4HKXB

Influenza hemagglutinin in complex with ch67 fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
201
Chain Sequence
b'QSALTQPPSVSVAPGQTATITCGGNNIGRKRVDWFQQKPGQAPVLVVYERFSDSNSGTTATLTISRVEAGDEADYYCQVWDSDSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 45
structure length 201
sequence length 211
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkxB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkxB01
2F8OA 5MERA 3C08L 1CLZL 4YFLI 4R4FH 3EDKA 3I6KA 3OPZL 2CKBB 2D9CA 3RWIA 1N4XL 1OSZB 1BM3L 5ICZA 3MV7A 1BJ1H 2CRYA 2YPLD 5F7HA 2XZAH 5J57B 4KI5D 1Q9WB 2R0ZL 5I18H 4IRJB 4DW2L 5IESL 4PGEB 1ETZA 3ARVA 5I1EL 3H9HB 5LAXA 2Q7YA 1MLCB 1NFIB 1QBLL 7FABH 1HXMA 2IADA 2Z4QA 2GK0A 1OPGL 2GITA 4PLKD 2Y07L 5J1SC 3QXWA 3LV3B 3TESA 2NY6D 1Q38A 4ZOAA 2HG5B 3MV9D 4J4PA 5D6DA 2CKNA 4OKDA 1MCBA 2EC8A 3BRGC 4K3DH 3THML 1IM3A 1DQQA 5JLZA 5J3HD 5I73B 2WLZA 3JVGC 2EDFA 4Y16A 5TQ2H 1FYTD 5T3ZL 2CSPA 2QR0B 4JHWH 4EDXA 4UZGA 4XBPA 2AXGB 5K59F 5IVOA 1DLFL 1WCBA 1IGIH 4WU5A 1MCRA 1WT5C 1CDBA 4XP6L 4LPCA 2OJEB 4R7NB 4ZYKB 1BFOA 1P4IL 4CVUA 2NYYD 3BPLB 3QIBB 3CNKA 1QEWB 1Y0LB 4HS3B 4ZUUA 2AV1A 1TZHB 3G6JE 3GDBA 4OB5H 1D5XB 4XXCC 5C0JA 1WAAA 4YX2L 4LARH 3O6FC 5DD5H 1LK2A 3MV7E 4JRXB 1WQVT 3M45A 3HCVA 1F8TL 3FHQA 1TNMA 4IHOB 1IM9B 3CGTA 4HS8L 2L7JA 4MNGB 5LKNA 3C5JA 1YNTB 5CD3B 2VSDA 3CDGA 2NY4C 1FBIL 2D7PA 1FZKA 1FL5A 3GMOA 4M7ZB 2ITDA 3QIUC 5ITBL 3MJ9A 2HKHH 2VRAA 2YOCA 4Y5VB 2CPCA 3QDGB 3W0WE 4YHPA 1HIMH 1JK8B 5IGXL 3B9EA 3MNWA 2V2XB 3S6CA 1ES0A 2NW2A 3AUVA 5KVFH 1YEIL 3DXAB 4KK5C 3VRJA 4KKNA 4MA7H 4JFZL 4XI5D 5EUKB 4EBQH 1IVLA 3QHFH 3B2UC 3EJJX 3IDYC 1SJXA 2BVTA 3TYGH 1JWMB 5TDOA 4N8CL 4UB0L 4O2FA 2OTUA 1XZ0A 1ZS8A 4YLQT 2HH0H 3BE1H 3FO2A 5EC2B 4AT6A 1HHKB 3OKMA 2GFBB 5IHZB 1Z2KA 3QUZC 4QRPB 1KCRH 3WIIL 1IKNC 3VFWA 4U1SA 2UUDK 5FYKE 4G8EA 1NDGA 4LMQE 2FEEI 4RMQA 1JGDB 4Q9CA 3MNZB 1RZIA 5LBSL 5HPOA 2YD9A 3CUPA 1U8QA 4YDVA 1I3UA 3GSNA 2PYEA 4LEXH 1MHPL 3NZ8B 5D2LA 1NC2A 3GMMB 2MOVA 3MRBB 2P5EA 4LKCA 1WAAE 1N6VA 4P3CH 5IEKA 1SBSH 4GO6B 4ZS6C 4JG1L 1JF1A 1T3FB 1BBJB 4HGWA 5GQBA 2XZQL 4JFFB 1Y6KR 1UA6L 1DN0A 1W0YT 2AV7A 2FATL 4YGAB 5GJTL 3EO0A 2WWKO 2R8SL 2IH1B 1R0AH 3X3GH 5A43C 4RFEA 5ECJE 1S3KH 3MCKB 5ID0B 1OD9A 4G80B 4OIIH 3VCLA 2J6EA 3BPOC 1EEZB 5F7MC 4K23L 1JHTB 2W65B 3ARGC 4I77H 4OGYH 1C08B 2IAND 4N0YH 5D9SA 1YEDB 1FPTL 4GSDH 3MNVB 5KSAD 5C0GB 3OKDA 1J0IA 2W9LA 4QGYA 3A0OA 1U8LB 3IJHA 4RGMB 5D7JA 4KQ4H 4O4YH 1CDIA 3RVVC 3SHSA 3S35L 1HNGA 3QWQB 3ALWA 4YIQA 3WXVH 4Y4HC 3OGOE 4YXLL 3BISA 2R4RH 1R3LB 5ICXA 4M4RA 3O6FB 3ZT6A 4GQ9L 5LCVH 5E2VL 3PUCA 4UIMA 2ADIB 4QT5B 2VKXA 4UT6H 3CSYB 5EN2A 3QUKA 5HGBA 4TUKH 1UH4A 1EEYA 2NY4B 1JWUA 2HAZA 3V5KB 2J88L 3QIUB 5D2LE 5IBTL 3KPOA 2P5EE 3W81A 3WHE0 3WHE1 3HC0A 1OSPL 35C8L 5IVXF 4NWUL 3INUL 3SQBA 4WDIB 1A14H 5HI5D 4OLXH 1XF4B 2JKXA 3QUYA 3D2UD 3IU4H 4YWGH 2G5RA 3IFPA 5CFHA 1NLDH 4GW4A 1U8HA 5DYOB 5FM5O 3UTSD 3WJLA 1ZHBB 1AE6L 4QHUB 1R3HA 2EH8H 3KPRD 3M1BB 4JFHD 2VLRB 2PXYB 2VXSH 5GIRB 5A2IH 2WINA 4ZFOL 4C56D 4MLIA 4LASL 3RPIA 3QUZB 4HWBA 3K46A 4LHUB 4DFIA 4WIQA 1BECA 1CD9B 5C86A 1CFVL 1I8KB 3EDEA 1Q72H 1AD0A 3SDCC 4QHMA 3RDTC 1KXTB 1AY1H 5BCAA 3O45B 1S8DB 4FFYL 2VITB 3K2UH 3GO1H 2W91A 3TJEL 5LQBL 4FQ1H 1UT9A 4CW1B 4DN3L 5LVEA 4FZEL 1A6ZA 1SYVB 1I3GH 1MPAL 4AMKH 3WKNA 4NRXA 2OL3B 4B0MM 3HE6C 4MB5A 4ORGB 3H9ZA 4CUCA 4EUPH 3SDAD 1W0WB 1CL7H 3BPOB 2JCCA 4U6YA 3KXFB 4N9GA 2BSTA 3ARGB 2V9QA 2VJXA 2G60L 3VXUD 2VLMD 3EFDL 1SEBB 4PJ7F 3O6MH 2DWDB 3GI8L 1KB5A 5EO0B 5GRVL 3Q2CA 3ZDXE 1XF2B 5DD6A 1X7QB 3EOTL 3WN5A 1P2CB 5D7KE 5KS9B 1M6OB 2HN7B 1A4KB 2X1QA 2AXFB 1T5XB 4KK9D 3VXQA 3ES6A 1HEZA 2IPKA 5GGTA 2C4XA 5IV2B 1DQMH 4HIJB 4OUUB 4Y4HB 4M6ML 1F6FB 4KJYA 3O8XC 3UPRB 4HW6A 3DV4A 5IK3A 3QUMH 1UWGL 3PHQA 1II4E 4NO0A 3G04A 5SV4A 5JHLH 1FZOA 2UYLA 4UNTA 1HSAB 2X89A 1EERB 2QHLA 4GW1A 5BV7C 32C2B 4KGLA 5DEFA 3TLRA 4P9HH 5FO9A 3KPTA 3K4ZA 3LRSB 1L7TL 3EHBC 4PYHA 1SY6H 4PJ5A 4N8VG 2KQNA 2C1PA 4DVRH 1TJGH 3CMGA 1U95A 5D7LA 2J8UB 5GS1A 2QQLL 3DRTB 2P43B 3VXSA 2AJZA 3ALPA 2RQ8A 3R1GH 3FQNB 4YFEA 5D72L 2H9GA 4PRIB 5DRXB 3KHOA 4D0BA 5B38B 3BP6B 5L0QB 2W0FA 4EKXA 3T0XA 2ZCHL 4PRPA 1PKQA 1YEFH 5D1QC 1D5IH 1LVEA 2Y72A 2CLRB 4EZMA 4WY7L 4FOMA 4U1GC 2XTJC 2DM3A 1HN1A 5IBUB 4ZMAT 1O7VA 3OWEA 4HZLA 5LXGL 1P4LB 4D9QE 2X41A 3EYVA 3SPVA 4FP8H 2VXVL 3BZFB 2AXJA 1K8IA 5E7BA 1FSKC 3SDCB 1YDPB 4G43B 1IAOA 4P4KB 4FTVD 1ZLSL 4J23A 1CICA 1XGYH 1F90L 3VFOA 2X4SA 1X6LA 1X5YA 3BD4A 4PJCE 3IFLH 3CVHL 3H42H 1RJLB 5F3BB 4G3YH 2YKLH 1PVHA 2IPTL 3HE6B 3PP4H 2XZCL 5C0IA 2OI9C 3VMPA 5IVNA 5T1MB 1U3HD 3MRDA 4XCCH 4N8VA 5IG7B 2X4OB 5IVZB 3T2OA 4R4BB 1RPQA 1QSEB 5D7LE 3RY4A 5MEND 3DIFB 2W38A 1LNUA 4GAFB 4QNPE 3CFCH 1C5BL 3EGSA 3TO4C 5DUBA 3TF7C 1CU4L 3WE6A 5IQ9A 5M7QA 3RVTC 1AXSB 4LDLB 4JPKH 4B41A 2DYPB 3MTRA 4KVCL 1YECL 3VGDA 5CILL 4LVOC 4NO5A 5KS9F 5IFJA 1ZOXA 3AREC 1A8JH 4K8RC 3ZYZA 5MHSE 1ZT1A 5F96L 1QHPA 4P2OC 3O8XB 3ZT5A 5DMYA 3KR3H 3Q0HA 3RA7L 1W72A 3MUZ1 3FT4A 5I1CL 2UZIL 1MRFL 3HFML 3IRPX 3G6JF 5LGJB 4MAYD 5HGHB 5C08B 3O4LB 5DQDL 