4HLQB

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
molecule keywords TBC1 domain family member 20
total genus 51
structure length 172
sequence length 172
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlqB00
3Q72A 2H57A 1JI0A 2FEOA 1GM5A 3L0IB 2G1KA 4Q4AB 1DG1G 5UKDA 2B8WA 3CBQA 4N0EA 3J81k 4HB4A 2HUPA 2BCGY 5HR5A 4HLCA 3MRSA 1QDEA 4EPTA 1U2RA 2G6BA 2N1BA 4NE2A 1GVNB 2QSZA 3AVXA 2WJHA 4G01B 4DLTA 2O8CA 4TMTA 4OK6A 1F48A 3O8RA 2CK3D 4MA4A 5J40A 2XX3A 2K5UA 4D25A 221PA 1N5IA 2FFAA 2ZE7A 2KJQA 3C7KA 1KIMA 3GJ6A 2CJWA 4A2WA 4O2LA 4OI4A 3S1AA 4P3YA 1XNJA 2C78A 3TR5A 2Q3HA 3KB2A 4GZLA 3RWMB 5F3WB 4P4SA 4DLRA 4DJTA 4L16A 3ETLA 4B74A 3GLFA 5H8WA 4PFSA 3L43A 1U0LA 3SE0A 3JVVA 3KQNA 2VIIA 4D4MA 1F60A 3OIWA 4F4CA 1NY6A 1OFTA 2HJVA 3CLVA 5DGXA 3EX7C 1S9DA 4NL4H 521PA 1AKEA 1XZPA 3MMPA 3K09A 4H9GA 3C5HA 2F1RA 4JL5A 4LRWA 4RZ2A 4K46A 3QF7A 1Z07A 1DO2A 2Q9AA 4AIIA 2J7PD 2ZI5A 4CF7A 2FSHA 1N6LA 1Z8FA 4RY2A 4LPSA 1YZUA 1T6NA 1NVVR 2ZE8A 3V00A 1KMQA 2OV2A 3BD9A 3BS4A 2DWQA 4YDHB 3D31A 4DSTA 2WTUA 4AY2A 4TLBA 1IAQA 3PG5A 3RRMA 3SFVA 4RD2A 4TZ0A 4X8HA 4GT1A 3AP1A 4QJ4A 5JZVA 2CMKA 4PAQA 1F6BA 1ZNXA 2VQSA 1XMVA 4JVMA 1VTKA 4DCUA 1IXRC 1K5DA 3RDPA 1HA3A 1JXMA 2R6DA 2DFNA 1CTQA 1LNZA 1NL3A 1MRSA 3A37A 4DC9A 1UBFA 3WYFA 1E32A 2WPDD 1GTVA 3BB1A 2VP6A 4XIGS 2UZ3A 3T1OA 3B9QA 3HDTA 5DN6D 2MMGA 3AKEA 4HB2A 3B13B 3BE4A 4JMPA 4RZUA 1CULC 1E6CA 4QM7A 1G64A 4G5OA 4JLKA 3THWB 3IO3A 1JJ7A 3EZ7A 3WMFA 2OFXA 3U44A 1OFIA 1NVWQ 1KK3A 1RIFA 1G6OA 3PXGA 4US1R 2R6AA 5JRJA 1VHTA 5K8UA 4BRUA 1KSGA 1LFDB 4NBSA 4YMUA 3T06B 2YC4C 3LX5A 3AVQA 1RRFA 1Q1EA 3CF6R 3A58B 4HDOB 4RCZA 2GK6A 1P62B 4GL2A 4ESHA 2QE7A 4TMVA 3K70D 1OLOA 1Q3TA 3I72A 5JRZA 4HEJA 4IDOA 4IW3B 2Q3FA 3KTAB 4TL8A 1ZCAA 2HT1A 4DLYA 4NCJA 4B3FX 1BMFA 2YWEA 2IUUA 2DBYA 3K9HA 4KYIB 3ZQ6A 2R6GA 4Q66C 1RVDA 4D0LB 3EPLA 4GSYA 1GUAA 2W6IA 3ND9A 2X8AA 3T1VA 4NCKA 2BDTA 1MH1A 4LYFA 1D5CA 4LV6A 3MWJA 3GEEA 4XTCS 2MSEB 2ZI4A 8OHMA 3Q9LA 2QTVB 4ABYA 2GZDA 3N5CA 3GLFE 2O8FA 2A78A 2IT1A 3LW8A 1S1CA 5AK0A 3VU9B 2GVZC 3U7GA 2WJGA 2IYQA 5JWOA 1Z28A 3CZPA 4CEHB 4NYIQ 4OK3A 1R4AA 5D3MB 1IY0A 3NBFA 1CBUA 1VG1A 1N5JA 1NRJB 3NKVA 4OK5A 4DLXA 4DZZA 3DVLA 5LBIA 3N2EA 4IDNA 4NYMR 1FTSA 4JZKA 5AJWA 3U2QA 4RD4A 2MSCB 4EJSC 1KI3A 1W4CA 1P5ZB 5JJKA 1E2QA 1YU9A 4B48A 1XF9A 1JPJA 4GP6A 5TY0A 3MSXA 4A36A 2QN6A 1L8QA 5EE3A 1KNQA 4DCTA 1YVDA 3KFVA 2C2HA 5TARA 4JLDA 2RCNA 4EFNA 2ZRJA 1PV4A 2PLRA 4A0FA 2VH5R 3A1TA 2AK3A 2J7PA 2ZANA 5AUPB 1KO8A 5AJZA 2NQ2C 2C03A 1TQ4A 2C8VA 2XB4A 4XD7A 4QNRA 3QI2A 1C4OA 5BYJA 1QHGA 4IXNA 5KUTA 3SYKA 3IHLA 4TT3D 3KJIA 1C9KA 3GLGA 4AKEA 4FINA 5HCIA 4CIDA 5B57C 3HR7A 2PJZA 1CS4C 2ATVA 2HYIC 4MDFA 5LB4A 1M74A 1QG4A 2GZAA 3OAAD 4D26A 2AKAB 1X8LA 1IN6A 4GNKA 2BVNA 1CLUA 4Q21A 2WKPA 5KOYA 1P60A 4GFDA 1FW6A 2FPKA 4KU4A 1P9WA 2XTNA 4R98A 1OF1A 3FFBA 1NMYA 4HAXA 4X8LA 2G77B 4KXFB 3K0FA 4HAZA 3WNBA 4CRWB 2ZITA 4YMWA 1VYVA 3ASZA 2QMHA 3WYAA 2CCGA 5GJVC 1KY3A 1T9HA 2B7CA 4DLUA 3ICEA 4ZIRA 1I4TD 1E99A 5FI0B 2GCNA 3WBJA 4V02A 3BK7A 2O5VA 1TEVA 3W8NA 2CDNA 4F91B 1KI1A 4D81A 2GA8A 4OI2A 2IYTA 3IBYA 2VHUA 4QGGA 3QKTA 4HDQB 2W2VA 4LJ6A 2CEAA 1OXSC 4Q19A 1Z0KA 4A1FA 4F4IA 4RD0A 2ZRIA 1E0SA 1D2EA 2RMKA 2VYFA 2YZ2A 5FL7A 4LBVA 4WBSA 4DHEA 2QT0A 4BLOA 3O8DA 1WDTA 4MDEA 4YMTA 3VR4A 1XXHB 4LJYA 4Q7KA 3K70C 4QM6A 1JEDA 2ERYA 2F9MA 2GAAA 2OLJA 4M22A 5B2ZA 4DUGD 1Z2AA 1YR7A 1DAFA 2ZSBA 4URYR 3GJ5A 1R5OA 4A6PA 2H17A 1HEIA 2NZJA 3CWQA 3QF4A 2OESA 4B3XA 2R6FA 2ZUBA 1S0UA 5ELXA 4E09A 2G3YA 3D3QA 1I4DD 1YR9A 5FR2A 1HUQA 2PCJA 4TLDA 3P26A 2IXEA 4TN1A 1YZLA 3LLMA 4L4UA 3NVAA 2EFGA 1VECA 1ZYUA 3EA0A 4L8GA 2IWHA 2ZRPA 3O8CA 2ZVQX 3BFVA 2IYVA 1KAGA 3FE2A 5IF9A 2NGRA 4MRRA 2ZRGA 4Q1CA 3TW8B 3PR1A 1FP7A 2XB2A 2BEJA 1E1QA 1G4UR 3A1SA 5TMPA 2IS2A 3X1YA 3N2IA 3UG7A 3T15A 1Z0DA 3SBEA 4JVNA 1TPZA 1TMKA 3QUSA 4BASA 2QZ4A 1NN1A 2EFDB 1GKIA 4JBWA 4E5UA 1G3MA 4MGYR 2ZRLA 3RC3A 2YNMA 1IBRA 2ZI3A 3BH7A 3DOFA 3B8HA 5F98A 4RFVA 3EPKA 1E9FA 2WWXA 1A4RA 5JLJA 3ADBA 1YHNA 1E4VA 2J87A 2ZRFA 5JMTA 1HYQA 1TUIA 4Q4JA 2X2EA 3DOEA 2GJAA 1E2HA 1VG9B 2WHXA 1RE0A 4PHTA 4Q7MB 3SU8A 1P6XA 4XD7D 4F4JA 4MRNA 5C4GB 5DE3A 2WSSD 4D2IA 2HF8A 2QAGB 1FQKA 2CHQA 1GOTA 3A1WA 3TUIC 5C2JB 5FBVB 1AS2A 2AXPA 4IVQA 4ZI3A 2ZS8A 1QHXA 5FTLA 2DCUA 2JLZA 1E69A 2OAQ1 3OAAA 2XZPA 3NHAA 1PVOA 3AKDA 4BLPA 2OZEA 2ZYUX 1GNQA 3GJ7A 2J45A 1Z06A 4BGDA 4BLTA 2KBEA 1EFCA 2G0NA 4B2PA 3OIYA 3H4MA 3VQTA 5TDHA 5CYOA 4DT1B 5CIWA 2ZYTX 3BAFA 4URUR 4GBMA 5C4MA 2QM7A 3ICQB 3LBHA 1J8MF 1OXTA 4B75A 2CJWB 5FBQB 4Q02A 3LAWA 1NF3A 1OB5A 4WVFA 2P67A 2E87A 4YC7A 3EWAA 3PEYA 4BFZA 4PO9A 1XCPA 1KI9A 4MRVA 3IEVA 1CEEA 4OHWA 1SVSA 3AVUA 5B64A 1JNYA 3DO6A 1GRNA 1KJYA 3CH4B 1G7TA 3CPHA 3FFAA 2HXSA 4C0QC 2ASEA 2Q3MA 3VNVA 4JT2A 2ZI7A 1A1VA 1N25A 1Q21A 5JWHA 1II9A 2GBLA 3D8BA 5FR1A 2FMXA 3E70C 1DAEA 2FFQA 2PX0A 3LNCA 4UJ5A 1TTTA 5DISB 1ZUHA 3MAAC 2QA5A 3DZDA 3SQXA 1E94E 3EZFA 2BBTA 1U81A 4RSGA 5DHAA 5DYGA 4R2IA 3ZD6A 4C2TA 2F3RA 1L4UA 5K8IA 1ANKA 1RYHA 2HEIA 3WYGA 2BOVA 5D3MA 