4HKZH

Trastuzumab fab complexed with protein l and protein a fragments
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
b'GSYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4hkzH00
4KJMA 2B87A 1BDCA 4HJGH 1SS1A 2ZAEB 2KZJA 3FXDA 4HKZH 1Y47A 2QVAA 4NPEA 2M5AA 2P58A 2LXBA 1OVUA 1EDKA 2R44A 2KZIA 5CBOA 3FXEA 3QWOC 1LP1B 1NVOA 2LR2A 2OTKE 1MFTA 5EFWB 2K3RA 5DJUB 4JBZA 1FC2C 3MZWB 1U7JA 4ASWA 1X0TA 4K3AA 5DJTB 1EC5A 3MHVA 2KIKA 1LP1A 2KUBA 1EDLA 4K35A 1EDJA 1LT1A 2B88A 5K5GB 4ZNCA 1EDIA 5C39A 4IOIH 1OVVA 4WWIA 2WMMA 1DEEG 2QRXA 1JMBA 4BXLA 4HB1A 4CPGA 3S1KA 1U7MA 2LXCB 1JM0A 2UWJE 2B89A 3ZDMA 1BDDA 2KS1B 1ZXGA 4NPDA 5CBNA 1H0TB 2HR3A 4ZMDA 2JWDA 2RKLA 2M0BA 4NPFX 4GOEA 4EYYQ 2B87B 3PH0A 1S3JA 2I8DA 4MN4C 1OVRA 2Q1KA 4GOFA 2SPZA 4GODA 4ASVA 3RGUA 2KI7B 2M5AB 1H0TA 1Q2NA 1ZW0A
chains in the Genus database with same CATH superfamily
1VQ7P 3NXSA 2QJKB 2FFDC 5M1BA 1SS1A 2N1TC 1N7SD 3KYQA 5KLVG 2A06E 1JCDA 1Y47A 4BWNA 1HTLC 2M5AA 2IZ1A 4WB4A 1VQKP 2LXBA 1S9KD 2E74B 5KAIH 2O1JA 2YXQB 2QJKC 2WSEH 2AEFA 2FYNB 5GTHH 2D2CD 2YMYA 5CCGA 3A0HE 5B5EH 3KDPB 3M0DA 1AA0A 2ITAA 2W27A 3PLNA 1NU1K 1P84E 1HGZA 1SQPE 1QLED 3L4FA 3E1RA 1LTIC 2FYNC 2G8YA 4ZNCA 1L0NE 3HUSB 2HPCB 1PZQA 1IK9A 5E79H 5CJ4A 2BCCJ 1U7MA 5CJ0A 3OW2O 1U57A 3FGAD 1FU1A 1SQVD 4YXDC 1FZAA 2BEQD 3VP9A 1YJWP 3QH9A 2K1AA 1SQQE 2GM4A 4EYYQ 3LW5H 3VYIA 3HUSC 1L0LD 3RL0C 1FDMA 1SQBK 2W83C 1SQXK 2M5AB 1H0TA 5APYA 1S5LH 1JY3O 3AEAC 3HRNA 3KXDA 2B87A 1LTAC 3MUDA 1PGOA 3MIWA 5AW0B 5AVXB 1NAFA 1PGJA 3FXEA 3CD6P 3CWBE 1ZR2A 2OTKE 1PGQA 2E76B 1BGYE 3HD7A 1PP9E 4D6TD 3D71A 2OTJP 5TISH 3W68A 1Z56A 1GTWA 3OJAB 1DH3A 4H13C 5CCGC 2ZYGA 3M0DC 4M3LA 1LTBC 5KJ7A 1QL2A 1RF1C 1P84D 3L71G 2NZ2A 2E76C 5AVZB 3WU2H 3CCVP 1JMBA 1RF0A 3CXHE 1VQOP 1J2JB 4RO0A 3TK1A 1KILA 1ZV8A 1NGMB 3P8CE 1FJPA 1H0TB 2QG4A 1EZVE 2ZVOB 1KB9H 1OMIA 4EOTA 4TT3H 2W90A 2B87B 1GW4A 2I8DA 1SQQD 2XNDH 2AEJA 1LJ2A 1Q86Q 1FZEA 1RHZB 3PHLA 2IBZD 3HTKA 1YBKA 1OXZA 2IFMA 3W67A 2N1TD 1NU1E 3RK2B 4HKZH 3L75J 1LTJA 2QJYB 3MUDC 2P58A 2R44A 1ZMEC 2IYPA 1KQLA 4C46A 2ZT9C 5AW7B 1KZUB 3G3ZA 3CWBD 1K9MQ 1PP9D 1M7LA 3M9BA 1NOHA 2Z5HA 4PD4I 1X9VA 2QJYC 4OH8B 4IL6E 2PFXA 1KILB 1R8EA 4GT1A 3L72D 3JCUH 1SQBE 1SQXE 3OA7A 1KD1Q 4O9BA 1RF0C 1L0LJ 3CXHD 3BRTB 3H1KE 3MTUE 2WITA 2YMKA 5CBNA 2Q9IA 2MJZA 4W7YA 4ZMDA 3HTKB 1KILC 1PIXA 1K8AQ 1GL2C 3P8CD 2FYZA 1HBWA 2W8ZA 1EZVD 5BVZA 1FZBA 2AEMA 1N86A 4I2LC 4PV1B 3RL0D 3C8VA 3L70E 1LTJB 3CCMP 4QMAA 3AE5C 2RH0A 2Q5UA 2XZRA 4N78D 4ZKUA 5KAIE 1L2PA 4NPEA 1NU1D 1Y8AA 1NTZG 4D6TJ 1EDKA 1KN7A 1LTJC 3VMAA 5B5EE 4EI2A 3RK3B 1T3UA 4XFJA 2O3JA 4R4LA 4LC1A 4H13D 2XDJA 3JC22 1ZP0C 2XU6A 4UB8H 2YNYA 3BATA 3FWLA 4DJGA 5E79E 3L74G 1EDJA 1OW6A 1XTCC 5AVWB 4YPCA 1L4AD 2KOGA 2IYOA 1BE3D 4TLFA 1UIXA 4U3FG 2P67A 2O01N 4H0LC 1KILE 1SQQJ 1JY3N 1KQFB 2RKLA 2M0BA 1AVYA 3H1KD 2HODA 1JY3P 4GOEA 2HFED 1LWUA 1YQ3C 5AVYB 3D6YA 1IFNA 4MN4C 3GF7A 1LTGC 1IFJA 3RGUA 3BCCG 3L70D 2YXRB 2KXPB 1YQ4C 2P2UA 2ZXXA 5AW2B 2YKQA 4OGQB 3CWBJ 5CCHA 5TISE 1L0NK 1UIIA 1PP9J 