3C9NB 3PWVB 1UVQB 4MD5A 4EXPX 1KIPB 5BV7B 2F9BT 1P7KB 3D9AH 3K81A 4WEMB 1GGUA 4LDOB 3P4MB 4P5TC 4U1KB 2CDGB 2Y7QA 5GGVL 1MCSA 4JFDA 5IHUH 1T1ZA 4S1SH 4EJ1C 3ARFC 5IHBA 1U8PA 5F9OL 5BQ7B 3GI9H 2GEEA 2XN9E 3QH3A 3PGDA 4PLOB 3RL1B 4GRWB 1I1YA 1T6VN 4L3EA 4Z7QF 3RKDC 3O6LH 5HGAB 2PKDA 3TWCL 5EU6D 4I3SL 1G7IA 1ADQL 4JRWA 2ESVD 2D7QA 3VFSB 3U7WH 3T2NH 1INQA 4HUWB 4I3RH 5EBLB 2VH5L 4M7LL 5D1QB 4N0UA 2IALA 3DMMD 5EPMA 5EU7E 3QXAA 1CK0L 3LQAC 3UEZA 1FVEB 3HR5A 3GHEL 4U1GB 2XTJB 3ZTJH 3MRPA 1V7ML 2MNUA 1T0NB 4MXWH 4XCYB 3PABA 1K2DB 5EZJB 2EYRA 4YAQB 4LNRB 2D0GA 3PWNA 5EB9A 3AM8C 2DLFL 4WU7A 1Q1JL 5BXFB 4JN2B 1QYGL 1T20B 1JV5B 3O6KH 1FSKB 4XPTL 5F9JA 1RD6A 2GSIB 1MVUA 1PG7W 3L7EB 1JGLH 5ANME 4C4KT 1XF5A 2NPLX 1QLRB 4IM8A 1CFSB 5DS8B 1JPSL 3KPNA 5FB8A 1DP0A 2W60A 2EIZB 2JJWA 3OPZH 2AABL 4Z0BL 1WAAF 2OI9B 4Y88A 4U1MA 1QR1B 5JQ6L 3D85B 4G42B 4OCSL 4DGIH 4JFDE 3VH8B 3H3KA 4YHNB 2R0ZH 3VWKA 2BERA 3VDCA 1S9WA 4L3EE 4EIZC 1WZKA 3D39A 3I6LE 4U6VH 4L9LC 3NBNA 4MD0A 3WKMH 5I1EH 5CZXD 4G7YL 4ZUVB 5E2WH 2BC4B 4D0DB 5ESAA 2M26A 5MP6L 1A7QL 2NY0C 4N0UE 1JGEA 1RUKL 4LVOB 1OPGH 1TCRA 2DIJA 4KKAC 4LLDA 3AREB 3NCBB 3BHBB 4DK3A 5IB2B 5DFWH 4LLVB 4XAKE 4P2OB 4GG6A 4PTTA 1OW0A 1UACL 5DJ8B 3UTTB 5HHQB 5D71H 3QPXL 4YDKL 1G9ML 1TETH 3DUUA 2GSGA 4HPYL 5SWSD 2R2BB 4QYOA 4R0LC 4RSVA 2Q6WB 3SY0A 5E5MB 3S3PA 4O58H 5TF1L 2AERT 3SDYH 4PJDB 1G7MB 1NLBH 2KQMA 4P5TB 5BRZB 3NIFE 2YPLA 3JV4B 5EO1A 2GJJA 2CRIA 3ARFB 2W07A 3R06B 4EI5C 5ID1B 2BVQA 3MRLB 2Y1VA 2W1NA 5D2LF 2Q8BL 1MJUH 4F37K 2YPVH 2ICEA 3FTGA 2VWEC 1QOKA 3VXRB 4FABH 5IWLC 2AQ2A 1AQDB 3MRIB 4X80H 5DO2C 4X4ZA 4QRTA 1A9EA 1MCNA 3DVFA 3MV9A 3S5LG 1P6FA 1E27A 4Y2DC 5L88L 5C0ND 1R3JB 2VDPH 2UY7A 4YFLF 3WIFA 2DQCH 3WUWG 3OX8B 2B4CH 1QQDB 3VFVA 3KYOA 1EHNA 2Z92B 1V3LA 1KPVB 5T1DL 2IAMD 4DCQB 1MJ8L 3T0EC 4GFTB 1FCGA 2NY3B 3S34H 4WFFD 4L8BA 4GG6E 2VDQL 5I66A 2CKBL 1P1ZA 1MNUL 3I75A 1HE7A 2SEBA 4U7KA 5F88A 1KPUA 3ZKXC 3STZA 3D5OF 4IOFC 2PR4H 5CMAB 3DOSA 3GMLB 3BP4A 3VRIB 5A2FA 2GCYB 4TSBL 1A7RL 1F4YH 1RZJL 4CJ0A 1IGYB 4Q0XH 3HHRB 4MJID 5FUZL 1HYSC 5TE4H 2NY2C 1S5IL 2YPLE 3GZKA 3LS5H 4CDGC 4KZEL 1R5WB 3L5XL 3MOQA 4KI5E 2D2OA 3N9GL 1LE9B 4ZO6A 3VMNA 3LVEA 5EORL 5JHDD 5K9KB 1DLHB 3H9SB 4L9LB 5E8DL 1JZ8A 1A4JA 5BJTA 2QSCH 2YD1A 1EAPA 4UIKH 4ZD3L 1NFDA 5I8OL 4NO2B 2VDRH 2OS7A 1H5BA 5CSGA 3NABL 2NY0B 5F1SA 1FFOA 1YNLH 4MA8H 5CJOH 3MV8B 4DJMA 5DUPL 4O9HH 1D6VH 1E6OL 4LEOA 2R39A 4PJHE 3MV9E 4PJEB 2IFFH 4KQ3H 4GAYB 1UADC 5GXBB 4PJXE 5CCKL 5HYJB 1J5OH 1A0QL 3WUWA 1DANU 1UC6A 4I0PD 5DT1L 2F5AL 1FYTE 4JM2C 3SGKA 4R0LB 1YJDC 3EOBA 1A5FL 4OFYD 1N5AA 3IGAA 4R2GD 3TPKA 9CGTA 2XV6B 3BO8B 5JPNB 1EHLH 3IYLW 1CDJA 1PY9A 2AK4D 1FHGA 1EEQA 4LOUD 3S35H 4EI5B 1SBBA 4GKZA 1BVKB 3EYQD 1DVFD 4PR5A 4OT1H 3U1SH 4JFEB 1BZ7A 4Y8AA 1I1AD 1U8NA 3EYUL 3MUY1 4F9LA 4KK6D 5JW4R 5CIPA 1RUAL 4QXTA 1YYML 4M8VA 1TNNA 4NKDA 4PG9A 4P4RA 1VFAB 4KV5F 3QP3A 5ICYB 5GPRA 4U05A 4DTGL 4LLAA 4K71C 3HC3L 4Y2DB 2FHBA 3W5NA 4YHKH 4JZNB 4MVBC 1S7XA 1CDYA 4P2RD 1FO0B 3PL6D 4O02L 2IBGA 3INUH 5EFIA 3G08A 5JW4M 1JNJA 5E6YA 1UXSA 4IMKA 5DRNA 1JZ3A 3P4NA 2R15A 5KSAA 3T0EB 2FEDD 1FDLH 5GS0L 2VTFA 2YN5A 1RVFL 5DURB 4LAJH 1S78C 1AE6H 3M17A 5IROC 2FZ3A 4H0IA 1ZTXL 5IEHA 3W39B 3ZKXB 4ZO9A 2EEBA 2BXYA 5L9DH 2X5PA 3KPSA 4L8DA 3QO1A 2GTWB 4C83A 4PJCF 1QO3A 1IILE 1FIGL 1FGNL 1D9KD 4WHTB 2GUOA 3ARBC 3QYCA 1T4KA 4XNQA 5FA4A 5DHYB 4ELMB 4MDIB 1QFHA 3PF2A 3TNMA 1A3LH 1ZA3A 4Z7UE 2Q3ZA 1CZ8L 1F3RB 1YUHB 5LQBH 4A2LA 4YDJB 1QFUL 5EUOB 2QEJA 3S37X 3DVNB 1ZLUH 3UTZA 3N06B 3UDWA 4PJBB 3RAJL 2ZSVB 3GRWH 4PGCB 3S96A 2BK8A 2A73A 3UJIL 4HCRA 2XZZA 2BY0A 1E4WH 3ROOA 5D7IB 1MIEH 2RFXB 1AO7D 1S7RA 3IJYA 1A6VH 3PNWA 3OXRA 3QUXD 4P59H 4QLRA 3UTSA 4CN6A 3EDDA 4UV4L 4HK3N 3PWPD 1NCCH 2ARJB 3A67L 2EYTA 5EIIB 2BNRB 4F2MB 4N0CC 1I7TB 2IANE 1YNKL 3T0BA 4JM2B 3U4AA 4UBDD 1OWRM 4ODWA 3A6OA 3BIBX 3SGJC 4LSPL 4YFDB 3CFDA 2XPGB 1RULL 1OT1A 5A2KH 1PGRB 3VA2C 2Y5EA 5DXWA 3MRNA 2DQUL 3O9WC 4Y5YA 3E6HA 4FXKB 3J8F7 5FXCH 3ULSB 4KKBC 5KOVC 3TNNB 4PJFE 1H8NA 2MCPL 2FSEA 1YA5A 1W8OA 1B3JA 2AJSH 2XNAB 3C5ZC 2BVUA 2ITCB 4POYA 1JP5A 3BGAA 2WUCH 4OD1L 1GGCH 3KHQA 2F74B 4MQ7B 4N0RA 4XC1L 4F33A 4F80A 3V6ZB 4ZQKB 2I07A 1IAII 4KDVA 2G75B 4YK4C 2X4QA 1RZ8B 5H35A 2Z8WC 4OF6A 3FFCB 5HI4C 1L7TH 2R2EB 3EJYD 5HHOD 3SJVD 5CAYB 3E0GA 4K55A 3SKNA 2K7QA 4WW1B 3MRQB 3VXUA 3MR9A 3MLXH 1RHHB 5CJXC 4PS4H 2LV4A 4JHAH 4OCYH 5DMJB 4L29A 1YYLL 3DX8A 1J12A 5D72H 1ZMYA 1Z6JT 3MLWL 1XGUA 2WLYA 1A02N 3UTSE 4NKOB 2ZCHH 2A9NH 3PP3K 1VHPA 4M5YL 3KPRE 4JFHE 3I02B 3P9WB 3I50H 3HC4L 1VDGA 5FUOH 5JW5B 3MODL 4C56E 5D1ZA 3QFDB 3TA3D 3FO1B 1H3WM 1FRGL 4K3JH 1JNHB 4LKXB 3E6FB 2ZSWB 2FD6L 3GJFB 2YBRA 4U31A 2DDQL 1UQSB 3ARBB 4X5XB 3HZYA 4TVPL 3SQOL 3IETA 3ILPB 4QRUB 5C07A 5KANI 5H2BB 2VKWA 2R9HC 4JFQA 1O5DT 1XGRB 3GMPA 3JZ7A 1S5HA 1U6AL 2EE9A 4HJJH 3CVHH 4IOIB 4WVRA 5HHPB 1PG7H 4DGVL 1QKZH 2J1KA 3GK8L 3QJFB 4MQTB 5FECA 2XZCH 5DD3H 2GIYA 2GTZB 4MS8C 4XAWH 3RU8H 4TPRL 1I9JH 2JIXD 5GS2H 4U0QB 4LQFL 4U3XA 4WTZG 3WO4C 1TJIH 4L4TD 2CLZB 3VXUE 2VLME 2DIBA 3S3SA 