2PJ0A 4KZTA 3SI2A 5J8CA 3DR6A 4FD6A 2G3AA 2HV2A 2PJ7A 4OC5A 5KTAA 4X2TA 4B14A 3G8WA 2Z0ZA 2P6EA 3D68A 4XPDC 1CP6A 4C7HA 2ZEPA 2Q04A 1Y9KA 4MMOA 4WWVA 3KHZA 3IJ3A 4OC4A 2IMOA 3KQZA 4OC0A 2WSAA 3S9NA 4BINA 3FRMA 3D2MA 3N7ZA 4MCQA 4PSXA 4MI4A 1YW6A 1LANA 2Z3KA 3H4QA 3SI1A 3FB3A 3IGRA 4M6GA 4PV6A 4UIAA 5LYDA 2I79A 5LYFA 1EE3P 5H84A 2PDOA 4F9VA 3ZJ0A 2C6CA 1Z8LA 2XEGA 1YGHA 1B6BA 3EFAA 4OAEA 4PK3A 2J8MA 2EUIA 4C2XA 2J8RA 4HKFA 1IGBA 1Q2DA 6CPAA 4GS4A 5LRKA 1IB1E 5LRJA 4CGMA 2AFSA 1S7LA 2VL1A 4MFLA 1XIXA 4YU9A 5LYIA 3IU2A 4CYPA 5JPHA 2PVVA 3BXMA 3ISZA 3FXTA 1LAPA 1MJAA 2EK9A 4ZGYB 4MJ8A 4TWEA 4MHYA 3RNZA 1TF9A 4NF1A 3EO4A 1R57A 3D7GA 5G20A 5JM6A 2RC4A 1FY7A 2A4NA 3S6GA 5IB0A 4UFWA 4CS0B 4DJLA 4NCZA 3LMSA 1Y0YA 1TIQA 4OC2A 2ZEEA 4UFXA 3RZAA 5C82A 4X5KA 1Z8WA 3MRUA 2DEAA 2OH1A 5BWAB 1F2OA 4MCRA 3L2NA 4U9ZA 3NH5A 3FNCA 4F0XA 3S9LA 2PJ1A 4IAVA 2B58A 3FF3A 1XOVA 4FD7A 4ZX9A 2REFA 3SJEA 3WC5A 3NA6A 3PB9X 5EC4A 1BPNA 2JLMA 1NSLA 4R7MA 2HC9A 4CAEA 1BAVA 3IWEA 1A2ZA 5DWMA 3BI0A 2C27A 2YNEA 3DDDA 1RTQA 4JXQA 4UFVA 4RUHA 1S3ZA 3RO0A 4MFJA
chains in the Genus database with same CATH topology
2YGWA 3VWDA 2D4PA 4ZBGA 4MFZA 3T90A 3H5ZA 1QSMA 4OLLA 3V8IA 4A30A 1NMTA 3F8KA 5CNPA 3OWCA 5A27A 2HQYA 3TT2A 4AG7A 2ZW6A 4NXYA 2X7BA 2CXAA 4A31A 4AVBA 2ZW5A 1CJWA 4A32A 4B13A 2B5GA 4Q38A 2FT0A 4XNHC 4Y49B 4M3SA 1M1DA 2H5MA 3TE4A 4UWJA 2PSWA 4MHDA 1M44A 3JTKA 1BOBA 5C88A 1K4JA 3GYAA 4A2ZA 4XPKA 3D3SA 4KOXA 2GE3A 1OZPA 2Y0MA 1Y9WA 4QUSA 2DXQA 4KOYA 4HNWB 5HMNA 5AG6A 5F47A 2ZPAA 3K9UA 4KOSA 4KVME 4UCNA 4EVYA 3CXSA 4JLYA 1M4DA 2B4DB 4B5PB 2R7HA 4B10A 2O28A 1Y7RA 2OB0A 4K30A 3ZZIA 4IF5A 4MFPA 5F48A 2J8NA 5A28A 2Q4VA 1LRZA 3TOAA 2VXKA 4L8AA 4C68A 2PR1A 3BLNA 5H86A 2Z3PA 2QECA 4KOVA 4II9A 4BMHA 2WUUA 4E0AA 1YX0A 5KTDA 4QBJA 1VKCA 1BO4A 2OZGA 2Z3NA 1N71A 4KOTA 4FD4A 3PP9A 3PGPA 1WK4A 1IYLA 4R3LA 2WPXA 1VHSA 4R3KA 1MJ9A 2I00A 5G22A 2Z11A 3R9FA 4CAVA 5G21A 3TOBA 3JUWA 3QAHA 5EBVA 1I1DA 4KUAA 4AVCA 2VZZA 4KVXA 2G0BA 3RYOA 4CGLA 1NE9A 3C26A 3BJ8A 4KSAA 4A95A 4KUBA 4H6UA 3D2PA 3FIXA 4CRZB 1QSOA 1XF8A 2Q4YA 2OU2A 4UWIA 3I3GA 5JQ4A 1L0CA 1KUVA 2EVNA 5IV0A 2PRBA 2R1IA 3EC4A 3CXQA 4LX9A 2OZHA 2F5IA 3GKRA 3EXNA 2FCKA 3PZJA 4R87A 1CM0A 3FYNA 3MGDA 4FD5A 3F0AA 4CAWA 3FBUA 1YVKA 2R8VA 3P2HA 5GCNA 1Q2CA 4KORA 1KUXA 3LODA 4M85A 4PSWA 1Z9UA 1SQHA 1YK3A 2D4OA 4XPLA 5ISVA 1MK4A 5AG5A 4XPDB 2Q0YA 4KVOE 1QSRA 4PK2A 4IUSA 5F49A 2PR8A 3UY5A 3S6FA 3S6KA 3S6HA 4I49A 5IX3A 3P2FA 3R1KA 1P0HA 4KLWA 2B3VA 3TCVA 3G3SA 4NSQA 3DSBA 4ORFA 2BEIA 4CYQA 4CAXA 2B3UA 1Z4RA 3I9SA 2FXFA 4DNCA 1ZO0A 3QB8A 4C7IA 3CXPA 1S60A 1IICA 2JEVA 2CNSA 1KUYA 4HNXB 1PU9A 4MY3A 1RXTA 2PC1A 2JDDA 2Q44A 2DPSA 3LD2A 2NMTA 4UCPA 3TO9A 4CYOA 4JWPA 2R98A 3IWGA 1XMTA 4YRHA 1IIDA 2WPWA 2VBQA 3NE7A 1I12A 3R9GA 4YGOA 4U5YA 4ONUA 5G1ZA 4F0YA 1S5KA 2HUZA 1PUAA 1UFHA 1XEBA 2FS5A 4UA3A 4AG9A 3SXOA 2FSRA 4AVAA 4CRYB 3TO6A 4JD6A 1XE4A 2K5TA 4MY0A 4Y49C 5J8FA 1B87A 3R95A 