4HLQB

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
total genus 51
structure length 172
sequence length 172
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlqB00
2OXRA 4KXFB 5BN3A 2Z4SA 4M8NE 3E2IA 1R6BX 3U7EB 4OI2A 3SZRA 1P5ZB 4QJ4A 2A5YB 3Q7QA 4GRAA 3LXRA 4DUGA 3GEIA 2I4IA 1VCIA 1N6OA 1Z0DA 2CHVA 2ODNA 3QEOA 2VHQA 2F1IA 1ZNZA 2PJZA 4XVRA 4Q4AA 4TMTA 4NCHA 4OI0A 3RS5A 1AS2A 3THXA 3QBTA 1Q20A 2CEAA 2WKRA 1XCPA 4LUCA 4CEIA 4OQFA 2CNWA 4Q02A 3R8CA 5EXXA 3FTQA 4LBVA 3ZS8A 2KWIA 3DM5A 1Z6GA 2ZYUX 3NEYA 3E1SA 3VU9B 4FINA 3LBNA 5FBLB 2HYIC 3LDAA 2QZ4A 2Q3MA 3UMRA 1TEVA 1FMLA 4DDUA 1N6IA 1C9KA 3AVXA 1EX6A 2GCOB 3DEFA 2RGBA 4NYMQ 4US1R 1HTWA 4TT3A 3NEJA 4FCWA 2WZQA 4NDZA 5EP4A 1OH8A 4KSBA 1F6BA 3W6NA 3QNUA 4JVSB 3A6PC 3QY0A 4JJKA 4D4KA 1QVRA 1TQDA 1W36D 1IOZA 2P6UA 3TUIC 4XJXA 1JBKA 1DAEA 1GZSA 5EZ6B 3FMPB 1L4UA 2AFIE 3KL4A 2QBYA 5HKKD 2OCAA 2GBLA 1R2QA 4JVMA 1E2JA 3WYGA 2GXQA 2ZRGA 3KTAB 3EPKA 3EZ7A 3EZFA 2JASA 4LV5B 2VP6A 4DT1A 4C0QC 3PITA 3KFVA 3K0CC 4BFYA 4IJMA 4JLMA 3THYA 2GDJA 1DTSA 3KQUA 2ZRIA 1BO6A 5C18A 4OHYA 1U0JA 2D3WA 1UJ2A 5J4YA 3F5FA 2FGKA 3AF2A 3BB1A 1CU1A 4MRPA 4IOLA 5DI9A 2FJUA 2ZYWX 1E32A 1E79A 2C98A 3CRW1 4QBHA 1KI1A 3SBDA 1HE1C 2QQEA 5SZKB 3TR5A 3K0SA 3GJ4A 4BFXA 5HE9A 3PV0A 3AKCA 1ZC4A 3GCGA 5JWHA 5FUVA 1HH4A 1JAIA 4LJ7A 3K1JA 3TRFA 3VHLB 1OF1A 3BRWD 1YZTA 3A8TA 3AKYA 4F4IA 3IIJA 1EWQA 4DSNA 5EP1A 1DG1G 2ZRKA 3SFVA 1II8B 4KSCA 3RDPA 3UG6A 4NCIA 1P61B 2D06A 2O0JA 3BB3A 1OIVA 1OXXK 2RHDA 1OIXA 5EXTA 1W7AA 4OK3A 3VU9A 3I8SA 3L43A 2GA8A 1C1YA 2FMXA 2I3BA 3ZIAA 2IXEA 2FDCA 3PR1A 4ZIRB 4M53A 3EZ6A 2B6HA 2GCOA 3AF1A 1N5IA 3BFVA 4OBEA 1YZGA 4EPRA 5KSOA 1J70A 5FPSA 1D6JA 1RYHA 1S9HA 3AVQA 4B2PA 5HTKA 3JVUA 3MG9A 4E03A 2AD5A 2DCUA 2EYQA 5CB8A 1D2EA 3LY5A 4Q1CA 1ZM2A 4UXHA 1FTSA 1XEXB 2AKYA 5JECA 3AUYA 1W49A 2FSFA 4AI6A 2ZS7A 3AF0A 2PEZA 1EFCA 4C7OB 4GI7A 4PC3A 1SVWA 3KTAA 3W8RA 3J81k 1P9RA 3BJIC 5AWFC 4JLAA 2QAJA 1U9IA 2GJ9A 2PX0A 2ZITA 1NVVR 1XEFA 2CL6X 2IBMA 3IBYA 1OXTA 2F1RA 3G82C 4JL5A 1HT1E 1W0KA 2V9PA 2V6IA 2ZRCA 4G3XA 4AKGA 5BYJA 5JS7A 1QDEA 3BAFA 4URUR 4CEHB 4RKEA 2ORIA 4EFNA 1A5TA 1ZJ6A 4HDOB 3QSYA 3ZZTA 2IX3A 3LXXA 1F48A 1KO1A 3E70C 1RRPA 5KU1A 2FZ4A 1OFIA 2WJHA 4IVQA 4PQYA 4IDHA 1XMIA 2AXNA 1Q12A 1CR2A 1IHUA 1ZUNB 2A7QA 1AS0A 2FPKA 3NG1A 3SHFA 3B60A 4ZDIA 3QE0A 3GMTA 4DDVA 1M8PA 1KO4A 2GNOA 3D31A 3DMDA 5AJYA 4PPNA 3I92A 1DBSA 1Q1ZA 2A2ZA 2FV8A 4KU4A 3SDZA 2C77A 3SI7A 2B8TA 1II8A 3I5XA 1FNNA 2GXAA 1GSIA 4PZYA 4UJ5A 3DDCA 4P32A 3K70D 3PVSA 3CW2A 1AK2A 5TY0A 3W6OA 3T35A 1CJKC 1RW4A 2JIZD 2FFBA 2V8OA 4NYJQ 5J4LA 1CF4A 5TMPA 1ZRHA 5FTLA 2GJSA 4ZIRA 2FPMA 3ADDA 4QOSA 2AN9A 4KLNA 1OB2A 4IHQA 3PEWA 4RSGA 2Z0MA 1R8QA 2ZSDA 5AJVB 5TXGA 5KSZA 1GRQA 5JCZA 2VL7A 2HDNB 1KDPA 1JQLB 1JR6A 5HPYB 1GIAA 1T3SA 3FVQA 3KKQA 3MWJA 1XEXA 3UATA 2R44A 2ZJ2A 2J0QA 4C7OA 3K09A 3GLFA 1XTIA 2ZYVX 4H1UA 4BZQA 3K0AA 1T5IA 4PSKA 4OK5A 4GOKA 5CDFE 5DN6A 1DAGA 1MOZA 5CJ2A 1CLUA 4RD3A 1VCNA 1G8FA 3SEAA 2GF0A 3LFUA 4F91B 4ACAA 2ZRFA 3IKJA 3M1IA 4PC7A 4XTCS 4WIAA 1S4QA 5EXSA 5B64A 5JS8A 1XD2B 2AHOA 5FPTA 2ANCA 4LHZA 3RC3A 2B8WA 3FHOA 2VP2A 2XJ4A 3RYTC 1BYUA 4YLGA 3RANA 4AD8A 1VG1A 3ZH9B 5FUWA 1MV5A 4QXAA 1UM8A 4K8OA 3GLFE 2PT7A 1N6RA 4HDQB 4AG6A 1QZXA 1W5SA 3LW7A 2Q21A 1KOFA 4LJAA 4LGMA 1IXZA 1KJWA 3L0SA 1UBGA 3OEHD 2HF8A 3KUDA 621PA 1HURA 5F3WB 1OXVA 1NP6A 2A30A 3KXKA 1RE0A 5EXPA 2VLIA 2CCKA 3GJ6A 3LLUA 1XZQA 2NG1A 2CJWB 3HP1A 1G4AE 5B58C 1ZM7A 2IYWA 2Z6VA 3LLMA 3CZPA 4MKGA 2BCGY 2AWOA 2CVHA 3WYFA 1G3UA 3M6AA 3H2YA 1NVWQ 4KYUA 1MRNA 2JLRA 2VH5R 2VHCA 2C03A 1OW3B 4NL4H 5GADl 2HLDA 5CYOA 2XAUA 3SN6A 5FI1B 2VHUA 2CLSA 3TUJC 3U7HB 1T4GA 4JL8A 3OHMA 1TNDA 3VR4A 3WMFA 1WA5A 3B78A 4RD4A 4YXWD 1P9NA 3B1ZA 3GJ3A 3KXIA 5A4JA 5EUQB 2J46A 3BK7A 5JRZA 4A2QA 4MGIR 4LV8B 4YONB 4B75A 1NMXA 1S1CA 1I2MA 1XMJA 3FWYA 4PZZA 5JI3E 5FL7D 1UKEA 2J7PA 1G20E 3AEZA 1VKJA 3VX3A 3ZVRA 3CRRA 1Z29A 2IXFA 2V6JA 1E1QA 2IW3A 2ZI5A 5TVKA 5JCPA 2Q3HA 3CPHA 4IFEA 2F1JA 3EXAA 3OAAA 2BM0A 2FSIA 1ZIOA 1JXOA 3IPXA 4ABYA 1WBDA 5E95A 1E2MA 1G7CA 3VKHA 1BIFA 2R65A 1Z0JA 3T34A 2XGJA 5DYIA 4B71A 1KY3A 