4LSSH 1JE6A 1K4DB 5EU5A 4MD4B 4NOFA 5BZDA 4WV1C 3TM6A 2EDXA 4JM2F 2VAAA 4I1NB 3PDOB 3VD7A 1NAMA 3DURB 2ZWLT 2PTTA 3TYFB 3O9WB 4KJPC 4WFED 1IC4H 5E4EC 1IJ9A 4PJ8D 3PIQA 1AKJB 5FKAB 3C5ZB 1UM6H 1QBBA 4X6DB 4CAGA 5KTEL 2HLAA 3OAZH 5ALBH 5KN5B 1RK1A 2IQ9L 4I3GA 1FAKT 1GH7A 1F6AA 4KDTA 1DE4A 1T6WA 4U1HB 1CBVH 3QPQC 4QTIH 3MFFB 5J9PB 3K74B 1U3HA 2JB6B 4CNIA 1IE5A 1TTUA 4Z7OE 3UTPD 2IH3A 4KJWC 2YMXH 1B0GB 1T2QL 4XP1L 3QDAA 5F9WB 4EN3C 1BOYA 4LSTL 1QNZH 4I4WB 3N1GC 3MRCA 3P9LB 5JDJA 4UV7H 1YC8A 5D6CB 1I7RA 4ODBD 1VGEL 1U58B 5CUSL 3FN9A 1JJUA 5KANG 5IMOA 1N6UA 3MLTB 5D8JL 4DGYL 5DMKA 3CPLB 5LG1A 2A6IB 4RAVB 3WDHA 3WLBB 1HYRC 1UB6A 4HS6A 4HH9A 3DETD 4P5MB 4FZ8L 5AUMB 5E08H 1T89A 3DUHA 4HXAL 4FQXD 3Q3GB 4JKMA 2JJUA 4MNHB 1Q1JH 1QSVA 3WXWL 1RUQH 3VI4E 1NFKA 4XPTH 3SKMB 2XQBH 3G9AB 1IQWH 4FG6D 3O3DA 4X8JA 4FTVE 2NTFB 4FXGB 3PHSA 1BQHB 5CWSB 4I18B 1MJ7H 4P57A 5IIEB 1J10A 1DUZA 1AQKH 4CADB 4KI5F 1SMOA 1JPSH 1GIGH 2WBKA 1CGUA 1RZKH 1EXUB 1PX3A 1QBAA 1O7SA 1KENL 4OZGA 3AS0A 1NGXB 1OY3B 4YO0B 3RTQD 5C8JB 2GJ6A 3LS4L 4Z0BH 4YHOL 5EU6A 2WBJD 1HHHB 2ESVA 4E0RA 3GUTA 1AIFB 1WFNA 2P5WB 1Z9MA 1CG9A 3LKSA 4U7SA 3MLVH 3DROB 3VFNA 3DMMA 3WO4B 4Y4KC 4AK1A 1YC7A 3C6LD 3WHXB 4PJHF 5I30H 5MENE 4PJXF 4LGRB 1BWWA 3CD4A 1H3GA 1D5BB 1NGWA 4WV1B 1CGTA 3MJGX 4XZUB 5TE6L 2YRLA 5J6GB 3BSZH 2DAVA 4L4VD 3IDXL 1NGPL 3REWA 5IB3A 5D1XC 1CFBA 3BIAX 3JWDL 5DJ2A 1LEIA 3EYSL 1CR9L 4QWWD 5KVDL 4GUPA 4OIAA 5E4EB 3BGFC 4XCEA 4OLYH 3V6FB 3LKRB 2MQCA 1CD8A 3G5ZB 2ERJC 1ADQA 5E6ID 3B3IB 2PETA 4RFNB 5A1AA 5DSCB 2J3SA 4YQXH 1QSFD 5L2KD 3L3KA 5FYJL 4AEFA 2XWTB 1P53A 1WFOA 4ONHA 5C09A 1KJMA 1BP3B 4DZ8B 4LLMA 2R56L 1A6WH 4R26L 4BH7A 1A1OB 4Y19B 5J11B 4HLJA 2ICWB 3V0AC 5EU6E 1UB5B 1YEHH 1NL0L 2BX5A 3I3EA 4M7LT 4MX7B 5FDWA 2ESVE 5K93A 4HHAA 4KY1L 4HUVB 3TZVD 4C59B 5H94B 2B2XL 4LRIA 2HTKD 3BGMB 4NM8L 4RMWA 4YHZH 5DFVD 1CD1B 1MIML 5CZVH 4EI6B 3VFUA 3GIVA 1KPRA 5DZNA 3L95A 4K94H 1JGUH 2VN4A 3D87B 1MEXH 1NSNH 4G6KL 2CMRH 3BUTA 5SX5K 1AGDB 4X0KB 4AENB 3BIKA 5MEPB 1SEQH 5T5NG 1CXIA 1A6UH 4FFWC 4PRHA 1KJ3H 2FGWL 2ZUYA 3EKCA 3G5VA 3LKQA 3PQYB 1UH3A 5IUSA 3U36A 4L5FH 5IJKA 4FS0A 2V7HB 3DX9A 4Q9BA 4DUXA 4M5ZL 2R1YB 2MWCA 3V4UL 5T1DH 3IF1B 4J3OC 3QG6A 5BW7A 2CIKB 3QIWC 3DUSB 4A6YB 3K7UA 3PWJA 3NACH 1ONQA 4X6FA 5JDSB 5TDNB 1R3IH 2AKRA 1BHGA 4Z7UF 1MNUH 2IPUG 2OZ4H 4XNUH 1OAUH 1NJ9B 3V8CA 3WYRA 3I9GL 1E4KC 1RZJH 1ZHLA 2H6PB 5CHNB 4Z77A 3TIDA 5FUZH 4Y1AB 3MUGB 5DRZB 4NJ9H 4WW2C 4Y5XC 5JTWA 4KZEH 4LLUA 5DR5L 3VFTB 5JORB 2LQRA 4IJ3C 2DQIL 5DEGA 1L7IH 4ZS7L 2O5XL 4W6YB 1WICA 5EOTB 5C0AD 3QJHA 5E8DH 3LKNB 5IB1A 1ZT7B 5EH1A 3GMQA 5I1GH 5I8OH 3BJ91 3VI3E 3C60A 4PP1C 2DQGH 1N8ZA 2Q8AL 3J7HA 4AG4L 3QCUH 1RIUL 43C9A 2B20A 4JAMB 2F15A 4I2XA 4JG0L 2VQ1A 2ZCKH 2ERJB 1FE8H 5HVWA 4QXGL 4X6EA 3VXPA 1GAFL 5H37H 2H8PB 4MB4A 3OJDB 1RFDL 4PJFF 4RGNC 1HSBA 5SWSE 4MAYC 4P46D 1IFHH 1E0OB 5E6ZA 3LOWA 2DTMH 4N0FB 5E9DA 3HNTL 3BW9B 4MJIA 3QAZC 1CL7I 2FX7H 3O0RL 4NQUA 3BI9X 1NGYB 1N26A 5KSUA 5KSBA 3U0WH 4LIQH 4YNYB 3BPCB 2B5IB 3RL2B 5CBEA 1T2XA 1H15A 1IEAB 3EJZD 5JHDA 4G8FA 3STLA 4E41D 5IMKA 3RGVA 3MJ8B 2V9TA 3VXOA 4OIBA 5E2UL 3NFSH 3BOVA 3F7QA 3GSVA 1RUAH 4H26A 1SYSB 4H88L 1BREA 3Q5OA 5DJZB 5D6DC 5E8EA 4JJ5A 4WI9A 5JXAL 4XXDB 4IOSD 5CEZH 4Y16C 5C7XL 1GC1H 3VDBA 1NCWH 3SCMC 2HRPL 5D2NB 4I0PA 2VDOL 3QT2A 5C0FB 3QI9D 4G6AD 4F7MB 1VERA 3MXWH 3S88L 2YSSA 3FO9B 4OFYA 2HFEB 3QRGL 3QIWB 3CX5K 3MGOB 1ZAGA 4I2XE 4PV8A 1HH9B 3L5HA 3ZDYE 1RVFH 4WFFE 2YUXA 5C92A 1R24B 2ZPKH 3KJ4C 2Z31A 1MHCB 3OB0H 1HQ4B 1TVHB 3H0TB 4TNWK 3LH2L 3TPUB 1KN4H 1DVFA 4V1DB 4MZ3A 1EFXB 1T7XA 4GW5B 2E3VA 5DVKA 2OCFD 3GGWB 3G6AB 1MJJA 4NQSA 4PGBB 2X4UA 3FOLA 1OL0A 2C3XA 3AMKA 4WW2B 1S9YB 4Y5XB 5KSBE 1UM5L 1MCPL 4IJ3B 3FB8A 4ELKB 5J6HA 1BOGA 2E6JA 5JHDE 1PX4A 4NFDA 1JTTA 4XCNA 5T3XL 1UYWH 1CZ8H 4ZDHA 4RGOL 4S1RL 2V5SA 3CJJA 1BQLL 2YR3A 1WWCA 5CGTA 2FL5A 4P2RA 4ODXA 3F7YA 4O2CA 2ADJA 3RWDB 4OLZH 3RAJH 3WL9A 3FB6B 4WHYH 3UJIH 5CLWA 4ZUSB 1K9TA 4G8GB 4EUPG 2Q76A 1G7PB 2P24A 3JWOC 2ORBL 1J8HD 1DQTA 3QQ3A 2FGZA 4KHXL 3T2PA 4JY6B 3RWIB 4M9OA 4RGNB 2P47B 1H3TA 1IARB 1J0ZA 3ARRA 1D5MA 2FWOA 2VDLH 5ICZB 4R4NC 3T0VA 3V4PH 1JZ5A 4LQ1A 2F5BH 4S1QH 5JUEH 1K4CB 1PEZA 3Q1SL 2ZUSA 3WO3B 3EW3B 3L1OH 2AK4E 5CGYD 4GKNA 2JLLA 1F11A 4J12A 1JIBA 4N1HB 5LAXB 1DANT 1XR8A 3CVIL 4JVUA 4F7PA 1OARH 4Z7OF 5DHVH 3MX0A 1L6XA 1HXMB 3T1FA 4KUZL 1EO8H 2IADB 2GK0B 3QEHA 5I1KH 2GITB 1TENA 3VJ6A 4D9RD 2P8MA 1S9VB 5BZWA 3GIZL 3QNXA 4KKCD 1FO0L 1XCQB 1FAIH 5F97E 3VWJD 5T1KD 1IM3B 1DQQB 3MRMA 3OXSA 2DF3A 4X6BA 4Y16B 4P2QD 4P2RE 4TNWF 3BT2L 3MBED 2F8XC 1OF2A 3PWPA 1CIUA 4EDXB 3DWTA 3UAJD 3VW3L 4NUJB 4AEEA 4EUPA 4MQXC 5I71C 2IAMC 1N59B 1ZLVH 3A6CL 4DN4L 3BWUC 5C0BD 1MF2H 3VI4F 2QHRH 1YN6A 1FGVL 2ADGA 4BA8A 4G9DB 5F1NA 5C0JB 1KCSH 4RBPK 1KEGH 1LK2B 1FRGH 3HCVB 2OXHA 4GRLD 3K0WA 2RCSL 3QR2A 4YHYC 2WWKT 3IKKA 1ACYL 2ZG3A 3C5JB 4XPBH 3SKOA 1QFWH 1FZKB 3GMOB 1J1OL 4NP4H 3IJSA 3T09A 1QRND 5ETUA 4UQ2A 1Q94A 4PFEA 2WAHA 4YPJA 3ULVC 4YHPB 3TJHD 3QUMA 1A7NH 5HHOA 3MNWB 3SJVA 1BVZA 1ES0B 2OL3H 3QUYC 