4L89A 3R96A 4QVTA 4NEXA 3GY9A 4CGNA 1IYKA 1YLEA 2ZW7A 4OADA 4MBUA 1P4NA 4MFQA 2VQYA 3R9EA 2PQ8A 4CYNA 2FE7A 4CGOA 4YFJA 2CNMA 4Q36A 2QIRA 4MFKA 2JDCA 4C2YA 2P6GA 4QB9A 4B5OA 2FIAA 1S7NA 2ARHA 2B4DA 4RS2A 3D8PA 3SHPA 4B5PA 1U6MA 2YNCA 5HH1A 2VZYA 4CAFA 2Z3MA 4XNHB 2CY2A 2KCWA 2B5GB 2P6FA 3EY5A 4KOUA 1S7FA 2YNCC 3TFYA 2G3TA 4UCMA 4KOWA 2REEA 2VEZA 3JVNA 1RO5A 3A9LA 3W91A 1S7KA 2P0WA 5I0CA 3WR7A 3DR8A 3B8GA 2VI7A 1Z4EA 3IU1A 2Z3LA 5AG4A 4BBHA 4CGPA 2CNTA 4H89A 2Q7BA 4LUAA 2ATRA 5KTCA 1V0CA 4A33A 1GHEA 3KKWA 4AB7A 3E0KA 3VWEA 1KZFA 1YREA 3T9YA 2GIVA 4KS9A 5E96A 4C2ZA 4E2AA 4RI1A 5AG7A 1WWZA 3W6SA 4E8OA 2Z3OA 3W6XA 4B12A 3BJ7A 2B4BA 4KSFA 3F5BA 4JXRA 5DWNA 1YVOA 4QC6A 2Z10A 4UBRA 1Q2YA 2GANA 4JJXA 2ZXVA 1M4GA 3DNSA 2FL4A 3SXNA 1ON0A 2ZW4A 4J3GA 4B11A 2YNDA 2BUEA 2AE6A 2FIWA 1QSNA 4R9MA 3TTHA 1I21A 1M4IA 1YR0A 4R57A 2BSWA 1QSTA 2DPTA 2QMLA 4HNYB 5AGEA 5FVJA 2OZUA 4H6ZA 5F46A 1MJBA 2IL4A 1J4JA 2BL1A 4U9YA 3TO7A 4KLVA 4F6AA 2AJ6A 4KZTA 5J8CA 3DR6A 4FD6A 2G3AA 2HV2A 5KTAA 4B14A 3G8WA 2Z0ZA 2P6EA 4XPDC 4C7HA 2Q04A 1Y9KA 2WSAA 3FRMA 3D2MA 3N7ZA 4PSXA 4MI4A 2Z3KA 3H4QA 3FB3A 3IGRA 4PV6A 2I79A 5H84A 2PDOA 3ZJ0A 3EFAA 1YGHA 1B6BA 4OAEA 4PK3A 2J8MA 2EUIA 4C2XA 2J8RA 4HKFA 1Q2DA 4GS4A 1IB1E 4CGMA 1S7LA 4MFLA 1XIXA 3IU2A 4CYPA 5JPHA 3FXTA 4ZGYB 1MJAA 4MJ8A 4NF1A 3EO4A 1R57A 5G20A 2RC4A 1FY7A 2A4NA 3S6GA 5IB0A 4UFWA 4CS0B 4NCZA 1TIQA 4UFXA 5C82A 4X5KA 2OH1A 5BWAB 4U9ZA 3FNCA 4F0XA 2B58A 4FD7A 2REFA 1NSLA 5EC4A 2JLMA 4CAEA 3IWEA 5DWMA 2C27A 2YNEA 3DDDA 4JXQA 4UFVA 1S3ZA 4MFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWD A;  2D4P A;  4ZBG A;  3T90 A;  1QSM A;  4OLL A;  3V8I A;  1NMT A;  3F8K A;  5CNP A;  3OWC A;  2HQY A;  3TT2 A;  4AG7 A;  2ZW6 A;  4NXY A;  2X7B A;  4AVB A;  2ZW5 A;  1CJW A;  2B5G A;  2FT0 A;  4XNH C;  4Y49 B;  4M3S A;  1M1D A;  2H5M A;  3TE4 A;  4UWJ A;  2PSW A;  4MHD A;  1M44 A;  1BOB A;  5C88 A;  1K4J A;  3GYA A;  4XPK A;  3D3S A;  4KOX A;  2GE3 A;  1OZP A;  2Y0M A;  1Y9W A;  4QUS A;  2DXQ A;  4KOY A;  4HNW B;  5HMN A;  5F47 A;  2ZPA A;  3K9U A;  4KOS A;  4KVM E;  4EVY A;  3CXS A;  4JLY A;  1M4D A;  2B4D B;  4B5P B;  2R7H A;  2O28 A;  1Y7R A;  2OB0 A;  4K30 A;  3ZZI A;  4IF5 A;  5F48 A;  2J8N A;  2Q4V A;  1LRZ A;  3TOA A;  2VXK A;  4L8A A;  2PR1 A;  3BLN A;  5H86 A;  2QEC A;  4KOV A;  4II9 A;  4BMH A;  4E0A A;  1YX0 A;  5KTD A;  4QBJ A;  1VKC A;  1BO4 A;  2OZG A;  1N71 A;  4KOT A;  4FD4 A;  3PP9 A;  3PGP A;  1WK4 A;  1IYL A;  4R3L A;  2WPX A;  1VHS A;  4R3K A;  1MJ9 A;  2I00 A;  2Z11 A;  3R9F A;  4CAV A;  3TOB A;  3JUW A;  3QAH A;  5EBV A;  1I1D A;  4KUA A;  4AVC A;  2VZZ A;  4KVX A;  2G0B A;  3RYO A;  1NE9 A;  3C26 A;  3BJ8 A;  4KUB A;  4H6U A;  3D2P A;  3FIX A;  4CRZ B;  1QSO A;  1XF8 A;  2Q4Y A;  2OU2 A;  4UWI A;  3I3G A;  5JQ4 A;  1L0C A;  1KUV A;  2EVN A;  5IV0 A;  2PRB A;  2R1I A;  3EC4 A;  3CXQ A;  4LX9 A;  2OZH A;  2F5I A;  3GKR A;  3EXN A;  