2CVFA 4JLOA 1W0KD 4MYUA 1G3RA 4X8MA 3DPUA 2AL7A 3V4FA 3OZXA 1X1RA 1W46A 2E9SA 3HYRA 3QBVA 4PZYA 4FD2A 3GJ8A 1IN8A 1P9RA 2IEZA 1SGWA 1W2GA 3UANA 3TGPA 3U44B 4MUAA 4MKFA 2QROA 1W4BA 2WWFA 1KGDA 1OT3A 2ZUCA 5E3HA 2W2TA 4PC6A 3H84A 3AVTA 3RHFA 5G3YA 2EW1A 2YV5A 4LWZA 1LTQA 2CK3A 3MD0A 3VR2A 4TQAA 5HZKA 1YKSA 1LY1A 5CITA 2JASA 1VDZA 3QY0A 2KBFA 1R8SA 4FCTA 3L0PA 2XTZA 5AJYA 1E98A 3C15C 2BC9A 2OBNA 2QNRA 1J2JA 5DH9A 1KI7A 3SJZA 2FG5A 2V7QD 4QHSA 1TUEA 1E9BA 5SZIA 1HT1E 5AUNB 2O8DB 1JR3A 2ZRCA 2G83A 4LHZA 1TF2A 5CB8A 1QHNA 4QHTA 1E2EA 1GWNA 5F2EA 4EPWA 3RS0A 3Q7PA 4DDUA 3WMGA 1D6JA 5HCNA 2ZROA 3L2OB 4URVR 4A15A 4ZI2A 1G5PA 3NG1A 3OEHD 4HLUC 4LZZA 1RRGA 5FL3A 5G3ZA 4HATA 1V43A 1R5NA 2C98A 4PPFA 4BFWA 2WSSA 4CGZA 1FZQA 3CZQA 1KZGB 1SVIA 2IYYA 4V0LA 5J5CA 4RD3A 3W90A 3WNDA 2JLXA 4MRSA 4E07A 2V8OA 3L82B 4A6XA 3QE0A 4AG6A 2ODNA 3C5CA 2YHSA 4GOXA 4JLBA 1E0JA 4PQRA 3T1TA 4KLNA 4Z8XA 1Z6YA 3IKJA 2RGXA 4JVSB 5JJLA 1PUJA 1R8QA 1FTNA 1WF3A 2ZAOA 4A8JA 4OQLA 3BH6A 4WA7A 1UAAA 4G5SA 1GSIA 4GOKA 2FPMA 3U4QB 2ZE6A 2ZJAA 4D0NA 1UKEA 2QTHA 3KQLA 2G0TA 2W58A 4W7SA 1NIJA 1XXHA 3K0CA 2JIZA 1CJVC 1ZBDA 2D62A 3BFXA 4C0KA 4QJ5A 1G5TA 3W3ZB 2ZI9A 4JJKA 4NDZA 3T5DA 4C0BA 4JJZA 4PX9A 2ODBA 1XEXA 4KVAA 4RFSB 4HUQB 1L2TA 2BJVA 2WIAA 1U9IC 4Q7LA 2VO1A 3EARA 4U7DA 2PH1A 1C1YA 2JJ2D 5J4YA 2RAPA 4TTPA 3B1VA 1XTRA 5FI1B 3TR0A 3QBTA 1NKSA 2AHOA 3SS8A 2JLYA 2RGNC 1ZD1A 5DI3A 3BB3A 2W6JD 3LFUA 2JDIA 1ZW6A 3UATA 4W5JA 2PMKA 1PUIA 1XFAA 3CX6A 1UADA 3SEAA 1AGRA 5KNCA 2VHQA 4Q5IA 1Q44A 4HYYA 4KJZA 3PV0A 5CYPA 3FTQA 4ZV4A 3VKHA 1KDTA 1CJMA 3OIVA 2W00A 1GL6A 1XD8A 2XXAA 4KCGA 3F8TA 2BWJA 5LD2B 4NTZA 1E2KA 4LGMA 2VHCA 2ZRDA 4RD6A 4YLGA 3TVTA 3VU9A 1A82A 1ELOA 3Q3JB 4YXWD 1BMFD 1QHHB 2ODWA 4CEIB 4B33A 2NOAA 5E7JA 5K8TA 3K9GA 3M1IA 1DO0A 1U0HC 4M9QA 1GAJA 1MABA 3VHLB 1E3MA 2KSQA 1NG1A 5EZ6B 1KI8A 1E9RA 4PC1A 1EXMA 3AKCA 4QOSA 1U8YA 1IQPA 2A30A 421PA 3ZS9A 4B2IA 1H65A 2RGCA 1JECA 1COWD 3WRXC 1B23P 1BKDR 4ZDJA 4GRAA 2BKUA 2ZIAA 1M6NA 4MUBA 4BEBA 3TRFA 2FX3A 4KFSA 1SKYB 3PITA 1CJUC 2DPXA 2FFBA 2QP9X 4M53A 3VMFA 2J0SA 3GJ3A 2CLDX 1JR3D 1VYUA 3HYTA 3PUZA 4L9WA 3HPRA 3MG9A 2MMCA 2DY1A 2IXFA 3HPQA 5AWFC 2I1VB 2F55A 2H92A 5EP1A 1GIAA 3HR8A 3U3KA 2HT6A 1AN0A 4TYYA 1KJZA 1KSFX 1JR6A 1OIXA 1FFHA 2GXSA 5L3QB 1XMSA 4PXAA 1DARA 1JAIA 1SXJE 1N6IA 1DBSA 1T3SA 4TSFD 4WZ6A 1OKKA 3KX2A 2ZJZA 3K0EA 3U6KA 2ZRNA 3AF1A 5JFGA 2H8KA 4DCVA 1B0UA 1E2GA 3GMTA 3BC1A 4PPGA 2OEPA 1II8B 4FXPA 3LVQE 4L9SA 3R9WA 3IUYA 1TQ2A 3EASA 2EYQA 4BFVA 1Q1ZA 4TT3A 1MO4A 4UXIA 2AD1A 5HE8A 3UWKA 3IEUA 4HSEA 2WIBA 3W6OA 4AD8A 3LVRE 4G1UC 4M1MA 4FI3C 4RVCA 4ZCMA 1Z6TA 4JSTA 2GJ8A 3MJRA 3TKLA 3CPEA 3ECCA 1NVVQ 3VR1A 4BFXA 3UIEA 5FH9A 1D8TA 3ADDA 3IIJA 2WICA 2WZQA 3EIEA 3PFIA 4LX0A 1NG9A 4LYJA 5L3SB 1P3JA 4N3NA 4NYJR 1Z08A 4D80A 1ZUIA 2GBLC 2V54A 1M7HA 1GNPA 2JA1A 1VIAA 3RC8A 1CR2A 2W83A 3GJ0A 1LF5A 2DFLA 5DLQC 1QG2A 1MR3F 1TEXA 2QORA 3U3OA 3QPUA 3U3JA 3VAAA 5JEDA 4RZ3A 5GVRA 3EPJA 1ZC4A 1JB1A 3KQKA 2QEQA 3TJZA 1UEIA 2QPAA 2J59A 1LVGA 4A2QA 2HJGA 2QENA 1N6NA 4TZ6A 3FKSD 2YINC 3SI7A 1P73A 4XH9B 2GF9A 1SVMA 4P31A 3TSZA 4QFMA 2J0QA 3OHMA 4WAUA 2O8BA 1P9NA 3UPUA 3GLHA 4JL6A 5A4JA 2VHJA 2O52A 5JBQA 3I32A 5CJ2A 1O87A 4PANA 3BBPA 5K8LA 4A82A 1BS1A 3LO5A 2ZSDA 3Q85A 4IEIA 4EKDA 1T5LA 1P2UA 2GILA 1W4AA 4J0QA 5DHFA 4U02A 2ZRBA 3QKUA 4BZXA 1WXQA 4FMCF 3FGNA 5J4LA 5KO2A 2FE4A 2GCOB 2FFHA 2WAYA 1KHTA 1NP6A 2QL6A 4QHYA 5F9FA 4TYNA 1VKJA 1OXVA 1Q1BA 1AZTA 2JEOA 2WAXA 1KDRA 1UKYA 1N6RA 2W0SA 4PC7A 5BQ5A 4ASUD 3K0FB 1KSHA 4A2PA 721PA 3B6EA 2OFWA 4M1OA 5J4KA 3THWA 1E1QD 1CR4A 3ND8A 3W3AA 1P7CA 5FTKA 4DWJA 3ZD7A 5JS8A 3P20A 1U0JA 3W9YA 2Z5FA 2Q9BA 2IYRA 1U90A 4RD1A 3AP3A 4A9AA 1Z83A 4A0HA 1XBTA 3QENA 2P5SA 2JAQA 1G7RA 3H1TA 1N6HA 5SZKB 4Q9JA 5BW8A 4Z51A 3LV8A 1J70A 4TSFA 3KJEA 5BN3A 3LRPA 1X8KA 1MT0A 1CRQA 1R0WA 1E0KA 4M9XA 4I1VA 2V7QA 2H1LA 2EWVA 4IVRA 4OJKA 4AK9A 1M2OB 1RRPA 1HTWA 4FN5A 3X1WA 4EQ6A 4Z1MA 1EWQA 3DMNA 5JEEA 1ESMA 1DAGA 1WCV1 1ZD9A 5SZJA 1GKYA 3RRZA 4HZUA 3QVVA 3FWYA 3LXRA 3RAPR 2JGNA 5KSPA 3ADKA 3GFTA 4HAVA 3ZLJA 3VNUA 1WBDA 3PUVA 4KO8A 1RPZA 5G40A 3R20A 3THXA 1JR3E 5LB2A 1M1YE 4US0R 1YR6A 2WM9B 3QQ5A 4H1UA 1AM4D 4R71A 3EPHA 2QRNA 1VIYA 2GXUA 2P6NA 4ZCIA 2OCPA 1OJLA 2EFEB 1E96A 1KDOA 2CE2X 2ODEA 3BJIC 3OFND 4IDPA 2EYUA 2GJSA 2D4HA 3QKSB 3L8YA 1SXJD 4QC2A 3CR8A 4PZLA 4NP6A 1FL9A 1XPRA 2BM0A 4U00A 3T61A 3DM9B 3IGFA 1KNXA 4DDTA 2JJ1A 1MABB 3GLIB 1YRBA 2ANCA 3RYTC 4MQBA 5BXQC 1EGAA 3RSOA 4CEIA 3PVSA 2IWRA 3QVUA 1SQ5A 1TX4B 3DHWC 3B5JA 3FVQA 4B6EA 2VP5A 4ESVA 1SXJB 1XTJA 1W36C 3GLHB 2PJRA 1N0WA 3BIFA 1J8YF 1UDXA 3TK1A 2IS4A 2O8BB 1Q3HA 2OCBA 3IIKA 4ZIRB 4BLRA 4DB2A 4ZCLA 2DFKB 2V6JA 2H7VA 5EQTA 2I1QA 4NYJQ 4XOIA 4LYAA 1DE0A 3C14C 1OV4A 1G1MA 1XP8A 2GZHA 3HU3A 5E7MA 3RRNA 1KOFA 3T1QA 3D7MA 1HH4A 1S8FA 4B3DA 5FOXA 3THXB 2A5JA 4OQFA 4ON9A 2ZR0A 3U60B 4Q01A 1D2NA 2GCOA 5A5GA 4WOPA 1U94A 4HZUB 4Q4LA 4HZIA 3U7HB 2RH5A 4EIWA 4S2EA 2O8DA 4P33A 4LPKA 3KB1A 4M1SA 5KTYA 4M1WA 3REGA 4ASUA 2ANBA 3CRVA 1VG0B 