4HKXB

Influenza hemagglutinin in complex with ch67 fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
201
Chain Sequence
QSALTQPPSVSVAPGQTATITCGGNNIGRKRVDWFQQKPGQAPVLVVYERFSDSNSGTTATLTISRVEAGDEADYYCQVWDSDSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 45
structure length 201
sequence length 211
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkxB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkxB01
4XNQB 4QXGL 4XCYA 3OB0K 1MVFA 4Y5VA 4P3DA 1C7SA 5H35A 2B1AH 5SX5H 2DWDA 5ENWB 3T65A 1U3YA 4YDKL 3FN9A 4G7VH 4XCEA 2WWKO 4LVHB 4JPKL 4A6YA 1NLBL 1KB5H 4WIQA 2X09A 5I1KL 2F15A 4ZO7A 2H8PB 1AY1L 5F9JA 1EJ6A 2QR0A 3CDFA 5HDOA 3EFDH 2DKSA 3TVMD 1DTUA 2DQFA 1T89C 2EE3A 4LKXB 5HGDB 4APQB 5JMRA 2JTDA 2YC1A 1HOCB 4AK1A 1HSAB 4IRSB 5FA3B 2K1MA 1H3WM 2CPCA 3NCEB 4KDTC 4OFKA 4XBGB 1ZVSB 1A5FH 3SGEH 1Q0YL 1M7IB 3I6GB 5D2LB 4GAYB 4I0PC 1JNLL 1UM5H 2AJUH 4HUNB 3CLFL 3MLZH 2PUQT 4EEEA 2GTZA 1QSEB 4O51B 4PGDA 3L3OB 4HGMA 2Q8BH 4PRDA 3HFMH 3RVXC 4DN3L 4HFUL 5D8JL 1WT5C 3Q6GL 3KLHC 2G9HB 4ZO9A 4IRZH 4GJTB 1FL5B 1MJUH 4KROD 5T5NF 1NANI 3ORJA 1UB5A 2A38A 4UUJA 4Y19E 1N5AB 2NX5A 1JN6B 3MRCB 5IQ7H 3DV6A 4N0CD 3T2NH 3DWTA 5ESQA 3NACL 4GW4B 2AJZB 2FB4H 4FQJH 1MF2H 2XWBB 5DR5L 1QEWB 3EYQC 3UTZB 5JA8B 3OR7A 3EOTL 3OG6B 4IRJD 1T1XB 1P9MA 1NCTA 4ELKB 2XIDA 1R5IA 4UBDD 5I15H 1YY8A 5ITBH 3VGHA 2F5BL 3LHPL 5C6PB 3VD5A 3VWJA 1ZSDB 3MFFB 1BP3B 5E8PA 3QULB 3KPOB 3RDTB 2YXFA 3OWEA 3T77B 1JPTH 3VMNA 1G9MH 3CH1B 4N5EC 5E2VH 3LPWA 5EOCJ 4I3RH 3QNXB 2YD2A 1A9BA 4NM4H 1V7NH 1GC1L 1R5VA 3L5XH 5I75B 5JZ7D 1NKOA 4RDQG 3IAPA 1I9JH 2ICWJ 4RGND 3OKNA 2YSSB 3STBA 4H0IA 1S7VB 3TZVD 4GMSH 4OAWA 5KSBF 5A40E 4HUWB 4JM2D 5EZOH 1XZ0B 1EEYA 3NIGE 1QFWI 5D71L 5F96H 4HKXB 3W81A 3MR9A 1A14H 1NAKL 4UZGA 4KMLB 1GC1C 3ZKND 2R2CA 1B3JA 3HZYA 2UVFA 4JN2B 1MHPH 5I1JH 1YPZB 4NP4H 5DHYB 3VD9A 5D72H 3VCLA 4YIQB 5EFIB 4MZ3A 5KS9B 4GRMB 4RDQF 1I7UB 3BDYH 4Y19D 3VFNA 3K3QA 5C07B 3BT2H 3JTTB 2FIKA 4BQ8A 1EX0A 2FDBP 4XPAH 2EIDA 1TVHB 2CLVB 3FTGB 4PV8A 1HKLL 1TCRB 2ED7A 1Q0XL 5KW9L 2CLRA 1FL6A 1FZOB 3QEHA 3S98A 4H25A 3ALXA 4P4KC 5HPMB 5GGTL 2X4TB 3ZE1F 3MA7A 4LHQB 4H0GA 4LNRB 2FJGA 4MB5A 4OLXH 1KCRH 4M8VA 1H3UA 1T0MB 4P46A 3TYGL 5K93A 1X5KA 5GRZA 1PGRB 1NAMH 5C0CB 2QEJA 4I77H 3TO4D 1ZVYA 4J3UA 4YHKL 3RX8A 1DBMH 1OAZH 4POZD 1MJ8L 4Z7WB 1F5WA 3IETA 3LQZB 3MBEC 3CAFA 1II4E 2EIBA 1YN6B 3KPSE 4JO2H 5GRUL 1YY9D 2E9BA 3EDDA 4JQIH 4N0FA 4JZJA 4XNYH 5JHLL 3GZKA 2ERJB 2WLYA 1WZ1H 4PJ7A 1F6LL 4PLJD 43C9A 3U2SA 5D7LE 4MJ4A 1G6VK 3WS6A 4MD0A 4X4YB 4PJ9B 3OKYA 2E7CA 4PUBH 2JF1A 1WZLA 3UTPE 1WISA 3TPUB 3KLAB 2CMRL 1TTGA 4FQLL 4X7FC 2IPKB 4NUJA 3NABL 4UQ2A 1I3GH 4P2OC 1I8MB 1YDPA 5I17A 3GIZL 5D1ZB 1S7RB 2HP4A 4U6VH 1GZPB 1NDGB 3BMVA 4JKMA 3RWHB 4F9LC 3RKDD 2ARJA 1DQLH 3G6AB 3LPGA 2E7MA 4YX2L 4H1LA 3PJSB 2R2BA 1S3KL 5DJCB 2VR5A 1IKFH 1GGBL 4GUPA 4U3HA 5L2JA 5DJDB 4IRJB 5F44A 5I1GL 4A6YH 4YBQC 1H5BA 5E2TL 2ORBL 2DLIA 1P1ZB 2DM3A 8CGTA 3K8KA 3LN9A 1A9EB 3VRJA 3MUHL 1CZ8H 1OSPL 5CZVL 1KBGH 1KJ3H 2ZSVB 2W0FA 1U8MA 3CDGA 2DQHL 5IHZA 1CGWA 5DXWA 5FGBC 3ME0A 1TLKA 1Z3GL 4BFGA 3QEQD 1BQHA 1AO7A 1DVFB 2H26A 1LD9A 3MRFA 3SJVE 1EH9A 1ES0B 2V5YA 4IS6B 1RJCA 4KI5D 3FO0H 1TIUA 4L1DA 3FN0L 3P11H 3KPRE 4MA7L 3TM6A 3QUML 1X5IA 2BVEA 5DSCA 3TZVB 4WFHD 4CADA 4CUCA 5C92A 1X4YA 3FOLB 1I9RH 1IAOB 2NY3B 3GSXA 3IB4A 5D7LD 3QIBB 5T3ZE 3ARQA 4LPCA 2WWMC 2LVEA 12E8L 2YEZB 1QFWH 1F4XL 3ZDXE 2R0KL 3L5IA 3UTPD 3AS2A 4OD1L 3VXMA 2AS5M 4LSUL 4K7PX 5HJ3A 2IWGA 2Q6WB 4Y88A 2IANA 4P4RA 3MRKA 4X6CF 1LWRA 2Z92B 4KKLC 2P5WA 5BV7L 1L7TL 5I1LA 4ONOA 4Y19B 3OR6A 5DQJA 3X13A 2AI0H 4EKXA 4MXVF 5CEZL 4KDVA 4M6ML 3WS3A 3PQYE 1K8IA 4R0LC 5J1AA 5KZCD 4L3EE 1CU4L 4G9DA 3CZFA 4ELMF 1Y6MR 3UMTA 5BV7C 4Z76B 1D9KC 4YGVA 3RIAK 3OAUL 1VKXB 1PFCA 3H3BC 2XTJC 1LEKA 5DRNA 2E27L 3FO9B 4N5ED 3MXWH 5E56A 1IM9B 1BFOB 1FDLH 1W0WA 5I19H 3O6FA 4IOFD 4HPYH 1MJ7H 2Q20A 4KJYB 3TO4B 1NSNL 5EZJB 5DC0A 4LCUA 4N1HB 1FHGA 2GEEA 4OZ4A 4TPRL 3WCYA 2H32A 1AC0A 3WDIA 4Y2DB 4G9FA 3TBSA 2EDFA 3BJ91 4OUUB 5I8OL 4BFBD 3O11A 4PTUB 3KPRD 4KUZH 1KB9K 2PW1A 5ISZD 2P24B 1XH3A 4OCMC 4TQEH 3SDAC 4LGPB 2XNAA 3GMQB 4PJCE 2J4WH 2HN7B 4UTBH 4Z7QE 4PD4K 4XVSH 5A16A 3ZTNH 5T3ZD 2OTPA 4X7SH 3QDGE 4OV6F 2FHBA 3WSQL 3ILQC 1KEML 5FO9B 1UCBL 3ILPB 1SBSH 3T0EC 4MJ6A 3V6ZB 3PDOA 2WNGA 3T8XA 4F2MB 5DHXB 1I1AD 1NGXB 3DVGA 4XCFH 1J5OL 1F6AB 2HFGH 5DWUH 3DUSA 3KPMA 1A21A 2XA8H 3VD3A 2B4CL 5E7BA 4RISH 3U46B 1VADA 3PQYD 1BM3H 1SVZA 1BEYH 1F45A 4Y5XB 5HYJE 4L3ED 5B38G 4XPFL 4JFZL 1BLNA 4F57H 5E0QA 5JW4M 4S0TD 4NQUA 2B4CC 4KJQD 1PLGH 3DHMA 3TJEH 1F58H 2NY7L 3O4LA 1WCQA 1WWBX 2BRRL 5EBGA 3BYTA 4NQEE 3DECA 3HAEB 3U7WH 1A7OL 1Q9LB 3MJ9H 3D0LA 2EO9A 3VGFA 5DJ6B 1MREH 3M8OH 3FQUA 1HQ4A 4WEBH 4Y89A 3LN4B 4NZTH 4WCYH 2WINA 4FP8H 5TFSL 3RIAF 1TQBB 3WL9A 4R26L 1N3NB 3KPSB 2CRYA 4IJ3C 3TN0D 1T7XA 4MNQA 1OF2B 2FO4B 3T4YA 5E08H 4EUPA 5CGMA 4BKLA 5D7LB 3MJ8B 1BMGA 1U8IB 3PE9A 5BZDB 4LLYA 5FYLH 1U58B 1QPXA 3L3JA 4KH2A 3WN5C 5B4MD 1AXSA 2X4RB 2E3VA 5E4EC 3CLEH 1DE4A 1MQKL 1T89A 3I50H 4OCSH 3GJFA 3MRQA 1N64L 