3AE4C 1WRGA 5EFWB 1Q90D 2ZT9D 1S2EA 2H7HA 1JOCA 1VQMP 3V2QA 3VMZA 3B71A 1VDFA 1KQGB 4OGQC 5KLIB 1IFDA 3WU2E 3RK3E 3PRJA 5AW1B 1LT1A 1SQVG 3AEGC 3BCCE 3AE6C 2HODB 3Q3DA 4WWIA 1YITP 1BCCE 1KB9E 5KLIC 1L0LG 1JM0A 2QSIA 2JWAA 4DOJA 4RKUJ 3AE7C 4BRYA 3TF5A 4NPDA 1NTMD 3G4SP 1KILD 3L73E 3H1LE 4NPFX 1GL2D 5BU8B 1J1DC 2P1JA 3USSA 1DX7A 2QA4P 4JF7A 3SFDC 2Q1KA 2WSFH 1N73A 3L35A 1T2KD 5H2FH 3VMYA 3V2NA 2BASA 1NU1J 2PGDA 4RESB 1K05A 3I5CA 4D6TG 3PTZA 1KYOH 2P10A 3MD0A 1R5LA 3H1ID 3MGNA 1IO4A 1YIJP 1NTKG 1M8OB 5CCHC 3QWOC 2LR2A 1LT9A 1PPJE 2Q3IA 1N7LA 1U7JA 3TSIA 3NMDA 3JCUE 3H1HE 1BE3J 3R2PA 1ZLLA 4PD4H 2W6BA 1SQXJ 1PV3A 4BRYB 3L75D 2N9BA 1LNQA 3B8EB 1AQTA 2QIWA 1HJ0A 4GIFA 3H1KJ 5AVRB 1YHQP 1N73B 1BCCD 2IBZI 1KB9D 4H0LD 2RN0A 2E74C 1QX8A 3H25A 2IBZG 1IC2A 3L70J 1QVFO 3H1LD 3M9HA 5B66H 4JYCA 1E79H 3V2PA 1JEKA 4I6MC 2OYIA 1E5WA 1X8YA 1N73C 5KLVE 3TGUG 3CX5I 4KJMA 5KKZB 1BDCA 3SWKA 4Y28J 1LT9B 2IPPA 2QJPB 1G2CA 3FWNA 3B4SA 2FYUG 4B86A 1RQVA 1FBMA 3N4XA 1Q82Q 2O01H 4UB8E 1HWTC 1NKNA 1KTMA 3F5HA 2KB7P 5AW3B 4ASWA 2QJPC 3L72G 2HYNA 4YXWH 1EC5A 1VL2A 2A06D 5AVVB 1N8RQ 1EDLA 4GKGA 2R5BA 3CCQP 3BASA 3VN0A 1VQPP 1EDIA 2Q7CA 3U59A 1NTMJ 1DEEG 1USEA 4JQ0D 2QE7H 2I1KA 3VMXA 1SVFA 1BDDA 3VTPC 3HE4A 3KPEA 1ZXGA 2OYIB 3EFGA 2RMZA 2NPSA 1HGVA 4OWFA 1FS0E 2GUSA 1MKMA 3AEEC 1SQPD 1H88A 2QM7A 1S3JA 1S72P 1JB0J 3AEDC 1L0ND 1G2CB 1FOSF 3SWFA 1VPCA 3H1JG 3KQGA 1VF5B 2OYIC 2V4HA 3H1IJ 3HE5A 1FZGA 1JTHA 3SWYA 1GU5A 5BU5A 4IFDK 1QEXA 1VF5C 5CCHD 1SFCD 3Q5SA 1NVOA 3R4YA 3P7KA 1OW8A 1KYOI 1NH4A 1YTZI 3B5NA 3TNUA 1NTZK 1NYHA 3HD7B 1QL1A 5GTIH 3L71E 1OFCX 1BE3G 1A02F 1M56D 2WWWA 1NWQA 2L5GB 3HE4B 1BCCJ 2NPSB 2KSJA 3SSUA 1X22A 3WUTA 1BGYD 3HD7C 3RK2C 3S1KA 5APVA 2C9LY 3H1LJ 3TYYA 2E74D 1AQ5A 4L75A 1N7SA 2HR3A 2JWDA 3I55P 5KJ7C 2KYVA 5H2FE 3KZIH 3HE5B 3AE3C 1NJIQ 1GK6A 2BCCG 3G71P 3V4QA 5APXA 1JTHB 1M1JA 2KS1A 4PJ0H 3CCRP 2HLOA 1ZOYC 2KK7A 5AVSB 1OW7A 3B5NB 1ZRTE 2M8RA 1OWAA 3AECC 3TNUB 1RY3A 1G1IA 1YTZT 3Q5PA 1EXIA 1T8ZA 2BEZF 1H8AA 1FDOA 3Q5RA 1K73Q 3NFQA 4PD4E 1M1KQ 4PV1C 5KTBA 2AXCA 3MHVA 5GTHE 1J1EB 3P8MC 2Y0DA 2ZJSE 1Q7YQ 2A45I 2E5YA 2XV5A 3IAOA 1N7SB 1NTMG 2B88A 2WMMA 2A45G 2WSCJ 4BXLA 3CL3D 2LXCB 3SFEC 5CCGD 1SQPJ 2UWJE 2B89A 1M1JB 2KS1B 5B66E 1J1EC 1SQVK 1L0NJ 2CPBA 2K88A 2W6JH 3E1IA 3RK3C 1QVGO 2H88C 2E76D 2JKVA 3PH0A 1ZN5A 2E5TA 1L0LK 1HUCA 2YKPA 2Y0CA 3II6A 2W6AA 3A7OA 4GOFA 1SQBD 2M3BA 1FOSE 4C7NA 1SQXD 1M1JC 1Q2NA 3H1IG 4DCKA 3IN6A 1NTZE 3H32A 3CMEP 3VP8A 2P7JA 4I7ZB 3CX5H 1S5LE 2KSEA 3IFMA 4JYBA 3CI9A 2QVAA 1ZRTD 2PP6A 1VF5D 1NKZB 1WT6A 1T6AA 5DJUB 2V7QH 3BVHA 1FC2C 2I1JA 5AVTB 1URQA 3L75G 3L74E 1NTKK 1MFZA 1BGYJ 2JR8A 1RH5B 4U3FE 5KLVK 1VQ8P 4IOIH 3HD7D 1RQUA 3RK2D 2AXTH 4HB1A 3A3YB 2YO2A 5AW9B 4I1LA 4WBAA 3V5BA 4C7NB 4LGDE 1VQ5P 1AV1A 5KJ7D 3O8ZA 1W5CE 2C0XA 3H32B 3C9IA 4OVNF 2ZFCA 1OVRA 1LWUB 1GD2E 4A7PA 3WUVA 4Z1MH 5CBOA 1KFNA 2WT7A 1OX3A 3WUUA 1PFIA 4HH2A 1NTZD 3JSVC 2KZJA 3CCUP 1NAYA 1URQB 1LWUC 1LGHB 3CCLP 2IFNA 1OZHA 1CSBA 3U1AA 4WVZA 2A06G 1DEBA 2Y9YA 2YO3A 1R5SA 