1TTTA 1YKSA 5FOWA 1XD2A 3TBKA 3IPYA 4IXNA 5H1YA 4TZ6A 2QMOA 3UK6A 2RGNA 4B74A 3ZVLA 3L2OB 2HCJB 4MDEA 1PLKA 3DHWC 4B6FA 4B3GA 5JRJA 3TE6A 5DISB 5JSZB 1OH5A 3THOA 3QQ5A 1NN5A 2OT3B 1KI6B 4FD2A 4YQFA 4MGKR 3QJYA 1LFDB 3QVUA 4MYHA 3D7MA 4QBFA 3KQLA 4AKHA 1EFTA 1JNYA 5IK2D 5IRCD 4DLYA 2PT5A 2V1XA 4BZPA 4FWTA 3A37A 1Y3AA 4D2IA 2P6NA 2FEOA 5B2ZA 2CJWA 2O5VA 2F43B 4NCNA 4LZZA 2JLXA 1N6NA 3EARA 2ATXA 3AH8A 3HJNA 4B76A 4UKDA 2A5DA 2YWGA 2J0UB 3CLVA 3LW8A 1EFUA 1N6KA 5KTYA 2GEDA 3L82B 2IHBA 3OFNA 1GNRA 1MH1A 3TGPA 2ZJAA 3KQNA 1H8HD 1DS6A 1RPZA 3SOPA 4P4TA 5CIQA 2P5SA 1E9BA 2ASEA 4FCTA 4M9QA 3VKWA 2WOJA 4ASUA 3OIVA 1MO4A 3B6EA 1QHHB 4G5QA 1Z28A 2ZI9A 4O0MA 2BJVA 1KNQA 4DRZA 3U5ZB 3B1XA 3ASZA 2D74A 3T1QA 4MITA 2W0SA 3VR5A 3MGCA 2Q6TA 4JVLA 4DCTA 2WBLC 5FPHA 4DSOA 4Q19A 4PHTA 3B7GA 1Z8FA 3CKLA 2AKAB 2C99A 2X8AA 1HYQA 1D8TA 3KB2A 3B82A 2DFLA 1ZCBA 2B7BA 4EDHA 1WB9A 2KSQA 4KBGA 3U44B 3L8YA 4BUJA 3NH6A 3LRPA 4W5HA 5CITA 1J8YF 4NZYA 4QHSA 1E2LA 2QP3A 2MMCA 1JPJA 4QBIA 1G3QA 1W44A 4GZLA 4F4JA 1WP9A 1XF9A 4EPWA 2CL7X 2X77A 4FIDA 4Q03A 1KZ7B 3BH0A 2GEUA 5E3HA 3WRYC 1JR3D 4URVR 4A8JA 1IONA 1YZQA 2ATVA 2RH5A 5JWRA 1LY1A 1SKYB 4BLTA 4D26A 1KKMA 2YWHA 1GL7A 4HUQB 3NHAA 1II9A 5BW8A 3BBPA 1S9DA 1KI6A 2VO1A 5HZHA 1NN3A 4LX0A 5KSPA 2V4ZA 2R62A 4DEXA 2OESA 1W4BA 3IIKA 5HKKA 5CJPA 4Q7MB 5FR1A 4B44A 2JLYA 3AV0B 4FMDF 4V0LA 1NIPA 4BEJA 1X8JA 4FN5A 3HU3A 2OFOA 1NI3A 1RZ3A 2R6AA 2YWEA 4D0GA 1VPLA 2F43A 2QPAA 5J47A 1EFHA 2X19A 4RD2A 3LH5A 1MABB 4JIMA 4NMMA 3U6KA 3PEVA 4KV9A 4IFBA 1HV8A 5DN6D 3VMFA 1ESMA 2WWFA 4I81A 1KSGA 4UNRA 1HA3A 2YOHA 4L9WA 4AC9A 1Z63A 5E4FA 4TMXA 1BS1A 1ZD8A 3WXMA 1IAQA 4KVAA 2RAPA 3AKEA 5J4VA 2XITA 4LHYA 4W7SA 1E9EA 1P4SA 2V7QA 3MLEA 1SZPA 1CJUC 1XCGB 3QXXA 3FFBA 2GTPA 2E87A 4P33A 4KO8A 1CIPA 1T3HA 3H1TA 3PUWA 4NYIQ 1LV7A 1ONBA 3HPRA 4JLNA 4DWJA 3N2IA 2F3RA 1D2MA 3MSXA 3R9IA 4UNSA 4QKQA 1U8ZA 1GNQA 4PXAA 4WZ6A 4IDPA 1G9XA 3U44A 2NTYC 1AS3A 1ZAKA 2K5UA 4CW7A 3MAAC 4G5GA 3V4RA 2NQ2C 3KXLA 3NIBA 2IYUA 3MRSA 1UBEA 3RSLA 1QHIA 2WWWA 4B47A 1N0UA 3I73A 1FZQA 4MRNA 2W2VA 2H7VA 4U7DA 4DCVA 3TH5A 4S2EA 1E0SA 1CJMA 3IBGA 4Q01A 2WSSD 4AYWA 5B30A 1VYUA 3I61A 1BMFD 3LD9A 2RKOA 4UXJA 1XTKA 3ETLA 4HUQA 1YU9A 3ND9A 1SVOA 2UZIR 4IKEA 4PAQA 3W5JA 1OXUA 5G53C 2EWWA 2JJ8A 1BYIA 1KO8A 1W46A 1XBTA 3B8HA 2NPFA 2WSMA 3SYKA 1FX0B 3X1YA 4LRWA 1EFRD 1KSHA 2IS1A 3S1AA 4GFDA 4R2HA 2WWXA 4C3ZA 4EJSC 5KOYA 2LCFA 1T6NA 1NN0A 1U8YA 4ARZA 5B57C 2ZRPA 3X2SA 1AN0A 1CRPA 3EIHA 2O8BB 4QHYA 3SU8A 4FW9A 3G5UA 3U3KA 3KKOA 1S3GA 3OAAD 2FFHA 2QAGC 4H9GA 3UIEA 1AKYA 3EPJA 5FPYA 4MYCA 2WWGA 5FBWB 1N2CE 3Q5DA 1VECA 5EQTA 4TQUS 3RS3A 1KY2A 1T8UA 4IOJA 1JXMA 3E5HA 4JLOA 4C0LA 5P21A 2EFGA 4IRUB 1FMJA 3BS4A 4F92B 2QMEA 1YZUA 2VF8A 1LTQA 1ZMXA 3W3AA 1U99A 3CR7A 4N3NA 1DARA 1XEWY 3X1WA 2FPLA 3X1XA 3VTKA 3CPJB 2FFQA 3Q8XB 4RFSA 2Z43A 4PANA 2DB3A 3Q7PA 4W5WA 4ZPXA 4IVRA 2A5JA 4MDFA 4YDHB 3AVVA 1W0JA 3TSOA 4DKXA 4WZBE 1G6HA 2IYTA 3Q72A 4EQ6B 4TZ0A 2PCLA 5G40A 1G5PA 2RB4A 4I1VA 3MFYA 2Z83A 1TUEA 1D5CA 3CUEF 2ZR7A 4JBYA 1KI2A 2KJQA 2EFEB 2JIZA 2WJJA 4N1AA 5H68A 4M9ZA 1NSFA 4KBFA 2G83A 4RCYA 1ODFA 1NLYA 1EGAA 2ZIAA 1GG2A 2P2LA 1RKBA 1KI4A 1P60A 2REXB 5CYPA 3CWZA 3FKSD 1N5LA 3H84A 2ERYA 1KI9A 1OJLA 3C15C 1R5NA 5EE5B 4YMVA 3BORA 5KUTA 2GVDC 4M2LA 4V0OA 4ESVA 1V43A 2GCNA 4KYIB 1I2DA 1FX0A 5AK0A 2BBOA 3IEVA 2QT1A 4Q1FA 2YVUA 3NTUA 2XB2A 1XJCA 4J0QA 4KFRA 2Q0HA 2QTHA 4LYFA 4MKHA 4BFUA 1ZBDA 3Q85A 4M1OA 1R5BA 4LJ9A 4DIDA 5CM9C 4XOIA 3ZLJA 2O8BA 1K5GA 2ZREA 2GETA 1IBRA 2WPDD 2YC4C 4GNKA 2ZRDA 4IOMA 4MGYR 1NJGA 2ZI7A 1W1WA 4G5OA 4LV6A 4Q9JA 1E2NA 4NCKA 2JLQA 2BBSA 3P27A 1KGDA 2RHMA 3H4MA 4XWOA 4TL8A 3IIMA 4C0SA 3OEED 2CDNA 1VCMA 2QY9A 1X6VA 1PUIA 4YC7A 1TQ4A 2REBA 4PR0A 3AP2A 1R0WA 5CLQA 3HYTA 3BE4A 4XWAA 3TLXA 3OZXA 1UF9A 5EZ5A 4DC9A 2BWJA 3DZ8A 5JHGB 3R9WA 1FP7A 3GJ5A 3UMFA 2W58A 3HR7A 1SVLA 5J40A 1DAHA 2ONKA 2QQ0A 3OEHA 2O8DB 1M7HA 4LYHA 4TQ9A 2DFNA 3N5CA 3KKPA 3QKTA 4EQ6A 4E07A 1SGWA 3VHXA 2F1HA 2WOOA 2CBZA 3CNNA 1WXQA 2AR7A 3OIYA 5IT5A 4PZLA 5C2JB 4M9XA 2NO7A 2EFHB 5FBRB 4C0HA 3CR8A 1E2FA 5AUPB 4LHXA 2CK3D 1U0LA 