3P73B 4UDTB 3IYLW 4H1LH 5MI0C 4WTZA 5DRWA 5J6GB 4PB0L 3CMOL 4GQ9H 1U9KA 1MFCH 1YECL 3RVUD 4UINH 2X4OA 1QSFE 5E8EA 5EU4B 4I0PA 4GKZA 4I9WE 3NIFF 4PGEA 2Y72A 1HNFA 1MCRA 2H1PL 3D3VE 5HYJD 4LSRL 3EGSA 2J8UE 4JDVB 4K7PY 4Z78A 5DC9B 3VJ6A 1U8QA 5I71B 3KYNB 1YNTB 5LJYH 1I1YA 3MGTB 4K7FB 3GGWB 1KG0B 3SCMC 1TJIL 3PABB 2ADGA 4CJ0A 5BVPL 4Z6AT 5LXGH 1EHLH 4OV5A 1I3VA 4NKIL 1OVZA 4WWKC 3RY5A 1KYOJ 1I9IH 3PWUA 2N7AA 4HGWB 4UNTA 2OQJA 3IDYB 4HZLB 2X4UB 2C26A 1FV1B 4P2CG 4PP2B 4M6AA 4D0DA 4NRYA 3V8CA 4F9PC 2ZNWA 3RJDA 3STLB 4PJIE 1XGUA 2BSSB 3KPRB 5D6DC 1YEEL 2W07A 1HILA 4PRPE 1G0DA 4G43B 4HK3J 4EVNB 4X9HA 4MQ7A 3F12B 2CLZB 4JG1L 5ELIA 5IMMB 1AHWB 1I8IA 5SWZE 1PSKH 3DXAA 2XI9A 4XVJH 4AT6A 4HPOL 3MLYL 2UWEF 4XWOC 4KC3B 4R7DB 1H8NA 1K9TA 2BHUA 2QADC 2HFTA 1KPUA 2X70A 3ES6A 3GI9H 3WXWH 4OZHF 2EDRA 4OM1L 4KUCD 1I1AB 5GS1B 1ZT7A 2EYRA 2XOTA 4XC1H 3EO9L 1S78C 4IHOA 4KAQH 5C0EB 2D7TL 3SKMA 2BK8A 3TYFA 2OBGA 2LAAA 4WV1A 1FSKC 3PQYB 3I6LD 1TJHL 4LFHG 2W9EL 5D7JC 1D5IL 5AD0A 1CD1B 3DO7A 25C8L 4L3EB 4QEGA 3BUYB 32C2A 1JYXA 5EU7E 2W65B 3B2UC 3NCBB 5C8JB 1RJYB 4M02A 1FZKB 2F58L 3B8SA 3SO3B 1L4IA 2H32H 2D31A 5FDWB 4JO1H 5D7IF 4LLWA 5C08D 5E8NA 4NHCL 1JGVL 4UI2A 3O3DB 4BA8A 1IC4H 1FNGB 1OAQL 3HC4H 3T3MF 3IKKA 2NYYD 4NWUL 4XB7A 3BIKA 4JREB 4JQXC 2R1XB 3HZMB 4K7PH 3LMJL 4X5WB 1X9QA 4JKWA 5DQDH 2RR3A 1A7RH 2GJ6E 3U6RB 5KSAA 3INUH 4P4KA 4J12A 3RVTD 4BK4A 4PS4H 3DYPA 3VG9B 4FFVC 3FT4B 5DA0B 3RX5A 2VXTH 1G7JA 3GSNB 3IFLH 4CMMB 4Y1AA 1BOGB 1M05A 3L5WA 4PJCB 1P69B 1HN1A 2HT2C 1R5WA 4NBZB 3UJJL 4O02L 3K46A 3IU3A 3QCVL 2ITDB 4FFWC 1C7TA 3F65A 5HY9A 4NFBA 5SWZD 3QDGB 4W70A 5E6ID 3S6CA 5IIEA 5E8OB 3MBEA 1J7VR 4LMQI 1DQTA 4QRTA 1YMME 1MVUB 4OSUL 6FABL 1L9MA 4S2SB 4PRHE 5IROA 5GIRB 5TE4L 1P4IH 3QDJA 3V0AC 1F3DH 2Y06L 5FUZL 3ARGA 2OP4H 3CU1A 1IGFH 2JJWA 5CP7B 3VE0B 3FO1B 1UWEL 1BQUA 5DQ9B 3ECBB 5HYJB 2NZIA 1ZA6A 5J06A 2NY6D 5C09A 3H3PH 3KWWB 4U1LA 5AAWA 3UPRA 1MCPL 1AKJA 4KY1H 2AV7B 4P2OA 4X99B 4MDJB 4R3SA 1TETL 4IMLA 3I2CH 3LRHA 4F9LA 5MENA 3DX7A 3VXNA 4NQEB 4JKKA 2XWTA 1AGFA 4YPGB 2ADIA 8FABB 5HGBB 2QSQA 1I7RB 2X9YA 1E4XH 3ULSA 4ZUVB 4Z77B 2CQVA 1PQZA 4XNZC 1YEKH 4XH2A 2YD3A 3SDCD 4Y16C 4EUPH 3ARVA 3X3FH 5J4MA 2FZ3A 5ICXB 2ATPA 4YHLL 3T08A 5HD8C 2FEDD 4P5MA 2WBKA 2ZSWA 2C4FT 3REWB 1BFTA 5L6YH 3QDAA 4M6NL 5GHWH 1W72A 3BP7B 2X2YA 3KYAA 2BY2A 4D8PA 4OZIF 2CDGA 3H6JA 5D7SH 4JPKH 4YHNA 3VFPB 4ZNEE 2VITA 5F97E 1WBZB 4AJ0A 5I1KH 4W6WB 4X6DA 1K4DA 4QXUL 2ZOLA 1I1RA 1S5HB 3M1BA 5ECJE 1HHJB 4IMKC 3AY4C 3QAZB 4NQSB 1RZ7L 4JFED 1PAMA 4M7JL 4PRHD 4GS7C 5HHXH 3P4MA 1FL3A 1HHHB 1NFIA 1QSFB 2FHCA 1U8LB 4TRPL 1MPAH 1YEIL 2VSDA 3I75A 1Q0YH 3HE7A 1J11A 3D3VB 5HXMA 1JNLH 2MPAH 3P4LA 2P7TA 2J8UB 5IWLA 4WTWA 3SO5A 3EYUL 3L3KA 3QQ3B 2JB5L 1VACA 4OZFG 3SKNA 4WTXA 4LSSH 4MNGA 1IJ9A 4AMKL 2BOCB 1MCHA 3S4SB 5IOPB 4P5KA 4P9HC 4Q74A 1FNAA 4MDIA 5HSFA 1NBZA 2XRAL 5FO8A 4XPHH 5IW1A 4LVNC 1HXYA 1DEEB 5F71A 4L4TD 5DRXA 4RFEB 4NZUH 5CEXB 4HJGA 1Z9SA 2EE2A 3NACH 4O2EA 3T2QA 5BS0E 3LEYH 2ZUTA 4N5UA 3VXRD 4YHZL 4PJIB 5ICYB 4J8RB 3TA3D 4XWOD 5C0BA 3IDGB 4PRPB 1ZOXA 5C0ND 4EN3D 1NGQH 3EOTH 3ZT7A 3UTOA 2NY0B 1BZ9B 1OAYL 4BH8B 1D6VL 4D9QD 5F1IB 5KS9F 2L7UA 5SWZB 3S96B 2C1PB 2F5BH 5E6IB 1WCBA 4ZQKB 3AVEA 4NCDA 4M00A 5I1CL 3SE4C 4MXWL 1Z5LA 2E9IA 3BQUA 1MELA 2WUBH 2YBRA 1W0YT 1QO3A 1B0GB 1WC7B 1IMHC 1ZA3B 1S5IH 1F90H 3B2UD 5CJOH 5JLZA 5FK9A 1U2HA 2Y5TA 1KENL 2CIIA 3QUZA 3GBMH 3TV3H 2EZ0C 4UNUA 2NX5E 2RJMA 4Z0XB 1EFXD 3QUXB 5ETUA 1K2DA 1NAKH 3V0WL 2O5YL 5ALCL 1P6FA 4DVBB 3RZWA 3OHXA 4L29B 4DEPC 5KAQG 2EC9U 4LEOA 4XZUB 4WI9A 5AYQA 3BYYA 4QY8B 2X4QA 3QHZL 3MV9A 1U3ZA 1X5XA 1N4XL 4XCNB 1NEZA 1C5BH 5CFHA 5JTWA 2MJWA 5IJKA 1WAAA 3WIFA 1EPFA 3SDCB 1ZHLA 1ACYL 2GTWA 2HT2D 1JYVA 2VIRB 2GJ6B 1U6AL 5ICZA 5C0AE 3I02A 3RX7A 5ESVA 1RZIB 3LS5H 3HA0A 2YRLA 1RIUL 4H88L 3QIUB 4WFGD 2XXMB 1XGTB 2BOBB 4DQOL 3IXAB 1P2CB 1JE6A 3MCKA 1V3JA 3TYGH 1BD2A 1U91A 1G7PB 4OLWL 1FH5L 2ZJSL 5CGYC 3LKNA 1T20B 1YMMB 4KKAD 3NBNA 4YHKH 3N85L 3C6LD 3LCYA 4YNYB 2P44B 4PRHB 4LSQL 4P57B 5GRUH 5HHQA 4F58L 4K3EH 2IG2L 3PGFH 1SMAA 1T3FA 3HNSH 5JHLH 4YPJA 1MUJB 4HJJL 4U6XB 1FCGA 2LABA 4HV8B 2YWYA 1VDGA 2FSEB 1JK8A 3ELAT 4PV9A 3D39D 2NX5D 5F6IB 4WI4A 3VXUD 3BGFC 2QHRH 4XAWH 2F74A 3IXTB 2JK5B 5F6HI 3W0WA 4FQLH 3C60B 1UJ3B 2NNAB 2APTA 3QG7H 1S8DB 3SOBL 3MYZA 4JLRB 5KSUB 4LU5L 5DDHB 1TPXC 4XB8A 3CVHL 4LDEB 1IEBB 1N26A 2PYFB 3T1FB 1Y18B 4YX2H 1E6JL 3FT3B 2ZG3A 2CIKB 1S3KH 1W72H 3VWJD 4MX7A 1K4CA 1ADQL 1NCAL 3PWPD 4ETQA 1KYOK 4EN3B 2A9ML 1R3JA 5I1GH 4QRPA 3MODL 1NAMB 4M7KL 4WWKA 4NN5B 1P5UA 2ADFH 1ZLUK 4YZFF 2FECI 4OLYH 1D5MA 4PJ7E 3CC5B 2AQ2A 1K6QL 3CUPB 1VGKA 2A9NL 5HDLA 4HF5L 1XF2B 1IAIM 4OLZH 1WBYA 5CD3A 1KACB 2VN4A 2IAMC 3VI3E 3QXUA 2P5EA 2LTQB 2JJVA 3HMXL 4QKXB 4ZDHA 3GKWH 5FYLE 5FM5O 4HEPG 3FMGL 4ZMAT 2C4XA 3FN0H 2VSCA 5BQ7A 1L6XA 4MA7H 2R4RL 3MV01 3IFOA 3SDDB 3OKOB 1FGNL 3QUMH 3E8UL 1FO0L 5JUEL 5JOPE 3P9MB 3R4DA 4MA8L 5B3NA 1MWAL 4M62L 4O4YH 2GFBA 5CZXC 1R3HA 4WI8A 5DMGD 12E8H 1AGDB 4U1GB 1F4XH 2LAGB 2YD9A 1CE1H 1IC5H 4MMZC 4YHIA 4L5FH 