3MP7B 2N9YB 3UIAA 4W7ZA 2FXMA 4IFMA 2FYUK 3A2AA 3G9RA 3GHGA 1URQC 1LTSC 4PV1D 1VQ4P 1RE4A 1SQVE 1JO5A 2WPQA 1JY2N 2ZXEB 3CLQA 2KLUA 1P84I 1HVVA 3RBXA 1FZCA 1L0LE 1FJKA 1SQPG 4CPGA 1AFOA 3KZIE 1KV4A 1LTTC 4UB6H 1L0NG 4RJTA 3RBZA 1SQBJ 3RK3D 1CI6A 4DZOA 4PJ0E 2WT7B 2K37A 4Y99B 5AVUB 3BCCD 2Z5IA 1SQQG 2KI7B 3RL0g 4D6TE 2WVRA 3U1CA 5APSA 3CC7P 2VRSA 1NTKE 4Y99C 3FXDA 3M91A 3L73D 1JCCA 2ZYDA 3GHGB 1RF1A 1SLQA 2KZIA 2K9YA 3S9OA 2JP3A 1MFTA 1DIPA 1L4AA 4WY4A 2K3RA 2WSEJ 1FZCB 2WTYA 2OARA 2XNXA 3RL0B 1X0TA 3CWBG 2JO1A 1PGPA 1BGYG 4N6JA 3GHGC 2KIKA 1PP9G 2LKMA 1RE4C 2CK3H 3EFFK 3T97A 2PRRA 5KKZC 1IFPA 1EXJA 1LT9C 1CI6B 3AE8C 1FZCC 3EWKA 1OVVA 1PPJD 2A45H 2IBZE 3CPWO 4OGQD 2E43A 1GK4A 3A0BH 1KMIZ 3CXHI 2IDBA 1IFIA 1HJBA 3H1HD 2R32A 1S1CX 3PP5A 1EZVI 3TGUE 3LW5J 4H13B 3IR9A 1SP4A 1GW3A 1EZVG 2SPZA 4GODA 1EQ7A 3CX5E 1NTZJ 1RF1B 2FXOA 3Q2YA 3IF4A 2FYUE 2O01J 4HJGH 5AW8B 1JNMA 1L4AB 4WY4B 1XTGB 5APQA 2POHA 1M90Q 1DD3A 3BRVB 1NTKD 2FY8A 4LLHA 3CC4P 1OVUA 1YI2P 3LIDA 1NU1G 3L72E 2OYOA 3L74J 5KLVD 4JBZA 3T97B 1L4AC 4WY4C 3C1LA 1FE6A 1A02J 1MUUA 2B9BA 1WMKA 3G6EP 1URQD 4K3AA 4U3FJ 3P32A 2KUBA 2IZ0A 1GL2A 2AXTE 1VQNP 2WSSH 2WPSA 2Q3EA 1GDTA 1FDIA 4EIJA 3FX0A 3ZDMA 2OYHA 3ITKA 1W2BO 5KAFH 1SQBG 3BCCJ 4N78E 2ZT9B 2KNCA 1SQXG 1NTMK 1IJDB 3V6IA 3H6PA 3H1JE 1GZLA 3H1KG 1YYCA 4L76A 1PL5A 4EDFA 3TGUD 4H44B 5APWA 3L73J 1JY2O 1Y9BA 2PAJA 3CX5D 2Z4EA 3L70G 1USDA 1CW5A 2NPSC 2FYUD 2G3AA 5AW5B 1K04A 1BSNA 4GDOA 3Q1MA 3LIEA 2M3EA 4AUWA 2C9NY 1N2DC 4L73A 2FBWC 2Q6QA 4H44C 3M9QA 3D6ZA 3V4WA 1DD4A 4W80A 1KYOE 1GL2B 1BE3E 2R3SA 1RE3A 4DT0A 1SQVJ 2E75B 1YJ9P 3CCEP 1VQLP 2ZYAA 1NO4A 3GG2A 3AE9C 2K9JA 1LP1A 1IK7A 3L37A 4IFFA 4KHXA 4U7JA 2OYHB 3A0HH 3V2RA 2KNCB 4UB6E 2KP8A 3GMAA 4AQRD 1P84H 1TU3F 2E75C 5C39A 2WSCH 1AJYA 5CMZA 3H1HJ 4HYTB 2QRXA 5CHXA 3B5NC 3D70A 1T2KC 3TDKA 3L71D 4AYCA 2BCCE 2OYHC 2WPRA 4JPZB 4C7RA 3GLMA 5AW4B 2H89C 3H1JD 1YJNP 4ASVA 4IL6X 1D7MA 1GU4A 1MZ9A 1ZW0A 1NTKJ 1FZFA 1H89A 3AE2C 3N7NA 2D2CB 3S4RA 1N7SC 2DW3A 2H8PD 1IFMA 2HG5D 5L8RJ 5KLVJ 2OQQA 2Y0EA 4H0LB 3A5TA 2J59M 3OAKA 2K9JB 2NRGA 2YKOA 1LP1B 3GF3A 2O1KA 2JEEA 2XKMA 2D2CC 1KYOD 4WY4D 1RE3C 2JDIH 2Y9ZA 5DJTB 1G1JA 1NTME 1HH0A 4K35A 3L36A 1Q81Q 2L91A 3A0BE 1KC8Q 2E42A 4XA4A 3F89A 1AVOA 3O6QA 1IZNB 4I7ZC 2OTLP 3NTNA 1S4XA 1JUNA 1KORA 4PD4D 3K5BA 1KB9I 3CC2P 1MV8A 1BCCG 3TGUJ 1T3JA 2BCCD 3CXHH 1SQPK 1VQ9P 3EQ2A 2H43A 2WZ7A 5APTA 2FXPA 3H1IE 2WPVB 4R4MA 3CMAP 1SFCA 2GUVA 3L73G 3H1LG 4N3YB 5APUA 2FYUJ 1FAVA 1X79B 2FFDA 4KT0J 3I56P 2N1TA 3E7KA 1M57D 2V7QJ 2ZAEB 3GW6A 2GA1A 2NPSD 2WQYC 1VQ6P 1S9KE 1SQQK 3L72J 2YIUB 2R5DA 1ZR4A 3KHUA 2C0WA 3L75E 4H44D 2CPSA 1KQSO 1KFMA 1OIPA 2QEXP 1S5LX 2J5UA 3VOPA 1J1DB 1HF9A 3MZWB 3CCSP 3AEBC 3M06A 1W2EA 3O6QB 2OGUA 1QGKB 1GMJA 2YIUC 1PPJG 2FKWB 4XE5B 1CZQA 5GTIE 3WMM0 3AEFC 4L74A 3AE1C 3H1HG 2ZVNB 5KAFE 3L71J 2IX7C 5K5GB 5AW6B 2E75D 4YTPC 1NHLA 5AVQB 4IL6H 3B5ND 3ABVC 3L74D 1SFCB 2KLVA 3CCJP 3H1JJ 5TJHA 2FFDB 2QM8A 2JJLA 3PJSK 1JY2P 4ZKPA 3HUSA 2HPCA 2N1TB 4U3FD 1JMMA 1BSHA 2R3CA 2MKVA 2WSFJ 3M0AA 1SFCC 2J58A