3HN3A 3VRJB 4XPAH 1ZVHA 3CFEB 4BJLA 2CK0L 4AEHH 5IB5A 3CXHJ 4DQOL 1AO7E 2R4SL 1SY6A 4UTBH 4D2NA 4OM1H 4N5ED 5TDOB 5HHXL 4TTDC 1ZS8B 1KIRA 2AEQL 1ZE3C 3FO2B 4AT6B 3PWPE 2ICWJ 3OKMB 1OAQL 1MCHA 3F12B 4F7EA 4M1CD 1ZGLA 3TA3A 2WIIA 2VB5A 1FNGA 4U1SB 3LD8C 4G8EB 5GS2D 4L8SA 1RZIB 2UVFA 3MPCA 4KAQL 4APQD 3CUPB 4YDVB 1T7WA 3GSNB 2PYEB 1IRAY 3DX7B 2W9EL 6FABH 3GBLA 4ZFFA 2P8LA 4LKCB 5IEKB 4ENED 4NZRH 4BZ2L 4WUUD 4DFHA 1Z3GH 5FF6A 2CK2A 1FJ1A 1I1AC 1ZSDA 4PGZA 4XHJC 1DN0B 1UM4H 2MTPA 2IQ9H 3V7MA 3ARUA 3BQUC 1CFNB 1RZ7H 3VCLB 1JHKL 4O2EA 3ZKMD 1N6QH 2F53D 1CF8L 1HI6A 2ED7A 2YXFA 2JIXA 5A3IC 1CDUA 1XGTB 3MLSH 3SJVE 5D9SB 1I9IL 4L4TA 5EU4A 4OM0H 4P9ML 2V7NA 5IBLC 5HYQA 1V8HA 3OKDB 3RUGA 5F89A 3HPJB 4JFPA 2YRZA 5I71B 3D0VA 5T33H 4P3DA 1EO5A 2D7TL 4OLWH 5L8LB 1IC1A 1KUMA 4HBQA 2P7TB 2VN7A 1FLTX 2BVEA 3ZTJG 4PJ8A 2DL9A 3HZVA 1G9EA 3EOYG 4G8IA 2FBJL 3QQ4A 2GHWB 4UIMB 1SJVA 2WANA 5C0EA 5AZEL 5J1AA 5EN2B 3IFNL 3MACL 3QUKB 4ZUTA 5HGBB 1B6DA 5C3LD 1EEYB 3MBXH 1ED3A 4QRRA 1JWUB 5FGSA 5E2JA 1JCKA 1OGAD 4LCYB 3K80A 1TLKA 3KPOB 2BP3A 5I6XC 3LMJL 3HC0B 5ENWA 4NNPH 2VMFA 4UILH 1Y18A 3QUYB 2W92A 4HX1A 4WWID 1ZLWH 2EDWA 3CCHA 5IKCA 1H0DB 3DARA 1KENH 2VZOA 4GW4B 2OJZH 1X5FA 1U8HB 3SDDC 4YHOH 1G7JA 1KC5L 4OZHA 3JBG7 3TCLB 3O11A 3WD5H 1NCBL 4Z7WA 1OWWA 3KDMA 3VI3F 4Y4FC 1A7OL 4R6UA 4PJ9A 3FJTA 1TVBA 2OR7A 2EXWC 3BN9C 2WINB 4L4TE 3HG1D 1CGWA 3RPIB 1KBGL 3L9RA 4GXUN 1V05A 1G9NL 1BZ9B 3RUGE 1U8IB 7CGTA 2B7DT 1AGCA 3LD8B 3EIFA 3H8NA 4PLJD 4Q58C 3MOBH 4GOSA 1AD0B 1WVZA 4HIIA 4QHMB 4FQXA 4RFOL 2A83A 2BVPA 2VXTH 5I1JL 3TT3L 1DCLA 2NY1C 4WFEE 2KUTA 1I1RA 1I1FA 1X4YA 3I2CL 5KVDH 1CICC 5B4MD 25C8L 2C3GA 5DJAA 3VG0L 1A6ZB 1P69B 3LEYH 4AIZA 4OAWA 5EA0H 4GXVH 5I8KL 5BV7H 5F1OB 4NRXB 5K9QI 5C0RH 4JKLA 1CN4A 5CP3A 4XVTH 3BQUB 2WBJA 1CQYA 1QG3A 3B8YA 4M3KB 5IW1A 4KMLB 5FYJH 2BFVL 2JCCB 5EIQA 4U6YB 4N9GB 2BSTB 4IDLA 1DL7L 4KZDL 4GRWH 4ZXBC 3UTPE 3ARDD 3HRZB 5KW9L 1S7UA 1DBML 2FO4A 3C6LA 4KRPC 1KB5B 5FUCC 4BELD 3LPGA 1EA9C 5GRJH 1PAMA 4ZAKD 4Q97A 4L8CA 3HMXH 3RNQA 3B2VL 4OZHE 1A3RH 1GJIA 4Z7WE 3WIHH 3OKEA 4AYFA 3VXQB 1MIMH 3F7PC 3K4DA 3BKJL 1OM3L 4KJQC 3TEUA 2EE2A 1UJ3C 4RIRA 3ZDYF 3CLFL 3C09C 3DV4B 5IK3B 5I9QC 5JXEA 3PHQB 4JPIA 3F6LA 3V52L 3ESVF 4NO0B 4IMLB 1BWMA 1FZOB 2UYLB 5E6IA 2IGFH 5C6TH 1JBJA 4JDZA 2XKUA 3LRHA 4GW1B 3S36L 1FNFA 1QP1A 2PW2A 4XNMB 5DEFB 4NN5C 2WSKA 4N9OB 1F58H 5I6XB 4PJ5B 2C1PB 3WFDL 1KYOK 2E6PA 1I85A 1ZHNA 3P4OB 5IMMA 2F54A 5GS1B 3VXSB 1XR9B 4X8XA 3IXTA 2H9GB 5HGDB 2BDNL 1BMGA 4QOKB 3MYJA 4D0BB 3E3QE 3AVEA 3KWWB 1HHGB 3B6SA 5HVGB 3I9GH 2W0FB 3D69A 1XGQA 4PRPB 1PKQB 4G7VL 4D94A 3TZVA 2A6DA 4Y4FB 1F00I 1H3PL 1L0QA 1UG9A 3D1MC 4IS6A 4LF3A 4X7FC 3NPSC 1FORL 4FFZL 1FZMB 4HZLB 4OD3L 5J89A 5EZIH 3EYVB 3SPVB 3MRHA 4IRJD 4QRSA 4K7PH 4RAHA 4YUEL 2E7LC 1K8IB 2X4NA 3P0VH 3KLAA 5BVJA 4L4VE 1IAOB 5K9QG 5DUML 4K8RH 4PJAB 3NCEB 4TRPL 1CICB 2E9JA 3VFOB 2BRQA 1B90A 3NIDE 4ZUWA 2F58L 3VXTA 3SDXF 4Q6IA 2OTWA 4K3EL 2CO6B 2ENYA 1GAFH 4NN7C 5HYIA 1N0XH 3MUHL 5I8CB 3FZUD 2PO6D 5DJ6B 2FX8L 5C0IB 1YEKH 4HQQL 3LSOA 3VE0B 3MRDB 1QSFE 5L2KE 4N8VB 3O81A 5DD1L 3F58H 4ZXBB 3KYAA 1LNUB 1B4JL 4KRPB 3ZE0E 3EGSB 3MCG1 3OKKA 5IQ9B 3E8UL 4PJGA 5HHMB 1K3ZA 3NA9L 3BDYL 1J05A 4MNQD 4I5BB 3QIBD 4NSKA 4U1JA 5EOQL 4P23C 2LTQB 3LQAH 3KGRA 4FQCL 4NO5B 1RY7B 4DKDC 4KROD 3ZKNC 1WZ1L 1UJ3B 1R6VA 5E7FA 4JRXD 4OGAC 5FEBA 1OLZA 4W81A 3QQ9C 3C09B 4NQEE 1IM9D 1W72B 5DJDA 5I9QB 3QHZH 4X9FA 2XWBA 1YQVH 3QBTB 5C3TA 5LWYL 3T4YB 2ID5A 4MD5B 2H3NB 3AB0C 4U7MA 1NEZG 4A6YL 4P46A 4RMUA 2D7NA 2DD8L 3C5SA 3QDGD 2QL1A 4JFDB 3V4VH 5INDA 1VFOA 4KMTH 1T1ZB 2W0LA 4FQPA 5CEZD 1U8PB 2HWZH 4FFVC 4JQIL 3QH3B 3DXAD 3LEVL 3PGDB 1I1YB 4L3EB 4XC3H 1EIBA 1FNSH 1FG9C 2R1WB 4UTAL 3BP5A 1D5ZB 3GMRA 3FRPG 1KLFA 2AI0L 3E3QC 1LEGB 2GJZA 2I9TA 4E41A 1INQB 2AJYL 2LVEA 1RMFH 3KNBB 5IW3A 3V6BR 2WUBH 5EPMB 1Q8MA 4PD4J 3UMTA 3HR5B 4QRPD 4M1GH 2IEPA 3HPLB 3S3JA 5FA3A 3MRPB 5GGRB 4PV9A 5C0AE 3HMWL 2BHZA 4PJGE 2EYRB 4AEIH 4OFKA 4RGOH 5DMIL 2YEZB 3V6OC 4WU7B 2CUMA 3HNVH 2EDEA 5F9JB 2FJFA 4YE4L 3N1PC 3TO2A 1MVUB 4OQTL 3H3PH 4NWTH 2NZ9C 1XF5B 1CFTA 4M9PA 4YDIL 3SE8L 4BM7A 5CEXA 4JFFD 5B3NA 3KPNB 2R2HA 4LSUH 2W60B 3JV0A 4DUVA 2ORBH 4L9DA 1MQKL 1YPZE 4CGTA 3AY4C 2HKFL 4LL9A 5SWZA 1U91A 4UNVA 1NEZA 4U1MB 1URLA 1NUFA 3AS1A 1IZJA 2OP4H 4FN0A 1YN7A 3LY6A 4JLRA 3L3DB 1IAMA 2R0LH 3K1KC 3EO1A 3WV0A 3VD3A 3VWKB 3UX9B 1JRHH 1RUPH 5TGBB 3D39B 4R90L 3AS3A 1JPTL 4MD0B 2YUVA 5GZNC 4ETQA 3BN3B 2O5YL 3PE9A 1MFDL 1F4AA 3FRPA 4E41E 4KUZH 4FQ2H 1MAJA 5ESAB 4NBYB 1H5BC 4KU1A 5D93C 4X9HA 1T03H 3SKJL 4J8RB 4TUJA 4JM4H 4HWEL 1TCRB 4PLNC 5HHVL 1MWAB 3O4OC 4NQDB 5T5FL 3KPLA 2D31A 1NGQH 3IDGB 2AJUH 3O6FD 4PTTB 4D9LH 4WUKL 2LABA 5I16B 5IT2L 2YZ8A 3PWUA 4OJFH 2GT9A 3DTXA 4RISH 2BXZA 2NY4D 3DUUB 3BZ4B 3SGKC 4ONOA 3GRWA 5TPWH 3QIUD 3B5HA 4QYOB 4G6JH 4Q7DA 1D7FA 2H45A 4X7EC 4Z5RA 3C8KA 3SY0B 3AB0B 1JGVL 1V7NL 3MRFA 3V2AR 1JN6B 2JTDA 3H7BB 3N50A 4QO1A 5KJRL 4HJ0C 1LDPH 3MLRH 4LVEA 4OSUL 3LIZH 1RJZB 4DN4H 5F6HJ 5D70H 3FMGH 5I1AA 1WFUA 2ZOKA 3WSQH 5DVMA 4KK5D 2IMMA 