4XCYB 4LSUH 4Y5VB 4P3DB 5H35B 2AJVL 1MHCA 3O41A 3T65B 2G2RA 3TIEA 4MHHG 4XCEB 4JVUA 5BV7H 1L7TH 3W5NA 5DJAA 4JPVH 4A6YB 1HQRA 1U8HB 4ODHL 4UU9A 5CEZH 2CXGA 2RIKA 5IESL 2BJML 3GI8H 1U36A 3O6LL 5F9JB 2QR0B 1AO7E 4RFNC 1CU4H 4QWWC 2DQFB 4KMTL 1XEDA 2OMBA 5J89A 4X9IA 2RGSA 4WRLA 2VMFA 4HBCL 2H3NA 1YNLL 1E4KC 4KK9C 4Z7UF 3HAEG 4URTB 5E24E 1WITA 2DD8L 5IBTL 3RAJH 2C7UA 5DD1L 5FCSH 2EICA 4JQXA 1NSNH 1SMOA 5FYJE 3RWFA 1INEH 4KK5D 2GTZB 4PGDB 4TPRH 1DDHA 3MREA 3VMOA 3VXME 1CS6A 4MXQD 3VFVA 4FQ1L 4PRDB 3GSOA 2HJFA 2IANE 2IBGA 3C5SA 3O6ML 3F5WA 1WBXA 1N7ML 4U05A 2CH8A 4X98A 1UB5B 2HT3D 2OXGA 4UUJB 2NX5B 3S88L 3DV6B 1MFDL 2VDNL 5ESQB 2EH8L 4O5LH 3FZUD 5LGKA 2BC4A 1YNKL 1MIEH 1KTKE 3F58L 2NMSA 5EU5A 4K23L 3ZYOA 2OYPA 3VXSD 4UT7H 3OR7B 2UZIL 4ODSL 2X9XA 3HNTL 4RQQA 3C5ZC 4XC3H 2E7LC 1YY8B 3GSUA 1J5OH 5DK0A 2N4IA 1TVBA 1H3PL 4JHWH 5GXBB 1I85C 3KYKL 1UZ6E 1GAFL 2B4CH 4DKFL 3T1WA 2HH0L 3VWJB 1TTFA 2XQYK 1T80A 3TF7C 5E8PB 2V9TA 2J6EA 3ULVF 1YQVL 4HKZA 2CUMA 4DGIL 1E27B 2Y1VA 5C0AB 1IGCL 4JFQA 1AO7D 3HNVL 4Y2OA 1KOAA 5FB8A 3ZZ1A 1A6AA 1A9BB 3FB7B 4G9FE 3QQ9C 4ERSL 2FD6H 4Y4KB 1R5VB 2O5ZL 4QTHA 3V95A 5B8CC 4PBWD 4XP1H 5HI5D 3G08A 4MJIA 4QHUB 5FYKU 1IEAA 2HTLD 2NY7H 1SYSA 2BRRH 4OAWB 3T0VA 3ZE0F 1A7OH 4XXDA 1HE7A 3GHEL 1VFMA 3MR9B 2X7LA 5FYJD 2VQ1A 5I8KH 5EUOF 2BNQD 1F4YL 4KRPD 5TFSH 5KSBA 3VXMD 3WFCL 1AGCA 2P4AB 2Q3AA 3HZYB 3WDHA 1NUGA 1OM3L 2IAND 1PZUB 4R90L 4I0KA 3VCLB 3FB5A 3HMWL 4GSDH 1CGYA 4JFPA 2P5WD 4LSVL 1V3KA 2WM0A 2W9LA 3VFNB 5FEBA 1HI6A 1UYWH 3DHJA 1A0QH 4L3AA 2FIKB 4WI2A 4FQXC 4A2LA 2XV6B 4HT1L 4IMKA 4PV8B 1MQKH 1ZKAA 5IGXH 1FL6B 5FUOL 1N64H 3QEHB 4H25B 1KEGH 2BXYA 1YN7A 4KK8C 3IFNL 1A02N 5M94B 1S9WA 5J13B 3MA7B 5C0RL 2FJGB 1YECH 3O4LE 3B8YA 4YE4H 3LZFL 4P46B 3PP4L 4Y5YA 2J3SA 1LEIA 1N6QH 1Y0LA 3SKJH 3BMWA 3RGHA 4P3WA 3ZDXF 4S1DC 1EAJA 1RSFA 4LSRH 3MNVB 3IETB 3MLTB 1IVLA 2X5PA 2ZOKA 3LOWA 4MNQE 4N0FB 2IAMD 4JZJB 3LKSA 4N1CA 4XGZA 1TJIH 4RMVA 1E6OH 5EOTA 2GJZB 4ZNCD 4PJ7B 5FKPA 3U2SB 3RWIA 4MD0B 3ZE2F 5M7QA 4HSQA 2M26A 1BQLH 3BKML 4HQQH 2NLJA 3L95A 1G7MA 3O3UN 4NUJB 4UQ2B 4JFXA 1YDPB 5I17B 3BKJL 1PJ9A 4AEFA 4YQXL 2V9QA 2PW2A 2W9DH 3BD3A 4DKAA 1NLDL 1FRGH 3DROA 2ARJB 1OP3H 3ZTJG 4JCMA 2I07A 3RFZC 2KUTA 2NY1D 4H1LB 2R0LH 1L0YA 2R2BB 3HC3H 3SE4A 1RUQL 5IJVA 4HPOH 3MLYH 2F9BT 4GUPB 3BPLC 2ZCHL 2YUXA 2Z31D 1J1PL 1MLCA 2R2HB 4PLKC 3TPKA 1H5BB 4IIQC 3ARDB 3EO9H 5J9PA 3MRHA 3EW3B 3ARYA 1BQSA 2GAZA 3S3PA 4K2UL 3O4LD 2W0FB 4Q9CA 1U8MB 2BVUA 4PJCF 2YD7A 1G1CA 3CDGB 4D0CA 5IHZB 1DBKH 1TJHH 4PRNA 3TWCH 1E4WL 5HHOD 4R97C 3RWDA 5DT1H 5BRZA 1ZV5A 1BQHB 1AO7B 2H26B 4JDZA 2YUZA 1LD9B 1FLRL 3MRFB 3LDBC 2BY0A 3W9DA 1FE8L 2DIBA 4JPWH 2FX7L 3G9AB 2NR6D 4Y0GA 1CFQA 4Z8FL 4MNQD 2F58H 4CADB 5DSCB 1X5LA 3NCYS 1OARL 2EDBA 5CMAA 3GSXB 3ARFA 4DK6A 2QKIA 4HH9A 3UTQA 1J9CT 1U3HD 5DMYA 1MH5A 4D9LH 3DXAE 5I0DA 4OCYL 3PG2A 1S7WA 3VXMB 4DFIA 3SN6N 3RTQD 2LE9A 4XPGL 3CFKA 4J4PA 5HJ3B 5DHVA 1MOEA 5SX5K 2DIJA 2IANB 4P4RB 1FORL 4WI7A 3HPJA 3MRKB 5D1QB 3L6FA 4GAJL 5IVZA 2P5WB 5A3IC 5I1LB 3LH2L 3OR6B 5DQJB 3X13B 4G6FB 2I9TA 1YEFL 3WS3B 1A6UH 4O02H 2P1YA 1K8IB 3QCVH 3B43A 1NMBL 1NC2B 2GK0A 3CCHA 1NMAL 4XP9H 3CZFB 4M3KB 2VLRE 5IM7A 2V6HA 5A43C 4PGCB 4YGVB 4OSUH 6FABH 5JA9A 4TUKL 1AJ7L 5IMOA 1VFBA 3ARRA 1SJEA 1KV3A 2J6EH 5DRNB 4ELMA 3PWLA 3QJHA 3B9KC 3QQ9D 1W0WB 4ZXBA 5FUZH 3O6FB 2G60L 4DAGL 4ZUTA 2UYLA 3OB0H 3SE8L 1A7NL 4LCUB 4GBXA 4OZ4B 2H32B 3G5ZA 2DQIH 4PJ5A 4Z7NE 4K9EH 4EBQH 1MCPH 1UM4L 4G9FB 3TBSB 1Q94A 3OKLA 4OCWL 5LCVH 5AWNL 2KPNA 3PL6A 3O11B 5JIHA 1NC4D 3UZVB 3S4SG 2PW1B 2YHGA 2DQCL 1XH3B 3A67L 2Z91A 4Y1AE 3OZ9H 2XNAB 4POUB 3RU8L 2EDTA 4GMTH 3O4OC 3QG6A 1ZGLA 5HTSA 2Q76A 4ACPA 3PP3K 5TQ0H 2LU7A 1YYMH 3GSRA 4MJ6B 4M3JA 3PDOB 3T8XB 4YDIH 2DDQL 3VW3L 3DVGB 3QNYA 5K59F 5F72S 3DUSB 3KPMB 4FQ2L 4LHJB 3QDJE 4NQDA 1RHFA 2ARJQ 3U0WL 5MP6L 2X4NA 4XNUL 1M7DA 5CHNA 1VADB 3G5YA 3D2UA 5FAAA 1C1EL 2MSPA 1IARB 4JGJA 3K4ZA 1JZ3A 5C09E 5GSVA 1NBQA 4NWTH 4QXUH 1FVCA 5EIVA 2CR3A 3QCTL 1BLNB 2FBOJ 4LLDA 5DJ0A 4M7JH 3TCLA 4FG6D 2EDKA 1JNJA 4X6EA 4BUGA 3O4LB 5IFAH 1AR1C 3WEXA 4TRPH 1JIBA 4KJPC 1YEIH 2QJDA 3NOIA 3D0LB 3U7YH 1OTUC 4MAYC 3FQUB 3WUZA 1HQ4B 4M61A 4ODVL 2CRMA 2WINB 4P9HH 2YZ1A 3EYUH 2HFEA 1YEJL 4MNQB 4MSWA 1GOFA 4PJDF 5KSAD 2JB5H 3T4YB 5D70H 2EDWA 5F7LB 4EUPB 4AMKH 4BKLB 2B0SL 4QHKI 1YYLL 3N1MC 4FXGA 4LLYB 4GRLC 4OCRL 4JO3H 3L3JB 1KN4L 3I85A 4QRQA 3EO1A 3QPQC 1DE4B 4J6RL 4LHUB 2YR3A 2IPTL 4X6DE 5GGUA 4ENED 3GJFB 3MRQB 2EDHA 2FECL 4YHZH 4G6MH 1UWGL 4N0YH 4KVNH 4C4KT 5DRWB 3NAAH 1E4KA 3STZA 2JIXD 1FNHA 2XXCB 1OP5K 2WSKA 5IF0A 2X4OB 3QDJD 4PGBA 4I0PB 4GKZB 1CICC 2ZZUT 3HUJE 4PGEB 3ARGD 5GJSH 2BNRD 2R1YA 2X05A 3O6KH 3F7QA 3EGSB 4Z78B 5C09D 2BSRA 3FKUS 4MXWH 3VJ6B 1U8QB 5AG9A 1WICA 1GGYA 1T2XA 3QUKA 1I1YB 4OGAD 3PHSA 2QV2A 3QCUL 3OJ2C 4KJWC 2E9WA 4K55A 5EBMA 4OV5B 4NN6C 5JW5A 2CO7B 5MEND 5CSGA 1CDHA 2AK1L 3PWUB 4QRRD 2OQJB 5JMOC 3S36H 4U6YA 1Z9LA 4XNMA 1G7QA 4D0DB 4NRYB 4L8CA 2HRPH 1XGUB 3WD5L 2VZ1A 4MLSA 4U3XA 1HILB 5DO2C 4GXUN 4MQ7B 2FH6A 5F9AC 4TSAL 2ED8A 3BI9X 4HGKC 