chains in the Genus database with same CATH topology
4KJMA 2B87A 1BDCA 4HJGH 1SS1A 2ZAEB 2KZJA 3FXDA 4HKZH 1Y47A 2QVAA 4NPEA 2M5AA 2P58A 2LXBA 1OVUA 1EDKA 2R44A 2KZIA 5CBOA 3FXEA 3QWOC 1LP1B 1NVOA 2LR2A 2OTKE 1MFTA 5EFWB 2K3RA 5DJUB 4JBZA 1FC2C 3MZWB 1U7JA 4ASWA 1X0TA 4K3AA 5DJTB 1EC5A 3MHVA 2KIKA 1LP1A 2KUBA 1EDLA 4K35A 1EDJA 1LT1A 2B88A 5K5GB 4ZNCA 1EDIA 5C39A 4IOIH 1OVVA 4WWIA 2WMMA 1DEEG 2QRXA 1JMBA 4BXLA 4HB1A 4CPGA 3S1KA 1U7MA 2LXCB 1JM0A 2UWJE 2B89A 3ZDMA 1BDDA 2KS1B 1ZXGA 4NPDA 5CBNA 1H0TB 2HR3A 4ZMDA 2JWDA 2RKLA 2M0BA 4NPFX 4GOEA 4EYYQ 2B87B 3PH0A 1S3JA 2I8DA 4MN4C 1OVRA 2Q1KA 4GOFA 2SPZA 4GODA 4ASVA 3RGUA 2KI7B 2M5AB 1H0TA 1Q2NA 1ZW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJM A;  2B87 A;  1BDC A;  4HJG H;  1SS1 A;  2ZAE B;  2KZJ A;  3FXD A;  4HKZ H;  1Y47 A;  2QVA A;  4NPE A;  2M5A A;  2P58 A;  2LXB A;  1OVU A;  1EDK A;  2R44 A;  2KZI A;  5CBO A;  3FXE A;  3QWO C;  1LP1 B;  1NVO A;  2LR2 A;  2OTK E;  1MFT A;  5EFW B;  2K3R A;  5DJU B;  4JBZ A;  1FC2 C;  3MZW B;  1U7J A;  4ASW A;  1X0T A;  4K3A A;  5DJT B;  1EC5 A;  3MHV A;  2KIK A;  1LP1 A;  2KUB A;  1EDL A;  4K35 A;  1EDJ A;  1LT1 A;  2B88 A;  5K5G B;  4ZNC A;  1EDI A;  5C39 A;  4IOI H;  1OVV A;  4WWI A;  2WMM A;  1DEE G;  2QRX A;  1JMB A;  4BXL A;  4HB1 A;  4CPG A;  3S1K A;  1U7M A;  2LXC B;  1JM0 A;  2UWJ E;  2B89 A;  3ZDM A;  1BDD A;  2KS1 B;  1ZXG A;  4NPD A;  5CBN A;  1H0T B;  2HR3 A;  4ZMD A;  2JWD A;  2RKL A;  2M0B A;  4NPF X;  4GOE A;  4EYY Q;  2B87 B;  3PH0 A;  1S3J A;  2I8D A;  4MN4 C;  1OVR A;  2Q1K A;  4GOF A;  2SPZ A;  4GOD A;  4ASV A;  3RGU A;  2KI7 B;  2M5A B;  1H0T A;  1Q2N A;  1ZW0 A; 
#chains in the Genus database with same CATH topology
 1VQ7 P;  3NXS A;  2QJK B;  2FFD C;  5M1B A;  1SS1 A;  2N1T C;  1N7S D;  3KYQ A;  5KLV G;  2A06 E;  1JCD A;  1Y47 A;  4BWN A;  1HTL C;  2M5A A;  2IZ1 A;  4WB4 A;  1VQK P;  2LXB A;  1S9K D;  2E74 B;  5KAI H;  2O1J A;  2YXQ B;  2QJK C;  2WSE H;  2AEF A;  2FYN B;  5GTH H;  2D2C D;  2YMY A;  5CCG A;  3A0H E;  5B5E H;  3KDP B;  3M0D A;  1AA0 A;  2ITA A;  2W27 A;  3PLN A;  1NU1 K;  1P84 E;  1HGZ A;  1SQP E;  1QLE D;  3L4F A;  3E1R A;  1LTI C;  2FYN C;  2G8Y A;  4ZNC A;  1L0N E;  3HUS B;  2HPC B;  1PZQ A;  1IK9 A;  5E79 H;  5CJ4 A;  2BCC J;  1U7M A;  5CJ0 A;  3OW2 O;  1U57 A;  3FGA D;  1FU1 A;  1SQV D;  4YXD C;  1FZA A;  2BEQ D;  3VP9 A;  1YJW P;  3QH9 A;  2K1A A;  1SQQ E;  2GM4 A;  4EYY Q;  3LW5 H;  3VYI A;  3HUS C;  1L0L D;  3RL0 C;  1FDM A;  1SQB K;  2W83 C;  1SQX K;  2M5A B;  1H0T A;  5APY A;  1S5L H;  1JY3 O;  3AEA C;  3HRN A;  3KXD A;  2B87 A;  1LTA C;  3MUD A;  1PGO A;  3MIW A;  5AW0 B;  5AVX B;  1NAF A;  1PGJ A;  3FXE A;  3CD6 P;  3CWB E;  1ZR2 A;  2OTK E;  1PGQ A;  2E76 B;  1BGY E;  3HD7 A;  1PP9 E;  4D6T D;  3D71 A;  2OTJ P;  5TIS H;  3W68 A;  1Z56 A;  1GTW A;  3OJA B;  1DH3 A;  4H13 C;  5CCG C;  2ZYG A;  3M0D C;  4M3L A;  1LTB C;  5KJ7 A;  1QL2 A;  1RF1 C;  1P84 D;  3L71 G;  2NZ2 A;  2E76 C;  5AVZ B;  3WU2 H;  3CCV P;  1JMB A;  1RF0 A;  3CXH E;  1VQO P;  1J2J B;  4RO0 A;  3TK1 A;  1KIL A;  1ZV8 A;  1NGM B;  3P8C E;  1FJP A;  1H0T B;  2QG4 A;  1EZV E;  2ZVO B;  1KB9 H;  1OMI A;  4EOT A;  4TT3 H;  2W90 A;  2B87 B;  1GW4 A;  2I8D A;  1SQQ D;  2XND H;  2AEJ A;  1LJ2 A;  1Q86 Q;  1FZE A;  1RHZ B;  3PHL A;  2IBZ D;  3HTK A;  1YBK A;  1OXZ A;  2IFM A;  3W67 A;  2N1T D;  1NU1 E;  3RK2 B;  4HKZ H;  3L75 J;  1LTJ A;  2QJY B;  3MUD C;  2P58 A;  2R44 A;  1ZME C;  2IYP A;  1KQL A;  4C46 A;  2ZT9 C;  5AW7 B;  1KZU B;  3G3Z A;  3CWB D;  1K9M Q;  1PP9 D;  1M7L A;  3M9B A;  1NOH A;  2Z5H A;  4PD4 I;  1X9V A;  2QJY C;  4OH8 B;  4IL6 E;  2PFX A;  1KIL B;  1R8E A;  4GT1 A;  3L72 D;  3JCU H;  1SQB E;  1SQX E;  3OA7 A;  1KD1 Q;  4O9B A;  1RF0 C;  1L0L J;  3CXH D;  3BRT B;  3H1K E;  3MTU E;  2WIT A;  2YMK A;  5CBN A;  2Q9I A;  2MJZ A;  4W7Y A;  4ZMD A;  3HTK B;  1KIL C;  1PIX A;  1K8A Q;  1GL2 C;  3P8C D;  2FYZ A;  1HBW A;  2W8Z A;  1EZV D;  5BVZ A;  1FZB A;  2AEM A;  1N86 A;  4I2L C;  4PV1 B;  3RL0 D;  3C8V A;  3L70 E;  1LTJ B;  3CCM P;  4QMA A;  3AE5 C;  2RH0 A;  2Q5U A;  2XZR A;  4N78 D;  4ZKU A;  5KAI E;  1L2P A;  4NPE A;  1NU1 D;  1Y8A A;  1NTZ G;  4D6T J;  1EDK A;  1KN7 A;  1LTJ C;  3VMA A;  5B5E E;  4EI2 A;  3RK3 B;  1T3U A;  4XFJ A;  2O3J A;  4R4L A;  4LC1 A;  4H13 D;  2XDJ A;  3JC2 2;  1ZP0 C;  2XU6 A;  4UB8 H;  2YNY A;  3BAT A;  3FWL A;  4DJG A;  5E79 E;  3L74 G;  1EDJ A;  1OW6 A;  1XTC C;  5AVW B;  4YPC A;  1L4A D;  2KOG A;  2IYO A;  1BE3 D;  4TLF A;  1UIX A;  4U3F G;  2P67 A;  2O01 N;  4H0L C;  1KIL E;  1SQQ J;  1JY3 N;  1KQF B;  2RKL A;  2M0B A;  1AVY A;  3H1K D;  2HOD A;  1JY3 P;  4GOE A;  2HFE D;  1LWU A;  1YQ3 C;  5AVY B;  3D6Y A;  1IFN A;  4MN4 C;  3GF7 A;  1LTG C;  1IFJ A;  3RGU A;  3BCC G;  3L70 D;  2YXR B;  2KXP B;  1YQ4 C;  2P2U A;  2ZXX A;  5AW2 B;  2YKQ A;  4OGQ B;  3CWB J;  5CCH A;  5TIS E;  1L0N K;  1UII A;  1PP9 J;  3AE4 C;  1WRG A;  5EFW B;  1Q90 D;  2ZT9 D;  1S2E A;  2H7H A;  1JOC A;  1VQM P;  3V2Q A;  3VMZ A;  3B71 A;  1VDF A;  1KQG B;  4OGQ C;  5KLI B;  1IFD A;  3WU2 E;  3RK3 E;  3PRJ A;  5AW1 B;  1LT1 A;  1SQV G;  3AEG C;  3BCC E;  3AE6 C;  2HOD B;  3Q3D A;  4WWI A;  1YIT P;  1BCC E;  1KB9 E;  5KLI C;  1L0L G;  1JM0 A;  2QSI A;  2JWA A;  4DOJ A;  4RKU J;  3AE7 C;  4BRY A;  3TF5 A;  4NPD A;  1NTM D;  3G4S P;  1KIL D;  3L73 E;  3H1L E;  4NPF X;  1GL2 D;  5BU8 B;  1J1D C;  2P1J A;  3USS A;  1DX7 A;  2QA4 P;  4JF7 A;  3SFD C;  2Q1K A;  2WSF H;  1N73 A;  3L35 A;  1T2K D;  5H2F H;  3VMY A;  3V2N A;  2BAS A;  1NU1 J;  2PGD A;  4RES B;  1K05 A;  3I5C A;  4D6T G;  3PTZ A;  1KYO H;  2P10 A;  3MD0 A;  1R5L A;  3H1I D;  3MGN A;  1IO4 A;  1YIJ P;  1NTK G;  1M8O B;  5CCH C;  3QWO C;  2LR2 A;  1LT9 A;  1PPJ E;  2Q3I A;  1N7L A;  1U7J A;  3TSI A;  3NMD A;  3JCU E;  3H1H E;  1BE3 J;  3R2P A;  1ZLL A;  4PD4 H;  2W6B A;  1SQX J;  1PV3 A;  4BRY B;  3L75 D;  2N9B A;  1LNQ A;  3B8E B;  1AQT A;  2QIW A;  1HJ0 A;  4GIF A;  3H1K J;  5AVR B;  1YHQ P;  1N73 B;  