2FCK A;  3PZJ A;  4R87 A;  1CM0 A;  3FYN A;  3MGD A;  4FD5 A;  3F0A A;  4CAW A;  3FBU A;  1YVK A;  2R8V A;  3P2H A;  5GCN A;  1Q2C A;  4KOR A;  1KUX A;  3LOD A;  4M85 A;  4PSW A;  1Z9U A;  1SQH A;  1YK3 A;  2D4O A;  4XPL A;  5ISV A;  1MK4 A;  4XPD B;  2Q0Y A;  4KVO E;  1QSR A;  4PK2 A;  4IUS A;  5F49 A;  2PR8 A;  3UY5 A;  3S6F A;  3S6K A;  3S6H A;  4I49 A;  5IX3 A;  3P2F A;  3R1K A;  1P0H A;  4KLW A;  2B3V A;  3TCV A;  3G3S A;  4NSQ A;  3DSB A;  4ORF A;  2BEI A;  4CAX A;  2B3U A;  1Z4R A;  3I9S A;  2FXF A;  4DNC A;  3QB8 A;  3CXP A;  1S60 A;  1IIC A;  2JEV A;  2CNS A;  1KUY A;  4HNX B;  1PU9 A;  4MY3 A;  1RXT A;  2PC1 A;  2JDD A;  2Q44 A;  3LD2 A;  2NMT A;  3TO9 A;  4JWP A;  2R98 A;  3IWG A;  1XMT A;  4YRH A;  1IID A;  2WPW A;  2VBQ A;  3NE7 A;  1I12 A;  3R9G A;  4YGO A;  4U5Y A;  4ONU A;  4F0Y A;  1S5K A;  2HUZ A;  1PUA A;  1UFH A;  1XEB A;  2FS5 A;  4UA3 A;  4AG9 A;  3SXO A;  2FSR A;  4AVA A;  4CRY B;  3TO6 A;  4JD6 A;  1XE4 A;  2K5T A;  4MY0 A;  4Y49 C;  5J8F A;  1B87 A;  3R95 A;  4L89 A;  3R96 A;  4QVT A;  4NEX A;  3GY9 A;  1IYK A;  1YLE A;  2ZW7 A;  4OAD A;  4MBU A;  1P4N A;  2VQY A;  3R9E A;  2PQ8 A;  2FE7 A;  4YFJ A;  2CNM A;  2QIR A;  2JDC A;  2P6G A;  4QB9 A;  4B5O A;  2FIA A;  1S7N A;  2ARH A;  2B4D A;  4RS2 A;  3D8P A;  3SHP A;  4B5P A;  1U6M A;  5HH1 A;  2VZY A;  4XNH B;  2CY2 A;  2KCW A;  2B5G B;  2P6F A;  3EY5 A;  4KOU A;  1S7F A;  3TFY A;  2G3T A;  4KOW A;  2REE A;  2VEZ A;  1RO5 A;  3JVN A;  3W91 A;  1S7K A;  2P0W A;  5I0C A;  3WR7 A;  3DR8 A;  3B8G A;  2VI7 A;  1Z4E A;  2CNT A;  4H89 A;  2Q7B A;  4LUA A;  2ATR A;  5KTC A;  1V0C A;  1GHE A;  3KKW A;  4AB7 A;  3E0K A;  3VWE A;  1KZF A;  1YRE A;  3T9Y A;  2GIV A;  5E96 A;  4E2A A;  4RI1 A;  1WWZ A;  3W6S A;  4E8O A;  3W6X A;  3BJ7 A;  2B4B A;  3F5B A;  4JXR A;  5DWN A;  1YVO A;  4QC6 A;  2Z10 A;  4UBR A;  1Q2Y A;  2GAN A;  4JJX A;  2ZXV A;  1M4G A;  3DNS A;  2FL4 A;  3SXN A;  1ON0 A;  2ZW4 A;  4J3G A;  2BUE A;  2AE6 A;  2FIW A;  1QSN A;  4R9M A;  3TTH A;  1I21 A;  1M4I A;  1YR0 A;  4R57 A;  2BSW A;  1QST A;  2QML A;  4HNY B;  5FVJ A;  2OZU A;  4H6Z A;  5F46 A;  1MJB A;  2IL4 A;  1J4J A;  2BL1 A;  4U9Y A;  3TO7 A;  4KLV A;  4F6A A;  2AJ6 A;  4KZT A;  5J8C A;  3DR6 A;  4FD6 A;  2G3A A;  2HV2 A;  5KTA A;  3G8W A;  2Z0Z A;  2P6E A;  4XPD C;  2Q04 A;  1Y9K A;  3FRM A;  3D2M A;  3N7Z A;  4PSX A;  4MI4 A;  3H4Q A;  3FB3 A;  3IGR A;  4PV6 A;  2I79 A;  5H84 A;  2PDO A;  3ZJ0 A;  3EFA A;  1YGH A;  1B6B A;  4OAE A;  4PK3 A;  2J8M A;  2EUI A;  2J8R A;  4HKF A;  1Q2D A;  4GS4 A;  1IB1 E;  1S7L A;  1XIX A;  5JPH A;  3FXT A;  1MJA A;  4MJ8 A;  4NF1 A;  3EO4 A;  1R57 A;  2RC4 A;  1FY7 A;  2A4N A;  3S6G A;  5IB0 A;  4CS0 B;  4NCZ A;  1TIQ A;  5C82 A;  4X5K A;  2OH1 A;  4U9Z A;  3FNC A;  2B58 A;  4FD7 A;  2REF A;  1NSL A;  5EC4 A;  2JLM A;  5DWM A;  2C27 A;  3DDD A;  4JXQ A;  1S3Z A; 
#chains in the Genus database with same CATH topology