2YPKA 5EN2A 5DHVH 1I8IB 1N4XH 2BNUA 4ZFFA 5C1MB 3DXAB 4AT6B 5A3ID 4JY5L 3WHE0 2XKSA 1SM3H 5SWQA 4PJEF 3JVGC 1KPUB 2X70B 3ES6B 1IQDA 5ALBL 4L9LC 4XCCL 3OKEA 1U6AH 1ZT7B 4HUKB 5D93B 2EYRB 1DBBL 3HB3C 4IHOB 2UWEA 1NDMA 1BHGA 5DTFA 3SKMB 4HCRH 2VL4A 3TYFB 1RIUH 5DFVC 4H88H 3IFPA 4C4KO 4WV1B 1JGUH 1JI1A 5AD0B 4S0SD 2FATL 4HIIA 3DO7B 3WIIL 1GIGL 4GKOA 3HE7D 3D48R 5JDSA 2VLRB 32C2B 3QISA 1FH5H 3RVVD 2ZJSH 5SV3A 1GGUA 4LSQH 3I9GH 3UTTD 1WGOA 5EBLA 2GI7A 1KLFA 4LL9A 1YEGH 4TULH 3RUGA 2D31B 1CFBA 3F6LA 4UV4L 4LLWB 5E8NB 3GBNL 3W11D 4GG6E 5BW7C 4PRIA 3ARED 5GGVH 4Q9RH 4GRWH 4UV7H 3V52L 3V6BR 1P6AB 5E5RB 3PWVA 5IT2L 1I1CA 3RIFK 4RZCA 3BIKB 5F9WC 1KJ2A 1CL7L 3UPAA 5D7IA 5KSAB 2WP3T 4P4KB 3CK0H 1FGVL 3FRPA 3TJHD 4QHNA 1ZT4A 5C0BD 1YEHH 2UY6A 5CJQL 3KHOA 3VFGL 1G7JB 4JG0L 4Y1AB 3L5WB 1M05B 3SOBH 3K81A 1QQDA 3CFDA 3BFOA 1A7PH 4GT7A 4FQQA 3IU3B 1JPFA 5HY9B 4W81A 1RUMH 2IBZY 2M1KA 3GRWA 4PP1D 5GGRY 5IIEB 1E6JH 4WVRA 3MBEB 1PKOA 1RK0B 4UILL 1ADQH 1NCAH 4QRTB 3U30B 1D7FA 4JRXA 3BQUD 1OPGH 3EYVA 2A9MH 3VDBA 3C5JA 4HUVA 3QDJB 4AZ8A 2W38A 3ROOA 2R0ZL 4V1DD 5EO9A 3ARGB 2A0LD 3ULUE 4NC2B 1K6QH 3QUZD 4PTTA 2ZCKL 4FQCH 4YHML 1ZA6B 5C09B 1NBYA 5J57B 5F89B 3UPRB 1AKJB 1JTOA 4MQXD 2ICWA 3BISA 5IBLD 4P2OB 3VGBA 1XR8A 4R3SB 4LRIC 3W0WE 4H8WL 3UROR 1J10A 4IMLB 2B5IB 1DFBH 3DX7B 4MVBC 3VXNB 5C71A 2XWTB 4YK4B 2R4RH 3OGOE 2W92A 3E8UH 3MV9D 4ZD3H 3ULSB 1PQZB 3ET9F 4M62H 3RVWC 4CDHA 2E8YA 3ZSTA 1UXWA 4XH2B 4H8WC 4GRLD 4RAHA 1CGTA 4QRUA 2FZ3B 3LRSA 5E99H 2ATPB 4XP6L 4HG4J 4P5MB 5D2NA 2I60H 2ZSWB 2D7MA 4OT1H 4QRPE 5ID0A 1W72B 4FZEH 4O2CA 1KGCD 1NQBA 4U0RC 4D8PB 3RIFF 2XZQH 4M1DH 4YHNB 2H6PA 2VITB 2DS4A 2QLVB 3EJZD 1EAPA 5HYIA 4NRXA 2BJMH 1BD2D 1K4DB 1BJ1H 4X6DB 3WYRA 1BWMA 2ZOLB 2P48B 4OZIA 3M1BB 3RPKA 2KQMA 1V7MH 4HXBH 4CN1A 4YHYC 2P5EE 1IAKA 3BJLA 2NXYD 2VXQL 3P4MB 1NCBH 1FL3B 1NFIB 1TJGH 3VG0L 5DMIL 3HUJB 2CDFA 3I75B 2HAZA 5AAMA 3ULUD 1IKNC 3BXNA 3HE7B 3A6BL 4EI6A 2DD8H 3UBXA 3V6FA 2P7TB 4ELKA 1S9VA 2RHEA 1A3LL 3NA9L 3B2VH 1JZ4A 3L3KB 5DC4B 1VACB 3W0WD 3SKNB 4EI5D 3QULA 1Q9WA 3T77A 4NHUA 4P5KB 1N7MH 2VXUH 2BSED 3DVIA 4MDIB 5KVEH 1NBZB 4KRLB 5IW1B 5FO8B 4FQHA 3MRLA 5B39A 2W91A 1HXYB 3S88H 5DRXB 1IGIL 3MUZ1 4U7SA 1UH3A 2EH8H 4HJGB 1Z6JT 2J12B 5ID1A 4O2EB 1MRCL 4HWNA 2NZ9D 3F58H 4XHJD 3REVA 2V7NA 4B7IA 4K23H 1DL7H 3UX9B 3PXJA 3MNWA 2HKFL 4ODSH 3QUYC 3HNTH 3B9KA 4DW2H 4CVZA 4CJ1A 1U8KB 4G8EA 3EDKA 3IDJA 5C0IA 3MJ7A 1WCBB 4DKFH 1ZK9A 1F00I 1DSFH 5LBSH 1LP9E 3NCJL 5HGAA 4WUUD 4OJFL 1YQVH 3BQUB 3WFHA 2YBRB 1QO3B 5KS9A 4GRMA 1J1OL 4DGIH 5JDJA 3HNVH 3MO1A 1Q38A 1SY6A 3UBXI 3ZYJA 2NTFA 1HHKA 3R0NA 3UXFA 5JLZB 4WWID 4YUEL 5GJTH 5FK9B 5EPMA 2Y5TB 3O8XD 3U9UA 2ZP0T 2CIIB 3QUZB 4HFWA 3DNKA 2IBBA 4S1SL 1FZMA 2R9HC 4R8WL 2H2PC 1JFQL 5ETUB 4A2MA 1K2DB 1HYRC 4ZFGH 4BSVA 4XBEH 4RNRA 2AJYL 2X89D 1F4YH 3T4AA 4XT1C 3WFCH 3OHXB 1EHNA 1MI5A 3MBXH 1U92B 4LEOB 3AC0A 15C8H 2DMKA 1G6RA 2X4QB 5MHSE 2YMXH 1OM3H 1ZEAL 1KJ2H 1B0RA 5KBNC 3HMWH 1KCUL 3S97C 1NEZB 4H1LG 2CKNA 4ZAKC 1RIHL 5CUSL 3WIFB 5HHPA 4ZUWA 1W0VA 1CLOH 5AZEL 1ZHLB 1MCCA 2GTWB 2Q7NA 5EC2A 3D25A 3N50A 4Y4HC 2KDGA 4XTRD 2MKLC 3A0OA 4HT1H 1ZLWH 3VI3F 5ICZB 1CXEA 1Q9OA 4TSCL 3I02B 1ZT1A 5ESVB 1MCEA 1J05A 4NFDA 2XTLA 3DSNA 2VDKL 4M9PA 3HPLA 3KLAA 4XP5H 2WBJC 4MAYA 4RSVA 4OF0A 4BFEA 1BD2B 3BKYL 1U91B 1BQHG 1FIGL 1MCNA 1S7RA 2OL3L 2FYYA 1VFAA 3LKNB 1LNUA 3HR6A 5MEPA 1F13A 4IJ3B 1RPQA 4JB9H 5KSBE 4F8TA 4C59B 2D4DA 5HHQB 2Z8WC 2J88H 1OCWL 4UIMA 1BIIB 1T3FB 5L0QB 3EZJB 4OIIH 4FTVD 4CNIA 1JV5A 2G5BA 1JK8B 4PV9B 1UM6L 5DGRA 5E4EB 3Q5TA 1RZJL 2PR4L 4TUJA 2F74B 1BBDH 1JHLL 3W0WB 1EV2E 2A6JA 5FFLA 4HXAH 3BKJH 4KHTH 3TT1H 4YQXH 4UTAL 1N6VA 5MHSD 1I1FA 4LEXL 3UAJD 4G6AD 1CICA 3BHBA 1P7KA 4WW1A 1RZJC 2Y07L 3NA4A 3BEVA 2XA3A 5ESAA 2AQ1A 1F2QA 4GH7B 3ZE1E 4MX7B 1K4CB 1NPUA 4Z95L 4ETQB 1JHTA 2HRLA 1R3JB 1EGJA 1J1PH 2BXZA 4QRPB 4ONFL 1NFKA 3SBWC 2APWA 4WWKB 1JTPA 4OLVH 1D5MB 4MJID 5T5FH 35C8L 4PY8J 1CLYH 1HZHL 1VGKB 2O26U 4HH8A 5FIEA 2LVCA 1JNHA 1T5WA 4R4NC 5KVDL 3G04A 1WBYB 5F93C 5CD3B 2OI9C 4U49A 5EU3A 5KG9B 3IKCA 5EBWA 2P5EB 1QHOA 1FLRH 3O2DA 4ZDHB 3H42L 1OOAA 4P3CL 5FXCH 3T09A 5LKNA 1FE8H 3ZKSD 3SDXA 2FX7H 5BQ7B 1PG7W 2YKLL 1B4JL 3IFOB 5CCKL 4NPYA 1T03L 1UZ6F 2DLTA 1XF3A 4KTDL 2QADB 5DI8A 5I1HH 5C0DA 2GFBB 3JVGA 1R3HB 2O5XH 3VWKD 1CBVH 4OCYH 5J0BA 4YHIB 1INDH 4XPGH 1CQYA 2HT4C 1MHCB 3O41B 5TPWH 2G2RB 3TIEB 3ZT5A 1PX3A 2A77L 1FSKB 4ZOBA 2QSTA 5DJAB 4JRYD 5DMKA 1HQRB 2X1WL 4OFYD 1UB6A 5F1NA 1XGQA 3BVNA 5EH1A 3QFJD 3O45A 4QTIL 4NRZA 2PNDA 1PEZA 5BRZE 2L0DA 1T66C 4I18A 1Q72L 2VYRE 1CGVA 5C7XL 4C57C 2CK0H 1HCVA 4TUKH 2AJ3A 1OAXL 2H3NB 1CXLA 3DYMA 3V0VA 1OT2A 3IVKA 3JUYA 1T21A 1OTSD 5T1KA 2W60A 4WW2F 5FO9A 4U1NA 5BW7A 3RZCC 3JV4A 3V6OA 1YJDL 2C7UB 2UZYB 3RNKA 1LP9B 1QLRA 4DAGH 1LO5A 4Z7UA 3RWFB 5I0ZA 1IT9H 1RVFH 3VFVB 1IFHL 1ITCA 5EA0L 3GSOB 3U46A 4AENA 2HJFB 1WZMA 2FLBT 4JZNA 4I2XA 3C5SB 4JDTH 2K3TA 3F5WB 4M5YH 4OQTL 1QPPA 1WBXB 1QKZL 1RQ5A 1UACH 4X98B 4LVEA 2DQCH 1QLFA 3I6KA 4NCC2 5TE7H 4K71C 5DUBA 4EDWH 1RZKL 3AMKA 1G6RH 2BC4B 4S1QH 2AQ3A 4WNQA 1WIPA 4XMKH 5EU5B 3OJVC 5EOQL 4O00A 1AXTH 5JHDD 4MXVE 4WTZG 4Q0XL 1NUNB 4AL8H 1QR4A 2DYPD 2EXWD 4RQQB 4JY4A 1U8JB 4DVRL 3GSUB 2VLKE 5H8DA 3I3EA 1TVBB 2EYSA 3IS0X 4ELME 4ORZC 2B20A 5MP6H 2OR8A 1DN0A 4XNUH 3ZKMC 5FKAA 3MUGA 1ZHNA 4HKZB 5BZWB 3MC0A 1PW3A 2CKBL 2WBJD 2OR9L 4DN4H 4JFQB 4LRIA 4CU8A 5I74C 1FN4A 4PJ5E 5FB8B 1A6AB 2X42A 3QCTH 2A6IA 3VI4E 2OTWB 1J86A 4QTHB 5DD3H 1UGNA 5DZLA 4U33A 1ZLVK 1TZGL 3U4EA 1IEAB 4XVUC 3FO2A 4UB0H 2IQ9L 3OB8A 1SYSB 2X40A 4K3JL 4XXDB 2NQCA 4XNZB 3WHXB 3C2SA 4F8QA 2W1NA 3ARFD 4HG4K 1IGTB 3AS1A 3MLWL 5DK3A 4Y16B 4M5ZL 2X7LB 3HC0A 3BX7C 1D5BA 2K7QA 2VQ1B 4LSTH 4ODVH 1G7HA 5KSBB 2PO6A 2Q1EA 1AGCB 1QLEL 3OKMA 4J4PD 4KKBD 5GZOD 3FB5B 5EUOA 4JFPB 5DUML 5E2JA 4D9RD 4U0QB 4NQDE 5IEKA 1GGCL 1HI6B 4AM0A 1FPTL 2DQGH 5GRVL 3BZEA 3D6GA 5F88A 1NMCC 3C09B 1IZJA 4X5XA 2NXZC 4PJ8A 3G6DL 3IDXH 1UKQA 3NPSB 2P46B 4J6RH 3EYOA 4MAUH 4GXVH 5F21B 4CN6A 1YN7B 5IBUB 4HGWA 1S9WB 2X4UA 5ILTL 4HX1A 2AAVA 5GGQL 3SJVA 4OM0L 3FHAA 3TFKC 2EEAA 3K2UL 1EGJH 3CU7A 5KJRH 4Y5YB 1BFVH 3DX8A 4ZXBD 1LEIB 2EDQA 4W4OA 4HBQA 4C83B 3O9WC 3GDBA 2WIMA 4J3TA 4GBXD 5GQBA 2WZPD 5E6YA 1QFWM 5IMMA 4C55A 5I6XB 2ZOKB 1E28A 4PJHF 4XGZB 2X4PA 3PL6D 3QXDA 2HTKD 3QCUH 2D03L 4HAFA 4R7DA 5EOTB 5FKPB 4NQTA 1T7VA 4P99A 4LVNB 3O2DH 3RWIB 3QI9A 5JQHC 1EJOL 1GZQB 2D4FA 1H3VA 3GRWL 2AP2A 2MFNA 3NH7L 2AJSL 1KN2H 2NLJB 1EZVX 3L95B 1SQ2N 2R2EA 1G7MB 1MFEL 7FABH 3J7HA 1CYGA 3CJJA 5E00A 2BY1A 4JFXB 2VXVL 3FHQA 4U1JA 3QUYA 2PW2B 2EDOA 3BZDA 3OQ3B 5H94A 4G6JH 3DROB 5CIPA 4NQDD 2I07B 2O93L 1REIA 4I3GA 4CAGA 4JJ5A 3QHTC 2HJLA 5DVLA 3QJFA 5T3XL 5IJVB 3MLUH 2GJJA 2AGJL 4Q6IC 1MLCB 1MRFH 5GISL 1FAIH 4NZDA 3MV8D 3NIFE 1BAFL 3G6JF 1DBBH 4JKLA 1B2WL 5CSBA 5J9PB 3MRHB 1FYTA 2CUHA 1XGYL 2GAZB 2R56H 2DBLL 4PB9L 2R4SL 3KLSA 3BH9A 3LD8C 5B3JF 1KXTB 3QT2A 5KTEH 3U6RA 4D0CB 4PRNB 4RMQA 1ZLSH 4KZDH 3RWDB 4DCQA 3DSFL 4LVHC 5DVOA 3WIIH 4CBPA 2ZG2A 3FT4A 5BRZB 5DGQA 1AQKL 3UC0L 3DX9A 4PJCA 3UTSD 3BKCL 3W9DB 4XBPA 3MLXL 2BVYA 2MCPH 1MCBA 1JRHI 3RGVD 5TF1H 1CFQB 2D0GA 2DJSA 4PYHA 3TBVA 5EG6C 4APQC 2QBWA 4JFDA 5CMAB 5T1DL 3ARFB 2QKIB 4HH9B 2D0HA 3UTQB 3WV0A 1LO2L 3GBNH 5GS0C 1MH5B 3R1GH 1MCSA 4MGXA 1TVDA 1S7WB 3BP4A 5I18L 5IT2H 4NUGL 4G3YH 1LO4H 1U8NA 1CL7H 3CFKB 5DHVB 1RFDL 3HPJB 4ZTPH 5IVZB 2UWEE 2DI7A 1GCFA 3VFGH 5CJQH 3U4BH 2F53A 1WFUA 1OD7A 1QRNA 2EH7L 3SDYL 3DMMD 2I9TB 1RV6X 2IQAA 5K9JL 1HNGA 3IAGC 5CILL 4JEGB 4IBLT 4KPHL 5JPMA 2GK0B 2HFFA 1N0XL 2EKSA 5IM7B 4UILH 4RMSA 4R4FH 4MD4A 5HVHB 1VFBB 5EWIL 4AG4L 1SJEB 3V7AE 1C16A 3WIHL 3CFJA 4ELMB 1OY3B 4KQ3H 3EFFA 4NKMA 3RUGE 3PWLB 3QJHB 4YHOL 2Q87A 4P2RD 4ZXBB 4J3SA 4G80A 1GXEA 5KANI 4ZUTB 3BGFB 4FABL 3OXRA 1TITA 5AYUL 4PRIE 3FN3A 4GBXB 3G5ZB 5FGCE 2C1OA 2VQTA 4MB4A 4PJ5B 4G8IA 4S1RH 5AUMA 3S5LA 1Q94B 3OKLB 5D7IE 3RDTC 1J0JA 3PL6B 4KVCL 4H8WH 1WBZA 3T3ME 4OIAA 5JXEC 4EOWH 1MNUL 2Z91B 4FQPA 3BAEH 5CZKA 2AXGA 1JGLL 1G0YR 2EDLA 3HUJF 3NPZB 3V4PL 2Q76B 1ORQA 4OI7A 5J7CC 4AQ1B 4ODWA 3GSRB 4M48L 4KV5F 2GY7B 3QEGH 3QA3A 4JRXE 3PNWB 3GUTA 4G8GD 4OF7A 1SY6L 2NXZD 2VDPH 1KTDA 4LPUA 3QNYB 3U1SH 3EJJX 3BE1L 4NQDB 2Y23A 4RAVA 3WFEH 1M7DB 4V2BA 1A1NA 5JORA 5CHNB 3G5YB 2OTUA 3D2UB 4JO4L 3WFBH 1EZVY 3D9AH 1OLZA 3P77A 5GSVB 1FVCB 3CIQA 2H2SD 5IQ9A 5IVXE 2VDOH 4HC1L 3JZ7A 4LLDB 4DTGL 4HWBL 5DJ0B 3TCLB 3UYOD 1X5FA 4P23D 5L2KA 2C5DC 4X6EB 1JI2A 3QIWD 5D1XD 3WEXB 2D9CA 5KVFL 1VEPA 2NCMA 1KB5A 4P5TD 3A6BH 4NC0B 1VGEH 3ZMRA 4M61B 1BREA 5IVOA 5CP3A 4OF5A 1T2QH 1AGEA 3B6SA 5SX4H 2HFEB 1A3LH 3T0BA 1F8TL 1RZ8A 3NA9H 3TVMC 1QG3A 1A3RL 4MSWB 1JRHH 1F4WH 4AY0A 5D2NE 3D69A 5INDB 1CDIA 4FXGB 1NEZG 4PG2A 3CDCA 3RL1A 1GPOH 1SJHA 2ICES 4PJDA 4LNVA 4NNPH 2ERJC 4QRQB 3PWJA 3EO1B 1AE6L 5L9DH 1VSCA 5GGUB 3TBTA 5FM8A 1N59A 1MRCH 4G8FA 4OZIE 1MFAL 1AGBA 4D94A 4JRXD 4MNHA 3STZB 2NY5L 5F9OL 3C6SB 2R0WH 1BWWA 1DQML 1E4JA 2WQRA 5IF0B 3RZCA 4PGBB 2NY2B 3UCRA 5F8QC 1ZAGA 4KROC 3NZHL 2ZCLL 1C5DA 2Z0BA 2FHFA 1W8OA 4GG6F 4WFFD 2R1YB 4QCIA 3KR3H 4HJ0D 4N0CC 3NCJH 2BSRB 1X4XA 2YPLA 1VPOH 2AABL 3QUKB 5CLWA 1IZKA 5GRJL 5DVMA 1DBAH 3C8KA 3VH8A 5ADOL 5EBMB 4IRJC 4OTXH 3HR5A 5JW5B 4OB5L 3SQBA 4UBDC 4M8QA 4XMPH 4YUEH 1UZ8A 1DQDH 2IGFL 1B6DA 4U6YB 1DLFL 1T22A 5HI4D 4XNMB 4Y4FA 3QZWA 1G7QB 1JFQH 4AEHL 3VD7A 4IRSD 3V5KA 4L8CB 1IGMH 3MLVL 1LDSA 3EIFA 1FNSL 3SGEI 3BZ4A 1WFNA 3C5ZB 4NC1E 2ADJA 5LG1A 4JR9L 5JO5A 3CX2A 2DM7A 3L3IA 1KC5L 4RGNC 1KCUH 2YPKB 5EN2B 1KIRA 4ZS7H 2BNUB 4ZFFB 3TZVC 1RIHH 5CUSH 5SWQB 4QGYA 3S34L 4JM2C 3WLWD 1IQDB 4N0UA 3TBWA 5HPOA 3OKEB 3ZKNC 5D7KE 2R8SH 2APVA 2UWEB 4FHBD 1NDMB 4R2GD 3DX6A 4PJEA 5EZIL 2DQEH 5TQ2L 3WDJA 4U1IA 2EDDA 1CVSC 1CK0H 3IFPB 1UA6L 3KG5A 1UH2A 1CI5A 2GK2A 4RMTA 3MTRA 3ZKXB 4HIIB 1JYWA 1T7ZA 2V17H 4K94H 2J7LA 1HH9A 3BKYH 3V2AR 1FIGH 2AEIT 2OL3H 4PJFF 1EVUA 1CG9A 2YUWA 3MA9H 3SEPA 4UIKL 3EOBA 5EBLB 3AS0A 4HUMB 1MI5E 1ERNA 4TVPH 3UJIL 4WHCA 4TYUA 4CRPA 3RUGB 4BQ9A 5L8KB 4JZOA 3ARBA 1OCWH 3LSOA 1CD8A 4LSPL 2LQRA 4FQXB 4LIQH 4WJ5A 1CN4A 2AEPL 1DUZA 4PRIB 1Q1JH 5JXED 4K8RL 3PWVB 4YBLB 5DD5L 4RZCB 2FX9H 5FGCB 3MCLL 4HIJA 1RZJH 2OZ4H 1KJ2B 