1BCC D;  2IBZ I;  1KB9 D;  4H0L D;  2RN0 A;  2E74 C;  1QX8 A;  3H25 A;  2IBZ G;  1IC2 A;  3L70 J;  1QVF O;  3H1L D;  3M9H A;  5B66 H;  4JYC A;  1E79 H;  3V2P A;  1JEK A;  4I6M C;  2OYI A;  1E5W A;  1X8Y A;  1N73 C;  5KLV E;  3TGU G;  3CX5 I;  4KJM A;  5KKZ B;  1BDC A;  3SWK A;  4Y28 J;  1LT9 B;  2IPP A;  2QJP B;  1G2C A;  3FWN A;  3B4S A;  2FYU G;  4B86 A;  1RQV A;  1FBM A;  3N4X A;  1Q82 Q;  2O01 H;  4UB8 E;  1HWT C;  1NKN A;  1KTM A;  3F5H A;  2KB7 P;  5AW3 B;  4ASW A;  2QJP C;  3L72 G;  2HYN A;  4YXW H;  1EC5 A;  1VL2 A;  2A06 D;  5AVV B;  1N8R Q;  1EDL A;  4GKG A;  2R5B A;  3CCQ P;  3BAS A;  3VN0 A;  1VQP P;  1EDI A;  2Q7C A;  3U59 A;  1NTM J;  1DEE G;  1USE A;  4JQ0 D;  2QE7 H;  2I1K A;  3VMX A;  1SVF A;  1BDD A;  3VTP C;  3HE4 A;  3KPE A;  1ZXG A;  2OYI B;  3EFG A;  2RMZ A;  2NPS A;  1HGV A;  4OWF A;  1FS0 E;  2GUS A;  1MKM A;  3AEE C;  1SQP D;  1H88 A;  2QM7 A;  1S3J A;  1S72 P;  1JB0 J;  3AED C;  1L0N D;  1G2C B;  1FOS F;  3SWF A;  1VPC A;  3H1J G;  3KQG A;  1VF5 B;  2OYI C;  2V4H A;  3H1I J;  3HE5 A;  1FZG A;  1JTH A;  3SWY A;  1GU5 A;  5BU5 A;  4IFD K;  1QEX A;  1VF5 C;  5CCH D;  1SFC D;  3Q5S A;  1NVO A;  3R4Y A;  3P7K A;  1OW8 A;  1KYO I;  1NH4 A;  1YTZ I;  3B5N A;  3TNU A;  1NTZ K;  1NYH A;  3HD7 B;  1QL1 A;  5GTI H;  3L71 E;  1OFC X;  1BE3 G;  1A02 F;  1M56 D;  2WWW A;  1NWQ A;  2L5G B;  3HE4 B;  1BCC J;  2NPS B;  2KSJ A;  3SSU A;  1X22 A;  3WUT A;  1BGY D;  3HD7 C;  3RK2 C;  3S1K A;  5APV A;  2C9L Y;  3H1L J;  3TYY A;  2E74 D;  1AQ5 A;  4L75 A;  1N7S A;  2HR3 A;  2JWD A;  3I55 P;  5KJ7 C;  2KYV A;  5H2F E;  3KZI H;  3HE5 B;  3AE3 C;  1NJI Q;  1GK6 A;  2BCC G;  3G71 P;  3V4Q A;  5APX A;  1JTH B;  1M1J A;  2KS1 A;  4PJ0 H;  3CCR P;  2HLO A;  1ZOY C;  2KK7 A;  5AVS B;  1OW7 A;  3B5N B;  1ZRT E;  2M8R A;  1OWA A;  3AEC C;  3TNU B;  1RY3 A;  1G1I A;  1YTZ T;  3Q5P A;  1EXI A;  1T8Z A;  2BEZ F;  1H8A A;  1FDO A;  3Q5R A;  1K73 Q;  3NFQ A;  4PD4 E;  1M1K Q;  4PV1 C;  5KTB A;  2AXC A;  3MHV A;  5GTH E;  1J1E B;  3P8M C;  2Y0D A;  2ZJS E;  1Q7Y Q;  2A45 I;  2E5Y A;  2XV5 A;  3IAO A;  1N7S B;  1NTM G;  2B88 A;  2WMM A;  2A45 G;  2WSC J;  4BXL A;  3CL3 D;  2LXC B;  3SFE C;  5CCG D;  1SQP J;  2UWJ E;  2B89 A;  1M1J B;  2KS1 B;  5B66 E;  1J1E C;  1SQV K;  1L0N J;  2CPB A;  2K88 A;  2W6J H;  3E1I A;  3RK3 C;  1QVG O;  2H88 C;  2E76 D;  2JKV A;  3PH0 A;  1ZN5 A;  2E5T A;  1L0L K;  1HUC A;  2YKP A;  2Y0C A;  3II6 A;  2W6A A;  3A7O A;  4GOF A;  1SQB D;  2M3B A;  1FOS E;  4C7N A;  1SQX D;  1M1J C;  1Q2N A;  3H1I G;  4DCK A;  3IN6 A;  1NTZ E;  3H32 A;  3CME P;  3VP8 A;  2P7J A;  4I7Z B;  3CX5 H;  1S5L E;  2KSE A;  3IFM A;  4JYB A;  3CI9 A;  2QVA A;  1ZRT D;  2PP6 A;  1VF5 D;  1NKZ B;  1WT6 A;  1T6A A;  5DJU B;  2V7Q H;  3BVH A;  1FC2 C;  2I1J A;  5AVT B;  1URQ A;  3L75 G;  3L74 E;  1NTK K;  1MFZ A;  1BGY J;  2JR8 A;  1RH5 B;  4U3F E;  5KLV K;  1VQ8 P;  4IOI H;  3HD7 D;  1RQU A;  3RK2 D;  2AXT H;  4HB1 A;  3A3Y B;  2YO2 A;  5AW9 B;  4I1L A;  4WBA A;  