4HKXB

Influenza hemagglutinin in complex with ch67 fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
201
Chain Sequence
b'QSALTQPPSVSVAPGQTATITCGGNNIGRKRVDWFQQKPGQAPVLVVYERFSDSNSGTTATLTISRVEAGDEADYYCQVWDSDSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
molecule tags Viral protein/immune system
source organism Influenza a virus
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
total genus 45
structure length 201
sequence length 211
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkxB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkxB01
1GGIL 4OCXH 5TJWK 3ARWA 3ZKNC 2EDHA 2V7HA 4HEPG 3I84A 5E6IA 3RZCD 2EO1A 4GAGH 3QDJB 3VWJC 3K1KC 2DWEB 2XZCL 5HI4D 4KXZI 4TNVK 5HYSB 3ZTJG 5IFHL 3X3FL 2IH1B 4HJ0C 3V5HA 4DUVA 1WITA 4W70A 1NKOA 2AAVA 4Y2DD 3TBTB 5D2NA 3ARSA 3QQ3B 5E2TH 4MJID 2NPLX 1XF5A 1UM5H 2I25N 5J6GA 1EX0A 5E8NB 3BOVA 2OR9L 1JFQL 1G7PA 1WEJL 2Q6WB 3WIHL 2X70B 3MA7B 4JPKL 1UA6L 2Z31A 1FE8H 4LHUD 5DFVC 1OGAB 4CMHB 2WWKO 4L8CA 2WBJC 1XGUB 1EFXA 4LSPL 3LAFA 1MFDH 1A4KA 2Z9TA 5DJ6A 3F7PC 2YMXH 4MA7L 2QR0A 4PP2A 1GHFH 3U4EA 2V5RA 1GYAA 1UA6H 4JGMA 3OKDB 3P11L 5L2KD 1G7IB 5C0RL 3MRBA 1FQ9C 3P4LA 1S7SB 2X9XA 4QT5B 3HAEH 2EEBA 1N7ML 5HDOA 3HG1A 1MH5A 5DMIH 3CX5K 4HH9B 2NY4B 2CIIB 3CUPA 3MV9E 4XPGL 2Q8BH 5CJBA 4DKFL 4OLYL 1DQJA 3GSWA 4KI5F 1EEYA 3DUHA 3WUWA 3F58L 4HS6A 4X5XB 5ID0B 2DMBA 3D18B 5EWIH 3X12B 4NO3A 5KSVB 3GJFH 3MOBH 4EUPA 2AGJH 2H9GB 3TZVA 2YD4A 3STZB 3ZKSD 2YD2A 4IMLB 5IG7A 5ID1A 5B39B 4PJHE 2IFGA 3RX8A 1BD2B 4N1HB 1U92A 1CICB 3QPXL 1LE5B 2VITA 3P73A 1SEQH 2P8PA 1OTSC 3GMRB 3LB6D 3VD3A 3QXAB 2NW3B 4XPAL 2SEBA 1MNUH 2DD8H 1EFQA 5MENB 3I2CH 5E5UB 5F7NC 3UJJL 4K8RC 1K4CA 2FGZA 1OOAA 1P9MC 2XN9B 2AJUH 5JIPA 5GGTL 2DQGL 1DQLH 5TDOB 1ZVSB 4C56D 1QLRB 4OIBA 4JRYB 2YC1B 5E2TL 3UP1A 5EU6E 1PJ9A 5IESL 4P3WA 1A4JB 1CD9B 1FNGB 5JHDB 4JY5L 2VL4A 2DS4A 1CK0L 5CEYB 2A9ML 3C5JB 3T0WA 4IJ3B 4P5TB 3AS2A 5IFHH 2OL3H 4R96A 5L0QB 4J8RA 1BFOB 5ICZA 4PD4K 4EN3A 4AENA 5HSFA 1SM3H 2VKXA 4U1SB 1IQWH 5D1QB 1RZJL 1TZGL 5FA4B 5B22A 3V4PL 1FPTL 3TP4A 3I02A 3TPUA 2H8PB 2OZ4H 4WU7A 1IQDA 5I9QC 2IBZY 5F7KC 3OR7B 1PW3A 1KCUL 3SDCD 4NNXB 5FUOL 3GIVB 1MCWW 3GUTA 3UTTD 2PXYD 2YC1A 1AO7B 3SGEI 3C08H 3F8UB 2X1PA 5EZIL 3DBXA 1MFCL 5DO2D 1K2DB 2NY2B 4H25A 3MTRA 2R15A 4YXLH 4NO2B 3QZWG 3OR6A 4JFDB 3CVHA 3WDJA 1X5KA 3LPGA 2Z93A 3EDKA 5J12C 2IMMA 3VFUA 3ES6B 3F7VA 1W0YT 4GRLA 3TO2B 4N0CD 4K94C 4QRUB 2Q8AH 3FFCB 3U7YL 1RZFL 4M1CC 5GRUL 5GRVK 4I3RL 4TN9A 4ZS7L 4AM0B 4M7LT 3KLSA 1T66C 5T1DH 4M8VA 4ODHH 4Z7UE 1BFSA 2XNAB 4I13B 4IM8A 4F8QA 2QBWA 4UUJB 3ARGA 1IGCH 5L8KB 4K94H 3GSQA 5CUSL 1IEAB 3BZEB 4FXKB 5IFAH 3SPVB 2W65B 1C12B 4PGDA 5E1HB 4HIJA 1RJZA 4NGHH 4Q97A 3SDXF 1FDLL 4ONFL 3VG0L 5ESQB 5L88H 3VXTA 3T8XA 4HWEH 3AVEA 5EFIA 5I1LA 3QA3A 4OSUH 3WD5L 5GS0C 3SDDC 2VLMD 1DANU 1CR9H 1RHHB 4G80A 1JK8A 1ZT7A 2AABH 4UT6H 4FQHA 1PYWB 3ARVA 3GMLA 1MVFA 3F6LA 4PGZA 1OCWH 5BRZD 5ICXB 2OK0L 2HKFH 1HSAB 1GGYA 2F53D 1XCTB 2VR4A 3QIBD 1UZ6F 6CGTA 4HWNA 5J56B 1GC1H 1ETZA 4GLRH 1QRNB 1UWXK 5BW7C 3MCKA 3HRZA 4R7DB 4KROC 4ZTOH 3RVTC 2OL3B 1HWGB 5AZEH 5C0CA 5MEQB 1SMAA 2PO6D 5GSVA 4LPTA 4YK4C 4N5ED 1CD1B 3VI3E 5DTFA 3KXFE 2GUOA 3MLUH 1KYOJ 1ZMYA 3TNNB 5DHVB 4I0PA 4KUZL 3ZO0A 1GOFA 1F02I 5HYEA 1T1XB 5DJYB 1YYMH 3L3HB 3ZL4H 2JJUA 5TDPB 4NJAL 3TM6A 3ARBA 3D85B 3MUGB 2FEEL 1KEMH 3KYMB 5JMRA 3SO5A 3PWVA 1UKQA 3RIAK 4OZHA 4Q6IB 3LN4A 3DROB 4ZSOE 4XWGL 2QL1A 3MBXH 4ZNEA 1UACH 5TPWH 1UM6H 1AI1L 2FIKB 3O6KH 3IU4H 5KANI 1EV2E 1QSVA 3OHXB 3OJVC 5DSCA 3SDAB 1JTTA 1N8ZA 1F90H 4GH7B 1I1AA 4I9WE 3MJ9L 3GSRB 1A7PH 3QDGD 4LNVA 5BZDB 2VIRA 1K4DB 5I8OH 3WMSA 4HIHB 2Z4QA 2F54A 4NN7C 4U05A 4MDIA 1ADQL 5CD5C 3CNKA 4WW2C 4DKEL 1RURL 5ISZE 4PS4L 4PY7B 4PREB 2X7LB 4M6MH 2H26A 3CLEL 4LLDA 4YE4H 1TETH 3WNOA 4I0PD 5IMLB 1H3TA 2YA0A 3GMPB 1VB9A 5CUSH 2YK1H 3ZKMD 4HUWB 3TLRA 5KSAD 1ZGLA 1RZKL 1V05A 3CZFA 2OTUB 1IZJA 1B0WA 4QOKD 3WLWD 4NPYB 3H9SA 4LPUA 3DIFB 3GSNA 1TIUA 4M6NL 3QIUC 3M8OL 2VB5A 2A74B 2EIZA 1G7LA 3ZYJA 1A0QL 2X42A 4WUUB 3LEVH 2XA3A 1KG0B 3EYOB 1KF9B 2X4TA 3PE9A 4QHMB 5FGBC 4NZTH 1VACA 3FKUS 4P2OA 5I1DA 1DEEA 3OZ9L 1YPZA 4MD5B 3RKDC 1TJIH 2Y06H 5BOPA 5HY9A 1DN0B 3S37H 3CZJA 5C0CE 4JJHA 2G60L 4U1KA 3FT3A 1E4XL 4GLRI 5HHMB 5C07D 4RAUB 3UJTH 1FZJB 2G9HA 4F3FB 4EZMA 3FN9A 1YQVL 5DMYA 5IWLA 2DQEL 4PJIB 1WJ3A 4HPOH 1S9VA 4NIKB 1YJDC 2P44B 3HS0B 4L3EE 4IIQB 5EZIH 3T4YB 1OTTC 3K2MC 2N7AA 3G6JF 3O3AA 1QSED 2DWDB 2Y07H 3CFJA 3M1BA 1G7HA 4JO3L 1PKOA 5F7EL 1YC7A 2F53B 1IGYB 2KPNA 4Q2ZB 4MXQC 4PJ8A 1CL7H 5IVXB 4RGNE 4P4KD 1R24B 4H88L 4P2OB 1KJ2A 2D9CA 2CGRL 4I3RH 4TQEH 3U0PB 1S7QB 5JHDD 15C8H 4R4ND 2WBJA 2QHRL 2A6JA 3FFDA 4MD0A 1RJYB 4KJQD 5A2KH 3MLVL 5A2JH 2P24A 3OGOE 1NDGA 1AHWC 1GGBL 3V8CA 5J06A 1EJOL 5AYQA 3VGFA 1OL0A 4Z9KB 2O5XH 3H9ZA 3GSVA 1JNHB 4JPVL 5BZWB 3T4YA 3FL7A 4MVBD 5DJ6B 1KB9K 3D3VB 4J12A 4RAHA 4DK3A 2UY7A 2H2PD 1SEBA 4KDTA 4X9BA 4QCIA 5MI0B 4C56B 2NX5A 3BGAA 3EUUA 1W0WB 1ZA3A 4J3OC 4WY7H 2VQ1B 3DV4B 4XNQA 2DAVA 2FR4A 2BSSA 3DMMA 3CMGA 4O4YH 4TOYL 1ZSDA 2R2HA 1QR1B 4PJAF 3P4NB 2YD5A 