4KFUA 3R8CA 1XTSA 3LXXA 4OHXA 4UNQA 3S1AB 5CB6A 3M0EA 5HPYB 1GG2A 3FMOB 4KHZA 4UXHA 5DNYB 3K1JA 2B92A 1E1RD 1LB1B 3GD7A 3EIHA 4LI0A 1SXJC 2ZS9A 2G1JA 4MITA 1NSTA 1TU3A 4PO8A 2REOA 1XEWX 1G5RA 4QKQA 1RJ9B 3UK6A 4UNNA 4NZYA 3NTUA 1T3LA 1XMIA 1UKVY 3TW4A 3V4RA 2XNDA 2G9NA 4NONA 1A7JA 5L3RA 1J7KA 3CX7A 2FJUA 2Z83A 2C95A 2QPOA 4FCWA 2NO6A 3WHKA 3NEJA 4LHWA 4C4PA 2F43B 1GRRA 4F93B 1BIFA 1YZTA 1W48A 2H5EA 1Z3IX 1DEKA 2RGGA 1QBKC 2QY9A 3HWSA 2D74A 2FGKA 1KO7A 3DZ8A 4CT5A 1E9AA 1S96A 1OPXA 2IYZA 4KV9A 4XVQA 4FMDF 3TSOA 2WWWA 4DLZA 2WOOA 2QI9C 4G5GA 2DR3A 4C2UA 3WRYC 1IY2A 2QTFA 1F2TB 3NWJA 3GQBA 4PQFA 3L8ZA 1TADA 2AN9A 5KPDA 4C0HA 1NBMD 3FMIA 3O8BA 1SXJA 3R7WA 4V0NA 1XCGB 2IUTA 2UKDA 5EE5B 2D7CA 4C7OA 1QZXA 2ECKA 4HUTA 5KSZA 2AXNA 2QMEA 2A3RA 4RJLA 2OT3B 3EXAA 2CLSA 4A8JC 1IJEA 5EZ5A 1QHHA 4BWYA 4KBFA 3WNCA 1KI6A 3OE7A 3ZVLA 1ZNYA 2ZJ2A 2JJ2A 4LV5B 2Z43A 4YONB 2ZJ8A 3FHTA 4EUNA 1VPLA 4DLSA 1IONA 3NDPA 1HY3A 4WW0A 2CXXA 1WMSA 5H68A 4P4TA 3PEUA 4RZXA 1AS3A 1A5TA 1G8PA 1ESNA 1NVUQ 5ANRB 4OI0A 4BEJA 2J3EA 3AVVA 2Q21A 2A5DA 2X2FA 5JWRA 2CNWA 3A6PC 3ZYCA 2IW3A 3I73A 2O8FB 3P4YA 2EFHB 1EWRA 2BMEA 4E22A 4DCNA 2CL7X 2X1VA 3I8XA 5AJXA 3U5ZB 4Q03A 2J1LA 1JEEA 2VP0A 1G19A 6Q21A 4LJAA 4IEEA 1NVXQ 1KI4A 3NH9A 1OB2A 4IFEA 3FKSA 5EXPA 3CX8A 4YXWA 2RGNA 1T8TA 3QPVA 3FKQA 2A7QA 3W5IA 2G88A 2JLUA 1ZNWA 2ZAMA 2RGAA 4ZO4A 3OESA 1W2HA 3LX8A 1U9IA 2WJYA 4CW7A 4TTRA 4A92A 4ITRC 1CP2A 1Z63A 1WP9A 2PX3A 4HLUA 4OQNA 4MKIA 5G53C 3RVBA 1Q57A 4DSOA 1Z0FA 5FTNA 2FNAA 1UPTA 1XX6A 5AR1A 4P4UA 1OH8A 4JLJA 1WA5A 4NYMQ 2FA9A 3GLHE 2X77A 3PUXA 4II7A 3K09C 2F1IA 1COWA 3EA5A 4IVPA 1CKEA 4ERNA 1UFQA 4RKEA 3T34A 3NC0C 1E2NA 1OHHA 4NYIR 1N5LA 2GEDA 1XCMA 2IF2A 2IHYA 3DM5A 3QG1A 1EX7A 1W44A 1IN4A 1X86B 4EAQA 2WWYA 3OF5A 2A5GA 4OL0A 4A4DA 1FMLA 1S1MA 3KKMA 5D3QA 3AF2A 2GTPA 3SN6A 5L8VA 1W5TA 3ASYA 5EXTA 1FNNA 1PZNA 1W0JD 4ZKDA 3I92A 5KSOA 2VEDA 3ZZUA 4FW9A 4LSGA 4LBZA 4AKGA 1P75A 1R0XA 2GJKA 4FMCB 1H8EA 1K6MA 1OKKD 3PCRB 4KSCA 4Q1AA 4Q1EA 3AUXA 5TXGA 1P2VA 5KDOA 1G8GA 1E2FA 4TYWA 2YOFA 4Q4HB 3RANA 2A5FA 1Z0JA 4LBWA 4W5WA 4C9BA 1OH6A 4CDGA 3K8YA 1T4GA 1Q22A 2CBZA 2F1JA 2V6IA 3B78A 4LC0A 2XITA 3A36A 3AVOA 4KSBA 4Q48A 4NKRA 3GPLA 4B73A 3LBIA 3OEED 3IPYA 2VF7A 2QU8A 2W2XA 2FSFA 1D2MA 2F6RA 3E5HA 1WQ1R 4EDHA 4CEJA 1NBMA 4CYMA 4Z1MD 4IRUB 3C8UA 1EFHA 3EZ2A 5TB5A 4Q4AA 3W5JA 4I99A 1AA9A 1GKUB 3EIQA 1WB9A 4JS0A 5BN4A 3ADCA 3F3YA 2XZOA 2ZRAA 1DAHA 4GOJA 4D4KA 1KMHA 2BIFA 1KK2A 2GJ9A 1W36B 3NEYA 3OE7D 1ZMXA 1G16A 4LDJA 2P5TB 2R6CA 2WJVA 4Q47A 5DI9A 3R9XA 2J0UB 4H1VA 3FMFA 2BMDA 4FWTA 1D9ZA 1R7RA 1UBGA 4Y0VA 2AK2A 3RS5A 1G8FA 5BN5A 3E2IA 2WJJA 1F3OA 4V0KA 1U8ZA 3IBGA 4PPNA 4CEHA 4IDQA 4P0TA 1E2IA 1I2MA 4QXAA 1CJKC 1IHUA 1ZRHA 2CNWD 4NCIA 3KXLA 3THOA 3ZVNA 2GXAA 5HKKD 2VRWA 3DKPA 4BFTA 3PENA 4UJ3A 4RCYA 4TQUS 1LS1A 2ZS7A 2VLIA 5C46F 1CU1A 1NBME 1RJ9A 5C1BA 4QBHA 5IT5A 3TNFA 5JECA 3OIUA 2GK7A 3K0SA 5KHOC 3MWKA 4BQSA 1DAKA 1M7BA 4B71A 1E2PA 2QMUA 2GWHA 3GLIA 4AYXA 1X1SA 4EPXA 1SULA 1M7GA 2GAOA 2VA8A 1EFUA 3I3SR 1US8A 4URWR 3KKPA 2OCAA 3KTAA 2KWIA 4G3XA 4Q00A 4A0GA 1R10A 2PCLA 3C16C 3M6AA 4LHYA 1W7AA 3BFKA 1HT2E 3B85A 3EAQA 1M34E 2FF7A 4B3CA 4M1YA 2QQ0A 2JCSA 3LBNA 3RWOA 1KTVA 1QHSA 2NTYC 2OSBA 4LC1A 2BM1A 1QVRA 3VX4A 3ZS8A 3TH5A 4N1AA 1AJEA 5FPKA 2XOKD 2HXYA 1QHIA 2ZR7A 4ACBA 2CHVA 1E79D 1NLZA 1W36D 4TYQA 2CLCX 3H86A 5CM8B 2VBCA 2VL7A 4MGIR 3THYB 1KDPA 1W4RA 2ZI6A 1FPMA 3A1VA 4I1SA 4AKHA 4FIDA 1WBBA 1BOFA 4HI0E 3JZAA 1W0JA 4MGKR 4PO1A 4URZR 1AQYA 4MYHA 5EUMA 2ZEJA 4DCSA 1A2KC 2XNSA 1CXZA 4NCNA 2HCBA 1S4QA 3BB4A 1E1RA 4C3ZA 1NN3A 4Q9HA 4XVRA 3TQCA 1W47A 3LW7A 1MKYA 1T8UA 1JAHA 4O0MA 1P2TA 2C99A 2ZRHA 1MO5A 3AB3A 5CDFE 1G7SA 2D3WA 3SYNA 1H8HA 1RW4A 3UMFA 2LKDA 4G5QA 4V03A 2V1UA 3CF0A 3U4QA 1XXHE 2QRZA 2O8CB 2NPFA 1UDWA 2YVUA 1NSFA 2CVHA 1KKMA 2TMKA 1RRCA 3GP8A 3KL4A 2FZ4A 1KZ7B 2OHFA 4BZQA 2QE7D 1XWIA 1YE8A 4NMMA 1N2CE 5JS7A 4MKHA 5L3SA 3SR0A 1A2BA 2YWHA 1KK0A 1DTSA 4QRHA 1T0JB 2ZYVX 3QXHA 1GZSA 2PMDA 4WXPA 2QAGA 2IYUA 1DPFA 3SFZA 4B76A 1KAOA 2WMNB 3RLFA 3OFNA 1OSNA 3MJHA 2JLWA 1VCOA 1XPUA 5LPNA 4C0SA 1UBCA 2Z4RA 2IC5A 3ZZ0A 3ZVRA 3WP0A 3CRMA 5J4VA 2J41A 1XU4A 3B7GA 4GP7A 3QKRB 1PLLA 4DKXA 3WMEA 3K0AA 1LF0A 5KDDA 2F3TA 2V4ZA 2FSIA 1ZM2A 4EPRA 5G41A 1JALA 1RYFA 2YWGA 2C77A 4WIAA 4XSGA 2BV3A 3WP1B 4AKIA 3BGWA 2OG2A 1TQDA 3QPWA 4OHZA 4EPYA 2QQEA 5B58C 1SVKA 1IN7A 3LWNA 2Z4SA 5E4FA 4PHGA 1EG7A 2FU5C 1G17A 1VCIA 1DELA 3IQXA 3KKNA 3KKQA 3CRQA 4IOMA 4PTLA 4R7ZA 1UKZA 1VYTA 2REBA 4URXR 3WBKA 3PUWA 3BXZA 3G5UA 4HLQB 3VR6A 4JVLA 4JBXA 1Q1QA 5HE9A 2DHRA 3R9IA 4R2HA 5FTJA 1N0VC 1KJWA 1L4YA 1RFLA 1QVAA 1XB2A 3EW9A 2R2AA 3Q5EA 3NC1C 1DADA 4BFSA 2JLSA 4TTQA 5HTKA 1XEFA 2AD5A 2D2FA 3BRWD 1XZQA 4EPVA 2A9KA 4PZZA 2NO0A 3A4MA 4V0MA 5EP3A 1PLJA 2HLDD 4RFSA 5AUQA 1KKLA 4JLAA 4KVGA 1DVRA 4IFBA 2ONJA 4LK2A 4O25A 3LQRA 1F2UB 4DSUA 1G20E 2WKQA 1QHYA 2PL3A 1L7VC 3I61A 2GKSA 3TQFA 3VKGA 2BJWA 1EFRD 3VKWA 1S9HA 2AFIE 1P72A 2BCJQ 1P2SA 2IF0A 2O8EB 1MV5A 1OW3B 1N6OA 3KXKA 2ZJYA 3AQ4A 3PJRA 