 2YGW A;  3VWD A;  2D4P A;  4YWY A;  4ZBG A;  4MFZ A;  3K2K A;  3T90 A;  3H5Z A;  4M6I A;  1QSM A;  2ZEG A;  3V38 A;  2OR4 A;  4OLL A;  3V8I A;  4F9U A;  5J1Q A;  4A30 A;  1NMT A;  3F8K A;  2OOT A;  3BI1 A;  5CNP A;  3OWC A;  1GYT A;  3PB8 X;  5A27 A;  2HQY A;  7CPA A;  4P4B A;  2JBJ A;  3TT2 A;  3PRT A;  4AG7 A;  4ZY0 A;  2ZW6 A;  4NXY A;  2PRQ A;  2X7B A;  2CXA A;  4A31 A;  4AVB A;  2PJ3 A;  2ZW5 A;  1CJW A;  4A32 A;  4R76 A;  4B13 A;  1KWM A;  1VHE A;  2B5G A;  3FMC A;  4JZ0 A;  4Q38 A;  2FT0 A;  2CTC A;  4XNH C;  4Y49 B;  1LOK A;  4M3S A;  1M1D A;  2H5M A;  4NJR A;  3TE4 A;  2ZEO A;  3IFE A;  3H8E A;  5D8N A;  3WC7 A;  4G1P A;  4OP4 A;  4UWJ A;  1IOF A;  2PSW A;  4HPS A;  4MHD A;  3H8G A;  1M44 A;  3JTK A;  3WAB A;  1BOB A;  5C88 A;  1YQE A;  1HEE A;  3PBE A;  4A39 A;  1K4J A;  3GYA A;  4A2Z A;  4XPK A;  3D3S A;  4KOX A;  1ZG7 A;  2GE3 A;  2GFQ A;  1OZP A;  2QVP A;  8CPA A;  1Q7L A;  2F8H A;  2Y0M A;  4ZY1 A;  1Y9W A;  4QUS A;  4MRI A;  1TKF A;  4P4I A;  3LAC A;  2DXQ A;  2ZEL A;  4KOY A;  4MXU A;  4ZYQ A;  3SHP A;  2CIJ A;  3JRU A;  4HNW B;  5HMN A;  5AG6 A;  4P4D A;  3PB4 X;  5F47 A;  1M4L A;  2ZPA A;  3K9U A;  4KOS A;  4PXD A;  1JWQ A;  2ZEF A;  4KVM E;  3HLP A;  4UCN A;  4EVY A;  3B35 A;  1YLO A;  2PIZ A;  4R6T A;  1LAM A;  3CXS A;  4JLY A;  1M4D A;  2B4D B;  3D7H A;  3KHX A;  4B5P B;  2R7H A;  4MCP A;  4B10 A;  3DLJ A;  2O28 A;  1Y7R A;  2OB0 A;  4K30 A;  3ZZI A;  4IF5 A;  4MFP A;  4X3R A;  2ZEH A;  5F48 A;  2J8N A;  5A28 A;  1YSJ A;  2Q4V A;  1YW4 A;  4A38 A;  1LRZ A;  3TOA A;  2VXK A;  4L8A A;  4C68 A;  3CZX A;  2PR1 A;  3BLN A;  5H86 A;  3SJG A;  5K8P A;  2Z3P A;  2QEC A;  4KOV A;  4II9 A;  4EWT A;  2EWB A;  4BMH A;  1Z8X A;  5I4M A;  2WUU A;  4E0A A;  1YX0 A;  5KTD A;  4UEZ A;  4QBJ A;  1TKJ A;  4X8I A;  4P4E A;  2PIY A;  4NGS A;  2PJ9 A;  1VKC A;  1BO4 A;  2GLJ A;  2OZG A;  2Z3N A;  4B6Z A;  1N71 A;  4PXE A;  2V8V A;  4KOT A;  1Z8T A;  4FD4 A;  2XEF A;  3PP9 A;  4P44 A;  1VGY A;  3PGP A;  4PPZ A;  3PFO A;  1WK4 A;  3GUX A;  1IYL A;  4H2K A;  4NGQ A;  2WPX A;  4R3L A;  3KAS A;  1VHS A;  4R3K A;  1MJ9 A;  1ZG8 A;  2I00 A;  4P4F A;  4P10 A;  2Z11 A;  5G22 A;  3R9F A;  4CAV A;  5DS0 A;  1NSA A;  5G21 A;  4GXH A;  3SI0 A;  3TOB A;  3QNV A;  2XEI A;  3JUW A;  3PB7 X;  5K8N A;  3QAH A;  5EBV A;  1I1D A;  2G9D A;  4KUA A;  4AVC A;  3SJX A;  1YME A;  2VZZ A;  3I1U A;  4KVX A;  2G0B A;  5THW A;  3RYO A;  4CGL A;  1NE9 A;  3C26 A;  4PXC A;  3PBB A;  1IY7 A;  2ZEM A;  4NGT A;  1ELM P;  5K8M A;  3BJ8 A;  1CPS A;  2C6P A;  4KSA A;  4MHP A;  4KUB A;  4A95 A;  3B2Y A;  1X10 A;  4H6U A;  2V8D A;  3D2P A;  4Z65 A;  3FIX A;  4UIB A;  3IEH A;  5D29 A;  1QSO A;  4CRZ B;  1XF8 A;  2Q4Y A;  2OU2 A;  2PJ5 A;  1Y0R A;  3KZW A;  4UWI A;  4WJB A;  3I3G A;  4W9Y A;  3D7D A;  5JQ4 A;  4NFR A;  1L0C A;  1KUV A;  2EVN A;  1DE4 C;  3D7F A;  5IV0 A;  4NGN