3GJ8A 2WJVA 2P3SA 4JBWA 1S2MA 2OZEA 1SXJD 4YXWA 1A7JA 3KDSE 4PTLA 1KK3A 3VR3A 2BHRA 2FE4A 5GJBA 2W6IA 4MYUA 3X1ZA 4RZUA 3H0KA 4R2IA 2V7QD 1U8AA 3FMFA 4HEJA 1GKYA 3EA5A 4IXMA 1S3SA 4HATA 5FL7A 1HY3A 3EZ9A 2Z4RA 2IWHA 4C9BA 3PEUA 5D3MB 2ZQ5A 1G8GA 1GWNA 2RCNA 3WRXC 2PCJA 3R20A 3TSWA 4A9AA 2OE2A 2VTKA 4QFMA 3TUZC 1JECA 3WHLA 1NBMD 1GILA 2BBWA 3ZVNA 3CF0A 1G41A 3C5HA 3W3ZB 3W8NA 4BFVA 3EASA 1JQJC 4A0GA 3AVWA 1M6NA 2AK2A 1IY1A 2Z5FA 1QRAA 2YYZA 4KFUA 2G9NA 4K81B 1IY0A 2PMDA 3GFOA 1IN6A 1DELA 1MR3F 1N5JA 3FFAA 1MT0A 3CF2A 1GITA 1FQKA 2GAOA 1CR4A 3IEUA 2BMJA 1DAFA 2DWOA 4AKEA 4Z8YA 3W6PA 1Z0FA 2BBTA 5GVRA 2H92A 2JCSA 2O8DA 5F9FA 1NMYA 1X8KA 5IK2A 3ND8A 4TMZA 1TU4A 5AUQA 2IHYA 1LW7A 2J0SA 5EUMA 2ZRNA 3K0FB 1VG0B 1Z07A 3PQCA 4WZAE 2JJ2D 3C41J 4ITRC 1SXJC 3CBQA 2NIPA 1ZM3A 1Q21A 2DWPA 3O8BA 4XD7D 4EJSB 3EIEA 3QPVA 3SYLA 2O52A 4GT1A 1W48A 2XTMA 1H8HA 2ORWA 2W2TA 3QOFA 1P9WA 4CIDA 4PC6A 3P32A 4Q7LA 5FTNA 2FZLA 1E9AA 2C9CA 2FG5A 1W47A 4M1TA 5LD2C 2QAGB 3L0PA 3B5JA 1XJ0A 4B2LA 2GILA 3LQQA 2ZRBA 4D0LB 4OHZA 1LF5A 1Q44A 1BOFA 3CIOA 1J90A 3REGA 1J2JA 1I4LD 1NVUQ 1VIYA 2VIIA 2W83A 3LA6A 5FOUA 2X1VA 3QUSA 5D3MA 1N5KA 3DL0A 4JSTA 4C2UA 3K8YA 4F7WA 1X1RA 2XZPA 1W0JD 2QP9X 2D7CA 3PENA 4TYQA 4BEBA 1X3SA 2WKQA 2YC2C 1TL7C 4DLXA 4M9SA 1CR0A 4PQRA 2ZE5A 4QC2A 3ZJYA 4BLOA 4HAYA 4QM6A 1XD8A 2ZROA 1OYYA 2VP4A 4I99A 1QF9A 3O8CA 3LBHA 4JYCA 1IN4A 2JEOA 3DOFA 3IHWA 3X1DA 3ZD6A 4OI1A 2ZVPX 3EW9A 3C14C 4C0BA 1JR3A 2EQBA 4Z54A 1SVIA 1DG3A 2WKPA 4BLPA 1P62B 3EIQA 4MYTA 3A36A 3F3YA 2JLSA 5H70A 1RRGA 2BJWA 1S8FA 4JYBA 5KO2A 2WWHA 3B13B 4HSEA 3TAUA 2WWYA 5GJCA 2FGJA 1ZC3A 3GLGB 3RSOA 2HV8A 2ORVA 1AGRA 1HQYE 2XXAB 4DB2A 1QHYA 3ZZ0A 3ONWA 4JLDA 4KCGA 2SHKA 2AFHE 2BM1A 3NBXX 3M0EA 2IYXA 1PJRA 1E2PA 3Q5EA 1Z6AA 2MSDB 5TB5A 3QVVA 5EP3A 4PFSA 3PUXA 3T15A 3K0FA 5FR2A 3GLHB 4R71A 3PUVA 3A4LA 3NDBB 1JR3E 2DWQA 4GMXA 4G5RA 1SQ5A 5J4KA 1ETUA 5KDOA 1MO6A 3A1WA 5DGXA 1A2BA 4XVQA 2O0HA 4JL6A 2WJYA 5TDHA 4UNQA 2QORA 2A5FA 4CEHA 3QXHA 5AR1A 1AQYA 4KJZA 3DOEA 1SVMA 3TR0A 4B33A 1XU4A 4KAXA 3RS7A 2ZUDA 4M21A 3VR6A 1RFLA 1KI8A 4TLEA 2OFXA 4US0R 4C0AC 5AUOB 4HLDA 1R5OA 1Z22A 2XSZD 1YZNA 3NXSA 2QGNA 2GJAA 3ZYCA 2NO0A 1ZINA 1U2RA 2WAYA 1KKLA 2YJTD 3FMOB 3P4YA 4LC1A 2FNAA 3QKSB 4O25A 3UXMA 3ZQJA 2CHQA 3B85A 3IILA 2JAQA 3I62A 4ESHA 3QXSA 1M1YE 1JALA 2J45A 2C04A 4IDQA 4V0MA 4BLRA 1M34E 4Q18A 3CPEA 4MRRA 3SQWA 5FUYA 3W5IA 3NC0C 4CRWB 1CKEA 4B73A 4AKIA 2OHFA 1E9CA 1IQPA 1NKTA 1RJ9B 4PHFA 2G1KA 3CH5A 3NBFA 4NBSA 5JZVA 3GJXC 5DHFA 5BWMA 3MJRA 2YNMA 4MRSA 2WSSA 2WHXA 4L4UA 3VR1A 1XTSA 1BMFA 1QHSA 2WJIA 2LKCA 4X8HA 2GHIA 4HB3A 1KK0A 2QEQA 1Z47A 4OJQA 3GLGA 2ODWA 4NYMR 1CRQA 4P4SB 1VDZA 3BWDD 4V0ME 4XIGS 5JHHB 2W6ID 1GTVA 3VR2A 2GJ8A 1EFRA 3B1YA 2DPXA 4TL7A 4HB4A 1KIMA 3GLHA 3KX2A 3NBZC 4ZDJA 4O2LA 1X8LA 4A4DA 3FHTA 3MMPA 4V0NA 4V02A 1TU3A 1AM4D 3OESA 2CVFA 3RS0A 4OKSA 821PA 3U4QB 3THWB 1RRCA 4HLQB 4PAOA 1Z5ZA 3UWOA 4RCZA 2IWRA 4RD0A 4RVCA 1N6PA 2NMVA 5E7IA 1MRSA 3KQHA 3B9QA 3ZZUA 1E3MA 4BQSA 3G0HA 2Q9AA 3GEEA 4XSHA 4O2RA 3CRQA 4KLZA 4TLBA 1VG9B 1CP2A 3RRNA 1UFQA 2VSOA 1W2GA 2XJ9A 1E2EA 3VAAA 1RIFA 1ZW6A 3GLHE 3FMIA 3QKSA 1JJVA 4LK2A 3ICEA 4LBYA 2OCBA 1P2UA 1E1RD 4IVPA 1WRBA 1XRJA 2F3TA 3AM1A 1F2UB 2OV2A 5FBQB 1E99A 2J7KA 2OSBA 1XNJA 4MKFA 3UMSA 1G4UR 4Q1AA 2WV9A 3T06B 1PLJA 5LPNA 1EXMA 4II7A 5DYGA 1VHLA 4OHWA 1DEKA 4O3MA 4Q4JB 1COWA 3LX8A 1XTRA 1U0HC 4UNPA 2D4HA 4IEIA 4PHGA 4G0NA 4XH9B 4YMUA 2J59A 2GAAA 1M2OB 1G19A 1U98A 1SXJB 2NO9A 3FKSA 2VRWA 4OQMA 5C46F 2EVWX 5G3ZA 1RRFA 4NH0A 4Q00A 3JVVA 3K0CA 5FOSA 4ERNA 4MRVA 2C95A 2GZHA 1J99A 5L3VA 5J5CA 4L9SA 2PZEA 2GK6A 4P4SA 2DFKB 1DAIA 4OK6A 2IYLD 5DO9A 4TLAA 3TVDA 1CTQA 1KSJA 4PO9A 4S35A 5LD2B 3W34A 1OPXA 4HLUC 2QG6A 3DPUA 1EESA 2VSXA 2ZR9A 1E4YA 1SVKA 2HXSA 3NHBA 5BYKA 4TYWA 1FTNA 1FP6A 4CGZA 4A0HA 1GAJA 4BLQA 3U3RA 2WPDA 5K8LA 1NNEA 1AJEA 3QKRB 3U4QA 1TQ2A 2G77B 5AJWA 3U6BA 3SFZA 2G3YA 4Q66C 2VP0A 1A82A 4WXRA 3CNOA 4OHXA 3OEEA 2G1JA 1Q22A 4LJYA 3BERA 3RWOA 1XXHB 3MUFA 2D2FA 1EWRA 2J5XA 1TEXA 1YRAA 1WF3A 1HT2E 1E2IA 3QPWA 4CZ2A 5JJKA 1GP2A 4BRUA 3ECCA 4RZ2A 2JGNA 5LB4A 