5CD5D 2Y7QA 4KRPC 4PJXF 2A77L 1S7TA 1BAFL 4OLZL 4K7FA 5JR1L 4N68A 3SGKC 3ULUF 3W5NA 2MHAB 5D5ME 1OWWA 1MH5B 5CP7B 1MFNA 1MPAH 1EFXD 2WBKA 4HLJA 3NCYP 1UZ8B 3OKEA 2R0ZL 4YHZH 4OZGA 2GAZA 5C08D 3BKYH 1QLFB 3VFOA 5E70A 5ID1B 2EDRA 4K3JH 1E4KC 4LSQL 3P3YA 4XMPL 1EEYB 4ZAKA 1NAMB 4WNQA 4JO4L 2V2XA 4X5XA 3WN5A 5ID0A 3DMMB 3O6LH 1G6RA 3QUXC 5KSVA 1AGCB 1UXSB 2GTZB 4PGCA 1A6PA 4LARL 4YBQC 5LAXA 1HXMA 3WFEH 1KJVB 4JN1H 4JZJC 2EYSB 4P3CL 1YEDA 1XR8A 2NXZD 5EO1B 2AK4B 3MRRA 4OCSH 3BZ4B 4WJ5A 2OTPA 4HXBL 4MA7H 5IW1A 1NGXB 4OGAD 3IFNH 1NEZB 3CFDB 4PG9A 3LRSA 4PR5A 3VFTA 1HZHL 3O0RL 3VDBA 4G42B 4FN0A 4F8TA 3V6ZB 4ZUTB 1Q9WB 2RIKA 1JV5A 4RNRA 5LKNA 4QGTA 5HHMD 2WSKA 3SE3A 2EYRB 4HK0A 3IFLL 2K7QA 3KYNA 1HHHB 1A7QL 3DXAD 3B9VA 5E00B 2CLZB 3RPIB 3RU8H 3MUHL 4R4FL 3ZE0E 3MV01 1XF4A 1RIVH 1EHLL 5D1ZA 3VG9B 2FX8H 1FNHA 5AYUH 4OLYH 2BOBB 3QI9C 4EXKA 5I19L 3C5ZB 3FTGB 1ZLUK 1I7UA 4FQPA 3CSPA 3SGDI 1NEZG 4RZCA 5D7IA 4DEPB 1N7MH 1RHFA 1PKQE 1SYVB 2DQFB 2VLKB 1D5IL 1LEGB 3QCVH 1QLEH 4Z7VE 2F58H 2R8SL 3MRLA 4G6FB 3KPSB 3AREA 3VGHA 5ADOH 4Y4KA 1DZBA 5T3ZE 4WI4A 1HXYB 4JFFD 2ERJC 3UBXB 2OP4H 2ADIB 5I1AA 2YD9A 3B3IA 1I9IH 4M43H 5CSGA 4HPYH 3W11D 4QRPA 2D7QA 5IJKC 5BCAA 1PG7L 2R0LL 3EFFB 3GMNB 1MQKH 5C7XL 1AHWA 2LU7A 1KCLA 2UUDK 4PLKC 2ZG1A 2X9WA 1OGTB 3BH8A 1J1XH 3V4UH 2K9UA 2C1OA 1CE1L 3KHQA 1QO3B 2CDFB 3U46A 1G7QA 4I3SL 4AZ8A 3AB0C 3GBMH 2VSDA 5IFJB 3ZKXC 1FORH 5DQDH 4XVJL 5A1AA 4JG1L 3GMOB 4MLIA 1VHPA 5D7LD 3QEQE 4Y4HB 1E6JL 1YMME 4PRID 5JOPD 4RMRA 5M95B 3BRDA 4HF5L 2X4QA 3EIFA 4UOW0 3RU8L 3STLA 1EZVY 4TSAH 2V5TA 3IAQA 4KK8C 2XICA 2NXYD 3SO3B 3NACH 1JGEA 1D6EA 1NAMH 1HQ4A 3P0YL 4F57L 1JPTL 1YDPB 5EZJA 2C4FU 3QULA 3SGJC 3TJHD 3VXSA 2NY6D 4YHNA 4KDVA 4YIQA 1GRWA 1RZ7L 3RI5F 3UZQA 5BV7H 4N9GB 2W07A 2OLDA 3HR5A 1HILA 1FL6A 1RY7B 2P42B 5CBEA 3VGBA 5KS9F 1F8TH 4PBXA 3O3DB 2FECL 1YYLH 2XQYG 5J12B 1AGBB 1WWCA 3MCLH 3KPPB 3W9EB 3QUXB 3C8KA 2Q7YB 1T1WA 3VFGH 5BS0D 2QTEA 1OVZA 3E0GA 3H3PL 5T1KD 5HVGB 1I85C 2IPKB 1LEIB 4R0LC 4EEEA 3QDGE 1I7RA 5DRWA 4KK6D 1INQA 1OAYH 2B1HL 4Z7VA 2E7CA 3WO4B 1U95B 5IB4B 4P2RD 1P1ZA 1Q9OA 1LO5B 3H7LA 2XN9A 5J57B 5C0IA 1YMHB 1RZ8A 4OIAA 4ZTPH 3QNYB 3V7AE 2F5AH 4L3AA 2HT2C 2ZKHH 3VI4F 4KI5C 1N4XL 4JREC 5C9JB 2DIJA 3BAEL 4Q6YA 1MQKL 1TETL 5KVEH 2R0LH 3GSOA 5BQ7A 1TJGL 4XC1H 4DZBB 4EI5A 4Q9RH 1FVDA 3LKOB 4NKOB 3SE4A 1YY9C 3SDDD 3EYVB 3ILPB 2ZJSL 2D7NA 4J1UA 5ADOL 2XY2A 5HHQA 1RJLA 2CXKA 4CADA 3TNMA 1LD9A 4U1NA 2GY7B 4LLWA 3D0VB 5EU4A 4LPWA 1R5VB 3GJEB 3JWOL 2X4SB 4OLUL 5T5NG 4LKCA 1YQVH 2EIBA 3QEQA 1V3MA 5BRZA 4XRCA 3QEGH 1RUAL 5FYLH 2E27L 2P8MA 1OWRM 4JDZB 5DD0H 2DM2A 2MSPA 2VL5A 3T2OA 3QIBA 1AR1D 35C8L 3D87B 1I9JH 1JHLL 3QNZA 3WL9B 4P59L 4XNYH 3QUYB 2HLAA 3PG2A 4JQIL 5E1AB 1F3RB 4WW2B 1QSEE 1CFNB 4H88H 5HYFA 1ZHLB 4PG2A 1BLNB 4F58H 4G8GE 2AJVH 1BVLA 2AI0H 4AMKL 1U58B 4Z7QF 1Z3GL 5DD3H 1HDMB 4D0BA 3HCVA 4X7TA 3SKOA 3KPNB 2UZXB 3PWJB 4LKCB 3R4DA 4JFXA 4J3SA 5JHDE 3Q2CA 2ADJA 3QUKB 3QXUA 3CXDL 3NA9L 1GXEA 3TN0C 1T6VN 3TJHC 1DUZA 4G7YL 4JN1L 43C9B 1C7TA 1MCWM 2DJ4A 2A83B 1C5CL 4IOIB 4ZUVA 3O4LB 2XQBH 4H0IA 1A7PL 4LASH 3HC4H 1ZLVK 1F3JB 3FMGL 1T2QH 1R0AL 5DD5H 4AH2B 5F7FA 4EOWH 2HLAB 2G75A 1I1CA 3L3JA 4JFYA 1TLKA 1AH1A 1CLOH 4JHAL 1U3HA 4UT7H 3DMMC 3X14B 3QWOB 4C4KO 3MBXL 3ZTNH 2JCCE 4OLXH 4ELMB 5FO8A 5IB1A 3IDGA 3GHBL 3ZHKA 4WI2A 5I16B 1BAFH 3VG0H 1RHHA 1RZKH 3K2UL 3NZHH 3WFCH 4X9GA 4P46C 4OUUB 5IVZB 1WAAF 4K94L 1A7RL 4O4YL 4TOYH 4RIRA 3TZVC 1RZKC 1JF1B 4FMKA 1A1OB 1G7HB 1IE5A 5GRUH 5B38G 5CZXC 3MV7A 3MRKB 3L3JB 1A1NA 1NMBH 3MLTA 4I77L 4JPVH 5GS0H 1CICC 2YD3A 5F8QC 3L7EB 3BEWB 4Z77B 2B4CC 5JW5A 4JZOA 1J10A 2C4XA 5DJCA 1Z9LA 5J1AB 1ZOXA 2R1YA 3WJLC 3L6FA 1A3LH 2V2WB 5F93C 1KIQA 3K3QA 4OM1L 3G6JE 4BSJA 5SWZA 3TYFA 1GGUA 4HFWA 1NCWL 1FG2B 1FO0A 4HUXB 4PJBB 3BWUC 4ODTL 4NQDB 3DVGA 3N06B 2FNBA 1VEMA 4HKJA 5IEHB 4U1HB 5C6TL 2DBJA 3EDFA 1ZGLP 2HFFA 1J05B 2IH3A 1KPVA 2Z8VC 1F8TL 2VQTA 1WFNA 5D7JC 5I18L 3C2AH 3NCJH 5JLZB 2FSEA 1L7IH 3GBNH 1HHGA 2QSCL 5MI0C 5ESAA 2ZSVB 3D69A 4LQFH 4P2OC 5T5FH 2W60B 1S8DB 3TH4T 5JW3L 3S6CA 1SM3L 1VFUA 1IL1B 3ARXA 3WFBH 1I75A 2V2WA 3VCLB 1IEBA 3CDGA 2EDFA 4D0DA 1PZ5A 1ONQA 3DYOA 5FKAA 1OPGL 3KS0H 4S10A 4WTXA 4LRNL 4ONGH 5HHPA 4IHOA 3KLHD 2P8PB 3GMRA 5JPNB 3EYOA 5I75B 3RIFK 4OV5B 5D96C 1YECL 4NQXA 2GJ6D 3OKMB 1DQTA 2I24N 4HG4J 1L9NA 1XT5A 4JKMA 3HHRB 4GXVL 1CGYA 3NIGF 2DTSA 1JTOA 5HGAA 5F6HI 5L6YL 3DLQR 5MEOB 5FYJD 4H0GA 1RFDL 1ZGLB 1I8LA 1AD9B 1RUPL 2WBWB 1F4XL 3T3MF 4ZD3L 5C0AB 2EECA 3N1GC 4JHWL 1JZ3A 5L9DL 1DQDL 3FFCE 1S78D 1QBBA 1LILA 4PJDA 4YC2B 4YPJA 4M8QA 3CDFA 3O45A 1KENH 3ROOB 4OZIA 2NY7H 1Q9WA 3QPXH 4RNRB 4ZFFB 2HMID 4ETYA 4MD5A 3BP5A 4FP8H 2NY4C 4TRPH 4QHLA 5D7LB 1P84J 2ZPKH 4TVSa 4PRDA 4TUKL 2HH0L 5ISZD 3MNWB 5FAAA 5E2WH 1IGTA 1WBXB 3IDYC 2DKUA 1SMOA 1NMAH 1FFNB 4QWWD 1B88A 2YPLB 4JGUA 5D7LE 3V4PH 2PN5A 3UXFA 3VFVB 1TITA 1IKNC 3CK0H 4WDIA 4DKFH 2Z91B 5GGUB 4BK4A 1RJYA 5F72S 4WO4D 2XFXB 1A6TB 1XGRA 5C0EB 2CUHA 1UACL 2NLJA 4UNVA 1EO7A 4AT6A 3HZKA 5F96L 4ZG1A 5JW4Q 2NY4D 4XHQA 5B3JF 3S9DB 2EZ0D 1XH3B 2ZCKH 3JV4B 