A;  2PRB A;  2R1I A;  3EC4 A;  3CXQ A;  1Z2L A;  3CDX A;  2IQ6 A;  4LX9 A;  2OZH A;  2F5I A;  3GKR A;  4M6H A;  2CTB A;  2FCK A;  3EXN A;  3PZJ A;  2PJ6 A;  1CM0 A;  3IO1 A;  4R87 A;  3FYN A;  3MGD A;  4FD5 A;  2RB7 A;  3F0A A;  4CAW A;  3FBU A;  3IIB A;  1F57 A;  1YVK A;  5IB9 A;  2R8V A;  3P2H A;  2I3C A;  2IJZ A;  5GCN A;  1Q2C A;  1ZG9 A;  2BO9 A;  2FVG A;  4KOR A;  4A37 A;  2AFU A;  1KUX A;  1X12 A;  3LOD A;  4M85 A;  2O4H A;  2PJC A;  1Z9U A;  2HB6 A;  1SQH A;  1YK3 A;  2ABZ A;  2D4O A;  1ELL P;  1MK4 A;  2PJ4 A;  2PJA A;  4IK2 A;  4XPL A;  5AG5 A;  4XPD B;  3S9M A;  1BLL E;  1BPM A;  2Q0Y A;  2QYV A;  4KVO E;  3D67 A;  2WYR A;  1QSR A;  2J9A A;  2PJB A;  4IUS A;  4MHZ A;  4PK2 A;  5F49 A;  2PR8 A;  3UY5 A;  1R43 A;  3S6F A;  3S6K A;  4PXB A;  1CP7 A;  4PSW A;  3S6H A;  4I49 A;  5IX3 A;  2NYQ A;  3N5F A;  3P2F A;  1TKH A;  1CX8 A;  4TNU A;  3R1K A;  1CG2 A;  1P0H A;  3RAM A;  4OID A;  2RFH A;  4KSI A;  2ZED A;  4KLW A;  2B3V A;  3TCV A;  3G3S A;  4NSQ A;  3DSB A;  2O53 A;  4ORF A;  2BEI A;  5EMI A;  4CYQ A;  4CAX A;  4UEE A;  2B3U A;  2EK8 A;  3TC8 A;  1Z4R A;  3I9S A;  2FXF A;  4DNC A;  4NGM A;  2WZN A;  1ZO0 A;  3NH8 A;  3QB8 A;  5JGF A;  2Q51 A;  4C7I A;  3CXP A;  3QAY A;  1S60 A;  1IIC A;  2JEV A;  2CNS A;  1KUY A;  2F7V A;  2ZOF A;  4HNX B;  1PU9 A;  4MY3 A;  1RXT A;  2PC1 A;  2JDD A;  2Q44 A;  2DPS A;  3LD2 A;  2NMT A;  2QJ8 A;  4NJQ A;  3FVL A;  4P6Y A;  4UCP A;  4PQA A;  3TO9 A;  4CYO A;  4FWU A;  5K8O A;  4JWP A;  2R98 A;  5F09 A;  3PEI A;  3IWG A;  4OC3 A;  5HVH A;  1CBX A;  1XMT A;  2PE3 A;  4FBE A;  4OC1 A;  4YRH A;  1IID A;  1XJO A;  2WPW A;  3ISX A;  2VBQ A;  3NFZ A;  1H8L A;  1I12 A;  3NE7 A;  3R9G A;  4YGO A;  1FNO A;  4RN7 A;  4U5Y A;  3NH4 A;  4ONU A;  5G1Z A;  3B3W A;  4F0Y A;  2BCO A;  2XEJ A;  5HXD A;  1S5K A;  2HUZ A;  1PUA A;  3GB0 A;  5HVG A;  1UFH A;  3B3C A;  1XEB A;  2FS5 A;  4UA3 A;  4AG9 A;  3SXO A;  2FSR A;  3HUV A;  4AVA A;  4CRY B;  3TO6 A;  3B3T A;  4JD6 A;  1XE4 A;  2K5T A;  4MY0 A;  4ZX8 A;  4Y49 C;  5J8F A;  1B87 A;  4AXV A;  1LFW A;  4Q7A A;  3R95 A;  3V7Z A;  2Q4Z A;  4K3N A;  4L89 A;  3CPX A;  2EO8 A;  3DGV A;  4ZI6 A;  3R96 A;  5LYL A;  2C6G A;  4QVT A;  4NEX A;  3GY9 A;  1PYT B;  2PCU A;  2POK A;  1IYK A;  1QMU A;  4CGN A;  1YLE A;  2PJ2 A;  1HDQ A;  4UF4 A;  2ZW7 A;  2Q7S A;  4OIW A;  4OAD A;  3FED A;  2BOA A;  3FEE A;  1P4N A;  4MBU A;  4MFQ A;  4ZY2 A;  2VQY A;  1AMP A;  3R9E A;  2CF4 A;  2PQ8 A;  4CYN A;  2FE7 A;  4CGO A;  4YFJ A;  2CNM A;  4Q36 A;  2QIR A;  4MFK A;  3GIU A;  2JDC A;  2V8H A;  2AFM A;  4C2Y A;  2P6G A;  3WT4 A;  5LRG A;  4IHM A;  1TXR A;  4QB9 A;  1IOI A;  2FIA A;  4B5O A;  1DTD A;  1S7N A;  2ARH A;  2B4D A;  2ZEN A;  3D8P A;  1UWY A;  1IU8 A;  2AFX A;  3NE8 A;  4OKO A;  1U6M A;  4B5P A;  3KI9 A;  2V8G A;  2YNC A;  2VZY A;  3CT9 A;  2Z3M A;  3FJU A;  4LQG A;  4XNH B;  5HH1 A;  2CY2 A;  4CAF A;  