3TSWA 1KO4A 1JQLB 3B1WA 4TL9A 4MH0R 2GETA 3I1FA 3VX3A 2V3CC 2IS1A 2AKYA 4Q1DA 3UMRA 2P65A 4B3BA 3KUDA 1GNRA 1F2TA 1HE1C 4TLCA 1QRAA 1YRAA 2XNDD 4N0DA 3T12A 1HQCA 5FFMA 3CB4A 1GILA 1T3HA 2D06A 5FTMA 1ZAKA 2ZVPX 2IYLD 4MGZR 5EXSA 3KJGA 4Q1BA 1E4YA 1H8HD 2BKEA 2PT7A 4RKFA 1W5SA 5L3VA 5FPTA 1T91A 4JLMA 1LV7A 2ZUDA 5AJVB 5FUXA 3NIBA 2RHMA 4BPBA 1BYUA 2BBOA 1XD2A 5FOWA 2FH5B 4A0RA 2WOJA 1KSJA 1JPNA 1AGPA 1DS6A 1PLKA 4M1KA 3OEHA 1E2DA 1ONBA 2C9CA 4B34A 2C04A 4TMXA 4US2R 2OM2A 2R9VA 3AEZA 4TLAA 1LS6A 4R9UC 5LD2C 4BFYA 1IOZA 3PEVA 3W6NA 1ODFA 4DLVA 4BECA 4DXAA 3R8FA 1Z6AA 2AWOA 4KI0A 2RGEA 1BO6A 2QUZA 2ERXA 5J47A 2DYKA 3PQCA 4D4LA 4I81A 3TIFA 2OUKA 3BOSA 1HQYE 1II8A 3HU2A 3PIRA 1AS0A 3HP1A 5FPHA 2Q6TA 2C5LA 3GLIE 1SVWA 1S3GA 2QAGC 5DYIA 2FSGA 1XEWY 1OIVA 2KI5A 4PC3A 1KK1A 3KFXA 4LUCA 2JIZD 3SJBA 1K5GA 1ZUNB 4B32A 3NDBB 5IDVA 3UKDA 2R8RA 2OO7A 1O3YA 1OH5A 1NN0A 3UMSA 2PEYA 4JL8A 2EU8A 3AV0B 1GL7A 1XJCA 3RABA 5JI3E 4LBYA 1X6VA 1G6HA 4ARZA 2HCJB 1GP2A 2AR7A 3CKLA 1XD2B 4U5XA 4Q18A 3V9PA 5GADl 4BRWA 5JSZA 2W0MA 3UWOA 4JIMA 4JYBA 3GJ4A 3QXXA 4F38A 1ZU5A 2Y8EA 2BBSA 4DLWA 5DI3B 1YR8A 2XGJA 3SYLA 4KLZA 2IHBA 4UNRA 3IIMA 5EUQB 3LY5A 1JQJC 2D7DA 4BFUA 1BH2A 4ZDIA 3U7FB 1SKQA 1SVLA 4OJQA 4M8NE 4OHVA 3AVPA 3GLFB 1FUUA 1Q20A 5SZHB 3CNLA 4D6PA 4Z54A 5HKKA 2HLDA 2NG1A 3SDZA 4X8OA 4M1TA 4BLQA 4OI1A 3NHBA 1XTKA 1NMXA 4KFRA 4QBFA 2ZJ5A 2O0JA 3AGPA 3FHOA 4AURA 3FPAA 2YOHA 2DWOA 2ONKA 3QEOA 2GNOA 1YJ5A 2ZYWX 3MLEA 1R0ZA 4UNSA 3WHLA 3AUYA 4GDFA 2B7BA 2IK8A 3P1JA 2FN4A 4WZBE 1G3UA 3QOFA 2QBYB 2EQBA 1JBKA 4GMDA 1Z0IA 1ZD8A 4PPQA 5CK5A 2UVQA 3QSYA 1OIWA 2P3SA 1LW7A 4PHHA 3RS3A 2P6UA 4B44A 2F9LA 3QG5A 5F9HA 3CF2A 3FOZA 3UG6A 2F7SA 2VP9A 2VP2A 4F7WA 1P4SA 2F43A 1TL7C 2PZFA 2GESA 2YYZA 4QNMA 4TL6A 2WKRA 3SJAA 2Z6VA 3IQWA 3QXCA 4LY6A 4KFTA 3X1ZA 1Z29A 5FUYA 1CR0A 4B6FA 2XOKA 2YKGA 2ZJOA 3NBZC 1W49A 4IJMA 4KAXA 3W6PA 1U98A 1ZM7A 1GRQA 1OYYA 2AWNA 2IYWA 4KITB 3L0OA 4Q7JB 3LD9A 5JHGB 121PA 5KDLA 4L5BA 1XPOA 1R5BA 4MYTA 1J99A 4FCVA 1NLFA 1I2DA 2RB4A 5GJWC 4P4SB 1VMAA 4G0NA 1AQUA 2A5YB 2C9YA 2FV8A 3CONA 5P21A 2GVDC 3ZQJA 4HAYA 1FNMA 2Q0HA 4EJSA 3GLGB 1Z6GA 3QXSA 4Q9IA 1YZGA 2FWRA 2D2EA 1SZPA 4C7OB 2REXB 2FEMA 2LKCA 2CL6X 2IA5A 3OEEA 3CPJB 3ZIAA 2RGDA 3AF3A 1ZNZA 3QKSA 1NLYA 2ZR9A 3ZZTA 2HF9A 3NXSA 5L3QA 2ZPTX 3Q8XB 3A4NA 3MGCA 5GVSA 1UJ2A 2ZRKA 4A8JB 4NPHA 2WWHA 4IOLA 3P27A 4AYTA 2ZREA 5KSYA 3DDCA 1GL9B 4LJ7A 4Q1FA 3BORA 4UNPA 3U7EB 4DIEA 1Y3AA 4IXMA 1R0YA 1NKTA 1R2QA 4OKSA 4JKIA 3A8TA 4TQ9A 3CO5A 1SKYE 3SHFA 4CT4B 4Q9LA 3SOPA 3F0TA 4MRPA 5DO9A 1YQTA 1IXSB 2X19A 4XSHA 5JSZB 5JJIA 3TVDA 4ARZB 4ILEA 3WXMA 1X3SA 3QF4B 3P32A 2QMOA 4POAA 4EQ6B 3TUZC 1ZIOA 4O3MA 1RKBA 2GHIA 1FUKA 1RC8A 3K9NA 2NMVA 1ZP6A 3AGQA 4PSKA 3REFA 1HV8A 2OCYC 1GFIA 3I62A 5IHPA 4EJSB 5EJEA 1WE2A 1RZ3A 1G8YA 3N70A 3QXJA 3BERA 3CR7A 3SNHA 3MFYA 4B47A 5HZHA 3G82C 3L0SA 1EK0A 2QG6A 3AF0A 1IN5A 5BWMA 3C4JA 3NBYC 1GITA 4BLSA 3BWDD 3U6BA 3GEHA 2V55B 5EE1A 1BYIA 5H1YA 2WWGA 5FUWA 4DVGA 2VPPA 2ZRMA 3B1ZA 1F5NA 2XAUA 2EFCB 2GDJA 1ZCBA 3I5XA 4LYHA 3DKVA 5DSZA 2P2LA 1DAMA 1NIPA 3KUCA 1G9XA 5GJBA 2OILA 1IY1A 3I5YA 3VFDA 3EC1A 3ONWA 1ZU4A 4V0OA 3SBDA 5JCZA 2J0UA 4FWIB 1G18A 3F5FA 2NO1A 3FYHA 1MOZA 3T5GA 4QJ3A 1J90A 1KO5A 4JYCA 3BH0A 2GEVA 1E79A 1KMHB 4DEXA 3TAHA 3B82A 4QBIA 3LH5A 1TAGA 5JCPA 1ZM9A 2IYSA 3O47A 2AX4A 2QT1A 2FDCA 3TBKA 1KYIA 5FUVA 2CE7A 1E2MA 3TMKA 3MUFA 4LHXA 1AKYA 1XTIA 4P32A 3KJHA 3PEWA 4TMWA 5CLLA 4JT4A 1MO6A 1FOEB 5CJPA 1G3IA 2WBLC 2VSOA 3GCGA 2O0KA 4UQOA 1I4LD 1VHLA 1Y63A 2LCFA 3QKRA 4QL3A 5LDDC 1IM2A 2ZETA 2YC2C 4PC2A 2V1XA 2YWFA 4DIDA 5GJCA 2CCKA 1SHZA 1AIPA 2HV8A 2O8EA 3CWZA 3QNUA 3TLXA 2W6JA 5DN6A 1ETUA 2JDID 4TYPA 4C30A 2GCPA 2XZLA 1S2MA 2UZIR 5CK4A 4E03A 5EP4A 4JLNA 4B43A 5KYKA 2RKOA 3QEJA 4LHVA 1UM8A 2I3BA 4XWKA 3GFOA 5FOTA 4PR0A 1WRBA 1ZC3A 1MO3A 1G291 1E2JA 1YZKA 3K70B 4CVNA 2Q9CA 3AM1A 2YOGA 3MWYW 2BMJA 4TWZA 1Q0UA 2VSXA 3VTKA 3KXIA 5KU1A 5TV2A 3KQHA 2P0EA 2ZU0C 4MKGA 4C0JA 3DL0A 2CCJA 4L15A 3ZDQA 5KNBA 2GRJA 3KQUA 3IILA 1G41A 2A2ZA 4LV8B 3ZJYA 2BBWA 4XTRA 2QPTA 1ZINA 1NN5A 3AVWA 2O0HA 4LJ8A 2ZQ5A 1CR1A 1V5WA 4ZKEA 4YDSA 4OBEA 4HUQA 1CRPA 2XSZA 2R62A 2DWPA 2OE2A 1N5KA 2QAJA 4AWXA 4DDVA 4I1OA 4IDHA 2IBMA 5FOSA 1XJ0A 5J4HA 2B6HA 3U3RA 3HU1A 2IXGA 4QG7A 1N0UA 2W6ID 1DAIA 4HAUA 4TL7A 5CDFA 1FP6A 2EVWX 4DSNA 4ZDWA 3GLGE 2OFOA 3E1SA 1NJFA 2XTMA 3K0AB 1OXXK 3ZH9B 2IEYA 3CUEF 2PT5A 1F2UA 2XJ9A 3EZ9A 4OQMA 1TNDA 4KBGA 1CF4A 2HYDA 2AFHE 1OE0A 2ZXUA 4IOJA 2JLQA 3TAUA 1W1WA 3EWSA 1UEJA 4AG5A 3U61B 2IYXA 4JLPA 3ZGXA 2C9OA 1E2LA 2KE5A 1E9SA 4NH0A 3VR3A 1D9XA 2NO7A 4NU0A 5M04A 3CRW1 1VG8A 3I8SA 1JJVA 2EWWA 3I4LA 4CEJB 1Z6XA 1T0HB 4JKYA 4MYCA 1ZVQA 4QGFA 2L0XA 1CJTC 4IHQA 5EE0A 3K0CC 2WVJA 2OBLA 4GMXA 2VSFA 3GFPA 5JI2E 5FPSA 1X8JA 4WXRA 1KI6B 1EFRA 5DIFA 1XRJA 1G3QA 1XEXB 4IKEA 3DEFA 4LJ4A 5KNDA 1IXZA 2J9RA 3K53A 1AZSC 4FMBB 4GPTA 3R7WB 3RS2A 2QGNA 2WPDA 4QGHA 3T35A 2IX3A 3RNLA 4JBYA 4B35A 3VR5A 5IK2D 3RS4A 3B60A 2ZJBA 3EC2A 4Q9KA 3CNOA 1E9DA 4ZPXA 3SC3A 4ZDKA 