1MELA 3Q3GB 2FIRT 4WEBH 4YDKH 4H1LH 5AD0A 4YGVB 1W72L 3RDTD 3IFNL 2VQ1A 3DV4A 4XNQB 5C07E 2CK2A 1HYRC 1FIEA 4OFDA 5FYKU 4Y19A 2ZG3A 1K8IB 5D6DA 1DFBL 5BW7A 4Z7WA 2WP3T 5ECJE 1WEJH 1S9XA 2MQ3A 2OZ4L 3BXNB 4MWFA 2YSSA 3G5YB 4C59B 4ODWA 3FZUC 4JR9L 1NDMB 5ITBL 3DHJA 3HNTL 5LXGH 4J4PD 4YBLB 4WO4C 3EKCA 4MB5A 2EDJA 3V52L 2OJEB 2ZWLT 2BFVH 3EW3B 2O5YH 3WXWL 1I8MB 5J6GB 4BZ1H 2PTTA 4HX1B 4QKXB 1J8HE 2YWYA 4A6YL 4YHZL 5D8JH 1MCFA 2XV6B 3VXOA 4S0SD 3RFZC 3ET9F 4W4NA 5E9DB 1Q0YL 1S9WB 3PQYE 2V2TB 3JWNC 3NZ8A 2DQIH 3UTTB 4YNYA 3DOSA 5ANME 4R2GB 4GAJH 3BX7C 4K8RL 4OCRL 2OXGA 4PJBE 4U0RC 5IMMA 2AKRB 3OX8A 5KG9A 4JLRA 5EUOB 4HGKC 2Y1VA 4Q9BA 5GGTH 5EO1A 1CCZA 5CP7A 4B7IA 1C5BH 1G9NL 2WINB 4PJ9A 5AG9A 4KI1A 4WU5B 5DHYA 2OYPA 1NGQL 3VRIB 3SO3C 4NO0B 5FA3A 2V5YA 1GHFL 3VWKD 5JOEA 3NFPB 2DLFL 4L8DA 3V4VL 1RU9L 2WUBH 2NY7L 4LSUH 3MNZB 4FQXB 3WN5B 4YDIL 2EIEA 5JZ7D 5KVGL 3GSXA 5I8KL 4MS8D 4OD2B 4KRPB 4U4BA 3NMEA 4ZFZB 4KAQH 4CAGA 5A16B 5I73B 3DGGB 1UB6A 2NY0B 1D5ZA 3CJJA 1S7RA 4FQ1H 4BZ2L 4HH9A 2BNQD 2W9EH 2JJSA 2W38A 1WWWX 1ITCA 2DL2A 3CH1B 5KVMC 3N0PB 2W9EL 4LCIH 4Y4FB 4DVBA 3MLVH 2EXYD 2NY3B 4PGDB 3SBWC 2ZCLH 1MLCB 4QOKB 4MD4A 4FTVA 5K9JH 1FP5A 4HJGA 4KHXH 4X7CC 5HYIA 4LL9A 4EUPH 2YD6A 4LLAA 3ILQC 5FYJL 4DK6A 3VRIA 4LVNC 9CGTA 2H2SC 1BBDL 4ORGB 2KZWA 4Y19E 5T3XE 4BFIB 3OXSB 3C08L 1P69B 4C54A 3GO1H 4Z7WE 3H9HB 1FCCA 1JK8B 4U3XA 4O02H 3UTSA 5DYOB 4ZAKD 3MRPB 2Y07L 4MGXA 4E9LA 4S1DD 4O02L 1HHIB 2R9HC 3E8UH 3S3SA 2J7LA 2Q20A 3VXMD 4H1LB 2R69H 4EN3B 4CVUA 1KIPA 1FPTH 3MLPA 3TCLB 1QFWL 3G6AA 4JPKH 4Y16B 2ZUYA 1RSFA 3U1SL 2DBLH 4U1MB 3QIBB 4OI9A 1XF2A 1OT1A 3MV8D 5F21B 2YHGA 5FDWA 1OD9A 1NCTA 3ZDYF 2EXYC 2NTFA 4NJ9H 4A6YH 4XRCB 5F9OH 4MVBC 1TTGA 1YN6A 2A9MH 2D9QB 1FSKB 4S2SB 3RY6C 3WKML 4Z8FH 3WXWH 3JWDC 3V52H 4K3DH 1JPGA 3OB8A 3SHSA 3MJ6A 1HWHB 3ARBD 1BQUA 1U8JB 4HUUB 3QFJD 4UT9H 1R6VA 4BKLB 2JF1A 4BH7A 3VXRE 4PJFF 3VXPA 1A3QA 4U6VL 4U1JA 4LCYB 4K9EL 5I8CA 3HAEG 3KPNA 5D2NB 1KSRA 3L95B 2OR7A 2ITCB 4ZPVB 1VGEH 2YK1L 3QPQD 1IGJA 1MHEA 1BVLB 2YXFA 1FZMB 3U0WL 2VISB 4MMZC 5ADPH 2H2PC 4KKAD 3O2DL 4PRNA 2EEAA 4S1SL 3WNPA 4BQBA 1U91B 5D2NC 5CBEB 4HKXA 3QBTB 1A7RH 3JWOC 3WDIA 2HFGH 3P0GB 3PL6B 5DVNA 2FD6H 1V8HA 4LVHC 3DVNB 4UMGA 2IEPA 1V7NL 3PIQA 4YFLF 3VA6A 4C58B 4K07A 3QCUH 3HMXH 2YUVA 5IHBA 1A14L 5FV1L 2DQUL 4HLZG 1D6EB 3WO3B 1VGKA 1K85A 4X6DB 1MFBH 5DA4A 1T89A 3BSZH 3TO4B 3U6RB 3KLAB 4PPTA 2JB5L 3GIZH 2YZ1A 3IF1B 3V0WL 5E4EC 1I8KB 2Q76B 1OSPL 3BP4B 4DCQB 1B3JA 2B4CL 4XMLL 3MGAA 2F19L 4YXHH 3MRDA 3QRGL 4OQTA 3CMOL 5IMKB 3KGRA 4X7EC 4FFWD 1AKJD 1ES0B 4N0CC 3GSOB 5C08B 4DN4L 3FFDB 1MFEH 2X09A 1I4FB 4EUPB 2IAMB 4QHKI 5I1EL 4RDQG 3TN0B 3DVNA 3NA9H 4Z76B 3RNQA 1F11A 4XB7A 3HPJB 3B6SB 4Z5RB 2ARWA 3U7WL 5DVKA 2A9NH 5HHQB 2AQ1A 3GSVB 3N1MC 2BVOB 4KY1L 3CPLA 3ARFC 3EJJX 5KBNC 1OLZA 5AZEL 1JNNH 1WAAA 2OR9H 3IGAA 4UOJA 1NH6A 2NW3A 3X3GL 4F58L 2ICEA 4RGOL 5FGBA 4IOSD 5DRXB 2FLBT 3U82B 2CJUL 4FQHB 1G7MB 1TNNA 3VFMB 4U7KA 1D5BA 1JRHI 1E6OH 3HS0A 3O9WD 2GEEA 4KTEH 5D6CA 1IT9H 4KJYA 3OKKA 1HYSC 4YK4B 3DPBA 3MRDB 5EIIB 4N8VA 2WIIA 3P30L 4NC1E 4N0FB 2XKNA 1A7OL 4ACPA 2XTJD 4CU7A 4XNXL 5I6XB 3QUYA 4HJJL 5GISL 2VDKH 4A6YB 3OSKA 3L3DA 5IF0B 4AEHL 5A3IC 3T2NH 1UC6A 3QDMA 2QQLH 5EA0H 5FF6B 1ZANL 2XTLA 3F5WB 1EIBA 3BN9D 2VLLB 5EN2B 1T2XA 5I71B 4LEOA 4ONFH 4KK5C 5TE6H 3HI5H 4P57B 1KTDB 1KENL 4U1SA 5D1QA 1Q9KA 3EDEA 4M3JA 4MCYB 3RDTC 3VFOB 5KSAC 3BDBA 2CH8A 3MRNA 5T33H 3FB8B 1FLRL 3H7BB 5KN5B 3I75A 4YDLB 4UINH 5SWQB 1HINL 1AQKL 4EIGB 1D5MA 3B9AA 1NGPH 3V6OE 4XNZC 1TVBA 2DM7A 1VERA 5DHVH 1ZTXH 4NC2B 2WP3O 2AJ3B 3TA3A 5BJTA 3T0BA 4HEME 3HI1A 3BFOA 4HH8A 2R2BA 2D0GA 4G7VL 1BFTA 4PJ5D 3FB7B 3WIFB 5DD0L 1Q72L 1T7XA 1VFAB 4PJHB 4GUPA 2FEEI 4H0HB 1OARL 3CFCH 4KV5E 3X14A 1OB1B 2X4PA 4APQB 1FFRA 3VXRB 1R5IB 3ARZA 5C3TA 4KK5D 2FB4L 3LN5B 3QH3B 2FHBA 1FIGL 2MQCA 1CICA 3WSQL 1HK6A 2JJWA 1YYLL 1F3JA 3FN0H 1K5NB 1HQRA 1MREL 4OUUA 5IVZA 1ND0B 3TIDA 3GM8A 1CBVL 4HT1L 4JY4A 1B90A 2OQJA 2D0HA 1ED3A 3BP5B 4FQJH 4PJ7A 1LQSR 5C6TH 4JPWL 3FT3B 4F37F 1NCBH 2IALB 3BAEH 5JOPE 1FFPB 2JJTA 1MWAB 3HAEA 4NPYA 3WJJC 5C2BL 5FGCB 1YPZB 4FQCH 1I8IB 2FZ3B 1YY8B 4ZTPL 4CVXA 4KVNL 3I6LE 1S5IL 2E6PA 4GQ9H 5EFIB 3BE1H 1M71B 4IIQC 2I60H 1NFKA 5GRJL 4J8RB 1OSZA 2W91A 3BIKB 4OF6A 3QO1A 2R29L 4OD1L 3ME0A 5D7SH 5ISZA 3U2SB 5IV2B 2XZAH 3AY4A 1EBAA 3MRJA 2BVPA 1NJ9B 2HG5B 5IBUG 3IDNA 4M1DL 5JDJA 1OAUH 1CDUA 4MQXD 4P5MA 3LOWA 1P7QD 5HYJA 3GI9H 3KYNB 4HK0B 4JM2F 2JB6B 1KOAA 3DUUB 5GZOD 2HLFD 5DK3A 2W0FB 2E8ZA 2EE9A 1G7PB 1IGYA 1ZS8B 5I1HL 4FQ2H 4M1CD 3V2AR 4GKZB 3OV6A 2R0WH 4JZJB 2G2RA 4HLZH 5LQBH 3H2WA 3D9AH 2GJJA 2FH8A 5EU3A 1F4AA 1OAZL 2CR6A 1A6WL 1YPZE 3B9DA 5C6WH 1UJ3C 1D5IH 3EOBB 2GT9B 4OM0L 1F00I 4P5TC 1JGVL 1CZ8L 2E8YA 5DZLA 2PTVA 4IDLA 3F65A 4MD0B 5EU7E 3ARBB 1B4JL 2V7HB 3ULUC 2OMNA 4J3UA 5CD3B 2GJZB 3MA7A 1EZVX 3D6GA 2E7BA 3U4BL 3QDJA 4PLKD 4PGEA 1MRFH 1FV1B 3VXMB 1C5CH 5DGQA 1X3DA 4XP6L 4FNLH 3JWOH 4XP5L 4XC3H 4CN6A 5ESVB 3KYOA 4NQSA 3LHPH 2XN9D 1DLHB 4LRIC 4X7SL 4PJ7E 3CSBA 1KPUA 3KYKH 1H5BA 2BHUA 4U1LA 4XAKE 1PDKA 