2KCW A;  2B5G B;  1XRY A;  2P6F A;  3EY5 A;  4KOU A;  1S7F A;  1R3N A;  2YNC C;  4P4J A;  4UEF A;  3TFY A;  4RS2 A;  4GM5 A;  3VH9 A;  2G3T A;  4NGR A;  1LCP A;  4UCM A;  5CPA A;  5ISV A;  4KOW A;  3H8F A;  2GRE A;  2ZOG A;  2REE A;  2VEZ A;  1RO5 A;  3A9L A;  3JVN A;  4DYO A;  3W91 A;  1S7K A;  2GLF A;  3IC1 A;  4MCS A;  4EME A;  4A94 A;  2P0W A;  3LWU A;  5I0C A;  3RBU A;  4BD9 A;  3WR7 A;  3FEC A;  1VIX A;  4JYW A;  1AYE A;  4EFD A;  3D4U A;  3DR8 A;  3B8G A;  2VI7 A;  2ODF A;  2V77 A;  1Z4E A;  3FH4 A;  4R8F A;  5ELY A;  5CBM A;  2JBK A;  3IU1 A;  4FUU A;  1QQ9 A;  3K9T A;  2Z3L A;  4DUK A;  5AG4 A;  4BBH A;  3KR4 A;  4CGP A;  2CNT A;  4H89 A;  2Q7B A;  4LUA A;  3T8W A;  2ATR A;  5KTC A;  4OME A;  3KGQ A;  4MHN A;  1CPX A;  1V0C A;  2ANP A;  2Q43 A;  3GLJ A;  3SJF A;  2NSM A;  4A33 A;  1GHE A;  3KKW A;  2C1C A;  4AB7 A;  3E0K A;  3VWE A;  1KZF A;  1YRE A;  3FX6 A;  1ARL A;  2JEW A;  3T9Y A;  2GIV A;  5HVF A;  4KS9 A;  5E96 A;  4C2Z A;  3B3S A;  1VHO A;  1ARM A;  4RI1 A;  4E2A A;  5AG7 A;  3D66 A;  1WWZ A;  3W6S A;  4CPA A;  4E8O A;  1HDU A;  2Z3O A;  3W6X A;  4B12 A;  1F2P A;  3BJ7 A;  1ZLI A;  2B4B A;  4ONW A;  4F8Z A;  2AFO A;  4KSF A;  1TF8 A;  2AFZ A;  3F5B A;  4JXR A;  3KQX A;  5DWN A;  3VAT A;  5JH9 A;  1YVO A;  4QC6 A;  2Z10 A;  3CPA A;  4UBR A;  1Q2Y A;  1XFO A;  3KR5 A;  2GAN A;  1Z5R A;  4JJX A;  2ZXV A;  1M4G A;  2FL4 A;  3DNS A;  3SXN A;  1ON0 A;  2ZW4 A;  2GU2 A;  4J3G A;  4B11 A;  3TX8 A;  2YND A;  2PJ8 A;  2BUE A;  2AE6 A;  1JQG A;  2FIW A;  1QSN A;  4P45 A;  4R9M A;  3TTH A;  1I21 A;  1M4I A;  3IWW A;  3WC6 A;  1YR0 A;  3VAR A;  4FAI A;  1Y7E A;  2EBJ A;  2DF5 A;  1PCA A;  3MN8 A;  4R57 A;  2BSW A;  1FT7 A;  1XBU A;  1XMB A;  1OBR A;  3PFE A;  4LQ6 A;  1ZLH A;  4O23 A;  1QST A;  2DPT A;  2QML A;  4NGP A;  4HNY B;  5AGE A;  5FVJ A;  1AUG A;  2OZU A;  4H6Z A;  5F46 A;  1MJB A;  2IL4 A;  1J4J A;  2AFW A;  2BL1 A;  3KL9 A;  3B7I A;  4U9Y A;  3BHX A;  3TO7 A;  3B3V A;  4KLV A;  3PB6 X;  2PVW A;  4F6A A;  2AJ6 A;  2PJ0 A;  4KZT A;  3SI2 A;  5J8C A;  3DR6 A;  4FD6 A;  2G3A A;  2HV2 A;  2PJ7 A;  4OC5 A;  5KTA A;  4X2T A;  4B14 A;  3G8W A;  2Z0Z A;  2P6E A;  3D68 A;  4XPD C;  1CP6 A;  4C7H A;  2ZEP A;  2Q04 A;  1Y9K A;  4MMO A;  4WWV A;  3KHZ A;  3IJ3 A;  4OC4 A;  2IMO A;  3KQZ A;  4OC0 A;  2WSA A;  3S9N A;  4BIN A;  3FRM A;  3D2M A;  3N7Z A;  4MCQ A;  4PSX A;  4MI4 A;  1YW6 A;  1LAN A;  2Z3K A;  3H4Q A;  3SI1 A;  3FB3 A;  3IGR A;  4M6G A;  4PV6 A;  4UIA A;  5LYD A;  2I79 A;  5LYF A;  1EE3 P;  5H84 A;  2PDO A;  4F9V A;  3ZJ0 A;  2C6C A;  1Z8L A;  2XEG A;  1YGH A;  1B6B A;  3EFA A;  4OAE A;  4PK3 A;  2J8M A;  2EUI A;  4C2X A;  2J8R A;  4HKF A;  1IGB A;  1Q2D A;  6CPA A;  4GS4 A;  5LRK A;  1IB1 E;  5LRJ A;  4CGM A;  2AFS A;  1S7L A;  2VL1 A;  4MFL A;  1XIX A;  4YU9 A;  5LYI A;  3IU2 A;  4CYP A;  5JPH A;  2PVV A;  3BXM A;  3ISZ A;  3FXT A;  1LAP A;  