3O3BA 4H20L 4DKEL 3TO4C 5D7IB 3C87A 3PWNB 4XXCA 4WW2C 1JHLH 4POZC 5L7XL 4JN1H 4UT6L 1LO3L 4QHNB 3WNPA 1CDYA 2AK4A 2D3VA 1IILE 4KK6C 4Y2DC 4AEIL 1QQDB 3CFDB 1F2XK 3X3GL 3H9SA 4FQQB 4LEXH 1JPFB 2Y07H 4PLJC 4Z5RA 4HLZH 4TNVF 3O9WA 3NZ8A 1XFPA 4OF8A 3AUVA 2ESVA 4XPBH 5AZ2L 5JXAL 2JE8A 3VU2A 4Q97A 3KJ6L 4JRXB 3EYSL 4WHTA 5LWYH 3EYVB 3R8QA 3WJLC 2V2TA 4WHDA 3C5JB 4HUVB 2GIYA 3MNZA 5C07D 1CXKA 3IJYA 1T5XA 3SQOH 4LCCA 3KPTA 3LQMA 2AW2A 5EO9B 3QQNA 3HLAA 4K07A 4TOYL 2DKMA 3RKDC 4PTTB 35C8H 1HZHH 3R06A 4OCXH 1NBYB 1WZKA 3TT3H 4DZ8A 1RUKH 1C5CH 5KVDH 4UAOB 2ICWB 2GQHA 2VDLH 3C2AH 5FYKH 5IVXB 1XR8B 4ZTOL 1P7HL 4Y5XC 1U8HA 5CKAA 1MI5D 1MCFA 5DJ2A 3DYOA 2VXSL 4W4NA 1RURL 5CP3H 5C0CD 4X6FA 2HG5A 5BS0A 1ZXQA 5CINL 5CCKH 3MGOA 2YA2A 4G6KH 1A7BA 4MA1B 2BRQA 4ZOEA 4KTDH 1ZE3C 1UXWB 5T5NG 1LP9F 5TDPA 3VDCA 2X1QA 3FFCA 5IW3A 2BDNH 4QRUB 2BVQA 3MACL 3LRSB 4OI8A 4JQVA 5D2NB 3W2DH 5ID0B 2D7NA 4KI5C 2VLME 1R3LA 3CNKA 3C9NA 1R3IH 4PJ9D 4WO4A 4GXUM 4O2CB 3RA7H 5DD0L 3Q0HA 4LVOB 2YN3A 2OJZL 2GKIA 4R97B 3V4VL 5IFHL 2H6PB 4RFOH 1EAPB 3AM8C 4NRXB 4KKCD 5D1ZD 3LDBB 4OZIB 4YZFE 4WHYH 1EBPA 4R2GB 1Q72H 1IAKB 2J5LC 4NQVA 5C7XH 4ZS6D 3QPXL 3SDXE 1Q9KA 1OAXH 3PP3H 5F7HA 1H3XA 3JUZA 3P30L 2FJHA 5GGSA 2CDFB 4J1UA 4RA0C 1NGYA 1CGSH 3BXNB 4EI6B 3UBXB 1KELL 3V6FB 1MCIA 4RGOL 3E0GA 2DQDL 4XMLL 3V4UL 1S9VB 3QWOA 3HE6A 2BZDA 3SGKC 2VO5A 1DEDA 2IFFL 1TXKA 5DZOA 3LV3A 2Z93A 4Z18A 4LP5A 2QHLA 1L0QA 4GKNA 1Q9WB 5I30L 5IHBA 4NHUB 4WEUD 3N9GL 3A6CH 2EXYD 4M43L 1E27A 5C0AA 1DVFD 3UDWA 4FQHB 1IAIH 3MRLB 5B39B 3L1OH 3FB7A 5E2UL 3SE9L 5IMKA 3TCXA 2VC2L 1MSPA 4Y4KA 1TNMA 4IOFC 4YXLL 3EYFA 1RU9H 5TE6L 5ID1B 3QNZA 3O2VL 4QHUA 2XY2A 3REVB 2V7NB 5IBUG 1QBMH 1HDMA 5C9JA 1EEQA 2NY3D 5T3ZL 3AB0B 3MNWB 3QIBD 5F7MC 3QXAA 3B9KB 3QDME 4DVRH 4JVWA 4CVZB 5EZLA 1A6ZA 2ICCA 4G8EB 1QBLH 3IDJB 1CT8A 5C0IB 3P0GB 3MJ7B 3V6OE 1AXIB 4FMFA 2RCSL 5F7DA 3ZO0A 4M1CD 5HGAB 3IJHA 1KJMA 3NVQA 4Z7UE 1AP2B 3WFHB 1AHWC 4BSJA 2CKBH 5H2BA 2DQJL 2OR9H 2QQNL 5K9QI 3MO1B 3QR2A 1YMHA 5J11B 2NTFB 1HHKB 2PXYA 1ZWIA 5I1EH 4I2XE 1I1AC 4Z7VF 2JJUA 5EPMB 3U9UB 1TZGH 3QBTB 3TNNA 5HDQL 3MUJA 4HFWB 2JJTC 1FZMB 2FBJL 4K3JH 2QQLH 3MFGB 3DVFA 3WKML 4X9GA 4BSVB 4DGYL 4XP4L 4RNRB 2DICA 1KCVL 5IW6A 3SPVA 1RMFL 3ARSA 3T4AB 1OP5H 4E41A 2VH5H 5C2UB 1S9KC 5F7FA 1IM9D 4NM8L 5LQBL 1MI5B 2GT9A 3BRGC 1JPSL 2E7HA 4JM4L 1G6RB 3KPLA 1PBYA 1JZ5A 3L9RA 3MOBL 1R0AH 2F5AH 1B0RB 3ARXA 4KJQC 3C8HA 3MNVA 4YFDB 3MJ9A 3SO3C 3MLTA 5HHPB 4KK6D 1HIMH 4ZUWB 4Y2DD 3CMGA 1W0VB 2C9AA 2AEQH 4K8RD 5EC2B 3D25B 1JPST 2GCYA 3G6DH 2ZUVA 5FCUH 3GSNL 2GJZA 4OFIA 5GGSY 5DD6A 3S35L 3V79C 1Q9OB 2FEEL 2VDML 4UT9H 4YWGL 1ZS8A 1ZT1B 4JREC 3WFDL 5J12B 1J05B 3TN0C 4ZFZA 2KKQA 3ULVE 4PG9A 3HPLB 1KFAH 2F19L 4MAYB 5GGQH 3VG9C 5GZND 5T1KD 2I9LA 3BESR 4UQ3A 5HHME 5FDYA 2FYYB 1VFAB 3RWJA 5B4MC 1DUYA 1LNUB 4BYHA 2EDXA 4OGYH 5MEPB 3TVMA 1MCOL 5F3HA 3ZE0E 2XPGA 1NCWL 3BSZH 1WTGT 4QNPF 3OPZH 3P0YL 4WUKH 4WENB 2VKXA 4UIMB 2EEDA 3RWCA 1OWRM 5EUOE 1SEQH 3TIDA 3RY6C 4CNIB 3RVUC 1JV5B 2G5BB 2R2HA 3BN9D 2HLFD 3ARDA 1TQCC 5JR1L 4TUJB 4LRNH 5FO7A 3RQ3A 1G7LA 2BSTA 1BVLA 1XF1A 2A6JB 4RGMC 2H45A 4PJXE 3BRDA 2V7HA 1I1FB 1CICB 2A1WH 3BHBB 1FVEA 1P7KB 4WW1B 5E6ZA 1WFOA 2QSCL 3BEVB 4LLVA 2Z4QA 3RPIA 3F7YA 4ONGL 3KPSD 2R23A 5ESAB 4XI5D 5I66A 1YEDA 1CE6A 5T3XH 5JW3L 2JLLA 1RUAL 1JHTB 4AIXA 1FBIL 4Z0BH 5GISH 2FX8L 3WHE1 3VDAA 1BAFH 3ABZA 4X80H 2IFGA 4O9HH 3ULVD 1TZHB 1OD9A 3CGTA 4CW1A 1XGYH 3M17A 1G7IA 2P8LA 2VL5A 3IU4H 3HCVA 3OV6A 4TSBL 4I5BA 5D1QA 1JNHB 1T5WB 4CVWA 3G04B 4X5LA 2BVOA 5HBBA 3DSFH 5EU3B 2EEBA 3IKCB 5EBWB 4P59L 1AQKH 3GEWB 2OXHA 5GS0H 2VABA 3BKCH 3ZE2E 2PO6D 2ZUXA 4NZRH 3SDXB 3P0VL 1JJUA 5HHVL 3KPQA 2VE6A 1NC2A 3AS3A 3ZT6A 4NPYB 2UV3A 5T1DH 3LVEA 4HIXH 2JCCF 1XF3B 4PGCA 5DI8B 2I26N 1P5VA 4JM2A 3DV4B 5C0DB 2N7BA 4I3SL 4AYFA 3MXVL 1NFDF 4PJ8D 3FQXA 3JXAA 5AG8A 1RFDH 3VI4F 2B1AL 5CBEA 2RFXA 4GRWF 3OKKA 1CGUA 1FYTE 5DMKB 1FLTX 2EH7H 3MRNA 1XIWA 3SGJC 3SJVD 1UB6B 5F1NB 4LAJH 1XGQB 3BVNB 3O45B 5CILH 1N8ZB 4NRZB 4JKPL 4OZGA 1QBBA 4KPHH 3VRIA 4I18B 3AAZA 3ALPA 2NYYC 4HHAA 4GQPH 2J8HA 5DUPH 1I8LC 1B88A 4DK3A 3RVTC 2AJ3B 3MRMA 3V0VB 1HYSD 3DETD 3IVKB 4JFYB 1T21B 3FB6A 5T1KB 2W60B 5I1IH 4U1NB 4JFDE 1A5FL 3JV4B 5EIQA 3RNKB 1QLRB 1LO5B 1IC7H 3QI9D 4YEEA 1IGYA 4D2NA 4Z7UB 1UM5L 4TUOA 1UJTA 4WW2A 5E6IC 3MLZL 4JHAH 4N8CH 3UYPA 4LASL 4AENB 5IR1A 1KCKA 1P53A 3HFML 4JZNB 4I2XB 2XQBL 2QQQA 4KVCH 4Z9KB 2ZUQB 3HI1A 4IRZL 5FHAH 2F53E 5MEOA 1MJUL 1QRNE 1INQA 1I4FA 1QLFB 3I6KB 4QXTA 5DA4A 5DUBB 4G7YH 3T2NL 4WNQB 3FFDA 3E2HB 2FB4L 4FQJL 1TNNA 2NY6C 2F54A 4OZFH 3BGMA 3OTTA 3WJLA 1MF2L 2EDEA 3HHRB 1BGXL 3RNQA 4JY4B 1WIOA 5GS2D 5I15L 2EYSB 1FYTD 3IRPX 3BE1H 3I3DA 5ITBL 1DN0B 3IS1X 1DZBA 2ILLA 1JHKL 5FKAB 3MUGB 1ZHNB 1J0YA 3O3EB 1QYGH 1J0HA 1RULH 4TVPE 3ZDZF 3IDMA 1JGDA 1A1OA 4PJGF 1FN4B 3SDCC 5E2VL 1WWCA 2A6IB 4LIQE 4I3RL 3FQWA 5KVMC 1UCTA 4HC1H 4NM4L 1V7NL 1FQ9C 2VDQH 3CXHJ 5C2BH 4ZUSA 2FEDC 1I9JL 4LHUA 3U4EB 3QDGD 3FO2B 2W0KA 4NKDA 3CH8A 4JFDD 2MQCA 4GMSL 5HHMB 4OIBA 1Z9OA 4X4MA 4LCIL 3P9LA 1T2JA 