3WNCA 1FQJA 2C5LA 2QRZA 2W0MA 3T61A 5M04A 4ILEA 1KAGA 3U2QA 5JSZA 4MH0R 5FI0B 4I1UA 1UPTA 5C4GB 3KB1A 1T0JB 2QRNA 4WOPA 4TYPA 1ZYUA 1UDWA 2LWIA 4YMSA 1KYIA 2MMGA 1QHGA 4HUTA 5FTMA 4DIEA 2X2EA 1XMSA 3UWKA 2HXYA 5EE3A 1OSNA 2RGAA 4D4MA 2AL7A 3PUYA 2H8KA 5FOVA 1E2KA 3KZ1E 1WE2A 2QENA 4GOJA 4LC0A 4Q4JA 1G3MA 1PUJA 2ZAMA 121PA 5CIWA 4AK9A 5FH9A 2J0UA 2DYKA 4HZIA 2WMOB 4FMCB 2CK3A 2WVJA 4LBZA 2OCYC 1KHTA 4GDFA 3A4MA 3PIRA 4JLBA 1SXJA 3PEYA 2FN4A 4MQBA 2A78A 1DADA 5TARA 2WTUA 3T5DA 4KHZA 4DLRA 2IEZA 4Q7JB 1QHHA 3HPQA 4JJZA 2FX3A 3U3JA 2W6JD 4D81A 2J0VA 3LBIA 1Q1EA 3BGWA 4P4UA 4TSFD 1Q3HA 3RRYA 4D82A 4RFVA 2OCPA 3C5CA 2VHTA 3DMNA 4IDOA 2XEXA 5DIFA 1J7KA 1J8MF 3OE7D 3EAQA 1G6OA 1GKIA 4TTPA 3ZGXA 1W4AA 1YZKA 4ZDWA 4A36A 4FWIB 4B6EA 1SXJE 1NBMA 4G1UC 3TW8B 5DI3B 5AUNB 4HAZA 1TPZA 4JLVA 4M1MA 4URYR 4Q48A 2ZSBA 1TF7A 3MWYW 4B43A 1R8SA 3SR0A 1H65A 1KO5A 5KPDA 4QNRA 3LVRE 1XXHA 1PZNA 3AVOA 3B1WA 1ZU5A 1R0ZA 1DPFA 2H57A 4LJ4A 4URWR 4PX9A 1KK2A 4ZI3A 4GP6A 4A6XA 5EE1A 4MGZR 4OQLA 1UKYA 3K53A 5LDDC 4KVGA 3R8FA 3W9YA 1E94E 3A4NA 3CRVA 5KHOC 1IJFA 4C30A 2O0KA 2XZLA 4W5JA 1G7SA 1UKVY 1IXRC 2DHRA 2ZXUA 1NVVQ 2ODEA 1XCMA 2WJGA 2FA9A 1NBME 4AYXA 3P26A 4KFSA 5AJZA 1NVXQ 1CJTC 3B2EA 3CO5A 4U02A 4DCSA 2JLUA 1NL3A 3BIFA 2JJ2A 2PEYA 1KTVA 1P2SA 2J1LA 2PJRA 1US8B 3LAWA 2XNDD 1DAKA 3IO3A 1T0HB 1KI3A 1YZLA 3MWKA 4XD7A 1MABA 3SS8A 2XOKD 4DZZA 1BH2A 1P2VA 1SKYE 3C16C 1Y63A 2IT1A 1AIPA 3UANA 1NG1A 4XTRA 5CK5A 2FFAA 4B3DA 4PO8A 4WW0A 3K9LA 4B3CA 5JFGA 3K9GA 4JVNA 1SVSA 2BMFA 1XZPA 2GCPA 5HCNA 4JT2A 3AF3A 3TW4A 4HAUA 3O8RA 5EE9A 1GM5A 4UJ3A 4Q4AB 4HB2A 2OFWA 1EG7A 5DH9A 2PLFA 4LJ5A 4RD6A 5L3QB 1DE0A 1GVNB 1NF3A 3DKVA 3L8ZA 3UPUA 2WIBA 5DSZA 3IUYA 4LPSA 1H8ED 1KJZA 3AGQA 1NG9A 1G3IA 2H5EA 1HE8B 3BOSA 2ONJA 2QSZA 1LVGA 3P4XA 1ZP6A 1NMZA 5DI3A 3QF4B 2IUUA 4QHTA 2EYUA 4FXPA 2O8CB 2ZJ5A 2ZUBA 1G8YA 2VP9A 4CF7A 1COWD 1KI7A 1IY2A 1TX4B 5FOTA 3PFIA 4B3FX 3I4LA 3Q9LA 1JI0A 4RZXA 2CCJA 421PA 3T1VA 1P72A 3RS4A 4G5SA 2QTFA 1NRJB 3HR8A 4I4LA 521PA 2R6CA 2KB0A 3ADKA 1YJ5A 1MO3A 5JEEA 2FSHA 6Q21A 1GOTA 4QGHA 4DT1B 5HE8A 1Z0IA 1W5TA 2IYZA 3HDTA 4L5BA 3VQTA 4C0JA 4NONA 3THYB 5IDVA 4ZDKA 4DBLC 3EZ2A 4TMKA 2TMKA 2Y8EA 3QG5A 5KNCA 1US8A 2OAP1 4JBXA 4FMBB 2GESA 1OE0A 1KAOA 4M4SA 2IS6A 1NLZA 2RMKA 1Z83A 4JLKA 2J41A 1G3RA 4OJKA 4PC2A 5J4HA 3SC3A 1KMHB 2KBEA 5JEDA 2BOVA 1KMQA 1Z2AA 3RHFA 1TAGA 3GP8A 4Z51A 2BC9A 3NVAA 2XSZA 1Z6XA 2QL6A 1UBFA 1OFTA 1M7BA 2GJKA 2N46A 3R9XA 1G5RA 1NIJA 1E0KA 1NLFA 1Z6TA 2HT1A 2GRJA 2C8VA 4A82A 5L3QA 3NBYC 5DLQC 3KJEA 2R6DA 2ZYTX 4LSGA 5KNBA 1LS1A 1QG4A 3TJZA 2BDTA 1D9ZA 2PLRA 4MKIA 5SZHB 1WBBA 2RGNC 2VF7A 1G18A 3GEHA 2QA5A 2PL3A 2NGRA 4A15A 4GMDA 4Q7KA 2ZI6A 2OM2A 4BGDA 1OT3A 2H16A 3WHKA 4DJTA 3CRMA 1TMKA 3GQBA 3QF4A 4IW3B 4GOXA 3QEJA 1E0AA 3D8BA 4KODA 2O8CA 2ZS9A 3U7GA 1B0UA 4FI3C 4PQFA 1XP8A 4TQAA 4Z8XA 1GKUB 2V55B 4BFTA 1IM2A 1W4CA 4AWXA 4CT5A 3BB4A 3D6TB 1E2DA 4GZMA 1P73A 5F9HA 2AWNA 4RD1A 1KZGB 2ZJ8A 2ZJZA 1OLOA 1KNXA 2JDID 4Q21A 2OBNA 1I4DD 3SJCA 5LB2A 2NO1A 3AGPA 4PSAA 2IS4A 4NU0A 3CF6R 3FDIA 1YHNA 4DXAA 1Q1BA 1P75A 2EFDB 3I8XA 3LX5A 5EP2A 5FL3A 2HCBA 2ZE8A 4CVNA 1R7RA 4V03A 3AQ4A 2V54A 1QBKC 4UNNA 1QHXA 4E22A 1T5LA 1Z06A 2Q9BA 4HLUA 2IF0A 3FB4A 4PAMA 4X8LA 4IEEA 3WP0A 2W2XA 5CLLA 2H17A 3U3OA 5C1BA 3EG5A 3IDQA 3RAPR 2IYVA 2F6RA 3ICQB 4U00A 1N0VC 2XX3A 1CXZA 4OHVA 2UZ3A 2D2EA 1KMHA 1G291 4PPQA 4I1OA 5HCIA 2KBFA 1K6MA 2R6GA 1GNPA 2D62A 4M1WA 2GXSA 4DSTA 1AZTA 2OO7A 2WM9B 3C8UA 2Q3FA 4ZKDA 4Q1DA 4YMWA 1RYFA 3I3SR 2ZM5A 4ZCIA 2O8EB 1L8QA 1ZD9A 4BLSA 3ADCA 4EPVA 2PZGA 1AQUA 3IO5A 3VX4A 2IUSA 4HAXA 5G41A 3HU1A 4LI0A 2JJ1A 3TK1A 1E1RA 3WBKA 2L0XA 2ECKA 1KSFX 1UKZA 4GSYA 4TWZA 4X8OA 4Y0AA 2QI9C 4DEYA 4EFMA 4URXR 4JLPA 1JAHA 4A8JC 4NYIR 1KK1A 1U81A 1R10A 4DDWA 2CCGA 3RC8A 4B3XA 2QNRA 3N2EA 4DDTA 3AP1A 5K8IA 4GL2A 1M74A 1BKDR 5DE3A 4EPXA 5JI2E 3MD0A 4GP7A 5FFMA 1W36C 1TADA 3I5YA 4QGAA 1CS4C 4TLDA 4QBGB 2HF9A 3WBJA 1E96A 2X2FA 5A0FA 1E9SA 4D25A 1D9XA 3SBEA 4B35A 5FTJA 4E09A 4XWKA 5HR5A 5KNDA 2A3RA 5TV2A 1M7GA 4CEJB 1E69A 1TQ6A 2PBRA 4Z1MD 2WICA 1XPOA 3P1JA 3UKDA 1G5TA 1XMVA 1TF2A 