1MJA A;  2EK9 A;  4ZGY B;  4MJ8 A;  4TWE A;  4MHY A;  3RNZ A;  1TF9 A;  4NF1 A;  3EO4 A;  1R57 A;  3D7G A;  5G20 A;  5JM6 A;  2RC4 A;  1FY7 A;  2A4N A;  3S6G A;  5IB0 A;  4UFW A;  4CS0 B;  4DJL A;  4NCZ A;  3LMS A;  1Y0Y A;  1TIQ A;  4OC2 A;  2ZEE A;  4UFX A;  3RZA A;  5C82 A;  4X5K A;  1Z8W A;  3MRU A;  2DEA A;  2OH1 A;  5BWA B;  1F2O A;  4MCR A;  3L2N A;  4U9Z A;  3NH5 A;  3FNC A;  4F0X A;  3S9L A;  2PJ1 A;  4IAV A;  2B58 A;  3FF3 A;  1XOV A;  4FD7 A;  4ZX9 A;  2REF A;  3SJE A;  3WC5 A;  3NA6 A;  3PB9 X;  5EC4 A;  1BPN A;  2JLM A;  1NSL A;  4R7M A;  2HC9 A;  4CAE A;  1BAV A;  3IWE A;  1A2Z A;  5DWM A;  3BI0 A;  2C27 A;  2YNE A;  3DDD A;  1RTQ A;  4JXQ A;  4UFV A;  4RUH A;  1S3Z A;  3RO0 A;  4MFJ A; 
#chains in the Genus database with same CATH homology
 2YGW A;  3VWD A;  2D4P A;  4ZBG A;  4MFZ A;  3T90 A;  3H5Z A;  1QSM A;  4OLL A;  3V8I A;  4A30 A;  1NMT A;  3F8K A;  5CNP A;  3OWC A;  5A27 A;  2HQY A;  3TT2 A;  4AG7 A;  2ZW6 A;  4NXY A;  2X7B A;  2CXA A;  4A31 A;  4AVB A;  2ZW5 A;  1CJW A;  4A32 A;  4B13 A;  2B5G A;  4Q38 A;  2FT0 A;  4XNH C;  4Y49 B;  4M3S A;  1M1D A;  2H5M A;  3TE4 A;  4UWJ A;  2PSW A;  4MHD A;  1M44 A;  3JTK A;  1BOB A;  5C88 A;  1K4J A;  3GYA A;  4A2Z A;  4XPK A;  3D3S A;  4KOX A;  2GE3 A;  1OZP A;  2Y0M A;  1Y9W A;  4QUS A;  2DXQ A;  4KOY A;  4HNW B;  5HMN A;  5AG6 A;  5F47 A;  2ZPA A;  3K9U A;  4KOS A;  4KVM E;  4UCN A;  4EVY A;  3CXS A;  4JLY A;  1M4D A;  2B4D B;  4B5P B;  2R7H A;  4B10 A;  2O28 A;  1Y7R A;  2OB0 A;  4K30 A;  3ZZI A;  4IF5 A;  4MFP A;  5F48 A;  2J8N A;  5A28 A;  2Q4V A;  1LRZ A;  3TOA A;  2VXK A;  4L8A A;  4C68 A;  2PR1 A;  3BLN A;  5H86 A;  2Z3P A;  2QEC A;  4KOV A;  4II9 A;  4BMH A;  2WUU A;  4E0A A;  1YX0 A;  5KTD A;  4QBJ A;  1VKC A;  1BO4 A;  2OZG A;  2Z3N A;  1N71 A;  4KOT A;  4FD4 A;  3PP9 A;  3PGP A;  1WK4 A;  1IYL A;  4R3L A;  2WPX A;  1VHS A;  4R3K A;  1MJ9 A;  2I00 A;  5G22 A;  2Z11 A;  3R9F A;  4CAV A;  5G21 A;  3TOB A;  3JUW A;  3QAH A;  5EBV A;  1I1D A;  4KUA A;  4AVC A;  2VZZ A;  4KVX A;  2G0B A;  3RYO A;  4CGL A;  1NE9 A;  3C26 A;  3BJ8 A;  4KSA A;  4A95 A;  4KUB A;  4H6U A;  3D2P A;  3FIX A;  4CRZ B;  1QSO A;  1XF8 A;  2Q4Y A;  2OU2 A;  4UWI A;  3I3G A;  5JQ4 A;  1L0C A;  1KUV A;  2EVN A;  5IV0 A;  2PRB A;  2R1I A;  3EC4 A;  3CXQ A;  4LX9 A;  2OZH A;  2F5I A;  3GKR A;  3EXN A;  2FCK A;  3PZJ A;  4R87 A;  1CM0 A;  3FYN A;  3MGD A;  4FD5 A;  3F0A A;  4CAW A;  3FBU A;  1YVK A;  2R8V A;  3P2H A;  5GCN A;  1Q2C A;  4KOR A;  1KUX A;  3LOD A;  4M85 A;  4PSW A;  1Z9U A;  1SQH A;  1YK3 A;  2D4O A;  4XPL A;  5ISV A;  1MK4 A;  5AG5 A;  4XPD B;  2Q0Y A;  4KVO E;  1QSR A;  4PK2 A;  4IUS A;  5F49 A;  2PR8 A;  3UY5 A;  3S6F A;  3S6K A;  3S6H A;  4I49 A;  5IX3 A;  3P2F A;  3R1K A;  1P0H A;  4KLW A;  2B3V A;  3TCV A;  3G3S A;  4NSQ A;  3DSB A;  4ORF A;  2BEI A;  4CYQ A;  4CAX A;  2B3U A;  1Z4R A;  3I9S A;  2FXF A;  