1DOAA 4F92B 4O2RA 1YZQA 1HURA 1NJGA 2ORVA 4HAWA 1EX6A 1G8HA 1VCNA 2SHKA 4IOKA 4WZAE 3SHWA 2WV9A 3AVYA 3IO5A 4I4LA 4B3GA 2GEUA 2GXQA 2JLRA 3LA6A 4PAOA 3MCAA 2XEXA 2ORIA 2FPLA 1R6BX 2RGBA 4FMDB 1SHKA 2FOLA 4D0GA 1TU4A 4YMVA 1TF5A 4LJ5A 1KI2A 2ZU6A 1XDBA 2C96A 1ZM4A 2N46A 4HB0A 2WMOB 4M9ZA 5H70A 5TVKA 4DEYA 4KODA 3A1UA 3B1YA 1XJQA 3W8RA 3RS7A 1OFUX 1U99A 1NI3A 1N6PA 4M2LA 2BHRA 3AP2A 2QM8A 3LLUA 4Q4JB 1NMZA 4M0LA 3VHXA 3M4YA 3W34A 1AK2A 3EZ6A 3AF4A 1UF9A 2PBRA 4UKDA 1ZJ6A 4C0AC 2B8TA 3KKOA 3B9PA 3SZRA 5FL7D 2PEZA 3CIOA 4DBLC 5CLQA 1FQJA 2PZEA 2PZGA 2DFTA 1Z2CA 2IL1A 3CM0A 2FGJA 1S3SA 2XSZD 3ZIAD 1OXUA 4PHFA 1EESA 2ZE5A 2QP4A 4LOAA 4D82A 1OH7A 3Q5DA 1IJFA 1II0A 2OXCA 2ATXA 1N3BA 4JSYA 1KO1A 1T5IA 1FMJA 5FBLB 2QSYA 4XJXA 3AKYA 4W9MC 3WY9A 1KY2A 1Z0AA 2E1RA 2ZTSA 3U3MA 4DDWA 4YQFA 621PA 3KDSE 1FX0A 4AI6A 4AYWA 3KZ1E 2F1HA 2J46A 3RRYA 4S35A 3HJNA 2BEKA 3JVUA 2NPIA 2ZSEA 1FX0B 3FHCB 1DG3A 2MSDB 4NCHA 5AUOB 4DB4A 2J0VA 3SJCA 4QBGB 5FOVA 1TQ6A 1UBEA 1K8RA 2DB3A 4D4JA 4YMSA 1N6KA 2H16A 2CHGA 1G21E 2V9PA 1OYWA 3P4XA 4I1UA 4HDCA 4LJ9A 4TMZA 4OQXA 2Z0MA 821PA 4HB3A 4UXJA 2JJ8A 4Z8YA 1E0AA 4G5RA 5CIQA 2VHTA 3K9LA 4GI7A 3LDAA 4KYUA 3IPXA 1GDDA 2N42A 2RHDA 3CH5A 3C41J 4PAMA 4BE7B 1NY5A 3TUJC 2OLKA 2NZ8A 4DRZA 1EFTA 3THYA 5KPJA 4W5HA 1MRNA 2VTKA 3PUYA 2VF8A 3IDQA 4JLVA 4Q4HA 5E95A 5CM9C 3G0HA 2IS6A 2OXRA 2XJ4A 1QF9A 1NNEA 2P6RA 4XWAA 4B2LA 4HLDA 3DMDA 4BZPA 1XD9A 3D6TB 1E9EA 1TF7A 2BMFA 2NIPA 5E7IA 4GZMA 2XXAB 1OFHA 4DT1A 3FMPB 5IK2A 3Q7QA 3GEIA 1ZIPA 3AH8A 3NH6A 4Y0AA 1P61B 2GF0A 4PSAA 2WJIA 1OHHD 1M8PA 1Z5ZA 3JZMA 3ZVMA 1US8B 3LQQA 2ZM5A 1CIPA 2B21A 2JJ1D 4M4SA 5JHHB 4C0LA 2QBYA 4V0ME 2FZLA 4OYHA 3H0KA 5FBRB 3H2YA 4NHOA 3RSLA 4OHYA 2QP3A 2J5XA 2I4IA 2LWIA 4CZ2A 5EP2A 4PSVA 2PLFA 1Z47A 3QJYA 1JXOA 4TMKA 2ORWA 5EE9A 4AC9A 3X1DA 5FBWB 4XWOA 3A4LA 4M9SA 5A0FA 2J7KA 4LCBA 3EG5A 1HE8B 3NBXX 1Q12A 2KB0A 3GJXC 4XVUA 1E9CA 3TE6A 4BUJA 5FPYA 1H8ED 2IUSA 5C18A 5IRCD 3X2SA 2H18A 1G7CA 2CL0X 5B30A 2WWIA 2WSMA 2ZSAA 2VP4A 2JLVA 1XTQA 4DUGA 2HDNB 3CW2A 4M21A 5FOUA 4K81B 2YJTD 1YZNA 2JATA 3FB4A 4TLEA 4EFMA 3FDIA 1U8AA 1Z22A 2NO9A 1ZM3A 5EXXA 3SQWA 1G4AE 3B2EA 1XMJA 3CNNA 3X1XA 1SVOA 3IHWA 2OBMA 2QGZA 4ACAA 5BYKA 2OAP1 3B1XA 3CRRA 2R44A 4QGAA 3QIAA 1PJRA 1VCMA 3UXMA 4K8OA 2ZSFA 2R65A 4EFLA 4PQYA 3MWLA 1W0KA
chains in the Genus database with same CATH superfamily
3TLEA 1K5HA 2ZJ7A 2H57A 3EXG1 2FEOA 3F73A 2DR0A 1DG1G 4DA8A 3QA9A 4ZAVA 3ZDDA 2E3JA 5HR5A 1Z88A 2P69A 3AVXA 4EPTA 3RK4A 4BNDB 2QSZA 3TGLA 2HIMA 2P6OA 2FW6A 4K0RA 4K6KA 4DLTA 2O8CA 4ICIA 3FJ1A 3ILVA 2DHEA 2OL4A 2PMEA 1F48A 4FQ7A 1D5WA 3O8RA 1BRMA 1DEAA 2CK3D 1P4GA 2ISSD 3L8FA 1YQQA 2QU7A 3R8FA 2K5UA 3C1UA 4PHCA 1VSVA 1XHLA 2Q62A 1UDAA 4QAQA 1ZXBA 2X0EA 4LJLA 4A2WA 3AHHA 2XGGA 3AFGA 1QTRA 3V1YA 1NQTA 3F78A 1SG0A 1ZIDA 1R4MA 5J63A 4ZOQI 1T3TA 1HG1A 1XKXA 4E6PA 3HKDA 4C22A 5LDHA 5F3WB 3W5UA 1DRWA 5LL6P 1UDBA 1W6UA 4D57A 3ETLA 2ZTHA 2Q1TA 1VIDA 3EQ6A 2AA3A 2IIVA 3AJ8A 2WTBA 3HCPA 3L43A 1CRZA 1NNUA 3LLVA 1U0LA 3DPSA 4IH4A 4JJ8A 4E88A 3MVEA 3JVVA 1K2WA 4NJMB 5E6UA 5K4HA 3KE9A 4D4MA 1SBNE 2BE7A 3ADPA 1F60A 4WNCA 5C1OA 2IOQA 3CLVA 3EX7C 2HJ9A 2GUWA 4UHHA 1Z75A 1D2AA 1E6UA 3CF4G 4FFDA 4G0ZA 1ISJA 2AYYA 5H7XA 3TNDA 2QX7A 3LM8A 4YECA 2F1RA 1I2AA 1NAHA 1XC7A 3FNQA 3P2JA 3RUFA 4RZ2A 5DXJA 3QF7A 1Z07A 3P0JA 2N75A 3CG0A 1Z7WA 4CF7A 4N7JA 3PX7A 2FSHA 1N6LA 1KPIA 1Z8FA 3GVPA 3LBYA 1MH9A 1YZUA 4YYEA 5EJAA 1KMQA 1ISSA 2PFSA 1CSEE 1X19A 4O4JB 2DWQA 4DSTA 3ET5A 4Y18A 1R4MB 1NF9A 4O2BB 4NOKA 3RRMA 3SFVA 3EPHA 2EF1A 4JNKA 3ZHCA 4AY2A 2VCYA 3E0XA 3BDAA 4KP7A 3Q3GE 4RD2A 2Q3LA 4TZ0A 4X8HA 4GT1A 3WLJA 2MSWA 4PAQA 1HFWA 4UUPA 3RWBA 3W79A 3E84A 1XMVA 1XLUA 1VTKA 2CV0A 3A2NA 4XVHA 3G02A 1M0WA 2JVJA 4OU4A 1HA3A 4OKIA 3GUZA 2Z1MA 3VHXB 1CTQA 4NOMA 5EAIA 3I01A 2EXXA 2H2IA 1QRTA 1SBTA 1UZAA 5GV8A 1RBQA 1EBFA 3EDMA 3GFVA 4UMEA 3T1OA 5LP6B 3T7AA 4JI2B 1YONA 2WTNA 1T2AA 2MHCA 2MMGA 4JMPA 3MA0A 4MUMA 1QGED 2IP1A 3CZRA 5GOTA 4TUYF 5D6NA 5FP0A 3TYXA 1RYDA 1UMCA 1QO0A 4X95A 1HQDA 2JIMA 4I08A 1JJ7A 3TTYA 3U44A 1KK3A 1Z8DA 3AEXA 4IH9A 1MX5A 2H54A 2W9XA 3S44A 3I42A 3PXGA 2QDKA 3JQBC 4NBKA 5JRJA 5KQGA 5J58A 4RDIA 1KSGA 2YN4A 4GLOA 4NBSA 4DV0B 3M1AA 1RDFA 3D6FA 4ILKA 5FUMA 1QE0A 2RHLA 1RRFA 5IKPA 3W8DA 4E14A 1X87A 4P0QB 2H65A 5TR9A 1N9KA 2JGLA 3PVZA 2NVUB 3ZWYA 4TMVA 1SPXA 4BMZA 3AC0A 4ESHA 3K70D 4JLSA 5JRZA 3CY6A 4HEJA 4BX8A 4GQAA 1J24A 4PF1A 1E4EA 4D9FA 2AQ8A 2Q3FA 5EJ4A 4TL8A 1ZCAA 4NMXB 3P2MA 3TRJA 1H42A 1NJ5A 3DHEA 2HT1A 4MV0A 4NCJA 3LKVA 5LU8A 1SXQA 4EVRA 2C20A 2BFFA 1JLHA 1PHRA 9ATCA 4BKPA 2DQSA 3WGNA 4LRQA 2FPPB 3COWA 4JBNA 1K88A 1DDIA 4L78A 3ZQ6A 4NBVA 5CFQA 1I7DA 2PIDA 1L7NA 1PIWA 4AZSA 1GUAA 1JWBB 2W6IA 1YGPA 2BKAA 4X3CA 2BDTA 1JEJA 4LYEA 4F5EA 1UBRS 4JP8A 5REQB 2R00A 3OKAA 5EQDA 2ZI4A 4WOJA 4B85A 2UYYA 4ABYA 4I3GA 3GLFE 1XRNA 2VDPB 1S8NA 1WULS 2UYOA 5AW7A 3LW8A 2H52A 3E22A 3H17A 5K3CA 4K6FA 3T95A 4PAGA 3TNJA 4N6NA 3AL0C 2EJCA 5JWOA 1UIRA 3CZPA 4KN5A 2MIIA 3PC6A 4NYIQ 3N39C 1I8TA 3NBFA 1ZH8A 1VG1A 