2RIKA 4GRMA 3B2UD 3FQRA 4DAGH 1VEMA 1U8OB 3ZZ1A 3T65B 2VLRD 4LCWA 5I74C 2MPAL 5IJVA 1F97A 1RUML 1U0QA 1DBBH 1X4ZA 1ACYH 1A9EB 2AEPH 2ZJSH 3DYOA 3QUZD 4LHUD 4HGKC 1E27B 5I1HH 5HDLA 4MZ2A 4XNZC 1JUFB 5T1KA 3WIFB 1DQLH 5ESVB 3KYOB 3T4AB 1OAZH 4YH6A 4CJ1A 2IBZX 4TSAH 1QLFA 4K7FA 4NPYB 4EVNB 1FL6A 3RUGF 3CXDH 1OP3H 5BS0E 3MREA 5DK3A 4ZS6D 5FHAL 2CK0H 2X05A 2DM7A 1NBQA 4XVSH 1NCAH 3TBTA 3VA6A 1P1ZB 4GAJL 1J8HE 2SEBB 1KPUB 4AZ8A 8CGTA 3STZB 1YJDH 2AEQH 4OZFB 4XVUC 1EHXA 3NCJH 4X5WB 4RDQG 2RB8A 5GJSH 4J6RL 4F57L 1J0JA 1M7DA 3KPPA 43CAA 2X9YA 1RURL 3ARGD 3MLYL 4GRLA 1OT2A 1UKSA 3BEWA 2M8XA 3TVMC 2NXZB 3PV6A 1A4JB 5FOBA 2BOCA 2C1OA 5I0ZA 3VFMA 5BJTB 1EAPB 1H3XA 2CXGA 5FYKU 1NFDB 2NY5C 1HWHB 3RVVD 1QRNA 5AWNH 4H0GA 5DK2A 3OJVC 3TBYB 3UDWC 1QPPA 3IDNB 5D93B 1H5BB 5D5MB 3VU2A 3MROA 4WWKA 1EJOL 1FP5A 1F4WL 3O4OB 5CKGA 1J1PL 4Y4HD 5F9DC 4D9RE 3QXTA 3T77A 2Y06H 4CN4A 1MQ8A 1JHKH 5GRUL 5L6YL 4NCDA 3EYFA 5F7LB 1YZZA 3WUWB 3MZTA 1EGJH 5JA8B 5HVHC 1DZBA 1OB1B 3HR6A 2VLLA 4P2QE 1EVUA 5DJ0A 2X4TB 1UCBL 1MHHA 1I9IH 4XVJH 4NQXA 3ZE2E 3KPQA 4HKZA 3IAQA 1JF5A 4MAUH 3MYZA 1I8IA 2DBLH 4JRYD 5CSBA 3BX7C 5C0BE 2EIDA 3PGCB 4Y5YC 2WNGA 4Q9RH 2HFGH 3TBVA 4APQA 1A6AA 4PR5B 1MSPA 5FK9B 1OAXL 2ZOLA 2JF1A 4EEEA 3P11H 1MAMH 1BZ7B 1U8NB 3I84A 3WFEH 4NRYA 4X9BA 3D48R 2EDHA 3UJTL 2FBJH 5CIPB 4QXTB 5I74B 2M2DA 4NKDB 4PG9B 4P4RB 1G7HB 1Z0MA 1LEKB 3LEXA 3MJ9L 4RMRA 4DKFH 1NKOA 1BLNA 4Z78B 5DWUH 4XNZB 2F53A 1QRNE 3SDCD 4UINL 5EFIB 5BOPA 4IRSC 3AGVA 4QTHB 5DRNB 5FO7A 3P4NB 1KCUL 5KSAB 2I9LA 3U4EA 5KVGH 5CJQH 1WLHA 1BVLA 1T83C 1EZVX 1LK3H 4HUXB 2FZ3B 1KXVC 3O2WL 3BVNA 4Q6YA 5IEHB 3MGTA 3HE6D 1KJ2H 1LO2H 5GS3A 4LPXA 3O2DL 2DMBA 2DB8A 3KPSB 4L8DB 5D1ZC 3RWHA 3QO1B 3NIDF 3QFJB 1QO3B 5ESQA 1F4XH 4TULL 1CXHA 2P44B 2V2WB 2A38A 1QACA 2DQTH 3GSNL 5FA4B 4XNQB 3DNKA 3TVMB 1CWVA 4CRPA 4K3HA 1ZA3B 2XY2A 4OFDA 3TT3H 2H1PL 3C2SA 1NAKL 5TFSL 4UUJB 2DYPD 5AZ2H 3RP1A 4P48A 3N1FC 4PJIE 4WUUE 3UTZB 2D7OA 2NCMA 2Z35A 3ZE0F 3S96B 2A73B 1OAYH 1IBGL 3HNSH 4RWHA 2J6EL 1NANH 4YXHH 3G5YA 3O8XD 3ROOB 5D5MF 4OLUL 1S7RB 3IJYB 2X7LB 1YEEH 3VFGL 2DQEL 1ORSB 2F53E 5C08D 3O4LD 1KIQB 3MJ7B 4L1HA 1FFPB 3QXVA 2EYTB 1DL7H 1ZKAA 2VDNH 2WP3O 2C4FU 3HG1A 4BFIA 4N8PA 2YA2A 2Q7NA 3EHBD 3OR6A 1UZ8A 2COQA 1LWRA 5FYJD 4LGSB 5I1LA 3ORJA 3HUJE 5HPMA 1BGXL 3GHBL 3MRNB 4HDIA 1SMAA 4FRWA 4Y5YB 1VESA 3L7FA 4NC1C 1T21B 3E6HB 2ZCLL 4CL7A 4IBLT 1OM3H 4ODTH 2FSEB 5FCUL 4X98A 3MLZH 1S7VA 1MCEA 4LLQA 4P2YA 3CLFH 5D1QD 3REVA 1YMMA 1KEML 4HEPG 1T66C 5EU3B 4F33B 1UWEH 2XTJD 4AQ1B 4G6FD 1OGTA 2AJVL 4DKEH 2BMKA 1OGAE 3LB6C 2UWEF 2CIIA 3AXLA 2NY7L 1B0RA 4ZFOB 3Q6GH 3OMZA 2JB5L 4YGVA 1B2WL 4KHTH 3SKNB 2BZDA 4R7DB 3VXUB 3GJEA 3MR9B 4HV8A 1N64L 3ARDA 4E5XB 2C26A 2IG2L 4JN1L 1XGUB 2E27L 3GSQA 5I1IL 3NAAL 3WS3A 1M05A 2YXMA 1RHFA 1RIHH 3S37L 3IKCA 1XAUA 3DECA 3HZMA 4PUBH 4LCUA 5MEQA 4XCFH 4HWBL 2VLKA 1H3PH 2VXQH 4S10A 1TJHL 5ALCH 5CD5C 2A0LC 3ZL4L 5D1ZB 3D85D 3M07A 4X9IA 3VXMB 4OD3H 2MJWA 1KSRA 4WEBH 5IQ7H 1YPZF 1MELA 4ZTOH 2YBRB 4PRNA 4CDHA 3HZYB 3IETB 3JXAA 1CXKA 1TVDA 5C07B 3TO4D 5KZCB 1NMCB 5DUMH 4JFQB 4NKIH 4LP5A 5DJCA 3RVTD 3ZSSA 3GMPB 3IT8D 3N85H 3BAEL 1KJVA 4OBRA 1S5HB 4BSVA 2G2RB 4YHML 4W70A 1AXTL 2X1WL 1ZLUK 3O41A 5H37G 4K3EH 3ARED 1PLGH 1KB9J 4K8RD 1G6RH 5K9JL 4P2OD 4LU5H 3UTTD 3ALXA 4OF8A 4KTDL 5B3JF 2NTSP 4G6MH 1KB5L 2Z9TA 5BRZD 4P5TD 1OSZA 1LILA 5EU5B 1B4JH 4QHLB 5F72S 2FEEL 5DJXA 5BZDB 3F62A 4MWFB 3ARFD 1WC7A 2VAAB 3QHTC 4IRJA 5GGTL 1NAMB 5EOQH 1B4RA 4PBXA 2PTTB 4JPWL 3RKDD 4PGEA 2RJMA 4S0SD 1TZGH 2DICA 4XTRC 2OK0H 1N7ML 1MLCA 3MZGB 5SV3A 1SHMA 3PIQB 3VXRD 4M7KL 1C7TA 4FNLH 1XIWC 4NFBA 4J3VA 2BNQB 3T1WA 2EH7L 1FN4B 3BEVA 3NTCH 2O26U 2FECI 3OG4B 5JOFB 1LP9F 2HG5A 2EDBA 3BZDA 5I8EA 2HVJB 1F6AB 2PO6A 1BZQK 5FGCE 3MQIA 1RK0A 1JHLL 2OSLB 3G6DL 5C6WH 1U3HB 4D9QD 3FT2B 4GQPH 4D3CL 2O93L 5I17B 4QHKI 2CH8A 2Y36L 3BKCH 4LCCC 3X14A 2DI9A 3M8OL 2NW3B 3MRCB 3MOAH 2AGJH 3WNKA 1RI8A 4LRIC 2OJEA 4R7NA 4ZYKA 4MNQA 4QXUL 4RCAA 3QIBA 3V79C 1QEWA 1Y0LA 3WFHB 1W0VA 3FT3B 1QA9A 5IMOB 1D5XA 3KJ6L 1G7LB 1I1CA 1NC4A 1P4BH 1IEBA 3K8LA 1GHFL 3H6JA 2HMIC 4JRXA 4HS6B 3HMWH 3NH7L 4HH9B 1A6TA 3FQTA 2A9MH 4MJ6B 5CD3A 4J1UA 3H9SD 3TT1H 4GBXC 4BQCA 5IVXA 5FYLL 1P7QB 4WHYG 1YY9C 1QFWI 4LSVH 1A64A 4X8JB 4MXQC 4MB3A 4Y5VA 4TQEL 4PB9L 2AJ3A 3SE8H 2NY0D 3S35X 3MV8D 3P9MA 1NMAL 2CJUL 4KKAD 3DXAA 1C12B 4OZGB 3BH8A 3BWAB 2GJ6B 4X7SL 5EUKA 3LHPL 4LSQL 3VGHA 4HMEA 5MHSD 1G84A 4E0RB 2YPKB 3GUTB 3U6RA 5DK0A 3QWRA 1JWMA 2BOBA 3I3BA 3LKSB 4PP2A 3WFBH 4EOWL 1S7SA 4ZTPL 1PEWA 4QRPA 1G9MC 2BRRH 1NGWB 4DOHE 2ICCA 2Y5TA 3MNZA 4EI5D 3C60C 1FNHA 3REWB 5IB3B 5DJ2B 1LEIB 5IMLA 4LIQE 2CR3A 4XGZA 3MRBA 4JFED 4XCEB 4QCIB 4XP4L 1K6QL 1OTSC 1W72L 4M6NH 1IGTA 2ZUWA 4JRXE 1TTFA 1T3FA 2W9DH 2D9QB 1RU9L 5DO2D 3CSPA 5EULV 4MNGE 5FGRA 1JYNA 2ZNWA 1N3NB 1QTYT 2Z8SA 3OAZK 2IH1A 4Y2DD 4PJ7A 3QEGL 3L3KB 4G80A 1Z5LA 3QDGE 1BD2D 2PN5A 3JVGA 3U30B 4F9PC 5C09B 2DM2A 4PY7B 3G5XB 3O3AA 4LLMB 4Y7MA 5CEZE 2VIRA 3MLUL 1YEDA 4WI2A 3DXAE 4YHLH 1GGIH 4LHUG 3T0ED 5C0GA 1IC5L 4LCCB 1CXLA 3MA7B 3W2DH 