4DNC A;  1ZO0 A;  3QB8 A;  4C7I A;  3CXP A;  1S60 A;  1IIC A;  2JEV A;  2CNS A;  1KUY A;  4HNX B;  1PU9 A;  4MY3 A;  1RXT A;  2PC1 A;  2JDD A;  2Q44 A;  2DPS A;  3LD2 A;  2NMT A;  4UCP A;  3TO9 A;  4CYO A;  4JWP A;  2R98 A;  3IWG A;  1XMT A;  4YRH A;  1IID A;  2WPW A;  2VBQ A;  3NE7 A;  1I12 A;  3R9G A;  4YGO A;  4U5Y A;  4ONU A;  5G1Z A;  4F0Y A;  1S5K A;  2HUZ A;  1PUA A;  1UFH A;  1XEB A;  2FS5 A;  4UA3 A;  4AG9 A;  3SXO A;  2FSR A;  4AVA A;  4CRY B;  3TO6 A;  4JD6 A;  1XE4 A;  2K5T A;  4MY0 A;  4Y49 C;  5J8F A;  1B87 A;  3R95 A;  4L89 A;  3R96 A;  4QVT A;  4NEX A;  3GY9 A;  4CGN A;  1IYK A;  1YLE A;  2ZW7 A;  4OAD A;  4MBU A;  1P4N A;  4MFQ A;  2VQY A;  3R9E A;  2PQ8 A;  4CYN A;  2FE7 A;  4CGO A;  4YFJ A;  2CNM A;  4Q36 A;  2QIR A;  4MFK A;  2JDC A;  4C2Y A;  2P6G A;  4QB9 A;  4B5O A;  2FIA A;  1S7N A;  2ARH A;  2B4D A;  4RS2 A;  3D8P A;  3SHP A;  4B5P A;  1U6M A;  2YNC A;  5HH1 A;  2VZY A;  4CAF A;  2Z3M A;  4XNH B;  2CY2 A;  2KCW A;  2B5G B;  2P6F A;  3EY5 A;  4KOU A;  1S7F A;  2YNC C;  3TFY A;  2G3T A;  4UCM A;  4KOW A;  2REE A;  2VEZ A;  3JVN A;  1RO5 A;  3A9L A;  3W91 A;  1S7K A;  2P0W A;  5I0C A;  3WR7 A;  3DR8 A;  3B8G A;  2VI7 A;  1Z4E A;  3IU1 A;  2Z3L A;  5AG4 A;  4BBH A;  4CGP A;  2CNT A;  4H89 A;  2Q7B A;  4LUA A;  2ATR A;  5KTC A;  1V0C A;  4A33 A;  1GHE A;  3KKW A;  4AB7 A;  3E0K A;  3VWE A;  1KZF A;  1YRE A;  3T9Y A;  2GIV A;  4KS9 A;  5E96 A;  4C2Z A;  4E2A A;  4RI1 A;  5AG7 A;  1WWZ A;  3W6S A;  4E8O A;  2Z3O A;  3W6X A;  4B12 A;  3BJ7 A;  2B4B A;  4KSF A;  3F5B A;  4JXR A;  5DWN A;  1YVO A;  4QC6 A;  2Z10 A;  4UBR A;  1Q2Y A;  2GAN A;  4JJX A;  2ZXV A;  1M4G A;  3DNS A;  2FL4 A;  3SXN A;  1ON0 A;  2ZW4 A;  4J3G A;  4B11 A;  2YND A;  2BUE A;  2AE6 A;  2FIW A;  1QSN A;  4R9M A;  3TTH A;  1I21 A;  1M4I A;  1YR0 A;  4R57 A;  2BSW A;  1QST A;  2DPT A;  2QML A;  4HNY B;  5AGE A;  5FVJ A;  2OZU A;  4H6Z A;  5F46 A;  1MJB A;  2IL4 A;  1J4J A;  2BL1 A;  4U9Y A;  3TO7 A;  4KLV A;  4F6A A;  2AJ6 A;  4KZT A;  5J8C A;  3DR6 A;  4FD6 A;  2G3A A;  2HV2 A;  5KTA A;  4B14 A;  3G8W A;  2Z0Z A;  2P6E A;  4XPD C;  4C7H A;  2Q04 A;  1Y9K A;  2WSA A;  3FRM A;  3D2M A;  3N7Z A;  4PSX A;  4MI4 A;  2Z3K A;  3H4Q A;  3FB3 A;  3IGR A;  4PV6 A;  2I79 A;  5H84 A;  2PDO A;  3ZJ0 A;  3EFA A;  1YGH A;  1B6B A;  4OAE A;  4PK3 A;  2J8M A;  2EUI A;  4C2X A;  2J8R A;  4HKF A;  1Q2D A;  4GS4 A;  1IB1 E;  4CGM A;  1S7L A;  4MFL A;  1XIX A;  3IU2 A;  4CYP A;  5JPH A;  3FXT A;  4ZGY B;  1MJA A;  4MJ8 A;  4NF1 A;  3EO4 A;  1R57 A;  5G20 A;  2RC4 A;  1FY7 A;  2A4N A;  3S6G A;  5IB0 A;  4UFW A;  4CS0 B;  4NCZ A;  1TIQ A;  4UFX A;  5C82 A;  4X5K A;  2OH1 A;  5BWA B;  4U9Z A;  3FNC A;  4F0X A;  2B58 A;  4FD7 A;  2REF A;  1NSL A;  5EC4 A;  2JLM A;  4CAE A;  3IWE A;  5DWM A;  2C27 A;  2YNE A;  3DDD A;  4JXQ A;  4UFV A;  1S3Z A;  4MFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...