3V5B A;  4C7N B;  4LGD E;  1VQ5 P;  1AV1 A;  5KJ7 D;  3O8Z A;  1W5C E;  2C0X A;  3H32 B;  3C9I A;  4OVN F;  2ZFC A;  1OVR A;  1LWU B;  1GD2 E;  4A7P A;  3WUV A;  4Z1M H;  5CBO A;  1KFN A;  2WT7 A;  1OX3 A;  3WUU A;  1PFI A;  4HH2 A;  1NTZ D;  3JSV C;  2KZJ A;  3CCU P;  1NAY A;  1URQ B;  1LWU C;  1LGH B;  3CCL P;  2IFN A;  1OZH A;  1CSB A;  3U1A A;  4WVZ A;  2A06 G;  1DEB A;  2Y9Y A;  2YO3 A;  1R5S A;  3MP7 B;  2N9Y B;  3UIA A;  4W7Z A;  2FXM A;  4IFM A;  2FYU K;  3A2A A;  3G9R A;  3GHG A;  1URQ C;  1LTS C;  4PV1 D;  1VQ4 P;  1RE4 A;  1SQV E;  1JO5 A;  2WPQ A;  1JY2 N;  2ZXE B;  3CLQ A;  2KLU A;  1P84 I;  1HVV A;  3RBX A;  1FZC A;  1L0L E;  1FJK A;  1SQP G;  4CPG A;  1AFO A;  3KZI E;  1KV4 A;  1LTT C;  4UB6 H;  1L0N G;  4RJT A;  3RBZ A;  1SQB J;  3RK3 D;  1CI6 A;  4DZO A;  4PJ0 E;  2WT7 B;  2K37 A;  4Y99 B;  5AVU B;  3BCC D;  2Z5I A;  1SQQ G;  2KI7 B;  3RL0 g;  4D6T E;  2WVR A;  3U1C A;  5APS A;  3CC7 P;  2VRS A;  1NTK E;  4Y99 C;  3FXD A;  3M91 A;  3L73 D;  1JCC A;  2ZYD A;  3GHG B;  1RF1 A;  1SLQ A;  2KZI A;  2K9Y A;  3S9O A;  2JP3 A;  1MFT A;  1DIP A;  1L4A A;  4WY4 A;  2K3R A;  2WSE J;  1FZC B;  2WTY A;  2OAR A;  2XNX A;  3RL0 B;  1X0T A;  3CWB G;  2JO1 A;  1PGP A;  1BGY G;  4N6J A;  3GHG C;  2KIK A;  1PP9 G;  2LKM A;  1RE4 C;  2CK3 H;  3EFF K;  3T97 A;  2PRR A;  5KKZ C;  1IFP A;  1EXJ A;  1LT9 C;  1CI6 B;  3AE8 C;  1FZC C;  3EWK A;  1OVV A;  1PPJ D;  2A45 H;  2IBZ E;  3CPW O;  4OGQ D;  2E43 A;  1GK4 A;  3A0B H;  1KMI Z;  3CXH I;  2IDB A;  1IFI A;  1HJB A;  3H1H D;  2R32 A;  1S1C X;  3PP5 A;  1EZV I;  3TGU E;  3LW5 J;  4H13 B;  3IR9 A;  1SP4 A;  1GW3 A;  1EZV G;  2SPZ A;  4GOD A;  1EQ7 A;  3CX5 E;  1NTZ J;  1RF1 B;  2FXO A;  3Q2Y A;  3IF4 A;  2FYU E;  2O01 J;  4HJG H;  5AW8 B;  1JNM A;  1L4A B;  4WY4 B;  1XTG B;  5APQ A;  2POH A;  1M90 Q;  1DD3 A;  3BRV B;  1NTK D;  2FY8 A;  4LLH A;  3CC4 P;  1OVU A;  1YI2 P;  3LID A;  1NU1 G;  3L72 E;  2OYO A;  3L74 J;  5KLV D;  4JBZ A;  3T97 B;  1L4A C;  4WY4 C;  3C1L A;  1FE6 A;  1A02 J;  1MUU A;  2B9B A;  1WMK A;  3G6E P;  1URQ D;  4K3A A;  4U3F J;  3P32 A;  2KUB A;  2IZ0 A;  1GL2 A;  2AXT E;  1VQN P;  2WSS H;  2WPS A;  2Q3E A;  1GDT A;  1FDI A;  4EIJ A;  3FX0 A;  3ZDM A;  2OYH A;  3ITK A;  1W2B O;  5KAF H;  1SQB G;  3BCC J;  4N78 E;  2ZT9 B;  2KNC A;  1SQX G;  1NTM K;  1IJD B;  3V6I A;  3H6P A;  3H1J E;  1GZL A;  3H1K G;  1YYC A;  4L76 A;  1PL5 A;  4EDF A;  3TGU D;  4H44 B;  5APW A;  3L73 J;  1JY2 O;  1Y9B A;  2PAJ A;  3CX5 D;  2Z4E A;  3L70 G;  1USD A;  1CW5 A;  2NPS C;  2FYU D;  2G3A A;  5AW5 B;  1K04 A;  1BSN A;  4GDO A;  3Q1M A;  3LIE A;  2M3E A;  4AUW A;  2C9N Y;  1N2D C;  4L73 A;  2FBW C;  2Q6Q A;  4H44 C;  3M9Q A;  3D6Z A;  3V4W A;  1DD4 A;  4W80 A;  1KYO E;  1GL2 B;  1BE3 E;  2R3S A;  1RE3 A;  4DT0 A;  1SQV J;  2E75 B;  1YJ9 P;  3CCE P;  1VQL P;  2ZYA A;  1NO4 A;  3GG2 A;  3AE9 C;  2K9J A;  1LP1 A;  1IK7 A;  3L37 A;  4IFF A;  4KHX A;  4U7J A;  2OYH B;  3A0H H;  3V2R A;  2KNC B;  4UB6 E;  2KP8 A;  3GMA