3C2AH 3RGVC 3OGCB 1U8LA 3OR7A 4HHAB 1WT5A 1M4KA 2IBZY 3BKYH 3JUZA 1WFTA 4OQTA 1Q0YH 4XMKH 5F21B 4IOFD 1KPRB 2XRAH 4M02A 3QNZA 4XXCA 4ALAL 4QRPE 1WWWX 4JR9L 1R3LA 5C70A 1HYSD 3BIKB 5GZOC 2NY2D 3O6FA 4J2XA 4PRHB 3LKOA 3CH1B 3EBAA 5DHVA 3RIFK 4AIXA 4GKOA 1JFQL 2ATPA 3G5VB 3LKQB 4QT5A 3U36B 5JW3L 3G9VA 1JF6A 4GBXB 3N1MC 3V5KA 2HT4C 3I6LD 1KTDB 1Q0XL 3QG6B 1U8JB 3RBGA 1BBDL 3U7YL 3PWJB 5FHAH 1DEEB 1ONQB 3JSSA 2XT1B 1NUNB 4JFFE 2AKRB 3UYRH 2Z31C 2V17L 2ED9A 1NCTA 1OVZA 5EDXA 5DGRA 3TN0A 5E2TL 4J6RH 4PJIF 4F57H 3N1QC 1TPXC 5I15H 3TIDB 1RURH 3D0LA 2X40A 2BNRD 4Z9KB 2Q86A 4JM2D 4LLUB 3WBDA 4IDJH 5B39G 5DEGB 1A7PH 1PQZB 2VXUH 2N1KA 3JTTA 3QUZA 3QJHB 4LHUA 2YA1A 3L3HB 5IB1B 1IKNA 5F7EL 3GMQB 3ZTNL 2Y9RT 1UZ6F 2DQJH 4ZSOB 3QDHA 4FQQA 1I3VA 4NQCD 3O45A 3C60B 1S8DA 2QQNL 1EMTL 1FYHB 1EJOH 4PRDA 1JNLL 1NMBH 4PB0H 4HIXH 4XBGA 1YEGL 2H32A 2DQHL 3QCVH 4BQ6A 4CW1A 3HUJF 4OCWL 5GHWH 4I2XB 4NHCL 3VXPB 2OL3A 4ORGA 1HSBB 3QQNA 5B38G 4HPOL 1T04A 3FFCD 5E9DB 1NBZB 4DWHA 4MVBD 4MJIB 4OZIB 2X42A 5IFAH 1SEBA 5KSUB 1GGBH 3AS2A 2DWDA 5CBEB 1F5WA 2I60L 1LO4L 3STLB 5IBUG 3NCCB 2W59A 3RIFF 4GS7B 1X7QA 5IMKB 3RGVB 5KS9A 1KELH 1P2CA 1S78D 2HN7A 1A4KA 4H5SA 3VXOB 3K2MC 3O3BA 1PG7X 4XPFL 2VLRE 3GSVB 4DUWA 1OOAA 5GS0C 4H26B 4KVNH 1E6JH 3FQXA 5B39A 3NA4A 5IFHH 3DGGB 3G6JA 2ZKHL 4HIJA 4Y4HA 1EZVY 4JJ5B 2J7LA 2E7HA 1AJ7L 1F3JA 3QCTL 3ARBD 5BO1L 4YJZL 2FJGA 1CGSL 1ZVSA 3FN0L 5E4IA 3UZVB 1BAFL 3X11A 1B9ZA 1KACB 5BVPL 3WNPA 2YSSB 1CGYA 3LRSA 1T22B 2R29L 3JWOH 2F19L 4PV8B 2KKQA 4JRYA 3W0WA 2C7UA 1CTOA 2Z31B 4NZUH 5JNYB 1ERNA 4PREB 4LAQL 3FQNA 1DVFB 1HH6B 4H20L 3QXUA 5B38A 1MCWM 3DSFH 3RWCB 1TPXB 1S7WA 3OKNA 1MJJB 3KXFE 2X4UB 2AEWA 3FOLB 1NKRA 4N0CD 3GSNH 1PFCA 1HKLL 4HJGB 5I19H 3KLDA 3SBWA 5J6HB 1BOGB 4HT1H 3TFKC 2G9HB 3P30L 4XCNB 3EOAB 4ZDHB 5ADOL 5KS9E 4LPTA 4HC1L 3BZFA 2FL5B 1MY7A 3TIEA 4NFCA 1T1YB 4RGMC 4ODXB 3O9WD 3MRRB 3F7YB 1FLRL 1QVOA 2ADJB 4O2CB 3RDTA 3T3ME 3EO9L 3WL9B 1TZIB 4KKBD 2VR5A 2N4IA 2JJTC 1AKJD 1GOFA 3C5ZD 5LGHL 1GZPA 2FB4H 2HFTA 2MKWA 2P24B 1D6EA 3UC0H 4DVBA 1RJLA 2DQEH 2LU4A 1WTGT 5IF0B 5GGQH 1HQRA 4HG4J 1AR1C 1D5MB 2FWOB 4HFUL 4JO2L 1KN2L 1FNLA 5HI4D 5T1MA 3KYMA 3OZ9L 4Z7QE 4ODHL 4M62H 3V0WH 4XNXH 4ZOBA 3X17A 4R4BA 4JRYE 2VZVA 4UDTB 4WCYL 3HI5L 4GKNB 3WUZA 2IQAB 5LJYH 4XHQA 1SM3H 1XR8B 2VNCA 4PRIE 3WJJC 1AXSA 1KLUB 3T1FB 5FHBL 5J4MA 1J0YA 3D25B 4BFBD 2EKSA 2QQQA 4K2UH 2EIBA 4WHCA 3VJ6B 3GFUA 2PXYC 3HI6H 2P8MB 4IRZL 2BHYA 3GM8A 3DBXA 2VISA 4H25B 4Z95H 3O8XA 5E8NB 3ULVH 2XFXB 1FH5H 3O2DA 4OD2A 1BFVL 4AL8H 1F13A 3QDJD 3OXSB 4X6BB 5EG6C 5C08A 3O4LA 5GISH 5HDQL 1MCKA 1OF2B 3PWPB 5FOJA 3C9NA 2XY1A 1UVQA 3PWVA 4DK6A 1KIPA 1P7KA 2R9HD 4G5ZH 4LHQB 1NGZA 1LO0L 2ZG2A 3PV7A 1I4FA 2ATKA 4LBEA 1A21A 3U4BL 3VH8G 4QEGA 5I1IH 1X9QA 4XBEL 1DBJL 5BQ7A 1MFEH 1OCWL 5GGSB 4KWUA 1Q9KA 1T80A 5F1NB 5I76A 2R69H 3OB0K 1A1NB 2JE8A 2P45B 3QULB 1VFBB 4ERSH 4MS8D 1WIOA 4KTYA 4ZPVA 1WSST 1GZQA 3HMXA 1CVRA 2AK1L 5D1QA 1DQDL 3B8SA 5B8CA 3U46A 3O2VL 5AD0B 1MCOH 3WIHA 12E8L 5M95B 4R8WH 1P84J 3HLAA 3MFGB 2NY5L 3IJSB 4ONGL 1GGTA 5EZJA 3WS6C 4YAQA 5KSVA 4BUGA 5ETUB 1JWSA 2IC2A 1HINH 1IAKB 4X4XA 1HZHL 2XXCB 5HHOB 4KJPD 3OSKA 4HCRL 1MRDL 3IFOA 2VLJD 2J4WL 3L7EA 2C5DC 1TQBC 4EXKA 4XWGL 1QLRA 3UYOD 4QRQB 1KNOA 4XRCB 4UT7L 1T0PB 1CFSA 4PY8J 5L7XL 4RWYH 3U0TB 3RQ3A 4PJ9C 1C1EL 1N2RB 3RJDA 5C08E 3O4LE 1INDH 4NHUB 1KLGA 5C0CB 5DLML 1T1WA 2LU7A 1W2KT 3X3FL 5CJBA 1IGML 5HI3C 3IAGC 1ZGLB 1QR1A 3QPQD 3X13B 2DLIA 2WIIB 1FNGB 3CFIC 4KJWD 5FYJE 3UJJL 1QD0A 3ARZA 5GGTH 4HGMA 3NN8B 5D96C 4JO4H 4Y19D 4EN3D 4GRWE 3GB7A 4JHZA 1HILB 1RIVL 4XMLL 5F7FA 1JRHI 2N56A 3BMWA 4MSWB 2HT2C 3TO4A 4ZFFB 5HDOA 5A16B 1J1XH 2HFFA 4ZUVA 1WWBX 2C4FT 4D0DA 5L0QC 1FJ1B 1ZSDB 3L3OA 2NX5D 2XYCA 5IM7A 4HKXA 4OF5A 1JNNL 3WDIA 1F3DJ 1CLYH 2XTJE 3BHBA 1UJTA 2OR9L 5KBNC 4P99A 5D7SL 1MRCL 5TQ0L 4LPVA 4F58H 4O2EB 1E4XH 5DJ8A 3UTTA 4LP4A 3PQYD 5HHQA 4OCRH 1HI6B 1KT2A 4M43H 4LVHC 3CMOH 4TSCL 2JELH 5EWIH 1FNAA 4L4TB 3T3PF 3UBXI 5BMFH 4NCC1 1GPOH 2D03H 2V7NB 4P5TA 1MREH 5HYQB 4P4KC 5C0DB 5F89B 4C4KO 4JFPB 5ABDE 3D0VB 3BKML 4U1LA 3W9DB 2AS5M 1J7VR 3ARFA 1ZLVK 4P3DB 3OAUH 1GVIA 3AFLA 1PSKL 4Q9QL 3NCFB 3HZVB 4JQXC 1GHFH 4Y1AD 3VXRA 4G8IB 5JXEC 3QQ4B 2V5RA 1TITA 2FDBP 1AQDA 5C0EB 4MDJA 5J1AB 1IKFH 3KG5A 4Y4KD 1J88A 1TXKA 5TE7H 4ZUTB 4OZ4B 2Z91B 4QRRB 1RV6X 5FYLH 4R97B 1LD9A 2CDFA 4H1LH 4Z0XB 1RJYA 4OCLC 2I5YL 4TQEH 1BIIA 2QQKH 3AM8A 5EZOL 1QQDA 5F1KC 1PY4A 1Y18B 5D1XD 1KPVA 4JKPH 1U41A 3PDDA 3H2WA 1I8LC 3X12A 4HX1B 1NMAH 3GSOA 2CJUH 3B9KC 5J13C 5IKCB 2K7PA 1TQBB 1EBAA 1MUJA 4OGZA 1PZ5A 4POZC 1YMHB 3JWDC 4OZHB 4M1DL 1VGKA 1NBYB 3O11B 2IMNA 1NCDH 4U0RB 3UTTE 3CK0L 3D3VD 3KDMB 1JL8A 2DLEA 4OUOA 1ACZA 1KTKE 2V9RA 4PJCA 1ULVA 4PJ9B 1J0HA 3IXAA 1TVBB 2QADC 2Y6SC 2C3VA 4HF5L 3GMLA 3Q5YA 2EICA 5DI8A 5H8DA 4Q74A 4FQLL 5I1DA 3L9RB 2HTLC 4PJDE 5BRZE 3PJSA 4ZFZA 5DC0A 1NAML 4HIHA 1AGCB 2V2TA 4JFYB 4P5KA 1L6ZA 3IVKB 3MV11 1R5WA 5SX4H 1ORQA 1LE9A 4FQXB 5D96B 1CLOH 2BVPB 4LRNH 3H9SA 1RZFH 1I1FB 5ITFB 4KV5E 3IDJA 1FVCB 3VXRE 4LLYB 2RHEA 5DJAB 