3HI6L 4ZS6D 4M1GH 1YNTB 1S7XA 2AXHA 4YHKL 2FDBP 4XPFL 1CTOA 4PRIB 4UQ3B 4MJIA 3P4MA 2P1YA 1OGAA 4KRMB 4L8SB 4F37K 3DGCR 1JFQH 4Y4HC 1TZIA 1M7IA 2EEDA 3OKNA 1A8JH 2YWZA 5C0FB 4G80B 4P2QA 2OJZH 1PYWA 2WMPA 4XCYA 3IKCB 5E5MA 1I3VA 5CWSA 5HDBE 1Z9MA 1OD7A 4MHHG 3IJYA 1XGQB 5INDB 1MF2L 4HBCL 2AXGA 1T21A 2RGSA 4R26L 4YFEA 3NCFB 3MA9L 1MWAH 2MKWA 4PY8I 3I9GH 2HRPL 2BNQB 2EKJA 5HYJE 3H3PH 2D31A 4PRDB 3X3FH 1WV7T 4LLWB 5JORB 5ETUA 4OM0H 1A7QH 4ELMF 3IFLH 1NC2D 2HJKB 3I6KB 1GZPA 2Q87A 3DX9A 2V17H 2CK0L 5KAQF 1A2YA 1L4IA 5FYJE 2JJTC 4ETQA 5T1MB 4HCRH 2H9GA 5GZND 5JNYB 1DQML 5AZ2H 4MDJB 5D5MA 4MA8H 4JCLA 2HT2D 3TYGH 3BKJL 2A6IA 3RVXC 5DMGD 4NN5C 4DTGL 3GUTB 2ATPA 2HT4D 5GGQL 3PHOA 2PW1A 3MACL 4HC1A 1KELH 2BRRL 3WLWC 4ORZC 3MXVH 4P9ML 1XIWC 4H25B 5DFTA 1NLBL 5I15H 3U9UA 1YNKH 1SYVA 2DQFA 1H15A 5GGVY 1AGFA 4UZGA 3ETBF 2DQJL 1XIWA 1JPFB 4U1IA 1MAJA 5E24E 4JVWA 4IRJA 2MMXA 3QR2A 5JIHA 3DETC 3TYGL 5D7KD 1CGUA 4G6FD 4L9LC 4MA8L 4O00A 5JXAL 1U8HB 3QDMD 3O11B 3T65A 4FQJL 5HHOE 4Y5YB 3RWCB 2BX5A 1I8LC 3HI6H 4ZOEA 4NQDD 4ERSL 2OK0H 1E4WH 3T0VA 1MCIA 4O9HH 4JJ5B 1JF6A 1AP2B 1T5WB 1ZE3C 3G5ZB 3GMPA 4R90H 4XNMA 5D1QD 4F7PB 1MY7A 3AUVA 1T1ZA 3EYUL 2R8SH 3ES6A 4D9RD 2EDEA 2X4QB 3NZ8B 4L3ED 4CDGC 2IQ9L 4MMXC 5ELIA 1UCBL 3BPLC 4OKVB 4F33A 3RTQA 1LDPH 3TWCH 5HXMA 1QSFD 4XCNA 4G8IB 3GMOA 3REVA 4PGJA 2GFBB 5D7JB 4ZO9A 3L3OB 5FFLA 1G7JB 5F3BA 1A5FH 3BZFB 1GGBH 3TVMA 3GEWB 4I1NB 4X8JA 2ID5A 4ZOCA 4RQQB 5E08H 1P9MA 3TT3H 5HGBA 3UBXI 3H9SE 1P5VA 5C0DB 4KTEL 5IIEA 1A1OA 4HIXL 2RFXA 3CDCA 4K71C 4LPCA 4PJCB 2AQ2A 1NGWB 3RWEA 4LF3A 3VWJB 1XZ0A 3HE7B 4IRSA 4ZXBD 4MNQD 4Z0XB 1CFVL 1WIOA 5DDHA 1TDQA 1NGPL 3NOIA 1ZWIA 3X3GH 1NCCL 3ZT5A 1CGTA 4KJPC 4ZUSB 2A2QT 2EDOA 2B39A 2VDOH 3MCKB 2GTWB 5KVDH 4HZAA 5LAXB 2PUQT 4MQ7B 3RY6A 2YRZA 2YA1A 3WBDA 3REWB 3SKMA 1MCQA 2CPCA 2EDKA 4M61A 4W4OA 1QLEL 3C09C 4NHUA 1QACA 1CDYA 1J0HA 3PGDB 3TVMB 4JFEA 4P46B 5FIEA 1YMMA 5MERA 1MRFL 4BFIA 3MV9D 1FL5A 4M7KL 1AQDA 1Q1JH 1KN4H 5IR1A 3T08A 5EOTA 5F71A 4QWWC 2Z8WC 1F90L 3RDTA 5KSBA 5EC1A 2HT4C 4IDJL 5E2VH 1NLDH 4PJGB 1B6UA 4N8VB 2CO7B 5IVOA 1V7MH 4XBGB 2J2ZA 2JJVA 1LD9B 1KIPB 1QG3A 1TVHA 3M8OH 5J13C 4G8FA 1IKNA 1BVKA 1U36A 1VKXA 1C08A 2B8OT 1U41A 2VABB 3L3GA 4LAQH 5D70H 4NKOA 3BKCH 1FYTB 3THML 4WFFE 2X05A 1QBMH 4NOBA 1HSAA 3QEQB 3NABH 4QHKJ 1YEJL 1DCLA 3Q1SL 4NFDA 1E0OB 4OCSL 2PCPA 1I1AC 3MPCA 5A3ID 4CMMA 4GO6B 3IS1X 3W9DA 3GI9L 3FN0L 5FUCC 2C3XA 2PYFB 5J3HD 3C60D 5E8EB 4ODVL 5HVHC 3WS6A 2X4OA 2QSVA 4BSWA 4MNHA 3B9KA 2BVEA 1DANT 3IDXH 2EO9A 3RDTB 5KSBB 3A0OA 1JI2A 1UG9A 1G6VK 3NGBC 1AO7E 5JPMB 3MV11 1X7QB 4OZ4A 5GRJH 3BKYL 3T0AA 4D8PA 3A6CL 1ZKAA 4P5KB 4KDWA 1FVEB 2HAZA 1R3LA 3HZVA 4YDVA 5D71L 1J86A 1ZAGA 4GMSL 3GSUA 5B38A 4N9OB 2F8VA 3HMXL 5E9DE 1BZQK 4AY0A 1DBJL 1CDCA 3JSSA 2CLRA 4XWOC 3OXRB 4NJAH 1FHGA 4KMQA 1LO3L 3LN5A 4D0DB 3UTTE 3ROLA 1YEFH 4APQD 3BUYA 2EC8A 3NCYS 1X5IA 1UB5A 4M7ZC 4NGHL 3LZFL 4F7TA 3O2DH 1N64L 1P4BL 2ADGB 1FIGH 1NEZA 5GIRB 4XGZA 1PEWA 2R39A 2XRAL 2UYLB 3R0MA 1RAMA 4TUJA 3DRQA 1BOGA 4TNVF 1T0NA 3MJ9A 3P0VH 5KSBE 3PQYD 1DN0A 2D7TH 1FL6B 1IMHC 5C0AD 3MOAL 4LHJB 4MJ5B 3W5MA 3UZEA 1S7UB 3VXQB 2F53A 1M7DB 1K8DA 3U9PL 1IGML 2AEIT 2ZCLL 1IT9L 3KNBA 3W9EA 2MPAH 1FNFA 2FCBA 5CZVL 15C8L 4P5MB 4WTZG 4X6EB 4PJDF 5I0ZA 4WTWA 3CC5B 2AABL 3DTXB 1NCDL 5AUMA 1TCRB 1INDL 1KIRA 1YEKH 2ZUWA 4FXKA 1CVRA 4KGLA 4LIQH 1LO2L 1UVQB 1PY4A 5ILTH 4RFNC 2P5WE 3MV9B 3N1PC 2L4OA 4KQ4H 4RA0C 5EPMB 4KH2A 4HKBA 3WFZA 5EU3B 2W9DH 3HI5L 4PLOB 1J18A 4M62H 3A6BL 3LKRB 4N1CA 1WC7A 4L4TD 1FG2A 3X13B 3DVFA 2BP3A 1L9MA 4EDWL 3E6FB 4CVZA 5AWNL 2GJ6A 3LKNB 3PP3K 4LVNB 4AEHH 4Z77A 5JW5B 3HC0A 2VN7A 3FQUB 2VR9A 3QQ3A 2FWOB 3FAWA 3PJSB 2FATL 4QRPE 3BH9B 3DX7A 3EOAA 3P9MA 4GS7B 2UY6A 2Q8AL 5FO7B 3HB3D 3C5ZC 5AUMB 5LWYL 3AU1B 4GW1A 2VZ1A 4HK3J 4C56E 1B4RA 1HN1A 5HPMA 1WCBA 2KH2B 4BZ1L 1MIEH 1JWUB 2PO6C 3T1FB 3JTTA 3QCUL 1JNNL 3V0VA 3LVEA 3MJ7A 4S1DC 1N6VA 3KHOA 4ZFOB 3VGAC 4YO0B 3AS1A 4JR9H 1O7SA 1AJ7H 3KVQA 4Y5VC 3SQOH 2KBGA 4YDIH 2V9RA 3CLEH 4ZO6A 4S1SH 4UU9A 1HSBB 2YKLL 3BJ91 2DLEA 3EYFA 2YUWA 3HZMB 4Q58C 2BVYA 3DO7A 1ADQH 1JYXA 5HHXH 4QRSA 3HMWH 1KCUH 4QOKA 3UC0H 5D96B 3HC3L 4WO4A 1H3UA 5J11C 2WQRA 5DURD 3D3VD 4XMLH 4YXHL 2F53E 4CRPA 2P46B 3FQNA 3UBXG 2H6PA 3H3KA 5E4IA 5DRNB 5SWZE 1PD6A 2JB5H 4WGVB 1RMFL 5IEKA 2AJZB 4BJLA 5GJSL 4L8SC 5D4QA 5E2VL 2J8OA 3VWKA 3UTOA 2HJKA 3I6KA 3CLFH 5C09B 5IQ9B 4K7FB 4TULH 2NY2C 5F7WC 5IB5B 3IDMA 4GKNA 5C0IB 2Y6SD 2XY1A 1EO8H 3H9YA 5D1ZB 3CUPB 3U2SA 3UAJD 3MV8E 2KKQA 4R8WH 4M5ZH 2BOBA 5E99H 5I8EB 4FQXD 1EVUA 1URLA 3RVUC 2NY1B 3M17A 5BQ7B 4NYLB 2HFEB 5DJDA 4PJDB 4NRYB 3H0TB 5DFWH 1FVDB 3JV6A 3LKOA 1KT2A 5C0RH 3S7GA 5KAQG 4JKWA 4J3WA 5J0BA 2H6PB 4CUCA 5LCVH 1BZ9A 4LLYA 1DVFD 1FGNL 5B8CA 1TMCB 2ATPB 4F80A 1MJ8L 4NN6B 2JIXB 2AEWA 3QO1B 5J6HB 1P84K 3OKOA 3O41A 1AJ7L 4WEBL 4YLQT 2DLGA 4M6AA 4WHDA 1QBAA 5IJVB 3FAXA 3QEHB 4FQIL 4R0LB 5CFHA 2RHEA 3OJDB 1Z0MA 4YAQB 3LQAL 4PRPE 4CDHA 5F7LB 2P45B 4FZEH 4OB5H 4UILL 1DE4A 2HT3D 3OXSA 5L2KA 2NY2D 4O2CA 2UWEA 3LKSB 3HNVH 1N3NA 2PO6A 4G42A 3K74B 1LE9A 