3HC0B 3JV6A 1JWSA 4KDTA 1D5BB 2VLJA 3QEQA 5H37G 3EHBD 1A14L 2NTSP 5BVJB 5JW4R 1G7HB 4PY7A 2PO6B 3OKMB 3TLRA 3GM0A 1MHPL 3Q6FA 5I1JL 4NP4L 4U0RB 5EUOB 1FCCA 5JW4Q 5IEKB 1U95A 4AM0B 4FFZH 4OKVA 1WT5A 5LAXA 3BZEB 5F88B 2PTTA 3BT2L 4X5XB 5I2IB 3QRFM 5K59E 4PJ8B 4XPAL 1MHHA 3ZHDA 1ZLWK 3U82B 3BP5B 3HG1E 3EYOB 1ZHKA 3K8LA 4YHYB 3QB7C 4NQED 4XAKE 4M4RA 1MFAH 1E4XI 2ITCA 4OD3H 3WXVL 2YRPA 4LGRB 5I1DA 1AD0A 1JPGA 4HX1B 5GSRA 5L2KE 4HUUA 4ZPVA 3C60C 1FNEA 3SJVB 1KCRL 2X9WA 5FYKE 3JWOH 3AMLA 4WI5A 3DX8B 3VFWA 2ZCLH 3LIZH 1NAML 4I77L 1DBML 5M95B 3OXSA 2FRGP 3VGDA 4QO1A 3GSWA 2AABH 4LPYA 1E28B 4HUXA 4HS8H 2X4PB 4JO2L 3TA3C 3BWAA 3QXDB 4OF3A 2IEPA 1MCLA 2VWEE 4JQIL 5IB2A 4D3CH 4M7LH 4EN3C 5C0NC 2W59A 4XNYL 2LU3A 1KPRA 4LKCA 3TP4A 1AI1H 3RI5K 1WZ1L 3F8UB 3X12A 4MQSB 4WDIA 3QI9B 1HXMA 4ODXA 4PJHA 4TTDD 5E7FA 4PJDE 4EQ3A 1DLFH 1ZMYA 4PUBL 4RMRA 2EDNA 4M93C 2R2EB 3WJJC 3ZL4H 1B9ZA 1BVKB 3FRPG 5E00B 1QSFD 1FNSH 1JTTA 4U1JB 3QUYB 4I9WD 1CFSA 1BZQK 4FA8A 3U9PL 3ZLQC 2IPUK 2LTQC 4U6VL 5H94B 5ISZA 2VLRA 3D3VD 4YEFA 2HVJA 1KC5H 5CIPB 3RUGF 2FJFA 3D85A 4JJ5B 2HJLB 3B83A 1EMTH 3QJFB 1UT9A 4MD5A 5E70A 3GMOA 1IKFL 3S34H 3UO1L 3FT2A 2YPLE 5JIPA 4Q58C 2LV4A 5KN5A 4XAKD 2YRZA 4A6YL 4U1GC 3S35X 2GSGA 1OSZB 1FYTB 5GRXG 5L2KD 3UJTH 3LS4H 3QHFH 4LBEA 5F7NC 3BH9B 1CZ8L 1HSBA 1UA6H 4I4WB 1KBGL 1KJ3L 1OAUH 3G6JA 1PX4A 2YD4A 2KH2B 4Y8AA 4NT6A 5GPRA 4HK0A 4DCQB 1T6WA 2PTUA 1KTRL 4PRPD 5LGHH 4N0RA 1LQSR 3DX9B 2NY0D 3QYCA 4U1SA 2HA1A 4QLRA 4XBPB 3E6FA 5HDBF 1LDPL 4BZ1L 5D9SA 3FO0L 4UIKH 3EBAA 3SY0A 5GGTA 3TBVB 3L5JA 4JFDB 1BF8A 1RK0A 1I9RL 4EIGB 2YD1A 1NCCH 2AEPH 5T33L 4NNXA 5DVNA 3EKCA 4ETYA 4ZOAA 1S7UA 3BP4B 1QFWL 4FQIH 1U8NB 3CFCH 4N0UE 4K3DH 4KKAC 3LKPA 3C6LC 5IVXF 3SE3C 1MCWM 1I3RB 3RI5F 3U0TB 1LO3H 3E3QC 1UKTA 2F53B 4PJEE 5F89A 1QRNB 3QUXD 4L9DA 2A83A 2YS4A 4I48A 3X3GH 1X6NA 2IQAB 5L88H 5JPMB 4NGHH 2HFFB 2OR7A 3C8DA 4BZ2H 2N56A 4ZPTA 4YDLC 4HWEL 2EKSB 1F4AA 2FH8A 4Z7OF 1EO5A 1NBVH 3KJ6H 3EYSH 4MD4B 1NL0H 1C16B 2JELH 2Y6SD 5F7EH 3CFJB 1V3MA 3MLPA 3EFFB 1MRDL 3MXWL 4NKMB 1P9MC 5E2WL 3UBXG 4QXGH 4G80B 4E5XA 1FDLL 2GJ6D 3MRRA 5I19L 3OXRB 4U1MA 1MJ7L 5BXFA 2C1OB 2V2XA 4YDKH 1PVHA 5I8CA 2H41A 4G8IB 4Y4FD 1VA9A 5AUMB 3VWJC 3S5LB 1VEMA 3QIUD 2XN9E 5FGBA 1NLBH 2C3HA 2IMNA 2AK4E 5IHUL 4I1NB 1AY1H 2AXGB 1K3IA 3H9SE 1YMMD 5B39G 4TQEL 5CINH 2J4WL 2GSIA 1ORQB 5IP4A 3ZTNL 4ODWB 4X7CC 2ESVE 1EK3A 2VAJA 3QA3B 3D1MC 2QL1A 3HUJA 3MACH 4EXPX 3GUTB 4NKOA 3RWGA 3NN8A 1KTDB 5JQ6L 3WUWA 2Q3ZA 5C0FA 3QO1A 4HS3A 4XCFL 3EJYC 5DWUL 1ORSA 4RAVB 4GAGL 4N8VA 3QUMA 2XA8L 3CLFH 5DD0H 1A1NB 5JORB 1MY7A 2YD5A 2OTUB 2VZOA 2PYEA 3DGGB 3V4VH 2OI9B 4RMWA 4YGAB 4DN3H 3ARPA 4HFUH 3C60D 3HG1B 5D8JH 3P77B 4NO0B 1ONQA 3Q6GH 3RWEA 3MRDA 5DMGC 9CGTA 5IQ9B 4B0MM 4R0LA 3MX0A 4OKDA 1XT5A 4F57L 3VXTA 2WK2A 5L2KB 1PLGL 1P4LA 2YXMA 1F58L 5GRWA 1D9KA 4DGVL 1CFVL 3P30H 3ARBD 2WIIA 5J13C 5DR5H 1KB5B 4Q9QL 1G84A 3PV7A 1HHGB 2F8OA 1MREL 3QO0A 1WUNT 4NZTL 1AGEB 3B6SB 4WCYL 4XMLH 4RRPA 4FRWA 3FFCE 4FP8L 4POYA 1RZ8B 5DJZA 1U8KA 4U2YA 3R0MA 2P49B 4MJ5A 3LHPH 2XFXA 2EKJA 4LAQL 2EIZA 3D69B 2AK4D 5T3XE 4OBSA 5E08L 4M43H 1Y6KR 4NSKA 3RL1B 1WSST 1SJHB 3H9SD 4PJDB 5C08A 5FYLL 5IB5B 5C6TL 4GKSA 3PWJB 4YR6A 1GC1H 4FN0A 5CD5C 3CLEL 3WS6C 3SDAA 3TBTB 5IV2A 1N59B 5DEGB 4G8FB 1G9NL 2ESVD 3O2VH 1AGBB 3I50L 4KK5C 1ZLVH 3EAKA 1X5YA 3SDDD 4OCSL 4MNHB 4MXQC 2W0LA 5T3ZH 4CMHB 2NY4D 4LARL 3RZCB 3T0EA 5D71H 1O7VA 3VFSB 4UINL 1G1YA 2JB6A 1FJ1A 1C5DB 2HT3C 1G9NC 1U92A 4QCIB 2X10A 1ZHBA 2EYTA 3FZUC 2YPLB 2DQJH 4GG6A 5J1SC 2WAHA 1QSEE 1JCKA 3ARTA 3C8KB 3VH8B 1ULVA 3HR5B 1EHLL 4HW6A 4M8QB 1UZ8B 1ZGLM 5HDQH 1HKLH 3HRZA 4BJLA 5BS0D 1Q0XH 5KW9H 4B50A 1I9IL 1T22B 2YPVL 5HYSA 4Y4FB 3QZWB 3RHWK 5GGTH 5I76A 4G5ZL 3V5KB 1GSMA 4XP4H 3FFCD 1KCVH 3BZ4B 4GLRH 2IALA 3JV0A 2ADJB 1JPSH 2GW5A 4UOJA 1KT2A 4JM4H 4ZO6A 5FYJL 5JO5B 1N5YL 3L3IB 2ZUUA 5HI5C 1LK3L 1MJ8H 4WO4D 3FAWA 4TVSa 1KIRB 3T0AA 2HTLC 1RZFL 3CXHK 1PSKL 5EORL 2OLDA 5I74B 4N0UB 3KAAA 1BIIA 1ACZA 3TBWB 3WN5A 4KRPC 1JL8A 2MTPA 1CXIA 3DX6B 4U1KA 2GYSA 4XC1L 4PJEB 4HMCA 3CVIL 4KAQL 4U1IB 5BJTA 2CO6B 2CMRH 4HIHA 5ITFA 1KIQA 4NZJA 4M9OA 3NABH 2QTEA 1HH9B 3GIZH 5IFJA 1CG9B 1R3KA 1VCAA 4KFZC 3BDXA 4OLEA 3HE6D 5DMJB 5EIIA 5E9DA 4X7TA 4PIRF 4E41E 4LLQA 3EOBB 3LB6D 5LVEA 4JFEA 2D7QA 3B3IA 4PJFA 4JZOB 3ARBB 1OGAA 3LSOB 5C0JA 1UEYA 1GGBH 2G75A 4JO1L 1NMCB 1AFVL 3HZKA 4WJ5B 5C0AD 1XGPA 1DUZB 3K80A 3UPCA 3SCMA 2P42B 1RY7B 5E2TH 3SKUD 2ORBH 1TFHA 4KHXL 5J3HC 4HIJB 1EEZB 3HC4L 4Y4KD 3O3BB 5TF0A 2WMPA 2XN9B 1OSPH 3KDMA 1OQXA 4MS8D 5CZVH 3INUL 2AK4B 4PS4L 2DQHH 4M03A 5I8EB 3SDXF 2VXTL 4F9PA 1Z3GH 5KG9A 3H9SB 3P40A 3RHWF 5D6DA 1C12A 2QSCH 4C56A 1IBGL 3GB7A 4Z5RB 3O9WB 1KCSL 3EJYD 4BH7A 1FG2A 4L4TA 1NGWA 4ONGH 2EC8A 3NZ8B 2V5TA 2ESVB 2IMMA 5BMFL 1JZ6A 5C6WH 5JW3H 3BD5A 4WHTB 1JUFA 2VJXA 5CS7A 3TA3A 2NY4B 2V2TB 3MNZB 1BOYA 1KLGA 3IJYB 1T5XB 4LCCB 2PXYD 3PGCB 3W5MA 3W82A 3IDUA 3OF6A 2R0KH 3HLAB 4OD1H 4FNLL 2IADA 2OP4L 1OT1A 1IGFL 3R06B 4TSBH 2HJKA 4DZ8B 2NY1C 3WJJA 3H3PL 3KYMB 3C08L 5D7JA 4KY1L 1WWWX 1J8KA 