3KYKL 4FQJL 1N5YH 4AIZB 1T2JA 4OAWB 5E1HB 3UO1H 3MV8A 3UBXG 5E8OB 4NGHL 2VABB 3S98A 3ILQC 4GMSH 2R0KL 4FFWD 2OQJA 3MGAA 4NBZB 4WI8A 1B88A 2A6JA 1KG0A 1AI1L 2PF6A 1QLEL 1H8OA 1KIUA 3BYTA 4LVHB 1G0DA 2FO4B 4M7JL 2ZUTA 1ZWIB 3C6LB 3NZHH 4K9EL 5ADPL 3QIWD 4L8CB 4LGPB 3RNQB 1N0LA 3OKEB 4BSWA 2V5YA 5E99H 2JK5A 4EI5A 4ODVH 1DN2A 1P5UA 2XN9A 1E28A 3MXVL 4V1DD 2ZUUA 4JFEA 2KL6A 4RIRB 3WNNA 1KV3A 4JPIB 4OLVH 5IWLA 3FQWA 3CFKA 4XPGH 5CSZA 1J11A 1IAIL 4WRLA 3FO0H 2PW2B 5DVOA 3H9SE 3U9PL 1ND0A 2L7UA 1X3DA 4NUGL 1I3RA 1YY8A 3GBMH 4Y2DA 4X6CB 4KPHL 3HA0A 4XNYL 1BD2A 1ZHNB 5DD0H 4JO1L 4PP1D 5IMMB 2F54B 3L6FA 3UBXA 3MV8E 2EDNA 3B9KB 5J13B 3IXTB 1ZLWK 4G8GD 4HBCH 4D8PB 2RGSA 3RNKA 4PJEE 1K8DB 5ANMA 2ADFH 1WEJL 2APBA 3B6SB 3GKWH 3D69B 2IWGA 4BZYA 4F3FA 3T3MF 4CVZA 1FC1A 2A6DB 2QADB 4RGND 4X4YA 3OJ2C 2FIKB 2DQFA 4LF3B 3QG7L 1OP9A 1DBAL 2GTWA 3CX2A 2FH8A 3GBNL 2A1WH 1PZUB 2ARJQ 3SKUD 5IB4B 5F8RC 3MRHB 4WNQB 4QRSB 5C2BH 4X83A 2X4NB 3R0NA 2YD6A 1EK3A 1CT8A 1T7VA 4WHTA 4ELMA 3MCLL 1MWAH 3KLAB 5BVJB 1UKQA 4QHNA 4OFIA 1FG2B 4JFEE 2VWEE 4P0DA 3PXJA 3F5WB 4M6OL 3SOBH 1NBVL 1S7TA 4ZUWB 2J8UF 1MFCL 4Q6IB 4UMGA 3ROLA 4ODSL 4D0CB 5J0BA 1SVZA 5F93C 4JPVH 3L3GA 1VADB 5TDPA 4PRBA 4Y16D 1K5NA 3SCMD 4R4FL 1BD2E 2ARJA 5FGBC 5EIIA 4F2MA 4JM2A 3LQZB 3ZHLA 1J9CT 5GSRA 1X5LA 3RVUC 4UT9H 3L5JA 1UCTA 1LO4H 4NM4L 3T0EE 4PJGB 1AHWC 2XZAL 1H3VA 4OKVA 2XPGA 5I18L 5HY9B 3HKFA 2NY3C 3KYNA 4U1JB 2XG5A 4NSKB 3UP1A 2H26A 2EDYA 4NQCA 4Q2ZA 1FQ9C 3C08H 1CLZH 3ULSA 3RWGB 5JOPD 3TNNA 2PUQT 7FABL 1N4XH 2VL4A 2ITCA 1BM3H 1R3KB 5DJDB 1SJEA 3HZKA 2XWBB 3QCTH 2F74A 4ELME 4XWOC 4NNXA 4YBHA 1DQJA 2XICA 4ZQKA 4DW2H 5IESH 4FMFA 5MEOA 2I26N 3ULUC 2G75A 1R5IB 2VZ3A 2YS4A 4P46B 1ZGLP 4K3DL 1IGJA 3QA3B 4PYGA 2R2EA 5TQ2L 3IS0X 4JHWL 1QBLH 4PJBE 4OZFH 3BZEB 1EGJA 4X6CF 3NGBC 5JQHC 5DF0A 2Y07H 1IGIL 1U93B 3BP5B 2WQ8A 4GT7A 2GJZB 4NKOA 3THMH 2BNRE 4XT1C 4OB5L 1I8MB 5JW5A 5T3ZH 5JR1L 4R4ND 5FA3B 4LARL 5DD5L 4E42B 1TDQA 4JFOB 3IU3A 1JNHA 3U2SA 1C8PA 1DLFH 5HBBA 1Y6MR 4OCXL 2O61B 3ARBA 2PYED 3HAEH 5EO9B 4XP6H 3TO2B 2P42B 4NQCE 1P4IH 5H2BA 2HKHL 1VKXB 2VE6A 1XCTB 5HD8C 3VMOA 3IAPA 1EUUA 2R2HB 4FQHA 4YX2H 4GRWF 1G7QA 2FH6A 5HHPA 5KVFL 4F7CA 5HYEA 1F8TH 4KDWA 2B8OT 4MA7L 4HS8H 3QJFA 1U91B 5SWZB 4EBQL 3R4DA 4RQQA 3QHFL 1FBIH 4HFUH 4PJHA 2HJLA 5ITBH 3FFCE 3TYGL 4PJXA 4Z7VB 1WJ3A 3ISWA 4ZPTA 2HH0L 3BE1L 3EO1B 3E2HC 2N7AA 3TH4T 5IGXH 1FYTA 1KJ2A 4WCYH 1KCRL 4ETQB 1YEIH 3NPZB 3SGJA 4MQXD 3LRGA 4Z6AT 2QSVA 1AHWB 4JFZH 3PDOA 3WCYA 3DURA 4TUJB 3O9WA 3IDMA 4LEXL 1ZANL 3WLWC 4N8CH 4UB0H 2MMXA 3KPLB 2D31B 1NDMB 4IRZH 1SBSL 3AAZA 4WI6A 5ACZA 4YXKL 3BRDA 5IHLB 4QF1A 4RNRB 1HXYA 1CDHA 3PWUB 3WIIH 4JFXA 4X6DA 1R0AL 3X3GL 1O0VA 4Z5RB 1S3KL 3C8KB 5LBSH 4OIIL 3MRFB 2VDKL 1LO0H 1MHPH 5J9PA 2JB6A 3ULVD 4I77L 1F02I 3B5GA 4N0YL 3QUYD 1LO5A 5I1AB 1HHIA 3FCTB 4JG1H 4NQVB 5CJXA 4GSDL 4XP5L 2XZQH 4HC1A 1UA6H 3NGBB 2FATH 4GRMB 5GJTH 2R8SH 3FQRB 3HB3C 4KQ4L 4O4YL 3S9DB 1R5VA 3S5LA 4IIQC 4LCWB 4M8QB 1BFSA 1X5GA 4TTDD 5E5RB 3QEUA 5L8JB 1KF9B 3WXVL 1I75A 4LK4A 4BK4A 4K23H 3MLTA 3CPLA 2R4RL 2A6IA 4Z7NF 4HULB 3W82A 5LCVL 1FPTH 2NY5H 3SE3C 4ONFL 3FONA 4UT6L 5T1KB 1UKTA 2P4AB 3CH8A 1DUYA 4TUKL 3QDJA 4MNHA 3U82B 1HZHH 1X5ZA 4YDLC 1QLFB 1WF5A 4PJDF 1FL6B 4DKAA 4Z7UA 3MREB 5CWSA 2WQRA 5IIEA 1RAMA 4CADA 1CDGA 3EUUA 4YXLH 2APTA 1A14L 4XHJD 2PCPB 4OLXL 5L7XH 4AQOA 4TOYL 4X6DE 4GQ9H 5DA0B 1FCCA 5E2VH 1C1EH 4YWGL 3ECBB 5C8JA 3BQUD 1LE5B 3FHAA 2B0SL 1M7DB 2CLVA 2J88H 2EH8L 5IBTH 3PG2A 4GRLB 5A3ID 3BEWB 1CLCA 3DROA 1OSPH 35C8H 3E2HB 4NWUH 3WHXA 4JY4A 2GYSA 2IANA 5IBLD 1OLLA 4JO3L 5FOBB 2C1OB 3VFMB 1EO7A 3RGHA 1D5BA 2R1XA 3RI5K 3UZQA 4S2SA 4XZUA 1Q72L 1WITA 5J6GA 2X44D 1AY1L 4TNVF 3MROB 4WWKB 2FR4A 3K2UL 3GO1L 2VLJA 2V5MA 3T77B 4FQ1L 5GSVA 1I7UB 1TIUA 4PJFA 5JIPA 2E7MA 4N5UA 4LASH 5TQ0H 5JW4N 3EYFB 3UROR 4ODUB 3B3IA 3QDJE 1CFVH 4RX4D 5DSCA 2VLLB 1ZGLM 1FNEA 4WO4C 4R3SA 4I48B 2BSRA 1G6RA 4FFYH 1TTGA 1CL7L 4NQXB 4PJ5D 4K7PX 1MLBA 3T0WA 3TJEH 2XWTA 4EQ3A 1I8IB 3BKMH 3BP7B 3F8UB 4MXVF 4DZ8A 3O6ML 4DN3H 4GMTL 3FAWA 3VXSD 3TBVB 4FZEH 1A6AB 4Y19A 4EN3A 1JYWA 4QOKD 1MPAH 1CVSC 3D2UA 3SDDD 4HAFA 3F7RA 4MX7A 2EC9U 2B39A 3HE7C 4PRPD 4NRYB 4HUVA 5H94A 1A2YA 2P5WE 4Y4FD 4IIQB 1I7ZB 4EI6A 2EXWD 2NX5A 3KVQA 3BN9D 1T1XA 5C9JA 3KPRA 4ACPA 3LEXB 2G60H 4PJEF 3EFDH 2VZSA 1EHAA 1AGDA 2EEDA 4X0KA 5MEPA 3GI8H 4C56A 3QUML 1JZ2A 2AQ1A 4ZNEA 5JHLL 3PQYA 4CBPA 4BQ9A 3EOTH 1G9NC 4OI8A 4YDLB 2NY1D 3OL2A 4P9HL 3PWLB 2R1YA 4EDWL 2VLJE 1CICD 5FYLD 1SY6L 4YPGA 2CIKA 4W6XB 3DUSA 4DVRL 1OP3K 2HJFA 5FV2A 1TJGL 4M6MH 1MI5D 2D4DA 5JDSA 1W8NA 5TDNA 3RPKA 3TH3T 4L4JA 4HWNA 1WGOA 2QKIA 4JQVC 3BVNB 1UWGH 3MGTB 3R1GL 4LLWB 2EYSB 4XPHL 1NJ9A 1MY5A 1MFAL 3RI5F 3RWHB 2ZNXA 5E1AB 5ISZD 2H6PA 1YEFL 3MUGA 3SDAA 2MFNA 3WNOA 4ZXBD 4JANA 4TUOA 4Y4KA 2EDRA 3EDFA 4KRPD 5E70A 4Y19E 5F9WC 4F8QA 4OFPA 2BNUB 2QQLH 5HHMD 4HKBA 3SO3C 3DO7A 4FP8L 3FB7A 2QTEA 4O00A 5J1TC 5F44A 2PTVA 3BESR 2NX5E 5D1XA 4KJQD 2EZ0C 1X5HA 2DI7A 2X70B 1XGYL 2NR6C 3GSRA 3RKPA 4C54A 2P48B 2LAAA 4HXBL 4WY7H 2CUIA 1SJHB 