2BGLA 1N5JA 1RYBA 4DZZA 4OK5A 4F97A 1MDFA 2H3HA 1NM5A 2HU8A 5LBIA 4H1WA 3N2EA 3M4JA 1FTSA 5E8JA 5LZ4A 4RD4A 2MSCB 3G7UA 3I0ZA 1YU9A 2J3MA 1R4NA 4NBWA 4D3FA 3OE5A 1RJGA 4C0XA 1XF9A 1OZHA 5CB4F 5J4YA 3AHFA 2B82A 5E9JA 2C5AA 4CL3A 5I47A 3AW8A 3V7YA 4BQRA 4R16A 1KNQA 1YVDA 1QKIA 4K3VA 3S27A 5EUBA 5FNVF 5BOSA 2BUAA 4JLDA 2VJCA 2G36A 2PKCA 4Z9XA 3V2IA 4JCOA 2B8NA 2QY6A 1JJAA 2FW1A 4PQGA 4WT7A 5EIOA 1ABBA 3IUPA 3KLOA 1XDGA 1ADCA 2QTAA 1H2ZA 3W5SA 5AJZA 4BDSA 4D0SA 4BB0A 4UVEA 3S2ZA 3O4RA 2R8EA 4XD7A 5MFZA 4HWGA 2JHGA 2NYVA 2CZCA 3ACBA 2MCFA 1LI4A 4LOJA 4WBNF 3TI7A 1LNSA 3FDJA 4GRDA 4IXNA 3BKXA 3IDAA 1RQPA 5BUCA 1GGVA 3QKWA 3GMSA 3IHLA 2JGEA 1W9HA 4Q7QA 4FM9A 5JNTA 5HCIA 3T38A 4DQDA 2C9DA 1V47A 2PJZA 5C8VA 4NCXA 4RORA 1WIWA 1XJWA 2ATVA 2HGZA 2W6MA 3K96A 3DZBA 4QDOA 3L05A 1T0BA 4NS1A 1T43A 4XPIB 2QR2A 3CEJA 4QOJA 5COAA 4QGSA 5TS2A 2EDCA 4D26A 3TS1A 4A23A 3N3AC 4AUMA 1CZOA 5FA6A 2JFFA 3NTRA 1BDBA 2DSTA 1NAIA 1EJ0A 2OV1A 2RSLA 5COQA 5KJFA 1T15A 1ND6A 3LGAA 4CKXA 3RJ5A 1P60A 3KRTA 2X9LA 2IZ6A 4RHFA 1JYSA 2ZWPA 4U7GA 3RB8A 3TBFA 4AZ3B 3GD5A 1S5PA 1W5EA 4PZEA 1XVVA 2XOEA 1NYRA 1Q7TA 2VPYA 2FZWA 3HXOA 2ZITA 2XYGA 4W8GA 1LSJA 1U04A 1YBMA 1UM9B 3NT4A 4DE5A 2G28A 5JIBA 4KQ9A 3BJRA 2CCGA 3E3LA 3FNGA 4H35A 3EXIB 4Y6RA 1QCZA 1A5ZA 2GBPA 3EHEA 3EODA 1C8KA 3IVMA 2J4CA 3ICEA 4ZIRA 1EIWA 5JD6A 1KMNA 4O63O 2GCNA 3KKLA 2DM6A 3CZAA 2OHOA 3JALA 3WWYA 4OTZA 3O4IA 3M6FA 3W8NA 5EVCA 4U3JA 3K9FC 1ZK2A 2X3FA 4NJOA 4YAKA 2GRUA 4QGGA 1P33A 5FI3A 4E6EA 5CBKA 1GG9A 1USVA 2QZ9A 4HDQB 2W2VA 4MWSA 2CEAA 1UBKS 4F4IA 4B6JA 3RSFA 2ZRIA 3DOHA 3I6MA 2VYFA 4W1PA 4CIBA 2KPOA 4MV6A 4R2KA 1AGXA 3V4LA 4KO1S 3FTNA 3O8DA 5KC8A 2AQIA 4HD8A 3O31A 3VR4A 1XXHB 1AG9A 4R05A 2WAMA 4PPYA 2F9MA 3T4UA 1YT5A 5B2ZA 1YR7A 5FQOA 2AFIB 4CI0B 5KAPA 2ZQZA 3C74A 1X7ZB 1RZVA 3MXTA 3QVKA 4WFJA 5JS2A 4O1HA 3QF4A 1NM5C 2O2ZA 1QIKA 2OESA 3GU3A 4UCWA 4RY9A 5ELXA 3O1IC 3U49A 2PCJA 3ZHZA 4TLDA 4C4OA 4DMRA 2WLTA 1WCIB 1EHYA 3ANSA 2FHPA 2IHKA 3R40A 1FSZA 4FHGA 5KNBH 3NVAA 3GCXA 4L8GA 1V2HE 2ZRPA 4FFRA 1JMVA 1AQ6A 2PZJA 4YJFA 2IYVA 4MP8A 5IF9A 5BVHB 2NGRA 1VPWA 4KQFA 1XTVA 1FFXA 3PR1A 1JF8A 3FPJA 3INNA 4CM9A 1RRVA 3W4IA 4M9CA 4JJAA 1LRKA 1CUZA 2VK1A 2IS2A 2IYAA 3T15A 2OGUA 5K0NA 3G23A 3CLTC 1TPZA 2P9GA 3C7AA 4E5UA 3VU1A 1UOEA 5JBNA 4M37A 2ZRLA 3ER6A 4INOA 2XNHA 3R1IA 2YNMA 4REQA 3KSMA 3BH7A 3DOFA 1D04A 1TD9A 3B8HA 2UXDB 4NATA 2FZKA 1XG5A 1DC4A 2N9UA 2O7QA 2RB5A 4FZRA 4H0CA 4RFVA 3WX0A 3ZE7A 5B1HA 5HOEA 5JMTA 1VLLA 1QTQA 1V1MB 1QNFA 3GFFA 4CFYA 2Q8QA 4TTJA 1VG9B 1N75A 3O9ZA 4PHTA 1QQ6A 3CMMA 1WDMA 3KP1A 2PGAA 1NJ2A 2FRDA 5C4GB 5EKUA 3P97A 3N3BC 4RE5A 4D2IA 2WWRA 4RTLA 3J81A 5KCMA 3SEQA 3OZIA 3H11B 3K2BA 1YD7A 2LZ0A 3MB8A 4YMHA 2AXPA 4HADA 3KQWA 1YF3A 1JHVA 4CCYA 3RADC 3UFBA 1PT8A 4S1TA 4ZXFA 2OAQ1 4MQMA 4P93A 2B4QA 1POXA 5ARBA 2CNKA 3CUSA 4GZ6A 3ZJTA 2FJPA 5AOCA 2W8BA 2KBEA 4DMFA 1OBCA 2GX6A 4NJMA 5TSDA 3ZG6A 2DH5A 5DNCA 2AZTA 3WLMA 2H4WA 4M55A 3S2YA 1U9CA 4BJ3A 1GKKA 3UWMA 1ZN2A 2C4KA 3JQPA 3RQIA 1MJHA 4UHKA 4DHWA 1ZI8A 4EI7A 3UYLA 4CQMD 5IH3A 3PYXA 4GBMA 2QM7A 3OWXA 3T5BA 4BBJA 5C4MA 4X7MA 2FSPA 3DTYA 1BDJA 2G5GX 4Q02A 3ZE8A 1GFWA 1NF3A 4BAZA 3UHJA 5G2OA 4FKZA 2E87A 4OGLA 4O0LA 4GLLA 4OLJA 3WGHA 2E5LB 7MHTA 3FUXA 4X54A 2B25A 4I14A 3QW4B 3PF9A 3RBVA 4YCBA 3IALA 4ZMSA 2EG5A 5I3ZA 4TM8A 2PZMA 3AVUA 4X62B 1JNYA 4UCQA 4X20B 3FSJX 4F8JA 4FX2A 3CH4B 4LECA 4NECA 2V58A 4HDNB 3BHMA 4JT2A 5DZSA 2Z30A 1II9A 3RVLA 2FMXA 2MR5A 1BWRA 2OWDA 3E70C 3N2KA 3R0XA 4YI3A 2PX0A 3IHTA 5T4BA 5HDBB 2CFIA 1T36A 1ZUHA 1CG6A 1BE1A 3VVCA 2FMFA 2Q3BA 5LBTA 1E94E 2IZ0A 3C7CB 3SQXA 4J03A 4NZOA 4MVXA 3LUAA 1YO6A 5B6JA 3KAJA 5BV7A 5EJ7A 3AR6A 4HRXA 4PG5A 3VISA 3ZCUA 2R7NA 4ODIA 1ECLA 2VK2A 2XDWA 1CETA 4JLOA 2X13A 2GGSA 4BQQA 3B1JA 5BURA 2XADA 5I7EA 3DPUA 4IQ0A 2E9SA 4IZ6A 4PZYA 3ETDA 3ZD9A 4FD2A 3TTTA 3UHFA 3X44A 2HUNA 2IEZA 1S02A 3EGEA 2H51A 4MWBA 1TJYA 4XLTA 3BUSA 4MUAA 2HA2A 2GZ3A 2QROA 2WWFA 1PP4A 1KGDA 3CZ9A 4MKFA 5C3MA 1JDNA 2XODA 4RGQA 2F8MA 1JHXA 4W1SA 2FRVA 4XJSA 3UK7A 5E3HA 4ENWA 4CTMA 3RVDA 1NRIA 3LKZA 4CHGA 5G3YA 5B3JA 1LTQA 4BNJA 4TQAA 1LY1A 4F60A 4EG0A 1IEXA 5CITA 4COKA 5H8WA 5KWJA 1YVPA 3PLAE 2KBFA 1R8SA 3L0PA 1LPMA 1N33B 1E98A 3IAM1 2QNRA 5JNRA 1J2JA 5K8VA 2BGUA 4TXJA 1KI7A 2V7XA 2CLKB 2FG5A 3PJGA 4TTAA 4Z2YA 2B34A 4ZAZA 3UGQA 4A73A 3K6JA 2EKPA 3AR8A 1HT1E 3KHSA 1B76A 3REQA 3CEMA 3LUKA 2PUVA 2C59A 2H5IA 1YS6A 2O8DB 3BIWA 5E6RB 1M0SA 1QHNA 2I99A 3BKWA 3ON5A 2JA2A 3DNFA 4QHTA 1GWNA 3GX1A 4MHOA 3RS0A 5IZ4A 4UE3S 1JJBA 3VI3B 1Q0PA 1JA1A 1VDMA 1VGQA 4KLAA 4X45A 3WMGA 2SKDA 5B7QA 5HCNA 3N0TA 1KJQA 3L7BA 2XY4A 4WI1A 1TVKB 3GAAA 2BFBA 1I14A 5T6BA 2XUFA 1U3GA 3Q0IA 4YAJA 1BE6A 2GLXA 5E6SA 3RTGA 4HATA 1DINA 3PHBE 1A8HA 1V43A 4FSHA 3OT1A 4JIGA 4BFWA 1IHDA 1FZQA 3WK6A 2DG2A 2VYND 5BVHA 4UM7A 2IYYA 4DV7B 3G1TA 4GZ3A 1NRXA 3WNDA 4JWTA 3OQMA 1A76A 3L82B 3RYFA 4EA7A 1T2EA 2GPYA 3C3KA 1CZUA 1OLUA 2YHSA 4BCDA 4IO1A 4J2TA 4Z8XA 1Z6YA 3IKJA 4DR2B 1WR8A 3B3FA 4LZPA 3T9EA 1WOMA 5JJLA 1Q74A 1SXPA 4OQLA 3BH6A 