2Z31C 4M6MH 4P46D 5FECA 4YDVA 5DJ2B 3P0VH 3I2CL 1JMXA 5F7WC 5HHVH 4X6FB 1H3TA 2HG5B 1UWXH 5BS0B 1EVTC 1F11A 3OX8A 2X1OA 1QACA 4KXZH 3MGOB 5CJXC 3NCYP 4PJBA 3F7VA 4N1EA 3WLBA 1EFXA 2OS7A 3B9EA 3CZJA 3OAUH 5TDPB 2M2DA 3VXOA 1YEKL 3FFCB 1DLHA 4I3SH 3GMRA 2E27H 2BVQB 3MXVH 3X3FL 3WO3B 3G5XA 5CD5D 1CDBA 1LP9A 5L6YL 1R3LB 3C9NB 4ZYKA 5GHWL 3LD8B 4WO4B 2NR6C 1OTTD 5DRZA 1MCDA 1NCUA 3UYRL 1MQ8A 4X7DC 2UY7A 3GSQA 3O81A 3QXVA 5D7SL 4OLUL 5FYLD 4BZYA 4HWUA 1IC1A 3CPLA 4OBRA 5I8OH 1UH4A 1UXSA 1U3HC 4JKPH 1MHEA 2KBGA 3KNBA 1GHFL 2VAAA 1NH6A 1XCQA 4L8SC 5JOPD 4NQVB 3RTQC 1BF2A 2AVGA 5HHXL 4WEMB 1Q9KB 3CD4A 3H9YA 2X6MA 2FJHB 1A4KA 4RGNE 5GGSB 3R8BB 3WSQH 4J1UB 1KEMH 1MPAL 1NGYB 1UCBH 2AXHA 3K74B 1C8PA 4DJMA 1MAJA 5IKCA 3D5OF 1D6EA 3VXQA 4PJAF 4MLIA 1U8JA 2MPAL 3ARDD 3QWOB 4JGMA 3HE6B 3DURA 3MGAA 3C6LA 3SE3A 4X7EC 4CKVX 3LV3B 2Z93B 4LASH 1RI8A 2XT1B 1K3ZA 2XQBH 4GKNB 4LSSL 5BZWA 5JNYA 3MQIA 3NCMA 2MCG1 4XPFH 2HVKA 1S7XA 2KQNA 3D39A 4XPHL 5IMKB 2Y7QA 2OTWA 4JFZH 4TNWK 1UVQA 3WNLA 2X44D 2JJSC 3EYFB 3VXUA 4NZUL 3QNZB 3ALWA 4OZGE 3LEYL 4LOUD 1HDMB 3WHXA 2V5RA 5C9JB 1BGXH 5A2KH 1IGTA 1OHQA 1NGQL 4Y16A 5EO1A 1U8OA 3QXAB 1K85A 5EZLB 1A6ZB 1QNZL 3H7BA 1CT8B 4F33A 4R26H 2QSVA 3HS0A 1JHKH 5ANMA 5F7DB 2IH3A 5JPNA 3IJHB 2C3GA 1KJMB 5D1QD 4F7PA 3PWPA 5H2BB 2WUBL 4NYLB 1YMHB 5IB1B 4PJXF 4G6FD 4F7TA 2PXYB 3T0WA 1ZWIB 1NCDL 4LQFL 1A6PA 1S5IL 5E5MB 1F90L 5CJOL 5D93C 3TNMA 3TNNB 1NC2D 3AY4A 3JBG7 1VB9A 3WFZA 1FYHB 1YC7A 3GBML 3TV3L 2XQYG 1PY4A 3FJTA 4WV1C 4Z7VA 5DURB 4LCIH 4PB0H 3CMOH 4CVUA 5IW6B 3SPVB 2VLLA 1AD9A 2F54E 4E41B 1X3DA 2E9JA 1QA9A 2YD8A 2GT9B 5J3HD 1QSVA 3KPLB 3O6FD 3MOQA 5IEHA 1CLCA 5IUSA 3L9RB 4C83A 1EXUA 2H1PH 4OZFB 4QRSA 4FG6C 2ENYA 3PGDA 4YC2B 3IDIA 1C5BL 1XIWD 4G9FD 1I7ZA 3BPNC 2GCYB 2VUOA 5BVPH 5DD6B 1GVIA 4NKIH 1VHPA 1ZS8B 1GZQA 2AJXL 3WXVH 3GMLA 1HKFA 4ZUUA 1NUDA 1XAUA 4ZFZB 3Q3GA 2XZAL 4PG9B 5KSAC 3LS5L 4TNWF 1WWAX 4ODUA 3MPCA 2I9LB 3O2WL 4UQ3B 3PF2A 2SEBA 3X11A 1KTLA 3OSKA 4X4ME 3RWJB 3PV6A 1DUYB 1YEEH 3H9ZA 1N2RA 2VLJE 3RL2A 3QEQE 3TVMB 2Y36L 4NQXA 1MAML 1X5HA 5F3HB 2XPGB 5KANG 4ENEC 4JG1H 3VFRA 3U30C 4KI5E 4OD2A 1MCKA 3LRGA 3RWCB 4JY6B 4K3EL 5CKGA 2A6DA 5IROC 3PGFL 4WFHE 5HI3D 3HNSL 3TIDB 1RD6A 4OGXL 4OM1H 1LE5A 3ARZA 3ARGC 2AERT 5FO7B 4NDMA 5EC1A 5A2JH 2QHRL 1G7LB 2D7TH 4XAWL 2BSTB 1GOHA 4XPTL 1BVLB 1A47A 2F54D 5CSZA 3GSVA 3U79A 1BZ7A 1J87A 4OGAC 2W9EH 1D5IH 2V7HB 3CFEA 4JPIA 3U9PH 25C8H 3QG7L 4HKJA 2E8ZA 1FVEB 4KROB 3U4AA 5TDOA 3KHQA 2B5IC 3RPIB 4LLVB 2Z4QB 3F7YB 1NANH 2R23B 4YK4C 1JF6A 5I66B 1YEDB 3NIDF 1CE6B 1W72L 5I1AA 3UO1H 3GNML 1QFHA 1QBAA 3VXSA 4NHCH 1JGVH 3MRPA 1OAQH 4CW1B 4NWUH 4U3CA 3M17B 2ADFL 1G7IB 4LHUD 3LMJH 2P8LB 2VL5B 4OLYL 3HCVB 3IGAA 4IOSD 4W68A 4I5BB 4PJHE 2PN5A 2AXFA 5C86A 2BVOB 1CFNA 4OLZL 3ZYIA 3S5LG 3K4AA 2VLJD 1AH1A 1JVKA 2R1WA 2VABB 3UJJH 3RP1A 3KPNA 5A2IH 3GKWL 4I0PD 5DLML 1LDPH 2IH1A 3GKZA 4BZ1H 3KPQB 2VE6B 4RGNB 1J8HA 4HCRA 1VESA 1WLHA 2DIAA 5ISZE 4JM2B 3RVXD 3KLHD 5T33H 2VLKA 4NOFA 4O4YL 4JRWA 3WNOA 5TE4H 3HE7C 3FQXB 5FHBL 1IQWL 2BNQA 1DANT 1CE1L 2JCCA 3RVVC 1IC5L 4HLZG 2Y06H 3KGRA 4L5FL 5IWLC 3RRQA 1KCLA 5CBEB 1UWEH 2RFXB 3OKKB 1NFDA 3SGDI 3TH2T 1OAKL 3EYQD 1XIWB 3MRNB 1YUHA 4JPVL 1S7QA 3G6JE 1TETH 4JFFA 3W11C 3GI8L 3AREC 4OZGB 3VRIB 2UUDH 3AAZB 2FWOA 1ND0A 4HWEH 5B3JE 5I9QC 3BPOC 4HHAB 2UZXB 2DMCA 2X4SA 3IF1A 3FCTA 5EO0A 1XGRA 3OG4B 3DRTA 3MRMB 2MQ3A 3TJHC 3DXAD 4RMUA 3FB6B 5DZNA 1OB1A 1MRDH 4PR5A 2DKUA 1T1WB 3NGBC 4L1HA 3PNWA 5E2WH 3CVHA 4YHLH 3RAJL 1IGYB 4PRAA 4XNXL 4TUOB 4PP1C 3GIVA 4M6NH 4WW2B 1INEL 1ADQA 4ZFOB 4LPWA 3B9DA 1A4JB 5IR1B 2FO1A 1H0DA 3BD4A 3BQUC 3NFNA 4L4JA 3EOYG 4RWYL 2V5MA 3S7GA 2IAMA 4HZAA 5EDXA 3HI1B 5DK2A 5IHUH 4PGZA 5MEOB 1CDJA 3K7UA 4L4VA 1INQB 1I4FB 2VLRD 1KIPA 4QXTB 3GO1L 1QFUL 1BJ8A 2A0LC 3D85D 1RZ7H 3QUZC 3FFDB 5E4IA 4O5LL 5CBAA 4Q2ZA 1MIEL 2F54B 4Q7DA 3BGMB 5LGJA 3LKQB 4KRNA 4MQXC 5IBLC 3HMXA 4UT7L 3RNQB 4B41A 4NO3B 2B39A 4M4PA 1TTUA 5JQ6H 1HHIA 3MV7A 4XC3L 4WHYG 5K9KA 2XYCA 1F02I 4J2XA 4GAGH 3U48A 4JHWL 5TGBA 5E1HB 1FO0A 2EIEA 1X44A 2ZPKL 1MWAA 4P4KD 4LF3A 3IDMB 1JGDB 4LPVA 5INDA 1A1OB 5IJKC 3MZTA 2OMNA 4Y1AD 2Z31A 4F7EA 3FQWB 5SWSA 3VH8G 2XRAH 2FD6L 4ZUSB 4PLNC 5KSVA 4PJGA 5CJXA 4XP1L 4NKDB 4U4BA 1AC6A 2BMKA 3MBED 4DGVH 1CFVH 4Q9QH 5HHOA 3QZWG 5CLTA 3P9LB 3JV6B 1JWSB 3KS0J 2VLJB 3C6SA 3EJZC 3QEQB 4EQ2A 5TDNA 4PY7B 1OAYH 1CTNA 5I8KL 1D6VH 3BO8A 3ULUL 2FCBA 1YQ2A 1VFOA 3Q6FB 3IDNA 2NXYC 4LAQH 3B5GA 3H2WA 1U93A 5I1CH 2J1KA 4GSDL 4KV5E 5T1MA 2I24N 5IB3A 1U95B 5E1AA 1AKJD 4OKVB 5LAXB 5GRVK 4P2OD 3MROA 2PTTB 1UYWL 5L0QC 1T04A 2EDJA 1U3HA 3CSPA 1A0QL 5GGRA 2PYEE 5C6TH 3ULUC 1F3JA 2HYMA 1MHHB 1ZHKB 1WJ3A 3CFIC 4L8SA 4HULB 2DM4A 2J5LB 3RTQA 3ARUA 4M1GL 1G9NH 4CGTA 1KENH 2ITCB 5IGXL 3IJSA 1KEGL 4KRMB 5I1DB 1AD0B 1JPGB 1S9YA 1XCTA 5GSRB 4HUUB 4ZPVB 5I16A 1GL4B 4EI5C 3MLRL 1FNEB 2FIRT 3SGDH 4LARH 3WKNA 1OWWA 4YE4L 1U3JA 2WV3A 4YBQD 4XVTL 2O5YH 3V0WH 3I6LE 5ALCH 3C5ZA 3NTCL 1ED3B 3VFWB 2E7LA 5CEZE 5DJ8A 1A8JH 2XTJE 3LPFA 1LHZA 1N6QL 4KQ4L 4XRCA 3SKJL 5KZCB 5E03A 1I85A