4PP1C 1DJSA 2V9QA 1AGEB 1MCSA 3WL9A 2VAJA 1EJ6A 4Z7WB 2G2RB 1AGFB 5ENWA 3WHXA 1OAXH 1KJMB 3GIVA 2J12B 2IF7A 2IQ9H 4D2NA 2B20A 5CP3H 3TVMD 1T5WA 4F7PA 4GG8A 4PJAB 1YEEL 5DJ2B 4P9HL 4QOKE 4XVSL 5GJTL 5IBTH 4ZFOL 4EDWH 2Z31B 4OBSA 3O6FA 4X5WB 3T65B 3FOLA 1MUJB 1T03H 4Z7NE 1GOGA 1KJ2B 4NQCD 1FO0L 5BOZG 2ADJB 4LIQE 1S7QA 3N85H 3C6LD 3D0LB 4JVUA 5D2LA 4J6RL 4ZS7H 3V6FB 4PBVC 3AS0A 1XIWD 3IETB 1NUNB 4KXZH 3SDCC 3N1QC 3BYTA 3W0WD 4GRWB 5I1AB 4V2BA 4XCNB 3ARDD 4MAYA 3L95A 4JLRB 2EKSA 5IHZA 3O3DA 5K93A 3GRWA 1NBQA 5BZWA 4XBEL 3SDCA 1CS6A 2M2DA 3F7QA 2FLRT 1QFHA 1IEBB 3MXWH 3SE9H 5JXEC 3MXVL 3C8KB 4WFFD 1G9MC 4U2YA 3MRHA 4HV8A 2BRRH 5C0ND 3TH3T 5TF1L 4X8JB 1S9WA 3LV3B 1X5HA 3TBVA 5B3NA 5MEPB 3IJSA 3W11C 1NUGA 3CVIL 3KXFB 4MXWL 4YIQB 4DFHA 3K8KA 5DRWB 4K3EL 1RZIA 4ZAKC 1KCRH 1DQQA 4K8RD 4XCYB 4XPBL 2L7UA 4E41A 5F9DC 1CG9A 1QRNE 5FYKL 4PJ9B 4MNQB 2BVUA 3OKLA 2XTJE 5HHNB 2CKBB 1AIFB 3EO0B 5H35B 4Q9CA 2C3HA 1T22A 4PJIF 3PWPE 4HFUH 4NO3B 1S7WA 1K4CB 4HJGB 1J88A 4R4BA 5TE4H 2ZUTA 1QBLH 3RIAF 4XAKD 3FT4B 3A67L 3LSOA 3VMPA 2AGJL 5IP4A 2APFA 1NPUA 2EH8L 1KTLA 4GSDL 4G9FE 1JPST 1MIEL 4W6YB 2NZ9D 5DLMH 2BHYA 3BEWA 4LSRL 2RQ8A 1FL5B 4M00A 4MB3A 4TPRH 5T3ZH 5BMFH 5DYOA 4QXTB 3GM0A 4Z78A 2ZUQB 2VDNL 3MV7E 1HXMB 4XCCL 2NCMA 4HFWB 1WZKA 4MDJA 3WEXA 4EDXB 1DVFB 3MLRL 5E7FA 1J12A 1T3FB 1A7BA 1YEHL 2OJZL 1Q38A 2VERN 3A6CH 5ITBH 3AXLB 4OAWA 1R0AH 1DUYA 3KR3H 5FYKE 1U8NA 4YXKH 4WJ5B 2DQGH 3JZ7A 1EAJA 4Z7UB 3ZKMC 4CVWA 4MQTB 2IH3B 1A4JA 1FNGA 2AJ3A 2DQHH 3HMWL 4UQ2A 4BM7A 5BJTB 1U8MA 4O2EB 2GKIA 5D2LE 3FO2A 4JHBA 3QIBC 5C0CD 3KYMA 1AXIB 1IFHL 1JV5B 2C3GA 1DBBH 2C9AA 3JV4A 1R3HB 3F7YB 3WFCL 2DTMH 2B5IC 4P2RA 2GUOB 1UXWB 4AL8L 1NCDH 2ICWI 4I0PB 1KJ2H 3CFKA 2M1KA 5EWIL 1T1XA 5DJYA 1UM5L 4LSVL 5E99L 4H5SB 4QGYA 3SGJA 5DUPH 3RTQD 5JPMA 1K5NA 1U8IA 3K80A 5J1TC 2YSSB 1KTKE 1FZMA 4QNPE 1BJ1J 1JHLH 3U9PH 3D48R 1CFNA 5CSZA 4Z0BH 4HHAA 4GRWH 1RK1A 4P3DA 4G43A 5HDQH 4B53A 4P5TD 3GKWH 4LVEA 5GGTA 3VE0A 2XZCH 3FMGH 5A40E 5JMOC 1IBGL 2DMKA 1UKSA 1I7ZB 2AERT 3D5OF 2ATKA 2XQBL 1JGDB 4WCYL 1CDIA 1C8PA 3P11H 4JDZA 4YFDB 4XHJC 4PRBA 1YY8A 4CVXB 3ARBC 5DQJB 1CE6B 5C0GA 1N0XH 1B0GB 2VDLL 5IBUB 4LLVA 3MRGA 4QRTB 3C2AL 2MWCA 3NCJL 3Q6GH 5D7KE 2X5PA 3VXUB 1FSKC 2I9TB 4FRWA 5ILTL 5T1LA 1ZGLM 3WIHH 4G9FA 4HIJB 3FFCA 2YKLH 2X1WL 4XGZB 4NHUB 4XC1L 2VXTH 1AR1C 3FJTA 5F1IB 3GFUA 2Z92B 2P8LB 3VXTB 2CKBH 5EBWB 2XZAL 4ZS6C 1PX4A 2ICWJ 2XKUA 1IC4L 6FABH 1KNOA 1ES0A 2F5AL 4F15B 1ZHBB 4R3SA 2OBGA 4OGYH 4OF8A 3CFBA 3WFDH 1A47A 4TTGA 1U3JA 4L3CB 4PJ9C 4KKBC 3HUJB 3KG5A 4FABL 1EXUB 5DK0B 5J7CC 3IRPX 5DC4B 3O8XD 2J4WL 4U6YB 1B0GA 2X10A 4GAGL 1LO4L 3R1GH 5J1SC 1TPXB 1KIQB 1DEEB 2IAMA 2NY6C 5DRZB 4YR6A 1LDPL 1NCBL 1XFPA 2AV7A 5GZNC 1YN7B 4H20L 5I76A 2GT9A 3NN8A 5CZKA 3UAJC 5DD6A 4FG6D 1N64H 3SCMD 1BQSA 3INUL 1G0YR 4NZRH 3HFML 2YD8A 5EPMA 1R24A 4JFHE 1K8IA 1ZHNA 5EDXA 5K9QG 5DJXA 3DRTA 4NKDA 4PJGF 5E8EA 3W2DH 5D1XB 1TJGH 3X13A 3BIKA 5E6ID 5C07A 1H3WM 3GBLA 5CEZE 2GJ6B 4ONHA 2NY0C 3NBNA 3DJ9A 4L5FL 2C26A 4NQSB 4FFYL 3LKQB 4MS8C 3DUSA 5HHVL 3CU1A 5E0QA 2OJEA 3FT2B 3QNYA 1RUQL 1IL1A 3D3VA 2VE6A 3DUUA 1YJDH 3FHAA 3CD4A 1IILE 3MJ7B 4NWUL 1SEBB 2ICES 2H32B 4WEUD 3O2VH 2FJGA 4GS7C 4M7JH 1IM3B 5GGRY 4FFYH 4YNYB 3IDXL 3MJGX 1D5MB 2FX7L 3LDBB 4I5BB 4TNWF 1ZHNB 4XP9L 2QQKH 2Z31D 3CXDH 5BS0E 3GRWL 3QZWB 1U92B 2FRGP 4P57A 5FHAL 4BH7B 1X5YA 5E8PA 2AEQL 3C6LB 2DF3A 4Q7DA 2F15A 4U1HA 2IANE 1P4BH 4PJHA 1WLHA 2BXZA 5TFSH 4UB0H 4XVUC 2OP4L 3BT2H 5IMLA 1FV1A 1NAML 1MAML 3AMLA 5D70L 5HVHB 2P43B 2P4AB 4LAQL 1KCVH 5GGRA 1X6LA 5BVPL 5EU6D 4PRNB 4CN1A 1E28B 4KKCC 4MDIB 1RK0A 1MJUH 4M02A 4CW1B 2VN4A 4HF5H 3PHSA 3EO9H 1HQRB 3F7RA 5GXBB 3QDME 4NM4L 3HC4L 2R56H 2MFNA 5DUBB 5DQDL 3QIWD 4BYHA 4FTVB 2EC9T 3UO1L 3TIEB 4MJ2A 1XF1A 1UCBH 1H3XA 1KUMA 5E7BA 5J9PA 4LOUC 4G6KL 3MRFB 4FTVE 2Y6SC 3BKML 1QSFE 1U8LB 2ZNWA 3O9WA 4R2GC 1RVFH 1SYSB 3ULSB 3R8BB 2VXQH 3GGWB 4HW6A 2HJLB 4JY4B 1I1YA 4Q9RL 4JM2C 2GK0A 3SGEH 3RWJA 3OGCA 5ACMA 5E8NA 1U42A 4HS8H 3LPWA 3VXNB 2R4RL 1BQHB 3D2UD 3MGOB 4ZYKB 2YR3A 4QY8B 5HHOD 4XC3L 2YBRA 2C5DC 2WWMD 4YWGH 1CT8A 1OP3K 4XB8A 5IW6B 1TJHH 3EOAB 2ED9A 3MFGB 5BXFA 4ELMA 1T7WA 5I1IH 1V7ML 4IRZH 3BSZL 3C5SB 4Z7NF 4R2GD 4M9PA 1CQYA 3MFFA 4JG0L 1MLBA 1VFOA 2V5SA 5GGVH 1WICA 2AK4D 4WDIB 4JRXD 2W0FA 2H32H 2FL5B 2NY5L 2ZSWB 2FJHB 2XKNB 2CRMA 2ITCA 4ZPVA 2IANA 3K46A 4X99B 4ODSH 2UUDH 4AIZA 3C60C 3OQ3B 3WO4C 4MLSA 4ERSH 1AXSA 1ZT4A 4P4RB 3V8OA 1AGDA 4NO5B 4EN3C 1NGYA 2OTWA 4JPIA 1N5YL 3FQXB 5DJ0B 3DNKA 5HD8C 1BQLL 1UENA 1WFOA 3P77B 4XCEA 4WI5A 5BO1L 5KANG 3KPRB 4LSTH 2AK1H 4EI5C 4YZFE 4QXGL 1FRGH 2MCPL 5I66A 4WI3A 3UJIH 2NR6D 1NCAH 2E7LC 5CD3A 1JL8A 1SVCP 4LCCB 1BGXL 1C5DB 1UEYA 2NXZB 3RWHA 4JKPL 1SJVA 4XAWH 3MOQA 5BMFL 3BXNA 5F6HJ 5EB9A 2YD7A 1SJHA 5JW4R 5CGMA 1AP2A 1NCAL 1IAKB 4ZAKB 3TFKC 4N5EC 5EU5B 5I30H 5C2BH 3BW9A 4NCDA 5DVLA 2I5YL 1N59B 1IAOA 3RZCB 3O9WC 4KVCH 4IOFC 2AEPH 3S5LB 1CDHA 3TWCL 4EN3D 3QEUA 3QRFM 1NCNA 2EYSA 1NBVL 2E9BA 3DXAB 4QNPF 4HCRL 3SGDH 5CEZL 1ZLSH 3BQUB 5MEND 3T3PF 4ORGA 3B4NA 1JTPA 4FXLA 1JVKA 2DLIA 