3IFLL 2X4RB 2FCBA 1LMKA 1V3JA 3H42L 4ZNEE 3D3VA 3OHXA 3PQYE 5LXGH 3GKZA 4G3YL 2YKLL 2H8PA 3OKYA 4EIGB 2VXVH 3PP4L 4WO4B 4E9LA 3CFBA 3HG1B 4BFIB 4N0FA 1U3ZA 2QV2A 4XCCL 3OR6B 2J8OA 1UZ8B 1ZLSH 4BZ1L 1QHOA 2EDQA 5I1LB 2I24N 4I18C 4ELMF 5HPMB 1F90H 1L4IA 1NGYA 4HDIB 4ISVA 4YNYA 5DVNA 4HEME 5KVEL 3NCMA 3L7FB 2FJHB 2BHUA 4Z76A 1P9MC 5EUOF 1HOCA 1A1MA 3DVGB 4JPKL 4X98B 2IPTH 1S7VB 3HE7B 5HSFA 5E8PA 3MJ8A 4LLQB 4PJBF 4B53A 3REVB 4Y1AE 1YMMB 3Q5TA 5JZ7C 1SYSA 3IS1X 1FC2D 4UQ3B 1EUTA 3PHOA 1VA9A 5DJZA 1OGTB 5D7IF 5C6PB 2HVKA 4U6HB 2BMKB 3W11C 3KR3L 2CIIB 3AXLB 1B0RB 1C5BH 4KPHH 5HYSB 1CU4H 3F7VB 4YGVB 2AQ3A 4JCMA 4HV8B 3ARDB 3D9AL 3V5DA 4KVCH 3V0VA 1YECH 2X9XA 5CILH 2DJUA 4F7MA 4LDEB 4BH8B 4X4MA 3FO9A 3O3EB 5IHUL 3GSQB 3WS3B 3BPNC 1M05B 3QIWA 4FTVA 5F1IA 4S1SL 1T7YA 2XOTA 2CDEB 3V95A 3U48A 3VFPA 5IOPB 3GI9L 2EDOA 2NZIA 3HZMB 5F96H 3D3VE 4L1DA 4LCUB 1S7QA 5MEQB 4HUUB 3O6LL 3RA7H 3WEXB 2VLKB 5I1CH 4RFNC 2UZIH 1MRFH 3HFMH 1I9EA 5DQDH 2QLVB 4V1DA 3U7WL 1T0MB 3T2NL 1CFQA 4I3RL 3GGWA 1MCFA 4W4NA 3MV01 1F45A 2YHGA 5GGVH 2HT3C 2XTLA 3O3UN 4PRNB 4WW2A 4Y5XA 3VWKD 5FO8A 1S9YA 1OD7A 1IC7L 3D39D 5DJYA 3DV6B 3MCLH 2UZXB 5F9OH 5HJ3A 4MXWL 2EECA 2YUWA 5FFLA 5J11C 5DJCB 5MENA 2LU3A 5E24E 3TWCH 3SO3B 4PGJA 1KJVB 4I3SH 4J3TA 4BSVB 1ZA6B 5CJ5A 4U1NB 1ADQH 4P23D 3O6KL 4F15B 4MMZC 1CI5A 3BMVA 3RWDA 4MA3B 2GAZA 3ZYJA 4NQDD 3FB6A 2VH5H 1XF3A 4M7LH 3ZKND 4M61B 4WTZA 4Y2OA 3CFJB 4P3WA 1OHQA 4OGAD 2XA3A 1KTLA 1MFBL 4ZNCD 4ZUSA 3TCXA 1CK0H 4CU7A 4G8GA 5DVLA 5KG9B 3QQ9D 3L5WA 3GHEH 2RBLA 1V7MH 1ZT4A 3DVIA 1JTOA 2NXYC 2VUYA 1AR2A 5D2NE 3QXDA 4JY6A 1IL1A 2DLFH 3VGEA 1QYGH 4MAYA 4EQ2A 4DGIL 4X4ME 5DJXB 4NM4H 3TC9A 4PIRF 5IR1B 1WC7B 4PGDA 2XXMB 1K4CA 2FIRT 4FFVD 4NIKB 3LN5A 5F7UA 4U6VL 3LAFA 5CP7A 3WKML 3MRGB 4V1DE 2XKNB 3BH9A 2AABH 5E2WL 2WV3A 3UTQA 3SE4C 5JQ6H 3BEVB 3C8HA 4OCSH 4YBQC 3ZT7A 4FA8A 4N1EA 1S9VA 1C5CL 3NFPA 4YBLC 2XKSA 3T0DA 5I8EB 1F3DH 4HSQA 2PO6B 4TN9A 5E94A 1RK0B 5C1MB 1XCQA 3N0PB 2Y4SA 4HUNB 5D71L 3RVXC 1KULA 4JKWA 3T08A 1TETL 2J12B 1B6UA 1JMZA 1NUGA 3SCMA 4G7YH 2EO9A 4O58L 5MP6H 3SDYL 1A7QH 2NZ9D 1NLBL 3MO1B 1RUKH 5CLTA 3VRLF 4NUJA 3X14B 1IGCL 1Y6NR 4G8GE 3BPNB 1PJ9A 5EBMA 4DOHB 1N59A 1GL4B 4PG2C 3OG6B 3MC0A 4MNQB 3P73A 4HIEA 1UACH 3H7LA 2ZZUT 3R0MA 5F6HI 1MJUL 1W0VB 5GGUA 5F3HA 1QA9B 3QPXH 4G9DA 4YDKH 1G9MH 2YPVL 4L3CB 4RGNE 1NC4B 4KROB 5DTFA 1IEBB 3SN6N 5JR1H 4HPYH 5EC1B 1F2XK 4X9GA 4FABL 5TF1H 1A6TB 4X6DF 4X80L 4HWZA 3CDCA 3FQTB 2NXZD 4OCXH 4J1UB 5IVXB 1AFVL 5JIIA 4KK8C 5T3ZD 5GRXG 4S11A 2B5IC 5GZND 1PDKA 3NCYP 2FHCA 2VDPL 2Q8BH 5IP4A 5DEZA 2DQCL 2AJ3B 2B4CL 2FRGP 1F4HA 4ZO7A 3P9MB 3BH8B 3TN0C 3AMLA 3CFEA 3RX7A 3S34L 4ZOEA 4NQED 3U6RB 5DK0B 2BOBB 3CXHK 5L88H 4PP2B 2NXYB 2PR4L 4NKMA 1S7SB 1F4YL 5D2NC 3F12A 3QZWB 4Q0XL 5SWSA 5TE4L 4QGTA 1ZEAL 2PYFA 4HJ0D 2WBWB 4XB7A 3LS5L 5J8OA 2NNAB 4ZG1A 1MJ8H 3KLHC 2Y5TB 2NLJA 4JY5L 3WFZA 2WWMC 2VDQH 1QBML 1ZANH 2CKBH 3DX7A 4PTUB 4XGZB 5IMLB 2GW5A 4JVPA 4MCZA 2QSCL 4UIKL 3RIAK 3BXNB 5F7KC 5JOPE 3VG9C 1IGTB 2VDRL 4YXKH 1TMCB 4TSBH 1KTRL 1A7RH 3GSUB 4MJ5B 1XH3A 2X9WA 1YNLL 4MA8L 5CJOL 2IF7A 4H8WC 1WK0A 4O9HL 1S5IH 1D6VL 3QWOA 3L5XH 4YBLB 2IFFL 4KQ3L 3N9GH 1KGCD 2KH2B 1CFNA 3EFFA 3LN4A 4PJ7B 2ZUQC 5EORH 2VDKH 1U36A 2V5TA 5EZLA 1J5OL 1Z5LB 1E4XI 4UOJA 3P77A 1XGTA 3RWJB 4ZD3H 5K9OA 3O3AB 1M71B 2VIRB 3RZCC 2EDJA 4XP5H 3NABH 4GG8B 5DC4B 3LKPA 4YR6A 5DUPH 3HPJA 4W4OC 1E6OH 1EHLL 2IAMA 3OR7B 2BVOA 5CCKH 4XVUD 4JEGB 4OT1L 3U1SL 1A0QH 4B7IA 3RWEB 2P7TA 1OQXA 3KPSD 3DRQA 3QNZB 5DT1H 1WBXB 3QFJD 2F5AH 3ZMRA 4NZJA 2D3VA 1A5FH 3LKOB 5DHVB 4ONFH 3HI1A 5DDHA 2ATPB 3TVMD 2H2PC 2X4PA 2PYEE 4LCYA 4OCNC 3L3IB 4YHKL 1G6VK 3EYOA 3OKLA 3EYUH 3T8XB 4TOYH 3L3JA 3JWNC 4GLRH 1H0DA 1YYMH 4JGMA 3TN0B 1FDLL 2B0SH 3QEQB 4G9FB 4J4PC 2OYPA 3TCLA 2VL5A 4DTGH 3IDYB 2X2YA 3DX6A 3HC3H 3D0LB 2Q86B 3FFDA 3ZLQC 3S36X 1AGEA 3RIAF 4O02H 5L9DL 3SBWC 3AU1A 2AAVA 3JTTB 1CE1L 1QPXA 4JO3H 1BZ9A 1U8IA 2XI9A 3RWFB 4UU9B 4XMPL 1JPFA 1VACB 2FNBA 5CS7A 4FQQB 5GS0H 2V6HA 1A3LL 2K3TA 5SX4I 4PRAA 2N7BA 4ZO8A 4K7PY 4PRDB 2AK4A 3SDXA 4XBGB 4MCYA 2H32B 1ZTXH 3KPMB 2CXKA 3IDIB 4U1IA 3VG9B 5EIVA 5AG8A 1I1AA 3GRWL 5DRWB 5TH2B 1FIGH 4U6XA 4PPTA 1JPGB 5AYQA 3ULUL 2BY3A 4AH2A 2DJ4A 1FGNH 2YD4A 4O5LL 1E4WL 3DGCR 1MIEL 3BQUA 4P59L 4JDVA 1A6VL 1T04B 2ZUQB 3ET9F 1ZV5A 5T1LB 4KFZC 1NCCL 3ULVE 8FABA 2QSTA 1QFUH 1ITCA 3HRZA 4IRSD 5I75C 4S1DC 2VUOA 3PL6A 4GMTH 3RZCB 2IFGA 2XWJA 5BS0D 1J0KA 4JDTL 1VEOA 4KGJA 3GSWB 4H5SB 3QDMD 4CVXA 3O3BB 3L5IA 5MERB 3FQXB 4UV4H 5B39B 5D1ZD 1OTTC 3I6KB 3A67H 3G6JB 3P3YA 2AJSL 1YNKH 3VXMD 4H1LG 2WUCL 1PKOA 1F3JB 3MV7B 1GGCL 3TP4A 4IMLA 3DYMA 3K8MA 4LSPH 2FJGB 5C07D 1RULH 1ZVSB 2B1AL 2HLFC 4RX4A 5FV1L 5KZCD 3K8KA 1D9KA 3QB7C 4NYLA 4XNMA 4DZBA 3X11B 4EDWH 3SDXE 2DQUH 1ETZB 2Q7YB 1WV7T 2E7BA 3CZFA 1P7HL 3B83A 1QR4A 2MCPH 4JRYB 3W0WB 2XQYG 2C7UB 3MLXL 3P4OA 4PS4L 2Z4QB 3VD5A 4JHAL 4OD1H 4OCYL 5F7DA 1XR9A 3I6GA 2VZUA 4R96A 5HGDA 4XPHH 2P8PA 4QOKA 4XC1H 1MFAH 3SDDA 3KWWA 1HHGA 1U92A 2A9NL 1S7WB 2JCCE 3OKNB 2O5ZL 5B8CC 1AO7A 4Y4FA 3QUXA 5JLZB