3GLFB 1SULA 3K0AB 3WY9A 5CB6A 1JEEA 2FWRA 1FW6A 1OHHD 1D2NA 2QUZA 2VBCA 1WCV1 2QM8A 3AVTA 1P6XA 3K0EA 3QKUA 3CH4B 2CLCX 4BRWA 5BXQC 2DBYA 1FOEB 2IYYA 2GXUA 3LVQE 3NKVA 4B3BA 4D4LA 3FKQA 1YR8A 3I1FA 2ZJBA 2ZETA 3CX8A 2GZAA 4HB0A 1ZNYA 3RNLA 1A1VA 2GZDA 4Y0VA 2GVZC 1XDBA 1YE8A 4ZKEA 4K46A 3EC1A 721PA 5JBQA 4WBSA 3AVPA 1DAMA 1G1MA 1CJVC 1FL9A 4C4PA 1LF0A 3L0OA 4PC1A 2HT6A 4DCNA 1ZM9A 3WYAA 4URZR 3C7KA 2H1LA 2OG2A 4ZO4A 2O8EA 1VIAA 4KITB 2OXCA 3AVUA 1EX7A 2ZRAA 1JPNA 1ZM4A 3FHCB 3SYNA 4GBMA 4IOKA 5D3QA 5BN5A 3T1OA 1Q57A 1G8PA 4WA7A 1E9FA 1OXSC 1IN7A 2H18A 1JB1A 5FOXA 1DO0A 1F3OA 2QE7D 2HJGA 2JATA 1CBUA 1U90A 4XSGA 1XPUA 5CDFA 3RS2A 4EAQA 2P0EA 1Z3IX 2R6FA 3VNUA 2IYRA 5GJWC 1YVDA 3EPHA 3V4FA 3O47A 4HAWA 2CHGA 5AJXA 4EFLA 2ZI4A 4EJSA 2MSCB 1I4TD 1CEEA 3EX7C 4EPTA 4CEJA 2FSGA 2BEKA 2BCJQ 1FPMA 3ADBA 2QMUA 1ZCAA 2IA5A 4QNMA 5JJLA 2C9YA 1ZNWA 2NZ8A 3BXZA 4JLJA 4LYAA 2AK3A 2QAGA 3IQWA 4B32A 4D0NA 4E5UA 2B92A 2W6JA 2OBMA 4DUGD 2CLDX 4DLTA 4IDNA 4TSFA 3QXCA 1G21E 4LJ6A 4BWYA 4P0TA 1YRBA 5FUXA 1E98A 1OYWA 3C4JA 4A2WA 4CT4B 3SE0A 3AB3A 3CB4A 3OE7A 3ZVMA 2AX4A 2ZTSA 4AG5A 2DR3A 1W4RA 1VYVA 3SJAA 2VHJA 1IN5A 2AXPA 1XWIA 2CNWD 3IQXA 3QXJA 4DLUA 1YR9A 3LNCA 3ZQ6A 4A2PA 4BE7B 2B7CA 1ZIPA 4D4JA 1OH7A 1UDXA 2ZI3A 4ZCMA 1X86B 1E6CA 1GL6A 2QGZA 3I72A 1SKQA 4RKFA 5CM8B 5K8TA 1PVOA 1S0UA 4F38A 2ZSAA 1E2GA 4Q1EA 4QL3A 1G64A 3RVBA 3FGNA 5CK4A 2A5GA 5C4MA 4NE2A 4TT3D 4B48A 2O8FB 2GF9A 5GVSA 2D7DA 4AIIA 4Q47A 3CX6A 1NKSA 1NY5A 2EU8A 3JZAA 2A9KA 4LCBA 3DM9B 3K70C 3NDPA 4BFWA 4DLVA 3GLIB 3DVLA 1YR6A 5GJVC 3NH9A 1F60A 2C2HA 1AA9A 2EWVA 2BEJA 3OIUA 3QPUA 1GRRA 3D3QA 2XXAA 1P2TA 1Z6YA 2ZE7A 3TQCA 1NY6A 2HYDA 3KKNA 2UKDA 1R0YA 3AF4A 3EA0A 1N3BA 3HU2A 3L0IB 4OQNA 4DSUA 2RGDA 4BZXA 3K9NA 3N70A 2EW1A 4EUNA 3GJ0A 2XNDA 4LYJA 3K9HA 2UVQA 2ZS8A 3WMEA 2QSYA 4FCVA 1E9DA 1Z2CA 1XJQA 1C4OA 2R8RA 2XOKA 1E4VA 2C78A 2ZJOA 4JKYA 2N1BA 2ANBA 2ZRLA 4N0DA 3WMGA 4TYYA 2V1UA 4DLSA 2HJVA 2E1RA 1E79D 1WMSA 2JA1A 4I1SA 4WAUA 5L3RA 1KDRA 2GWHA 1MO5A 4AURA 5ANRB 3SQXA 3MWLA 3GLGE 4DB4A 4OL0A 3WNBA 1N0WA 2R9VA 4BASA 2JLZA 3F8TA 5KSYA 3BD9A 1LS6A 1ZD1A 2NZJA 4QJ5A 1KDOA 4UQOA 3VKGA 3OF5A 2IYSA 2QN6A 1E0JA 4DCUA 1G7RA 1OV4A 5H8WA 1R4AA 2HEIA 1LB1B 1K5DA 3PUZA 3QIAA 2FH5B 2IXGA 2EFCB 1OKKA 3SJZA 4MUBA 2Q9CA 4L8GA 4D6PA 1EK0A 1H8EA 4PSVA 5KDLA 1XX6A 3VFDA 2JJ1D 5ELXA 4F93B 4LJ8A 1XTQA 2OLKA 1SHKA 3PG5A 2IK8A 4B34A 2ZRJA 3GPLA 4TL6A 2ZU6A 1ZNXA 2FOLA 3M4YA 1KO7A 1RVDA 3ZIAD 3ZS9A 2G0TA 4FMDB 1A2KC 1VMAA 4A8JB 1II0A 4ZI2A 4TN1A 4HAVA 1IXSB 1ZUIA 2IS2A 1RJ9A 4BFZA 3GFTA 4KFTA 3T1TA 2XZOA 2O8FA 2YKGA 4LOAA 2CE7A 1AGPA 1TUIA 2PH1A 2J3EA 1W36B 4C2TA 5EJEA 3A1VA 1N6HA 2GBLC 1HQCA 4LHVA 4YMTA 1GUAA 3EWAA 2FU5C 1MKYA 2OBLA 2R2AA 3FYHA 3KJHA 1XTJA 4A0FA 3GLIA 4TLCA 2IEYA 3EPLA 5JWOA 4TMVA 2ZRMA 4LDJA 3CNLA 3U61B 4HYYA 1Q0UA 2PX3A 3LO5A 5SZIA 2ZANA 2JLVA 3B9PA 4Q9IA 4Q9HA 4TYNA 2AD1A 1QG2A 2CXXA 4JKIA 3IHLA 4R9UC 1PV4A 1FFHA 4Q9KA 1NN1A 4ZV4A 4F4CA 1ELOA 4TTQA 1FNMA 3LQRA 3TMKA 2QPTA 2P5TB 4QM7A 5K8UA 1W0KD 2C9OA 4NKRA 4LY6A 3THWA 2YZ2A 3GLIE 3ZDQA 2YWFA 3EWSA 3TSZA 4CYMA 3GFPA 1DO2A 1OB5A 4LWZA 1FUKA 2VPPA 5L3SB 3OIWA 2P65A 2RGEA 1G16A 3FPAA 1ANKA 3Q3JB 1ZU4A 5L8VA 2F7SA 1KDTA 4LBWA 4V0KA 2DY1A 4QJ3A 5BN4A 2P6RA 2YHSA 4HI0E 1QHNA 3H86A 3CONA 5BQ5A 5SZJA 2BIFA 3W90A 1ESNA 1T9HA 3F0TA 4HLCA 2QPOA 4Q4LA 2NO6A 2HUPA 2BMEA 2OEPA 2ODBA 4L16A 3SJBA 4P3YA 2OAQ1 3BFKA 4MA4A 2F55A 2YOFA 3QBVA 1L2TA 3WP1B 1F2UA 4DLZA 2NOAA 3EC2A 1HEIA 4R7ZA 2E9SA 1PLLA 3R7WB 1IN8A 2PZFA 2ERXA 4YDSA 2FF7A 3A58B 1XFAA 2KI5A 3PCRB 2RGCA 1E2HA 3LV8A 4KI0A 4HZUB 2YOGA 4DVGA 4Q4HB 3RRMA 3ZD7A 3AKDA 2ZEJA 2OLJA 2BKUA 3HYRA 4M0LA 1GRNA 4H1VA 4OYHA 4BECA 2J9RA 4NYJR 3T5GA 4TTRA 1T8TA 1ZUHA 1E2QA 2VEDA 1Q1QA 1TF5A 2XB4A 2ZSEA 4NHOA 2JDIA 4D80A 3RLFA 1SHZA 1U9IC 2OUKA 1F5NA 4G01B 3S1AB 3TNFA 5IF9A 1LNZA 2VQSA 4ARZB 5KDDA 3BFXA 2ZJYA 2G88A 1IJEA 1CR1A 2C96A 2VA8A 4QG7A 1OIWA 3JZMA 4A92A 2WWIA 1NJFA 1OFUX 5DHAA 5JJIA 4PHHA 2I1QA 3QENA 3GD7A 1GDDA 1T3LA 2GKSA 1S1MA 3I32A 3BH6A 4OI4A 5E7MA 1GFIA 4DHEA 3QKRA 3UG7A 4M1YA 3CZQA 3TAHA 3CX7A 2GK7A 5G3YA 4N0EA 3SNHA 