3D3WA 4PLZA 4WA7A 4UVDA 3S6JA 1I0ZA 1MO2A 1SC4A 4HYTA 5AVSA 4BO7A 2FW0A 2QTHA 2G0TA 3NYRA 4J07A 5DNAA 1RLTA 4MAAA 3FMVA 1NIJA 4JA2A 4JD5A 1G6Q1 2E0IA 3SP1A 2VCEA 3BFXA 5JQWA 1GQOA 2O3UA 1G5TA 3W3ZB 4JJKA 4CL2A 1RHQA 4Y2GA 2WY2D 4NEQA 1FMCA 3IOYA 2GEKA 3AFIA 2ODBA 2Q4RA 2P41A 1G5QA 2IY7A 3EARA 2WWTA 4LCEA 4PR3A 4BO9A 4AL4A 4G89A 4TTPA 2ZBVA 5FI1B 5IYZA 1PFKA 2JIQA 2WJ6A 1SRQA 4QELA 2O14A 2BELA 2R84A 5AIBA 5LUAA 2APJA 3I45A 3DOIA 3E3AA 3MGAA 4AUEA 4HFRA 3BTVA 5CW2A 1KERA 3SEAA 3QNMA 2O2XA 3ZEAA 1H9BA 1X77A 1Q44A 2WT4A 4HYYA 1RWOA 4Q5IA 1WNTA 2Q0XA 4Q1VA 5GIPE 4JBLA 1PGNA 2WYWA 1ML3A 2Q1YA 1GRVA 1ND5A 3OIVA 1I9GA 5LZ2A 1IBLB 5JSKA 2YJ4A 2E4WA 3AT1A 2PUGA 3W3AH 3G2JA 1JG1A 3JTMA 2GEFA 5ARDA 4YLGA 1ZMTA 4UAVA 4AF8A 1FFYA 1A8QA 4EBBA 1QU2A 3ITKA 3DSRA 1BMFD 1E4OA 1QHHB 1P39A 2ODWA 2YMLA 3N0XA 3PL5A 2R68A 1PBNA 2O2IA 1VGRA 3OO1A 4JXKA 1IWOA 2XRFA 5HJ2A 3WIEA 3ZWQA 2C07A 5A3VA 4JB0A 4M9QA 1FMFA 1DBVO 1KI8A 4GI1A 5LQMA 4PC1A 4U3JB 1EXMA 1ZOLA 2YTZA 3AKCA 3ML1A 4IYRA 2VK8A 1U8YA 3RUIA 3VC7A 5CB4B 1IQPA 4UBNA 1HX7A 1PJTA 1R88A 1VB5A 3GUVA 4G0MA 2NV2B 1QTNA 3ZS9A 2RGCA 3CA8A 3OO0A 5L3ZA 3IQDB 1WZ2A 4HTFB 3WRXC 4I6JA 1BA2A 3IOMA 2ZIAA 3D4IA 3Q7RA 5TLSA 1KEEA 3TRFA 2ZXEA 3NYWA 1CJUC 5JRDS 2QP9X 3VMFA 4JN6B 1W30A 2CLDX 4WY8A 1N2CA 1NVFA 2MMCA 3OTWA 5DJ5A 3HPQA 3UPDA 4HRAA 1C3VA 1DUVG 3ZWMA 4B17A 2H92A 3TLGB 3EFEA 1EZ4A 4KWTA 3LYUA 1YZYA 5CJJA 3EF0A 2VJYA 1J9ZA 1OWMA 1V2GA 4LGVA 1UK9A 4RV5A 3CLSD 3K1AA 5GMOA 1OIXA 1PD1A 5CG1A 1XMSA 3GT7A 4MO2A 3AL3A 4YCDA 2DKFA 1XRLA 2E5WA 2AE1A 2J31A 4XGQA 1DBSA 1T3SA 5HFNA 3ZX4A 2KX7A 3HZHA 3OJFA 3EEOA 4PYIA 4ARUA 1DLJA 3JAWA 1F0YA 3ZKWB 5L6LB 3T1YB 1E3EA 1YB4A 1R27A 1CUHA 5DCYA 4DAEA 4PWYA 3TL3A 2P3QA 3F5DA 1A8UA 1CFZA 4PPGA 3G9TA 3JS5A 3MWEB 3O4VA 4MEJA 5NULA 3WV4A 3KDPA 1TQ2A 5I48A 4LA4A 4QLOA 1V41E 5E0KB 3CGWA 3SS9X 1HMYA 1QB8A 1MO4A 1GYRA 1R74A 1W75A 2HKIA 2JFQA 3BL8A 1MC1A 4RV4A 4YQEA 4N54A 4EF6A 3HA2A 2WIBA 4DADA 1LBTA 1WV0A 2XMDA 2VTBA 1QUEA 4RVCA 4ZCMA 3F4LA 1QGUB 1Z6TA 2GJ8A 2GWRA 3F7NA 4J9VA 4WDQA 3ECCA 3WKBA 5JARA 5KINB 3HGQA 4BFXA 5A6SA 5EKSA 3IR6A 1D8TA 4IGIA 4S0ZA 3X3HA 4Z6KA 2REQA 3PFIA 2J5RA 2YFHA 2QAIA 4LYJA 2PE5A 4N3NA 3U26A 2GBLC 5C8DA 1WXXA 3DE7X 2REQB 4N5IX 4MMZB 3EQZA 4KQXA 2W83A 1LF5A 1MJNA 1RMYA 1W581 2JGAA 1OLSB 2QXYA 1NBEA 1Q6ZA 3OFJA 3K9BA 4K6MA 3VAAA 1EWKA 2J67A 3TMAA 4PNZA 5DHRA 1HEYA 1CUYA 1JB1A 1ZC4A 4YHBA 5EMNA 2YXPX 3KWLA 4MK4A 3NV7A 4TRMA 3TJZA 2ZWMA 5IYZF 1P4AA 2J59A 2ZTLA 1WMAA 1IMOA 2HJGA 1HOXA 1KH1A 1T8RA 1XKQA 3FKSD 2H9AA 4LXGA 3SI7A 3M82A 4UUMA 3U9TA 4KIFA 2DPYA 1LA2A 3F9IA 3O5AA 4QFMA 5DT9A 3OHMA 4V1CB 1MGPA 3VH3A 2OGZA 1ZOSA 3C3EA 4HFMA 4KW7A 4OBWA 3ROFA 1E6EA 4J7AA 2OUIA 2VHZA 5JBQA 4R31A 3I32A 4FNMA 2GBFA 3I30X 1FNDA 4DMGA 1F0NA 1PJ3A 1JXQA 1I1NA 1SUBA 3LO5A 3Q85A 4A82A 2WJZB 1T5LA 1LI5A 3HBAA 3OLWA 3WQHA 2IY9A 4AJ1A 2CSXA 2Z3WA 3EBPA 1W4AA 4J0QA 2PXXA 3JQAB 4U02A 3O95A 2ZRBA 1ZCFA 3DCJA 3HYCA 1DLIA 5A1TA 5KTKA 2QZSA 2M1XA 3C8ZA 2GCOB 2FFHA 3PU6A 1KHTA 4F8YA 1IB0A 4RSMA 5HF8A 4L9RA 2WINI 4GI2A 4UTZA 4OV6B 1VKJA 2R5FA 4KWCA 3OFKA 3ZXSA 4CIYA 5KYXA 1TZJA 2XECA 3OA0A 3CVYA 4OLAA 4KWHA 3AUFA 4WE3A 2O8VA 2P8JA 1XF1A 2W0SA 4PC7A 5BQ5A 4YRAA 1V4VA 5DW0A 4DIOA 5EKTA 4YVFA 2OFWA 3GXOA 5FLKA 1E1QD 1VHQA 1RHJA 3ZZ1A 4JJ7A 2Q5LA 1P7CA 3WL5A 1MOPA 4N8DA 4PXSA 4X6XA 2QRGA 4XM2A 3DAPA 1MNQA 3AHCA 3HRKA 3OP4A 4K8RB 4WZAB 1WL8A 1BMQA 2QVCA 2Q9BA 4KE8A 5B6IA 2X5XA 3F7MA 5HJ7A 3NONA 1DJQA 1VLHA 4FTWA 3AP3A 2HLHA 4HGOA 4RU1A 4WKOA 4YRBA 3P8ZA 5JROA 2HC9A 4F6LA 2CJFA 1MXHA 1NMSA 4QXPA 5LQNA 1TEHA 2OD9A 3G5MA 5FNZA 4BQPA 2MWMA 4LE2A 3QJGA 4Q9JA 2WFAA 3HKBB 3PE4A 3QMMA 2WVHA 3QUAA 5C8XA 3CINA 4TSFA 2CLOB 3C3PA 3AZOA 3KJEA 3UJHA 1D0VA 4KPUA 3GT4A 4G1MB 4IHJF 1U2PA 4CQMB 2ORYA 1OLXB 2A7XA 1XCJA 4U2BA 3LY9A 1LDMA 1FU8A 3DLPX 4UCXA 1IZZA 2R8ZA 3NUQA 5D51S 3TR5A 3X1WA 4BNTA 4WWHA 3LSTA 1PYDA 2FPXA 1EWQA 1UH5A 2A9RA 4DTIA 4MVJE 2OC9A 5JEEA 1DAGA 1WCV1 5CDYA 3ZX5A 3H1BA 4MGEA 1QF6A 4YP9A 2ISCA 4AN0A 3RAPR 5KSPA 4RLFA 3ADKA 4HAVA 4YO7A 2RG7A 3PUVA 4CR8A 3H5RA 2B8EA 1UFKA 1J5EB 1L4FA 3G0CA 3HWRA 4MSUA 2HRZA 5LB2A 3CE9A 2FF5A 4LXIA 3M33A 3QEBZ 3DBVO 1YR6A 2PD3A 1G9TA 4H1UA 1AM4D 4JB8A 4ROSA 4OFBA 4J0KA 4F2PA 1XDWA 4CIXA 1O08A 3OPYI 5FWYB 3RF6A 3IAM6 5DB4A 2HJSA 2DOKA 4NIMA 4ZCIA 3PJEA 5ICSA 2BGGA 4WKNA 1N77A 2OMKA 3OFND 4E94A 5HP4A 4MVCA 1TXGA 2EYUA 1QLJA 4Y2UA 5A4MS 1PKEA 2PRKA 4YP7A 4AQYB 4RH0A 1E7MA 2IQ5A 2BM0A 2NZYA 1KMMA 4LIPD 4XD2A 1J00A 1KNXA 2V97A 3BTOA 2BY4A 3D9QX 3OJXA 3CS3A 4MWDA 3ZNQA 2JAOA 2VZ0A 4IG4A 4DJDC 1SA0A 4EJMA 4WKBA 5IKMA 5EKXA 5ALEA 1M6VB 3RSOA 2IWRA 3HCFA 4MVJA 1YIDA 5CDGA 3QVUA 1TX4B 4WOCA 4YRLA 2VP5A 3UB3A 1XTJA 3M70A 2D5IA 1W36C 4BX9A 1UDXA 4V39A 3EGOA 2Z56A 1Y8AA 3IIKA 3R5TA 4EFDA 1RAIA 4R3NA 4QBTA 3C4QA 2GCGA 3GUHA 3N5KA 3CKYA 4D7AA 2VXCA 5ENZA 4NBUA 2C3PA 4KQMA 1B8UA 1D1PA 4ALKA 5KQMA 3R7DA 4LYAA 1DE0A 1OV4A 1G1MA 1XP8A 3DYVA 5E7MA 4ND1A 4D02A 1YCFA 3T1QA 2VZ9A 5TJ9A 1S8FA 1V45E 2R85A 4B3DA 1HYGA 3FOEC 5FOXA 4RDHA 3GWZA 2QZJA 5BORA 