A;  4AQR D;  1P84 H;  1TU3 F;  2E75 C;  5C39 A;  2WSC H;  1AJY A;  5CMZ A;  3H1H J;  4HYT B;  2QRX A;  5CHX A;  3B5N C;  3D70 A;  1T2K C;  3TDK A;  3L71 D;  4AYC A;  2BCC E;  2OYH C;  2WPR A;  4JPZ B;  4C7R A;  3GLM A;  5AW4 B;  2H89 C;  3H1J D;  1YJN P;  4ASV A;  4IL6 X;  1D7M A;  1GU4 A;  1MZ9 A;  1ZW0 A;  1NTK J;  1FZF A;  1H89 A;  3AE2 C;  3N7N A;  2D2C B;  3S4R A;  1N7S C;  2DW3 A;  2H8P D;  1IFM A;  2HG5 D;  5L8R J;  5KLV J;  2OQQ A;  2Y0E A;  4H0L B;  3A5T A;  2J59 M;  3OAK A;  2K9J B;  2NRG A;  2YKO A;  1LP1 B;  3GF3 A;  2O1K A;  2JEE A;  2XKM A;  2D2C C;  1KYO D;  4WY4 D;  1RE3 C;  2JDI H;  2Y9Z A;  5DJT B;  1G1J A;  1NTM E;  1HH0 A;  4K35 A;  3L36 A;  1Q81 Q;  2L91 A;  3A0B E;  1KC8 Q;  2E42 A;  4XA4 A;  3F89 A;  1AVO A;  3O6Q A;  1IZN B;  4I7Z C;  2OTL P;  3NTN A;  1S4X A;  1JUN A;  1KOR A;  4PD4 D;  3K5B A;  1KB9 I;  3CC2 P;  1MV8 A;  1BCC G;  3TGU J;  1T3J A;  2BCC D;  3CXH H;  1SQP K;  1VQ9 P;  3EQ2 A;  2H43 A;  2WZ7 A;  5APT A;  2FXP A;  3H1I E;  2WPV B;  4R4M A;  3CMA P;  1SFC A;  2GUV A;  3L73 G;  3H1L G;  4N3Y B;  5APU A;  2FYU J;  1FAV A;  1X79 B;  2FFD A;  4KT0 J;  3I56 P;  2N1T A;  3E7K A;  1M57 D;  2V7Q J;  2ZAE B;  3GW6 A;  2GA1 A;  2NPS D;  2WQY C;  1VQ6 P;  1S9K E;  1SQQ K;  3L72 J;  2YIU B;  2R5D A;  1ZR4 A;  3KHU A;  2C0W A;  3L75 E;  4H44 D;  2CPS A;  1KQS O;  1KFM A;  1OIP A;  2QEX P;  1S5L X;  2J5U A;  3VOP A;  1J1D B;  1HF9 A;  3MZW B;  3CCS P;  3AEB C;  3M06 A;  1W2E A;  3O6Q B;  2OGU A;  1QGK B;  1GMJ A;  2YIU C;  1PPJ G;  2FKW B;  4XE5 B;  1CZQ A;  5GTI E;  3WMM 0;  3AEF C;  4L74 A;  3AE1 C;  3H1H G;  2ZVN B;  5KAF E;  3L71 J;  2IX7 C;  5K5G B;  5AW6 B;  2E75 D;  4YTP C;  1NHL A;  5AVQ B;  4IL6 H;  3B5N D;  3ABV C;  3L74 D;  1SFC B;  2KLV A;  3CCJ P;  3H1J J;  5TJH A;  2FFD B;  2QM8 A;  2JJL A;  3PJS K;  1JY2 P;  4ZKP A;  3HUS A;  2HPC A;  2N1T B;  4U3F D;  1JMM A;  1BSH A;  2R3C A;  2MKV A;  2WSF J;  3M0A A;  1SFC C;  2J58 A; 
#chains in the Genus database with same CATH homology
 4KJM A;  2B87 A;  1BDC A;  4HJG H;  1SS1 A;  2ZAE B;  2KZJ A;  3FXD A;  4HKZ H;  1Y47 A;  2QVA A;  4NPE A;  2M5A A;  2P58 A;  2LXB A;  1OVU A;  1EDK A;  2R44 A;  2KZI A;  5CBO A;  3FXE A;  3QWO C;  1LP1 B;  1NVO A;  2LR2 A;  2OTK E;  1MFT A;  5EFW B;  2K3R A;  5DJU B;  4JBZ A;  1FC2 C;  3MZW B;  1U7J A;  4ASW A;  1X0T A;  4K3A A;  5DJT B;  1EC5 A;  3MHV A;  2KIK A;  1LP1 A;  2KUB A;  1EDL A;  4K35 A;  1EDJ A;  1LT1 A;  2B88 A;  5K5G B;  4ZNC A;  1EDI A;  5C39 A;  4IOI H;  1OVV A;  4WWI A;  2WMM A;  1DEE G;  2QRX A;  1JMB A;  4BXL A;  4HB1 A;  4CPG A;  3S1K A;  1U7M A;  2LXC B;  1JM0 A;  2UWJ E;  2B89 A;  3ZDM A;  1BDD A;  2KS1 B;  1ZXG A;  4NPD A;  5CBN A;  1H0T B;  2HR3 A;  4ZMD A;  2JWD A;  2RKL A;  2M0B A;  4NPF X;  4GOE A;  4EYY Q;  2B87 B;  3PH0 A;  1S3J A;  2I8D A;  4MN4 C;  1OVR A;  2Q1K A;  4GOF A;  2SPZ A;  4GOD A;  4ASV A;  3RGU A;  2KI7 B;  2M5A B;  1H0T A;  1Q2N A;  1ZW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...