3U60B 2IUTA 3LWNA 2WMNB 1G8HA 4HDCA 5FPKA 4RFSB 4R98A 1RC8A 5L3SA 4NPHA 3U7FB 3DO6A 1P3JA 3U3MA 2ZR0A 1N25A 1WDTA 4WVFA 4EKDA 2XNSA 2B21A 5EE0A 4ACBA 2V3CC 8OHMA 1F2TB 1UBCA 2RGGA 1GL9B 2ZU0C 3SHWA 4B2IA 3V00A 2QU8A 4A6PA 3K70B 2I1VB 4M22A 3PXGA 2ZSFA 3B1VA 4Q1BA 4AYTA 4NP6A 2KE5A 2W00A 4JZKA 1Z0KA 2BKEA 3VNVA 3RWMB 2VYFA 1OFHA 2XTZA 2F9MA 2GEVA 4RY2A 3MCAA 3CWQA 3R7WA 2YV5A 4BFSA 1L4YA 3AUXA 1UEIA 2ZUCA 5FTKA 1XPRA 2HLDD 1DOAA 1FUUA 1XXHE 1O87A 3RRZA 4C0KA 1YQTA 4CDGA 4HZUA 2IYQA 4Q4HA 4LPKA 5F2EA 1R0XA 4MUAA 4DLWA 3O8DA 221PA 1L7VC 4X8MA 4A1FA 2ZE6A 2QBYB 2ZVQX 4Z1MA 1O3YA 3KQKA 3K09C 1T91A 1N6LA 2F9LA 4LHWA 2QTVB 1Z08A 5JMTA 1XB2A 1XD9A 2MSEB 2NPIA 3HWSA 3TIFA 4BPBA 3NWJA 4RZ3A 2VSFA 2J7PD 4QRHA 3CM0A 2WIAA 2G6BA 1DVRA 2CE2X 1OHHA 4ZCLA 2REOA 1UADA 4FMCF 1VYTA 1VHTA 4W9MC 1E1QD 4Q9LA 3THXB 2FEMA 2QT0A 2IC5A 3ASYA 4Q5IA 4CEIB 1OKKD 4QGFA 2ZAOA 2ZRHA 4M1SA 2JLWA 1HUQA 1G17A 2BVNA 4L15A 1B23P 2P67A 5KPJA 3GJ7A 1JEDA 2J87A 1G7TA 1W2HA 4EIWA 4PO1A 5A5GA 2WAXA 2VP5A 3WNDA 4GPTA 1K8RA 3QI2A 1ZVQA 4AY2A 5UKDA 2QMHA 3TKLA 4PPGA 1A4RA 4EPYA 5LBIA 1QVAA 2QP4A 4P31A 3DKPA 4RJLA 1VTKA 1AKEA 2BV3A 2OILA 1KJYA 2IL1A 1JJ7A 1U94A 2RGXA 4NTZA 4NCJA 1V5WA 2CMKA 1F2TA 3QG1A 4JSYA 5KYKA 1YR7A 4A0RA 4JS0A 1UAAA 2LKDA 3FOZA 4JMPA 4QGGA 3PJRA 2BMDA 3DZDA 1S96A 1UEJA 3MJHA 3IGFA 2YINC 4TL9A 2QM7A 2QE7A 1VG8A 4OQXA 3TVTA 3KFXA 1WQ1R 2ZPTX 3BC1A 3RABA 3V9PA 5HZKA 3QF7A 5E7JA 1NSTA 2XTNA 3TQFA 4UXIA 3KJIA 4PPFA 1E9RA 1AZSC 1VCOA 1P7CA 4XVUA 5IHPA 3REFA 2IF2A 3NC1C 4ON9A 2G0NA 3T12A 1OH6A 1Z0AA 4US2R 3A1TA 1X1SA 3OFND 2QROA 3FE2A 5JLJA 1XEWX 2CL0X 3AVYA 2N42A 3BH7A 3KKMA 2DFTA 3KUCA 5FBVB 4TMWA 4POAA 5DNYB 5F98A 4U5XA 3KJGA 3P20A 4M1KA 4WXPA 4JT4A 1CULC 4ASUD 3A1UA 3A1SA 1Q3TA 3AP3A 2PMKA
chains in the Genus database with same CATH superfamily
4U8HA 1FYXA 2QTLA 3NANA 2W2KA 2Z4SA 4GVPA 5D5HA 3UK2A 5LMZA 1WXGA 3FTDA 3TTVA 2Z56A 3AWIA 5KB3A 1AXEA 1EB9A 1LSSA 3ZZMA 2A5YB 3SIWA 2M6SA 3IR7A 3Q7QA 3PD1A 1HFEL 3R3UA 1JLKA 4GRAA 5BSKA 1VCIA 1Z0DA 2CHVA 2Y4NA 4HWKA 1XA0A 4IDEA 3X0DA 1YCDA 1OLSB 3ENKA 3RW9A 1BXRA 1RQPA 2X0NA 4NCHA 3QYAA 4RMJA 1AV7A 5BWOA 3UTDA 1IG0A 1OWLA 1VPDA 4TXNA 2J9FB 2WTAA 3CUWA 1PDOA 2NU8A 1J8DA 4D9NA 3C4VA 1Q0HA 3ILSA 1JXQA 2AOVA 4X20A 3SSAA 4JNCA 4HNVA 1YVRA 2DWCA 2ZYUX 3NEYA 4JP8A 1WUKS 3V7YA 4FINA 3LBNA 2W4MA 3GLRA 3S40A 2XDAA 3JRWA 3EAGA 4FBLA 3WSVA 1OX4B 4X41A 4YVFA 5JXJA 2C88A 2YICA 3D6AA 4LWOA 3OD1A 1H9CA 3I01M 3RAEC 1BU5A 4CL0A 2QIPA 3GGOA 1HTWA 1ZCJA 1QLJA 3BDVA 2C7VA 3TMYA 1F6BA 3BD6A 1SMKA 1ULAA 2WF8A 2FG7C 2X8JB 2HREA 4F4DA 4MW5A 5IKOA 2QUIA 4D4KA 5ALPA 1TQDA 2GYVA 1GNVA 4M1QA 4FDLA 3RU7A 2NXWA 3V8BA 4DLBA 1DAEA 4KO1S 1L4UA 2AFIE 4KQMA 2NUAB 3U56A 2OCAA 2CXPA 4W7HA 2DTDA 3WLJA 1R2QA 1N2SA 2DBRA 3DF7A 4REMA 4DNXA 3F4KA 2VOEA 2ZRGA 3I09A 5IT9A 2BGGA 1DJQA 1OTYA 3E03A 3EZFA 1I0IA 1K3FA 1LX6A 2WDZA 3EQ8A 4DT1A 3A7DA 1NVEA 1SH7A 3AILA 4FQ7A 1J8FA 3EG9B 4IJ6A 4IJMA 1TKBA 4BFYA 5ICEA 1RWQA 1TT5B 2FJPA 2GDJA 5F7JA 1BO6A 5GIOE 3PQ3A 4ZRNA 1GUFA 5LB2A 3V3TA 2H51A 3MT0A 2FGKA 3KIPA 4L8FA 3G2HA 5KOIA 2Y1KA 2C2OA 4IOLA 3IEPA 1E32A 2C98A 3CRW1 2GD0A 2HPVA 3MQFA 3M5WA 1L8OA 3OZDA 2QQEA 3TR5A 3K0SA 1Q6ZA 2DU8A 2NV6A 5K4GA 2GZ1A 1FEZA 5HE9A 4L73A 2CV1A 3FUTA 2IH5A 5FDFA 2I4LA 2R4QA 4G65A 1THTA 2GBFA 1ZESA 3IDSA 5YASA 4TV9F 1G9TA 1QIMA 1UT5A 1D5WA 3GCGA 3OIFA 3TLYA 2P5UA 3EVBA 3LK7A 1JAIA 4LJ7A 1NI4A 1YI8A 2HGZA 4E7PA 4QYWA 4QUJA 1OF1A 1OLSA 3JRNA 1YZTA 4N9QA 3W7VA 2GI4A 4CODB 4F0JA 1KJ9A 2YHBA 3AKYA 5ENDA 1JHUA 1NHGA 3ZWXA 3QSGA 1JLLB 4FE4A 4F4IA 5EP1A 2J9FA 3N7AA 1P0CA 4WLFA 2QLFA 4KSCA 3IUNA 3RDPA 4NCIA 1P61B 3SFVA 2O0JA 3WL6A 3KT6A 1ORHA 3PT9A 1TJYA 2GN6A 4Q93A 5C7LO 3HRIA 5DF1A 2QU7A 3NHLA 2G07A 5EXTA 3S70A 3MWDA 3D3EA 1HYHA 3L43A 5F5XA 4DA6A 4L9RA 1OX4A 3NM4A 3A1DA 4KKVA 2HLHA 3ZIAA 2B25A 1RXYA 3C1AA 5H0IA 1AUOA 2IXEA 3WLKX 2FDCA 4ZIRB 4M53A 3BK2A 2UYYA 4NBWA 3E23A 1YZGA 3EDYA 3IODA 4P80A 1A7UA 1Q14A 5AKKA 1B8PA 4B2PA 3AVQA 3FOCA 1JEYB 1B0ZA 3MG9A 2H9IA 3LT2A 1XLTA 2CUZA 2X8JA 1HDOA 3AR4A 3L6UA 3DV0B 3P19A 4LWPA 1ZM2A 4UXHA 3FZNA 3C6XA 4JC5A 3TM4A 4D3DA 3WG9A 