3ZKQD 2ITDA 2XOTA 5DHVA 2N4IA 2JIXA 2NY5H 4MAUL 4YHOH 2VH5L 5HGBB 2AJYL 4K7PH 2BSRB 4R4BB 3FQWA 1JHTA 3S98A 5SX4I 2ARJB 5EH1A 3LS4L 1CXLA 5ALBH 3RHWF 4ZXBB 4F2MB 1A6AA 4F7CA 5IROA 5F89B 3UJTL 2HFEA 3U4BH 3MLXL 3RL2A 1Z5LB 3GHEL 5AAWA 2EDYA 1U9KA 1KLFA 1FORL 1U8NB 1KB9J 3HNVL 1D6VH 2PNDA 1TJHL 2Q7NA 3OZ9H 1CU4H 3TO4D 4MXQD 4YWGL 3WEXB 1A6ZA 4WV1A 3MLXH 3N50A 4APQC 4ZNEE 1F58L 4FQIH 4S2SA 3BQUA 3QXTA 1BP3B 5H94B 3VRJA 4PJ5E 3WE6A 5C0BD 4NN5B 3WS3B 3OPZL 3CX2A 2R0WL 4YHIA 1BMGA 4HIEA 2WIMA 4P5KA 3S3JA 3D0VA 1ZXQA 3CFEB 3QXDA 3RWIB 3O4OB 1A02N 3ARFB 4KK8D 2D03L 5F7MC 4KZEH 4MSWA 5DO2C 4P2QE 2DQCL 5EC2A 5FM5O 5H37H 1P7KA 5D1XC 3H7BA 4X0KA 4TSCL 4BSVA 5SWQA 1OAUL 3SQBA 4LHUB 3WN5C 4URTB 8CGTA 4EKXA 3IXTA 3VDAA 2XNAA 1RQ5A 1Q0YH 4EI5D 2F8OA 3BUYB 4BKLA 32C2B 2H8PA 4WU7B 4X98A 1DEDA 5HGHB 1DLFL 2JK5A 1JPFA 3ZE1E 4PRPD 2HRPH 5CGYC 3V6OA 2P5WD 4KRLB 4KVNH 2VSCA 3D0LA 4N0YH 5D2LB 3S96B 1XMWA 3F6IA 3G5VB 3IJSB 3BESR 4P23A 3MV8B 2EXWD 5D1XD 1WZMA 4PYHA 3UEZA 1HDMA 4D0BB 2Z35A 1A4KB 2APVA 4JVPA 4JRWA 3EYQD 1HNGA 3QNZB 3QH3A 1G7QB 4RMSA 3ARED 3BMWA 4X5LA 3RGVA 5E6ZA 1CG9B 2P5EB 2R4RH 4LSTL 4EBQL 4I48A 2BOCA 3O4LA 4GW5A 4LFHD 2HLFC 2VDQL 4PV9A 3RTQC 4CJ0A 4QXUL 5C0DA 1RVFL 1I4FA 3QWQB 4G9FB 3EZ8A 4LCUA 4MQXC 5CEXB 3MMEB 1JYVA 4QF1B 2DQTH 4XWOD 1CL7I 4X7TB 3SKOB 4Y16C 3ZKND 4ZTOL 1WFUA 1JGEB 1DSFL 1J0IA 2CIKA 3RZCC 1WIUA 2FEDD 3RUGA 1Q94A 3JVGC 2ILLA 1CD1A 3CLFL 2F5BH 4MJIB 2EH7L 1HOCB 3AREC 4NT6A 1EMTL 4PG2C 3UTZA 3MRCB 4YR6B 3NVQA 4O51A 5IT2H 5ACLA 3O2DA 1FFOA 1J0KA 4KKNA 3PL6D 5IJKA 3H6JA 4PLNC 4OLZH 4L29A 5LVEA 1M1SA 4MAYD 5INDA 2QADD 1LNUB 4JFFB 4WGWB 4HMEA 1DDHB 3V6BR 5IMOA 3SEPA 1IAIH 1KJ3H 2NNAB 2VNCA 3CVHL 2NX5B 4DOHB 2JB6A 4O2EA 4OTXH 5I74B 2O61B 3GSXB 1MAMH 4A6YA 1CD8A 3MLSL 1MJ7L 2JELH 3GMLB 3DWTA 3G6JB 3QFDB 4WY7L 4DCQA 2W9DL 3GMQA 4JRYE 3DVIA 5KTEH 1XGYL 1FVCA 2YN5A 3T1FA 4HC1H 3AXLA 1EA9C 4Y5XB 3RWGA 1VGEL 4JM2D 4NHCL 4PJ8D 1C08B 3PL6C 5EOTB 4NFBA 3S4SB 5FKPB 1HH9B 1N5AB 4LMQE 4NUGL 3SE8H 5MENE 2FJGB 3LQMA 1JNLL 4PJGA 3QHZL 4KDTC 2FH6A 4QRQB 3U7YH 3P30H 1HSBA 1IC5L 3ABZA 3LMJL 4K3DL 2KUTA 2EE3A 3FO9A 4OGYL 3WFDL 1GH7A 4LDLB 4KQ3H 1FNSL 1IC4H 3C87A 6FABL 4NC0B 2CJUH 2VDML 1P4LA 1RV6X 2RJMA 5JIKA 4GQ9L 5L2JB 2FSEB 3GK8L 1CF8H 4FQCL 1F6LL 5CJQH 3OKKB 1FLRH 1WBZB 4JFQB 5DEGA 3NH7L 2IPUK 4HC1L 5IEKB 4L5FH 4D8PB 3BH9A 3QCTH 3GSNL 4E5XB 5FCSH 2CUMA 4M6ML 1N0XL 5IB3A 4LFHG 4NUJA 4JFEE 3WS6C 4MX7B 4DKEH 2HFFB 2LAGB 5IM7B 2NW2A 3VMNA 4JM4H 1B2WH 2VLJD 3RBSA 5DVOA 1IAIL 1DBJH 1KJ3L 1BM3H 5IK3B 4U1KB 1U8OB 2VDKL 3FQTB 1YN6B 4IRSD 4X6DF 1RIHH 4NQXB 2MTPA 4JJ5A 4JY6A 2FB4H 3K4AA 4WW1B 4ZFOA 4PJHF 4KUCF 1R3JB 4HAGA 2HVKA 3PABA 3MROA 3VRLE 3PGCB 4M7JL 3T4AB 5AAMA 3VRLF 4F33B 4JRXE 2ZCHL 1OGAE 5C70A 3LCYA 4S11A 1MFBL 1BQHG 4GFTB 3RVXD 2BJML 3LH2H 3REVB 3AFLA 5DUBA 4R7NA 1P2CB 1UQSA 3I3BA 3B8YA 5B3JE 5F1IA 1KCSH 5I6XC 2VISA 5HHVH 3RVWC 3QG6B 1IRAY 4MX7A 4IEFB 3EOTL 1J8HD 1WZ1L 1XGYH 2F54B 5DURB 4JRYA 1YYML 1VFAA 4TVPE 3UTPD 5CKGA 1UYWL 5D7IE 2AJUL 5CCKH 2D7MA 5D7IF 3TA3D 2EDLA 4BH8A 4J4PC 4LSSH 4NKIL 4WFHD 3Q5YA 4Y8AA 3V5DA 4OKDA 5DJXB 2DMCA 3K81A 4WTZA 3MUY1 1BFOA 5DFVD 1DN2A 2NY1C 1R3KB 5JDSB 2PF6A 4FFVD 4G9DB 2JKXA 4ZPTA 1LO4H 3T1WA 2CDFA 4U1GC 4G6JH 3ARUA 1F6AB 3IU4L 3J7HA 1AI1H 1HHJB 4TPRL 3K8MA 3ESUF 1D9KC 3Q3GA 4WEMB 4EXPX 2FGWL 2DL9A 1M6OB 4LNRB 1DL7L 3IU3A 4RAUA 3A67H 3TN0A 2R23A 3DVGB 2OTWB 5D9SB 3B6SA 3MJ8A 4NQTA 4XCEB 1OY3B 1FGVH 1NBYA 4L8CB 1FJ1B 2VLRB 1MIML 1BVKB 2X1XR 4OF0A 1TVDA 2DYPD 5IFAL 3O8XA 3SDAC 2DQDL 3QDGB 1UWXH 4KI5E 5ESAB 5TF0A 2BK8A 2V2XB 3GI8L 2HWZL 4IBLT 4G8EB 5EORL 2PTTB 4HX1A 1V3KA 4MXWH 4JRXA 2XWJB 4M03A 1CQKA 4LSDA 3ZE2F 1NBZB 4NZUL 4WW2F 2WZPD 1N6QL 5JQ6L 4L8BA 1OF2B 2HN7B 3MBEC 3DYMA 1OSPH 1PEZA 1G7JA 4KUCD 5F3BB 1KXQE 1X5XA 2CRYA 4M9OA 5EBGA 2FR4B 3KYOB 3STZA 3HE6A 3GSRA 5F88A 1X5AA 4D0CA 4M7KH 1EAPB 4P2QB 25C8L 5TQ0H 4LMQI 3LRSB 4PR5B 2LU4A 1RJZB 2P5WA 1U95A 5IB4A 2EICA 4AQ1B 2WV3A 1EHXA 2COQA 1G0XA 3ZHLA 1VDGA 2W92A 3P73B 1KJ2L 4AIXA 2QSQA 4QTHB 4EVNA 4P2YA 4Z7VF 4TNWK 3BVNB 3QT2A 3M07A 3FB6B 1BD2A 1PSKH 1NAKL 4LAJH 1BF8A 4R90L 1INEH 3OB0H 4OF7A 5DI8B 2HFGL 5C71A 1BZ7B 2NYYD 2XWJA 3TZVB 3OKNB 4YUEL 2XWTA 1F4HA 1MI5D 3D39B 5CILH 1H3GA 4NNPL 4M61B 4JFDE 4QHLB 4CADB 3BIBX 2DB8A 4U33A 5DVMA 2P7TB 1Q0XH 4U1LB 4QHMA 2G5BB 1CT8B 1K3ZA 4U6VH 5C09A 5JA9A 4NWTL 3AREB 4LDOB 3BZDA 1HEZA 2I07A 2B1HH 4KROD 1EGJA 3RVTD 5DK2A 5LJYH 2E7MA 3UPAA 4FZEL 2GSIB 5FCUL 4BZ2H 3GKZA 1F6FB 3U30C 1MCBA 2H45A 1JYWA 4J4PA 3RWDB 1VPOL 3OMZA 4I8DA 2PYEB 3VXNA 3UYPA 1QVOA 2IG2L 2P48B 3H0TA 3LQZA 4NWTH 3RP1A 1T0PB 3FCTB 2AJYH 1I9RL 3U79A 4G8GD 1DQLL 3UTQA 3MRMB 3QUML 1PQZB 5C9KA 1JHKH 3C6SA 5FUZL 3ULUE 2UZIH 5GSRA 3I3EA 3W0WA 3I50H 3HE7C 4RAVA 2CMRL 1NEUA 1JPSL 3ZT7A 2QSCH 4PJEE 5E9DD 2JIXD 3JVGA 5HVFB 3HCVB 1I1FA 1T80A 1T83A 4Q74A 3OB0K 4CJ1A 4JM2B 1ZA6B 2UZIL 2I5YH 2FHCA 3MSPA 1KBGL 5FUZH 3WHXB 5GJTH 1HHIA 1YEEH 5K59F 1M71A 4P2CG 4HUKB 3VMOA 3R8QA 5EUKA 4XPTH 3V7AG 3C09B 4WFHE 5DQ9B 1YNKL 4TSBL 1NLBH 3TCLA 4O58L 3MV8A 4WI9A 4BUHA 4JEGB 5I1IL 