5ALDA 4ON9A 4EEKA 5K45A 3MLBA 2ZR0A 3Q3HA 4RA6A 1E1NA 1VBNA 2GCOA 3QEMB 4YASA 1U94A 4HZUB 4BNFA 3ZXIA 3LT4A 3KELA 4R1SA 5H80A 4Q4LA 3CT6A 4OD0A 1PL0A 2RH5A 3LUFA 2VDJA 2W6ZA 3ILHA 3VZCA 2Z8XA 3CNHA 3DO5A 3SIRA 4HGQA 3B36A 1PYGA 4LPKA 4M1SA 1UOQA 4QPPA 4M1WA 3RF7A 1M3SA 5EIBC 1DXOA 3SC4A 1YDHA 3CQ9A 2X5JO 2YMMA 5HPYB 4BO3A 1GG2A 3FMOB 3OKPA 4UXHA 1IM5A 3GG2A 4GKBA 3LNTA 1D4FA 4I4TB 4R8SA 2GPAA 1S2IA 4PG7A 3Q9NA 2CC2A 2ZS9A 5CLHA 4MITA 2I7XA 1V48A 3AIMA 4HFJA 4XQ0A 2OZKA 3EK2A 3SZLA 3EAFA 3JCZA 1SQSA 1RJ9B 1TIPA 5KTOA 1OU0A 4WJZA 1EVZA 2YHIA 1RWMA 4DZTA 1QMGA 5KOJB 4FZ3A 5H4HA 4DA6A 3NTUA 3I76A 2FTKE 4JOBA 3ICCA 2P5UA 4HPWA 2B9EA 3FVRA 4EB6B 2BLNA 2XNDA 1M2VB 4HNHA 2FWBA 3WMWA 5L3RA 4NBTA 4CKCB 4G86A 5SY6A 3A9SA 3NBQA 4MP3A 3QYJA 1JPUA 2C95A 2F4NA 2YVKA 3FCXA 1GAEO 3KBBA 3JWJA 5CCDA 3WHKA 3WLFA 1FFBA 4KGDA 2BUBA 1K4KA 2WD9A 5JNWA 1EMDA 2LDBA 1V6CA 1LV8A 2F43B 1VE6A 2VRNA 4F93B 4L3WA 4FGSA 5CFZA 4X66B 4BNZA 1RHRA 3WE7A 4OY3A 4PE5B 3L7KA 2HTEA 3A2MA 3WC4A 1P7ZA 2QRMA 4BZZA 3SSMA 2IHVA 2QOEA 2RGGA 4MUYA 2ZB7A 4XM1A 1GQSA 3O4FA 3DZ8A 4CU5A 4B7CA 4DM4A 1SUPA 2CNOA 3T6KA 1IY9A 3OJLA 2IYZA 4DKJA 1OPXA 4G63A 3DMTC 3FXAA 2Y66A 1A9SA 4CNBA 1YWGO 1A77A 2M6RA 1QH8B 1GZ7A 2ZWOA 4RKYA 2CJPA 2EX0A 4RIFA 3F2IA 2OYRA 3WRYC 1EEHA 2Y1CA 1F2TB 1DJNA 2HLNA 1QFJA 1X1QA 3GRPA 1TADA 2XDYA 2AN9A 3L8ZA 5HYVA 3K0BA 2HBRA 3IQFA 1NBMD 5INTA 1SXJA 3A3KA 2D7CA 4C7OA 1I6WA 1QZXA 5DNUA 2FPIA 3ZCPA 4RJLA 3NGLA 4NF2A 1RRKA 3WTBA 1U2GA 3IXQA 3STXA 1OC2A 1RJFA 3WBBA 1AMUA 1Z8HA 1DV1A 1IQ0A 1QHHA 4L0CA 2QD5A 4BU1A 1DB3A 1Z3CA 1MPTA 3FOCA 4BWYA 4KBFA 1W4LA 1ZRNA 1VL2A 1ZD3A 3WNCA 3MAJA 3PYLA 4WK2B 5CR9A 2YMPA 5EQJB 1XL1A 2ZJ8A 1AK9A 3UKJA 3FHTA 3S1SA 4EECA 4LY0A 1IONA 2C5GA 3ECAA 1W85B 3U3XA 4CG2A 3VJKA 1HY3A 1KKUA 1DKNA 1S8OA 1I5OA 1THMA 2FPSA 5H68A 1F1JA 4P92A 4RZXA 3M1LA 5EJIA 3BHJA 3MGBA 4K9NA 1J0EA 9LDTA 3ZY3A 1YI0A 3HJGA 3H11A 4G5FA 1CUAA 3EYWA 2AI1A 2IW3A 2ZJ6A 3KT3A 3OWOA 4RS4A 4JSRA 2NUTB 3UCEA 2EFHB 1EWRA 2O8FB 4X1YA 4E22A 3R5KA 2DUNA 2QJRA 2ZJ4A 3D0RA 2PSSA 5ECWA 3GY0A 3U5ZB 4Q03A 5F5XA 2J1LA 3PX3A 3ISTA 1G19A 1GL3A 1SU7A 1WDKA 2HSZA 4JYPA 4LJAA 1NVXQ 2VDWB 4JYMA 4IFEA 1N57A 4L2IB 4M7OA 3PXCX 2I7VA 1BVYF 3P9KA 1T8TA 3IURA 1PDOA 4G5XA 1HE2A 4YXFA 3BGIA 3FLMA 1EBBA 2X9GA 3VH1A 1NASA 4C21A 2JLUA 5BRNA 2ZAMA 1G8MA 1W2HA 1EK2A 1MP0A 5DX0A 1F0PA 4M7PA 4CW7A 4RETA 4LOIA 3E05A 1WP9A 1U4SA 2PFKA 4QPJC 3EXG2 5LMCA 1A8SA 1OX5A 4RPHA 3MMNA 4UDNA 3FTEA 4DSOA 3N7AA 1J20A 2ON6A 4BN0A 1FLVA 4JMLA 1J5XA 2ZCUA 3C0KA 3P0EA 4BVLA 1OH8A 1KFKB 2X76A 1SCNE 3OJ0A 1EWVA 5KYWA 3GLHE 5CDHA 3I28A 3AR7A 1BDIA 1WSBA 2NX2A 3O1LA 4IVPA 1K7SN 1CKEA 1SZDA 1TA0A 1UFQA 4RLHA 3TD6A 2PUFA 4L4RA 2XWPA 5JCJD 4N0PA 3SIWA 1RMTA 2EJUA 1N5LA 2GEDA 5KSWB 1EX7A 1M34A 1M2JA 1X86B 4F9TA 4O08A 4FQ8A 4PTZA 2WM2A 4MUEA 4EBFA 2UXCB 2V7WA 4E3ZA 4YMLA 1O57A 2JBAA 2GTPA 3HSYA 3AERB 4L4SA 5EIEA 5L8VA 3ZU4A 3CN7A 5EXTA 4AF6A 1PZNA 4COOA 3F47A 4E5KA 1FJXA 1KJNA 1SU4A 4L72A 4RVUA 3VBEA 3H05A 4O2AA 1REQB 5D2CA 5KSOA 1PG2A 2VEDA 3GH1A 3EEFA 3I9KA 3L7LA 2DXIA 4FW9A 5AVKA 4B3MB 5LP6A 4AKGA 1P91A 3M1YA 2XUHA 3O83A 1R0XA 2GJKA 1WVMA 1K6MA 1OKKD 1GTG1 2EERA 4OYLA 1U1FA 4QYIA 4U63A 1C4KA 1M6WA 1XZ8A 4RHUA 4UHEA 5TGTA 2ZYDA 1ZGBA 4RULA 3GH3A 4JBIA 1LH0A 4Q4HB 4V2UA 3RANA 4E7PA 2BGJA 4MW5A 3TLJA 2R6ZA 3LSYA 1XVTA 4E08A 2F1JA 4WCFC 1BN7A 1BSVA 5CK5A 4NCAA 4W9RA 3KL2A 2P9HA 1L1QA 4O2BA 4BPRA 1J42A 3LBIA 3MOSA 5IT9A 5A0VA 3VTFA 2DF8A 2QU8A 4B7ZA 2FSFA 3O1HB 4KLRA 1FFDA 3RSHA 2FMTA 2NXJA 3HL4A 4BVKA 4CEJA 2Q8PA 3ZWXA 3S55A 4Z1MD 4EHBA 3C8UA 1EFHA 1R9GA 4J4BA 5EESA 5TB5A 4EM6A 4F3NA 2R7KA 4I99A 3MTGA 1E1YA 4JS0A 4HEA1 3INYA 2FUCA 3DEHA 2QJOA 4KXVA 4DA0A 1KAQA 1QAOA 2UUPA 3RUCA 3WJ7A 4JBGA 1WXDA 4UMFA 2BIFA 3A6JA 1W36B 3NEYA 4CMBA 1ZMXA 3VR0A 2II6A 1G16A 5P8WA 4Q47A 2WJVA 3O8QA 3P19A 2BFWA 2P9ZA 2VJPA 2VXYA 3U4HA 3W77A 3WGKA 4YK7A 2EAUA 5TRTA 2X0IA 3T0GA 4CUZA 3KK0A 3DEAA 2MYPA 1D9ZA 5FNVA 3DWGA 1L5NA 4FWTA 5CX4A 1XIVA 2AUMA 2VG8A 3K73O 4I4IA 2WJJA 4XPIA 4X41A 1ADGA 3TIVA 2IBTA 1BHO1 2GZRA 1I2MA 4ESEA 1Q77A 3UFXB 5CAEA 2C58A 4DCPA 4BB9A 1PT7A 2V45A 1Z4JA 4I9NA 1LK0A 5THQA 4Z7OB 3KXLA 2Q49A 3WGQA 1GNLA 2OQRA 1KVSA 2AZMA 4RK4A 4RCYA 3V4ZA 4WCDA 3OD5A 1K4MA 2HRCA 2ZS7A 3BL5A 3ZQ4A 1CU1A 2PMWB 4QBHA 3GRVA 5IKXA 1SB9A 2GK7A 3MJEA 4ZT7A 1P7VA 2AZDA 2ZT5A 3MWKA 3NNSA 3GCDA 4PLGA 4B71A 2YWXA 4BQSA 4WK0B 1GTJ1 2HM7A 2E4ZA 1EUDA 3VDNB 2AYXA 4F85A 4D9JA 4TWRA 4QDUA 2CUNA 2GAOA 1M7GA 3AJAA 3B3JA 4AS3A 1EFUA 2F3SA 3Q0TA 4LYYA 4F4DA 3ZJUA 1YB5A 5DP1A 1O0BA 4G3XA 3HQ4O 2CFTA 3NASA 2BH2A 3M6AA 1I7LA 2O6LA 4UE6A 2EJTA 5DGDA 1W7AA 3B85A 2H5JA 2PYZA 1TZMA 3FOAA 4IO0A 1I5RA 4JJFA 3ZXYA 5CIYA 3TB6A 4LRSB 2WHEA 4M1YA 4QGBA 4B3CA 4BBAA 2NZ2A 2B30A 4GX0A 1KTVA 2HRQA 4FZ5A 5JG7A 3IFSA 1M1UA 1TVKA 1YQ9A 3KPJA 2B7LA 2BKVA 2JFNA 4U6SA 4WX2B 4N47A 1YB7A 3TH5A 1NW9B 2CZQA 3EUWA 3HFRA 2QTCA 3O8QB 4B84A 1CUEA 2R1VB 1WEKA 2G67A 1W36D 2CLCX 1A4UA 5I7UA 2VBCA 1P9OA 3A0UA 3DE0X 4MGIR 3TB4A 3THYB 5A6VA 3EGXB 1W4RA 4AKHA 3A1VA