2G1UA 4A1OA 4FZVA 2ZPAA 1XEXB 2NUAA 3EVNA 1JBQA 1RMTA 1PGNA 3AF0A 3LPDA 5IKMA 1EJ0A 2V0CA 4XDHA 4MV5A 3KOWA 5K3FB 2YWRA 3W8RA 1R9GA 3NVDA 4IXTA 2IYAA 1BKSB 3ICPA 4JLAA 1GUDA 2QAJA 3DE3X 3W2IA 2H9YA 5IKXA 5TX7A 2JCVA 5EGNA 4ETWA 1M1YB 2UYQA 4OBBA 1IJBA 3D6HA 2E6UX 4KDFA 2IBMA 2BELA 2FEXA 3EG9A 2BMAA 3I0NA 3ILHA 1TT5A 2JH3A 3VUEA 1RRMA 4D6YA 1O0CA 3G17A 3KKKA 3T7KA 1BROA 3PNMA 4JL5A 4YLYA 5ED4A 1MFZA 2B3TA 4G0PA 2V6IA 2ZRCA 1EVKA 3F78A 3KXDA 4MB2A 3NEAA 5BYJA 4K0RA 5I7FA 1UC9A 4E7OA 1ZJ6A 1ONSA 3F9RA 2HL6A 2JANA 4BP8A 4YUXA 2H2GA 3LXXA 2GLTA 2QJWA 2BSXA 1AVTA 2B5WA 2GPAA 1KO1A 1XKLA 3DOIA 3P2IA 3H5WA 5AXCA 2MYPA 4E2ZA 1MIOA 2H1RA 4F86A 4NAHA 3WLQA 2FZ4A 5KU1A 1G2PA 4WKGA 1WMAA 4IVQA 4MW9A 2XUAA 4AMVA 2AXNA 3VR5H 3N0RA 1CR2A 1JHQA 3K30A 2P90A 3LCCA 1IG3A 1O95D 4DXHA 5DNAA 1SD1A 1D4OA 5AI4A 4DDVA 1KO4A 1XMPA 4ARVA 2HWYA 1DBSA 4KU4A 3SDZA 1QU2A 2AQHA 3PIDA 4CBVA 3I52A 4CLOB 1PG0A 1TUBB 2QX6A 4KNVA 4RE6A 4PZYA 4BWFB 2X9QA 1AQNA 5ILQA 2DUJA 1C0LA 4RJ2A 3AHGA 4ZT3A 1MGPA 3T35A 2JIZD 3QZUA 4NYJQ 3NAZA 1DC8A 2FPPB 1ZRHA 3W77A 4EUEA 1PJSA 3MMSA 4ZIRA 2Q5EA 2FPMA 3ADDA 1QLWA 1MGOA 4E2XA 2YHAA 2PXHA 5HRUA 4IHQA 2M2IA 1ORTA 3ET4A 4WXHA 3PEWA 1JEYA 4GSKA 4MDHA 2AKEA 2Z0MA 2ZSDA 1BAPA 5TXGA 3CE6A 4W5NA 1B6TA 3BHMA 2D3TA 3JQ8B 4ZA2A 3C1TA 4PRZA 1CEXA 2Y67A 1WLSA 3V9AA 1GIAA 1T3SA 1JR6A 3O1JC 5CH8A 3KKQA 2X0FA 1N2HA 1SOUA 2HK8A 2JBAB 5EJ8A 5ARCA 1XEXA 3C87A 4ZOBA 3HYLA 5C5EA 1JUDA 1T8SA 2AC7A 4PIVA 3AHJA 4YQZA 5DM1A 3UV7A 4X64B 2ZJ2A 3Q12A 3OJOA 4D3FA 3RTDA 3JYNA 3KKLA 2J0QA 1FFDA 4PU0A 4KK3A 4H1UA 1C9DB 4RK0A 4BZQA 3W1EA 1C3OB 4UTNA 3S29A 2OCLA 3B70A 2ZBPA 5DN6A 5LC1A 1DAGA 1M1YA 2K7FA 1CLUA 2C4TA 3LP5A 3NHPA 1VCNA 4RD3A 4UBKA 3SEAA 4ZVLA 4EX7A 3Q3VA 2WU3A 1RKXA 3LFUA 1H69A 2P9GA 3KYIB 4DV2B 5EUCA 1QGOA 3IKJA 3M1IA 5SV2A 3K94A 3M33A 3W04A 4PC7A 4E4TA 1K6EA 1VJ5A 5IMSA 1RADA 1CQZA 5B64A 4HX5A 2HA7A 2AHOA 2ANCA 4LHZA 1CUBA 4GD3Q 5CA1B 3RYTC 3P71T 4FUQA 2PA0A 1MJGA 1P1HA 4I9FA 1DIHA 3RANA 1TMGE 3OPVA 4AP9A 1GQQA 1U8EA 4LQDA 1BH6A 2HHJA 2ZUSA 4W6ZA 5IVIA 2HBZA 1N6RA 4HDQB 4LZWA 4AG6A 1C9JA 1W5SA 3WWYA 1EM8B 4LZJA 4A16A 2FUG1 1GNSA 1RP7A 1TYZA 2DLDA 3HJAA 3I58A 1KJWA 3EVTA 3R7NA 3L0SA 2R60A 4BNKA 1ISRA 4BGVA 3UPDA 1KVTA 4XQGA 1HURA 3D8NA 3CBGA 2NV0A 3LU1A 2AJCA 2WUEA 3NYIA 5JDIA 5F3WB 2IOYA 3FSRA 2PMFA 5EYPA 4GKJB 1HQDA 1RE0A 5EXPA 1MAHA 1U3VA 2YMQA 5EZYB 1TUBA 3UCXA 1FUYB 1Z5UA 2NG1A 2W6OA 5C5DA 5CA0B 5JOQA 2YY7A 1G20A 1E7RA 4R5HA 2IYWA 4MKGA 2D5BA 2Z6VA 1KA9H 3HL0A 3LGSA 4IQGA 5KHLB 3PDWA 3EXHB 1NVWQ 4KIJA 2X5OA 1SCKA 2HGSA 4H6PA 5JNUA 1QGDA 1KWKA 2ATIA 2FPPA 1C9MA 1T5OA 2VHCA 3E4CA 4X85A 2YX1A 2Q7DA 5GADl 1NONA 2HLDA 3LX4A 4JBNA 2XCRB 1CY4A 3DUWA 3MGKA 5FI1B 4WLOA 3W5HA 4C7JA 3B6ZA 3VI4B 1FUEA 4JI2B 1RR6A 1TNDA 1L7BA 3AY0A 3L6BA 3LI2A 3N0TA 1EXNA 3COZA 4JVOA 3VR4A 1BWSA 3WMFA 2DE0X 2AOXA 4ZZ3A 5EKTA 1MPXA 3B1KA 2J46A 3BK7A 3GEBA 1NLMA 2VXOA 1ID1A 4O4IF 1ITZA 4NK4A 3T9BA 4MAMA 1RYZA 1WNFA 4B75A 4TQGA 2JBAA 1I2MA 3I2GA 5KJ1A 1YQQA 2BEVB 3M3HA 4NZPA 5CGZA 1KPIA 5CVVA 1UZLA 1U0FA 2IP2A 4TLLB 2PL9A 4ZARA 4BMYA 5C7OO 4GI5A 4F06A 3WB9A 3CRRA 3CINA 2FN9A 1Z29A 1CPYA 4IMJB 2G04A 3TW0A 5LM3A 2IW3A 5MN6A 1W85B 1V3QE 3H75A 5JCPA 4X91A 3CPHA 3KHTA 3TEMA 1CDDA 2EW2A 2F1JA 3D54D 3OAAA 3NT4A 1BA3A 1WBDA 1L4BA 1T35A 1WSDA 1H0HA 3IUSA 4UTOA 5DOZA 3ZWBA 2HBYA 5IWAB 5EINA 1G7CA 3HFSA 3NYQA 1Z0JA 2YDXA 3PPXA 4B71A 5CTAA 1TTTA 4JI8B 4BN0A 3D1LA 1M1NB 3RV4A 4PXYA 1Z33A 4IXNA 5K6TA 4TZ6A 3L93A 2PSSA 3OMXA 3UK6A 5T4FA 4AX8A 2RHLA 2RSLA 2WJ3A 2PKXA 1D0IA 3OQHA 1GZ3A 1PLKA 1IWOA 1ZCZA 3QTLA 4N18A 4YJ2B 5EWJB 4C21A 3GLQA 5JRJA 5DISB 3UA4A 2BD0A 1XU9A 1QK5A 2PRSA 3GNQA 2LXNA 2ZFUA 3JPYA 4FD2A 1KI6B 3M9XA 2FPGB 5ECGC 3B7WA 3PNLA 3A32A 3QVUA 4X93A 3RAFC 1ZL2A 3KQLA 1BGVA 1XVLA 2FZWA 4RMHA 1YI1A 3Q0TA 4JYPA 3M7IA 4NOMA 2PT5A 3IPRA 4BZPA 4RKYA 1QDLB 1Y3AA 3D8TA 4D2IA 2P6NA 5EZYA 3T52A 5CA0A 5HVNA 2XOEA 2XRMA 3VVBA 4PG6A 3EARA 3EDRA 3K1AB 5DWDA 4B76A 1WHSA 3EXHA 3FVVA 2EEZA 4UKDA 2FX2A 5HCUA 3LP6A 3C70A 4C7KA 4F9EA 4FI3F 1N6KA 1C3VA 4CM6A 1HNXB 1ECCA 1IBLB 1N1MA 4HJXA 1M75A 1PS0A 2JFHA 3INNA 