5E6IB 4YHYC 1HI6B 3D39E 4NO0D 3LEXA 1BF2A 5IBLC 5DMIL 4XBEH 3ZTJH 4FA8A 1BD2E 4QRUA 2ZP0T 5CJXA 4P0DA 3V6FA 4JFHD 3X17A 4UILH 1EEQA 3G6DL 1MUJA 4MHHI 1HCVA 1J11A 4TUKH 1JIBA 2DOCA 5IMMB 3QEUB 3ROLB 2FECI 4XPAH 3DIFA 3GSNB 1X5GA 5EUOA 3RTQB 4JZNB 1GIGH 3IJHA 3MGTB 4PRPA 1BECA 4QXWA 5E9DA 1QPPA 1XCQA 5FM5M 1VA9A 3AAZA 5BVJA 2UYLA 4KGJA 4WUKL 2R0KH 3WLBB 4UBDD 3UTTA 1IC7H 4G6MH 2C1PB 3UTSD 3SN6N 2J8UA 4B41A 4HS6B 5F6IB 1QFPA 5ICXA 4U6HA 4PGEB 5A16A 1W72A 2BCKB 5GRXG 5IFJA 3S88L 3MA9H 4R26H 1DL7H 1EO8L 1K8DB 1IGIL 5GS1C 1VCAA 1LNUA 2CKNA 4JFOA 4L8DB 3QA3B 1KIUA 4MA1C 4HV8B 1CXHA 4Y4FA 3VFRA 2D4DA 3LEYL 5HVWA 3FHQA 1NFDB 4LASL 2CQVA 2JLLA 2O5YL 2VLJB 1KPUB 1NMAL 1QSFB 3B2VL 5CJ5A 3G6JA 3QFDA 1RMFH 3ULUH 3KAAA 4OLWH 2ZPKL 1S7RB 4J3VA 4JN2A 4Y5VB 3QUXA 5GRYA 3IB4A 1OAKH 4U2ZA 4Y2DB 2Y5EA 5IW1B 3RL2B 1G9EA 5HYSG 2VYRE 5E8DH 1ORQB 3HC3H 1B6DA 2O61A 5I8EA 1EGJL 3E1F1 1YMMB 5MERB 5IHLB 1HILB 1A6UH 5HHXL 5CLWA 3VWJD 3V6OC 2BMKB 1RIUH 1O5DT 5DS8A 1MCLA 1MIMH 4DEPC 4ONOA 1RUPH 2EDWA 5DTFB 4KJYB 1RFDH 3BP7B 5ERWA 2VDRL 4D3CH 2FX7H 1ZHLA 3E2HC 1HNFA 3PNWA 4U3CA 3VXUD 2IC2A 5DJZA 3FO2B 4CU6A 4HUVA 5ETUB 1U8PA 2E5EA 5JW4M 4TTDC 3T0EE 2ICEB 4V1DB 2BJMH 3DX9B 2YPKA 3LH2L 1JGVH 3IYLW 3PHQB 3RNKA 1RUAH 4E41E 3E2HB 1QFWI 4J3XA 5GJSH 4OAWB 1QEWA 3QI9A 5JR1H 4N90D 1NMBL 4CMMB 4KKAC 3BWAA 3WFHA 1LE9B 5EO9A 3PWPA 4OCXL 3O6MH 2X4SA 4X9HA 1U8MB 2APBA 2YD1A 4DVRH 4Z95H 5K9QI 4OCLC 5DMGC 1CFQB 1BJMA 3L3GB 4NN6C 2GSGA 2OTUA 3P9LB 5FGCE 2MNUA 3G08B 1KEGH 3S96A 1YQ2A 3TIEA 3GSNH 4WNQB 3GSQB 1I7ZA 4LEXH 1BX2A 4OZIF 1U8IB 1WBXA 4WWKA 3SPVA 5D7SL 5DMJB 2AVGA 2PETA 3RVVC 5LGJA 1BREA 1GGCL 3BGFB 3RGVB 3IDYB 1IGJB 4BZYA 1X44A 4CU8A 1WFTA 4A2LA 1KLUA 3BE1L 3QHTC 3C9NB 4Y4FC 5C3LD 1S5HA 3Q5TA 4X6DA 3WFHB 4M6OL 4GXVH 4R6UA 5EOCJ 3S35L 2I9LB 1YECH 2NLJB 4KQ3L 2QHRH 4W4OC 8FABA 3PWJA 4R4NC 4G5ZL 5HI3C 2A6DA 1XF3B 5TE7H 3QI9D 4JPWH 4D94A 5ANMB 2XZQL 1R5WB 3HN3A 4HDIB 3RUGB 4KKLC 1MI5B 3D39D 4NRYA 5F3HB 3SDXB 4KZDL 4U6TA 3TZVD 4CW1A 2AS5M 1CICD 1EGJH 3IDJB 4PB9L 1NANH 4WHCA 3QHFL 1T6WA 4UTAH 2Y25A 5CZXD 2BRQA 5DF0A 3WHE0 5KS9E 1MCOH 4XZUA 3QCTL 3QHFH 4MCZB 5FHBL 1JN6A 4X6FA 3T0EA 3B2UC 3KPMA 4HJJH 2FYYA 3HMXA 4HG4K 4P59H 3GKWL 4KTYA 5JTWA 4H26B 5HDQL 5L0QC 1D9KB 1X5FA 3T04D 1FG9C 3EOYG 2X4UA 3VJ6A 1FH5L 1KIRB 3RVWD 2P49B 3T0EC 1CDJA 3T8XB 3ARPA 5J89A 3DSFH 5IT2L 1BJ1H 3OF6A 4JQVA 4OM1H 2H1PH 4G8GB 1S8DA 1WSST 4NKDB 5DUMH 2YN3A 4L1DA 4M7LH 5ENWB 3ZSSA 2VDPL 3HNSL 1F4YL 2BXYA 1OT2A 2QR0B 4PP2B 1ZS8A 5EU7C 1ITBB 3QFJA 5LBSH 4DN3H 4PRAB 1ONQB 4JFZL 3HR6A 3F62A 3PQYA 1C5DA 1F97A 3U46B 2NY1D 4X6FB 2HA1A 2Y7QB 1NFDE 3FO0H 3BP6B 2AJSL 4Y19D 2FX9L 3HG1B 4LU5L 2ZZUT 3SE4C 2F74A 1CDBA 1YUHB 1QNZH 3JBG7 4N8PA 4HUXA 4ZO7A 3BW9B 2FIKA 1DQJB 3GSWB 1CGSL 3MBEB 5INCA 1UZ8A 2A1WL 1C1EL 2QKIB 2Y36L 3CH8A 3MLRH 3FT2A 4X99A 2R1XA 2IBGA 2NXYC 5FYLL 5D71H 1BIIB 4N0YL 5TPWL 4JHAH 1VFBB 1W8NA 1EMTH 1KJVA 3TBVB 1FNEB 1P2CA 1G0DA 1U3YA 1I85A 5K9OB 1HHKB 2X9YA 4JO2H 1G6RB 3BDXA 4X4XB 5ACZB 2CIIA 1Q1JL 5FO9B 3ARYA 2NY3C 1WK0A 4OI7A 3BD5A 3I6GA 1A21A 2ICWA 5J3HC 5KS9A 1DBKH 4OZFB 3QQ9C 2VDQH 3FB5A 1AKJA 3ARQA 2LABA 1AGCA 1TZIB 1UXSA 5ESVA 5INCB 3V6ZA 3U0WH 1T66D 1IZKA 1REIA 4XVTH 1L6XA 5CHNA 1FCGA 3W39A 4R7NB 5KVDL 3VFTB 1OM3H 5EOQH 2HVJB 3C2SA 2O5ZL 1TQCC 1IAKA 3OBAA 1BFVH 2NQCA 2VZOA 5CINH 4PREA 4YX2H 1GC1L 4W68A 1LP9E 4PLJD 3RPIA 5AD0B 3RA7H 4Y8DC 3NFSH 3H3BC 4Z18A 4F9LA 3QQ4B 1BJ8A 4F7MA 2XTJB 3U30B 3L9RB 3BO8A 3LS5L 4GW4B 1CFSB 1TQCB 2NY5C 3LQZB 4XVJH 35C8H 3Q48A 3FQNB 3QQ9D 3BPLB 1NFIA 3GBML 4OLVL 1D6VL 4J1UB 4PY8J 2DQUH 5BS0A 3WNLA 5F97E 5E94B 4ETQB 1RULL 1IC1A 1P5UA 5HJ3A 2EIZB 3FB5B 1ZLVH 3W82A 3OTTA 5JUEH 5MHSD 1AFVL 1GJIA 4L4VB 4UDTB 3W39B 3ORJA 5C09D 5IW6A 3VFVA 3IXAB 1F2QA 2R0KL 4AQOA 5I0DA 5DRZA 3SJVE 4R97B 1I3RA 4JQXA 3U0PA 1HE7A 1JHKL 5SX4H 1NAKH 4GRWE 1GIGL 3VFSB 2OCFD 4TSAL 2BVTA 4WV1B 3TV3L 4KFZC 3QP3A 3X11B 4GRLB 2VXVL 4QRRB 2ZOKB 3EBAA 4LBEA 2A73A 3I9GL 3O4OC 4K71B 2DWDA 3V9FA 5I19H 2IPUG 4EQ2A 4Z8FL 1W0VB 1KJMA 3VXSD 1EJOH 4PFEA 2NTSP 2LTQC 3STBA 1YEIL 4FXGA 1T7ZA 3OAYH 4JZJA 3IDUA 1T04A 4Y19B 1MLBB 3KLAA 4XAWL 5FK9A 4LP5A 1PBYA 1QFWM 3CDYA 3QWRD 3GJFA 3OR7A 1QFWH 4KAQL 1FYTE 4RFOL 4LPVA 2FO1A 4XPFH 4X80H 4YX2L 4RMWA 5GS2D 5E4EB 5F7EH 2X70A 3G9VA 1GAFH 5C08A 4HXBH 1G6RH 3NTCL 4K7PX 2ZUXA 4YJZL 2J8UB 1MRCL 1C5BL 1G9NH 1DQMH 5AZ2L 1JYNA 4PRPB 3L5WA 1T1WB 4NQED 1UH2A 3RHWK 4DW2L 4WFGD 2YUZA 1KC5L 4XI5C 1DBKL 2IPKA 4WI7A 5HHNA 5F7UA 1LEIA 1LK2B 2AEPL 3FOMA 1F4WH 2DQIL 1AFVH 1I7RB 3NACL 5HGGS 4JO4H 2G60H 3EDJA 1SBSH 5GHWL 4J2XA 2HTLC 1U3ZA 2J5LC 3PP4H 5GGVL 4JO2L 1WAAE 2Y06L 1B4JH 1RZ8B 2E6QA 3IETA 1E28A 2APXA 3MZGB 1WBYB 3H8NA 2PKDA 3LEVL 3O3EB 1P1ZB 4H1LA 4K55A 3LQAH 3L3KA 3DV6B 3NFSL 2W0LA 1AC0A 5DR5L 4M8QB 3L5HA 5I8KH 4MQ7A 1QYGH 5EZLA 4DTGH 4F2MA 4ZXBA 1XF2B 3KDMA 3PWUB 4MNGE 2AK1L 4IS6B 1GPOL 5DK2B 3ULVC 2XI9A 5DDHB 3TJEL 4HMCA 3ZLQC 3H42H 4YUEH 3LRGA 2D31B 5E2UL 5T3XL 3WNNA 1A1MA 3BDYL 1A6ZB 1CYGA 1WTGT 1ZA6A 3KYKL 4I9WD 4FQLH 4G6KH 4KK6C 3EHBD 3VFWB 3TEUA 2Y5TB 4OD1H 4H8WL 1AIFA 3EO0A 3C5ZA 3TNNA 3JV0A 4D9QE 3U0TB 3BN3B 4S0TD 5TDOA 2A6KA 3UO1H 5IROC 1QLRA 4P4KC 2Q8BL 1FYTA 3NAAL 3ZHDA 2X4NA 1MLCA 2OS7A 4HKXB 3EYSL 4JAMB 2OZ4A 2VKWA 1BHGA 1FH5H 2CGRH 1HXYA 3MLZL 1TENA 1RIVL 3D3VE 5CSZB 3RWIA 4PJFB 2PR4L 3ARTA 5F7YC 2GSGB 3SKUD 1YNLL 3G04B 5EBMA 4BFGA 4JM4L 3SDYH 3UDWC 2X44D 4G3YL 1JWSA 4P2OD 5EULV 3MRQB 1XGPA 4EIZC 5C8JB 1KB5H 3CCHA 4M1GL 4X4ME 1WWBX 2VIRB 2N1KA 5GRWA 2CLVB 4GRMB 4GRWF 4NSKB 4ZO8A 3NCCB 3C8DA 3O6FC 2X41A 2X4TB 4RMTA 1KLUB 1AGDB 3DX6A 4NO5A 4ZD3H 4UIKH 4TVPD 4PTTB 5F96H 2XIDA 3AB0B 3CFCL 1NC4A 1JE6A 4FNLL 1OAQH 1BBJB 3S37L 1WBZA 3DX8A 1FN4B 4PJ7F 2LV4A 4KRPD 1FNSH 2V2TA 4Y5XC 3K7UA 2GK2A 4AEEA 4E5XA 4PJEF 4XMPH 3IDGB 3QAZC 4PUBH 1RPQA 3CFKB 2R0ZH 3VFRB 3VH8G 1J0JA 4CNIA 1RUQH 1CZ8H 4MNGA 2YRPA 1IAIM 4MZ3A 5I1CH 1OP9A 1T7YA 3MQIA 1L0QA 2I9TA 2PXYC 3KJ6L 5L8JB 5C6PB 2CLVA 4GRMA 4GOSA 3BI9X 3NGBB 2NMSA 5HI3D 3TN0D 3MR9A 2J6EL 4XX1E 5HYJB 1VGKB 3K1DA 3VGEA 3CU7A 3NFNA 3FONB 1D5XB 3PDGA 3MRKA 3CZFB 3UYRL 1RURH 5E8OB 1C12A 1ORSB 2VAAA 1RZJC 5FECA 1M6OA 1PVHA 3SKMB 3GRWH 2BSED 3KPTA 4Z95L 5ESQA 3MGOA 3VWJA 1QSFA 3GK8H 5GISH 1JMZA 4NBYB 3QO0B 1QTYT 3ZE2E 1T2JA 3LIZH 5B39A 4H20H 3WNKA 3MRCA 4MZ2A 2CIKB 4N9GA 5F6IC 4DUWA 3DMMD 2QV2A 3AM8A 3R1GL 1MHCB 2EZ0C 1MJJA 4Y16D 2VO5A 2HTKD 3G5XA 4FABH 3HPJA 1LO0H 5DZOA 1DSFH 4XX1G 4D9RE 1S5IH 1S9XB 1RUKL 3UROR 4Z7OF 1IAMA 3HZYB 1FZKB 3O3AB 1N6UA 1INQB 3ALWA 3KPLA 2L0DA 1AC6A 2OL3A 4K7PY 4Z7WF 1OTSD 2VDRH 3LB6C 4LEXL 4D3CL 4LQFL 1S7TB 1HINH 4RX4D 5CSBA 3RWGB 5F44A 4QHUB 1KULA 5T33L 2MHAA 1LO3H 1A6UL 4V1DE 1FZOB 3NZHL 4X6CE 2I26N 4LPXA 3VH8B 3SKNA 4PV8A 4Z78B 3MJ9H 3I02B 2EDNA 3B43A 3Q6FB 4U7MA 5EA0L 2VRAA 3JXAA 1ZT1A 3BRGC 4WWKD 3QIWB 1X9QA 1CLOL 2ZOLB 3GB7B 1I3GL 5EO0A 3WKNA 2XYCA 1Q72H 4I5BA 1TJIL 1MVUA 4YHPA 4RBPK 3K8LA 1VENA 5TGBA 3VXUE 1KN4L 3ZSTA 3J8F7 1T4KA 4N1EA 3F12A 4UT6L 3ULVE 4YQXH 3B9KB 3BISA 2CD0A 1DBAL 4LLDB 4UNTA 1NGZB 5L88L 2J3SA 3EGSA 1UWEL 3O2WH 1PFCA 1QQDB 3KJ4B 4U0QB 4HULB 2ARJQ 4L4TB 4QYOA 4ZQKB 1QHPA 3C9NA 5I73C 3B9KC 5IK3A 2XQYK 4OFIA 4XT1C 4J7RA 1H3PH 5KTEL 4NBZB 2Z4QB 3K2UH 4JY6B 4PJGE 4Y7MA 1O0VA 3B9EA 1MSPA 3MODL 1MJ7H 1QPXA 2JELL 2VITB 2PYEA 4OFYA 5F9AC 2D7PA 4HUWA 4HGWB 4OV6F 4TUJB 3NIFF 4PJCF 3SY0A 2ESVD 1LVEA 1MEXH 1RZFH 2QQLL 5E8PB 1U3HB 1R5WA 2EDDA 4Y1AE 3T2NL 4HIXH 4YQXL 3WIHA 3KPRE 5F3HA 5GSRB 3FB6A 5E08L 5HYSA 1I3UA 3P4OB 2LVEA 1IGFL 1VEOA 2VLKA 3DARA 4F3FA 5I16A 4M93B 1A5FL 4E41D 1MCNA 5ALCL 2A83A 1SBSL 1I1FB 2CDGB 1H8SA 5GHWH 4DGIH 2VDNH 5HY9B 2VLRE 1D3CA 3S88H 1KG0A 4FFZH 3T09A 4GXUM 2ADIA 5F1SA 1BZ9B 1KC5H 4RBPH 2DM3A 2HMIC 4Y5YC 2G75B 4K7PL 3H9SD 3KYAA 7FABH 4PRAA 1KPRB 4NQEE 1FL3A 1CGVA 5E03A 4WFGE 1IM9A 3R06B 4KU1A 3SDDB 5HDLA 4HWUA 4RZCB 3SY0B 2IADA 5CEZH 1H9VA 5JDSA 1XAUA 1JPSH 1XF5B 2A73B 5F7DB 5DC0A 1OHQA 5ADPL 3ZYZA 3AS3A 1GPOH 2AV1B 2RBLA 4EBQH 3LN9A 1W0VA 1L0YA 4XTRC 1QD0A 2P24B 3FRPA 1C16B 5SWZB 5I71C 2Q6WA 2WNGA 3G6DH 2OSLB 4OFVA 3LKPA 4ZOAA 5I1GH 2B4CH 1CU4L 1HH6A 4LCIL 1LO0L 1P6FA 2OL3L 3UPRA 3V0WH 4U6YA 1I8MA 5I15L 2DJSA 5IJVA 5D93B 3W0WB 2Q1EA 1BQHA 4ZXBC 4QCIB 3SE3C 4HJ0D 2BNRA 4OZHF 4FQ1L 2YBRB 2HKFL 2ZUUA 1L7TH 1TZHB 4Q6IC 1OCWL 3FO1B 1CFTA 3R06A 4MNQE 1JNHA 5JW4N 5HTSA 3UJIL 3PXJA 5ITFB 4I4WB 2VLME 4ODUB 4OQ1A 5F70A 4OT1L 5I1JL 3O8XC 1FC1A 4O9HL 4L8BB 1N5YH 2PYEE 4JE4B 2Z8RA 1PY9A 3PV6A 3SKJH 1C16A 2J88H 4HZLA 5CILL 4JRXB 3QG7L 3ZDXF 5LG1A 1JPTH 4XXDB 3MNZA 1JWUA 4FQXA 4ZUWB 4ALAH 5CKAA 3CFIC 5IGXL 4P99A 1KCRL 2HN7A 2W65A 1AXSB 2GAZB 3OKMA 4NBXB 1IJ9A 1DVFC 4KWUA 3EOBA 3ULVL 4PJ8C 3BVNA 2B7DT 5IMKA 4PRHE 5KS9B 1G1YA 1JRHL 3ZDZF 1AQDB 1CFTB 2BHZA 1QR4A 4PTUB 2HJFA 3ARDA 4Y89A 5K9JL 3LS5H 2BFVL 3MC0A 3BEVA 1AO7D 1A22B 4PJAE 4QRSB 4WVRA 2APWA 3VCLA 1UB6B 1YEIH 2C7UB 3VXMA 4QTHA 4EVNB 5BS0B 2P5WB 3RUGE 1ODAA 3HE6C 2A6IB 3IFOB 3IDMB 3QQNA 4C83B 3RKDD 4BK5A 3EYVA 1FYHB 4ZFFA 2O5ZH 43CAA 4OV5A 1XR9B 4I0KA 1YPZF 4EUPG 4YXLL 2AJZA 2OI9C 3QUZB 4YHLL 3H9HA 1QA9A 1K3IA 1W72B 2BCKA 3UTSB 3L9RA 3FT4A 4NKMA 1I9IL 4M43L 3U7AA 2VH5H 1KB5L 2C3WA 1AGBA 3D2UA 2E9JA 1MRCH 5K33A 3WIIL 4C4KT 1MOEA 5F89A 1KFAL 3OJ2C 1Z6JT 2Q7YA 2V17L 5E95B 4Y5XA 4QHNB 3U36B 3QXDB 3CFEA 4EI5B 3MREA 2E7HA 4XP5H 2VL5B 1N26A 4XP6H 1NQBA 3MRIB 2XPGA 3MLZH 2YUXA 4I2XE 4JG0H 2BC4A 1U8HA 1S9YB 4KROB 2RR3A 4Y5YA 5B39G 4HBCH 1YMHA 4RAVB 4POZD 1M7XA 2GITB 3FRUA 4HCRA 3RWFA 1AO7A 1JHTB 3WYRA 1XR9A 3WS3A 4M5YL 5JOFA 5C9JA 3ESVF 3PWNB 5MENA 1P4LB 4KKLD 1CLYL 4DOHE 3EJZD 4I18A 1J1XL 4KTDL 3BGMB 3VFPB 4HS3B 1QVOB 1HHJA 2NTFB 1KCVL 2UVEA 3DURA 1A6VL 2BSTB 4RCAA 4NFCA 1LP9F 2F9BT 4PJBF 4LPYA 4N0UE 4JFDA 3QISA 3BHBA 3HA0A 3ZE0F 5HI5C 2A6JB 2MCPH 3BYYA 3MODH 2HWZH 4Y4KB 5IB3B 5DD1H 1OGTA 4PTTA 4X83A 3VXPB 2IBBA 8FABB 5C09E 3RIFF 2IBZX 2V6HA 3TGXA 5GIRA 5ICZB 2HKHH 3EFDL 1F4YH 3SJVD 1AHWB 3L1OH 4XH2A 4HD9A 2P8MB 4L9LA 1WZ1H 3O6LL 4ODXB 2ZCKL 4GG8B 4PJAA 1ZLWH 3OJMB 5DQ9A 5ICYA 3TPUB 3HG1D 3PABB 1ZT7B 3QAZB 2X89D 3FOLB 4PJXA 4MJ5A 2FX8L 3S4SG 1JGDA 1U8KA 2AXFA 4LLQB 5KW9H 1D7FA 1NDMA 2IANB 1XCQB 3L5WB 4MCZA 4TUOA 4AIOA 4XNMB 2AQ3A 1X6NA 1WTLA 1LK2A 2GHWB 1F4WL