4IV0A 4R3WA 3KQNA 3MYYA 5CX4A 2IV2X 2FCRA 2ATEA 1DS6A 2OG1A 1RPZA 3MN1A 3PNSA 1NW7A 1ZOIA 2LGJA 4LK3A 1MO4A 1YRYE 1QHHB 3R09A 2PUDA 2Y1OA 2ZI9A 2D0IA 2ZIXB 4ZREA 1A0OA 5GONF 2P9JA 3CXUA 3T1QA 2JK1A 2Q1WA 4MITA 2BEVA 3FCXA 3O4VA 2Q6TA 1NT4A 1GD1O 4DCTA 4EUFA 5DX8A 3TCXB 1EG2A 2CUTA 4PHTA 2CDRA 2ON6A 4WINA 2PGXA 4AP6A 2RGWA 2AKAB 3HB0A 4FEAA 5BPHA 5F23A 2H1SA 1D8TA 2XNCA 3L8MA 4P4NA 1WB9A 1V4BA 2VH2A 1ESEA 3BT7A 1TIPA 4KBGA 3U44B 1BD4A 1FP4B 2P41A 2C9DA 3K1YA 3M6MD 4G1BA 3UJCA 4BUJA 5LNK1 1QK3A 4P0QB 3PNPA 1KXZA 1W94A 2FPWA 4QHSA 4ZCTA 1GQSA 3AR5A 1JPJA 4HGQA 1G3QA 1W44A 4M55A 4QPDA 1M1NA 3VC3A 1HDCA 3ESQA 3WC4A 3ZEIA 4GZLA 4P5PA 3JWEA 3KAJA 4OXIA 2I4RA 2CL7X 3D6VA 3KLPX 4IM7A 4XPIA 2JIBA 1KZ7B 3BH0A 3TZHA 5L7TA 3H5AA 1S5PA 2COUA 4J9VA 1IONA 5EWJA 1UJCA 3LGAA 3TIXB 2PMEA 1SKYB 3NHFA 4J3JA 5EMJA 5IVKA 3CKKA 1USWA 4HNUA 2YWHA 4DA4A 1GL7A 4HUQB 5FADA 5BW8A 1ZLYA 4EYGA 5HZHA 1KI6A 2FPGA 2XUZA 1X92A 4LGCA 4N8DA 5C8YF 1KPHA 4MV6A 1QGED 1UPXA 2A3NA 3SQDA 3H6KA 1L7QA 3S2GA 4DDMA 2JAHA 1SELA 4NFHA 5FR1A 3MRVA 2WKSA 3JD3A 2JLYA 3AV0B 4FMDF 4KQKA 1EUDB 4V0LA 1NIPA 4M8SA 1G42A 3FPGA 1LCIA 1TECE 2NAPA 3G13A 2C54A 1NULA 1Z5OA 5JCJA 1DG9A 1QK4A 4UUBA 4HQKA 3LH5A 1USIA 1NM5A 3BXGA 3U6KA 3I9V6 3TE7A 1WTCA 4EL5A 2H1IA 1ESMA 2P79A 4JC0A 4H6VA 1Y4AE 2H85A 2YOHA 3BEDA 3W06A 3CX3A 4UNRA 1RWNA 2O2HA 1GADO 1UJ6A 2QRVB 3JAWB 2WT8A 5J4VA 1BVUA 2XH8A 1ZJZA 4XIIA 1P45A 1E8MA 5K6AC 2DHQA 3PNOA 3PNVA 5JH7F 1UPAA 1Z9BA 4HEQA 1P4SA 3AXTA 1DBRA 2ACWA 2ZIXA 5AK3A 1SZPA 3QXXA 1HL3A 5GZ1A 5LUBA 3WL7A 5IJZA 1S2IA 2E87A 1GTZA 4GNRA 4FGWA 1QLHA 1YI0A 2ISQA 2ZUVA 2J6HA 1ZMTA 5C3MA 3H1TA 2ICAA 4BUZA 4JLNA 2BGWA 4C4TA 3Q0EA 3E7FA 3TX6A 1TMYA 3N2IA 4WY5A 5FV4A 3MSXA 4UNSA 2PNJA 5K0JA 4BVFA 2XLBA 5DT9A 2HBRA 1TK9A 3U44A 4Z4HA 3O26A 1JAZA 4WJLA 3MJCA 4Y2UA 4KE8A 3RRBA 2NO4A 3ND5A 3TB4A 3KR9A 2NQ2C 3KXLA 4MRMB 1V5GA 4MNTA 3AXSA 3H04A 2HC9A 1OZFA 3G1WA 2CGEA 3PYLA 2ZJ4A 3WIDA 1RJDA 2Z4TA 5CIYA 1K7XB 1N0UA 2OWEA 1J56A 5E38A 2W2VA 4EHIA 3KZOA 3VNAA 3WAKA 4U7DA 5EESA 3GGJA 4LW8A 4QXPA 4I5FA 1E0SA 1CJMA 1BA2A 2OBYA 2BGUA 4MULA 5DEOA 2R66A 1TFUA 3H4IA 3LKZA 1VYUA 5B30A 3LD9A 5DNCA 1RZRA 4G4GA 4FP9A 2ZYRA 4HUQA 2XA9A 3DR5A 3CWCA 3W5JA 4PAQA 2YJNA 4FS3A 1A2QA 5G53C 2EWWA 3QWBA 3MHTA 1BYIA 2AJDA 3EQZA 1MAUA 3B8HA 4UDXX 3RYFB 3SC2B 3SYKA 3X1YA 2DPYA 1EFRD 1KSHA 4NJOA 1YZVA 3P0RA 2IS1A 1EUDA 3CNQS 3IQHX 3S1AA 5KOYA 5F64A 1ENYA 1KEVA 3HH8A 4X9XA 4RDIA 3NASA 1T6NA 2OCXA 4GEKA 4ARZA 3O21A 5EPOA 3ER8A 4KPGA 1RLJA 4TXJA 1GUBA 2ZRPA 1QRUA 2D2XA 1Z8DA 4GQBA 1TGYA 4PWYA 1CDOA 5BSUA 4RPJA 3SU8A 1BX3A 2ZATA 5AM4A 3G5UA 1H2ZA 3O2SB 2II6A 3OQBA 1DKRA 4YP9A 4FT4A 4AM8A 2YV4A 3NHSA 1AKYA 3ASVA 4ECEA 4M8KA 4MYCA 2QRVA 3COPA 1VECA 3B1JA 2QE6A 4I0WB 1JXMA 1GZUA 3PGJA 2HIHA 5P21A 4IRUB 2ZYDA 3BS4A 4F92B 2XDWA 2Q07A 1KJJA 1J0EA 1H2AS 2QMEA 1LTQA 2VF8A 3OUUA 2VDUE 3W3AA 4DUPA 5IZ4A 3IOBA 1PEAA 2NZVG 4RGVA 2B78A 3BWVA 3ORRA 2FWBA 4EW1A 3CPJB 1PSDA 2J6BA 2QS9A 2DB3A 4MQEA 4GKVA 5KKAA 3T5BA 4LRSB 3PX7A 4IVRA 4FYVA 4DDKA 5CFOA 3IJRA 2QUHA 1KEEB 5B7GA 3BHNA 4YAGA 4HS9A 4M36A 5BSGA 2YDYA 1G6HA 3A06A 1JSRA 3ZHTA 4TZ0A 5H4GA 1WDLA 2ZWPA 3PPWA 2CD7A 1C1DB 2FVYA 4RJTA 1PWHA 2B1QA 1QCDA 1LLUA 3ITNA 2G5CA 2Z83A 1TUEA 4NBTA 3RF6A 5IN5A 3CUEF 4L74A 5LL6P 3NP7A 1RWMA 3QGMA 2YW9A 4EZIA 5K3OA 1O0SA 5AW6A 2KJQA 1UOEA 2XV1A 2YNMC 3K4PA 3TRIA 1NSFA 4PV7A 3D3WB 2YWJA 1NLYA 4OATA 1RWPA 4BQPA 2UXBB 1BMTA 4EBFA 2Z5LA 3DT9A 1WPQA 3HJCA 2R8BA 1HYBA 5TPWB 2IOFK 2XDYA 2H7CA 3DVAB 1TZMA 4NOLA 1TDJA 1UZNA 3OSUA 3M5DA 1N5LA 5AK5A 1JWLA 4OL9A 2VF4X 2IYNA 2JBWA 2O8VA 2ERYA 3C15C 1NURA 1R5NA 2PN1A 3GJQA 1EVJA 3EY4A 5BR8B 3BORA 2BSQA 1NI5A 2AUMA 1CUAA 2B3DA 2GVDC 3QIVA 4M2LA 4B4KA 1HDEA 1V43A 1FFBA 4NEGA 1KIFA 1VE3A 4R69A 5B3AA 3VU0A 4IICA 3HCCA 3N8HA 2VQ6A 4MWSA 5JS2A 1U2ZA 3LQ1A 4WOKA 5AK0A 3EQ6A 3IEVA 4JHLA 5FB3A 4JOSA 2YVUA 2A0WA 2J3MA 3NTUA 1EUZA 3UFBA 2PQ6A 3W9UA 4KXQA 4KR6A 2DT8A 1Q0ZA 4JD5A 1LPAB 4ZANA 5LQMA 1KPGA 4R8MA 4OSPA 3QTTA 4DIDA 2H0AA 1FLDA 3KT8A 3MLAA 1IBRA 4GW3A 3L0ZA 5IDWA 4GNKA 4EA6A 4ZFNA 4NV1A 2BHNA 5A71A 4NCKA 1YL5A 1ENZA 5JQGF 1QGYA 2RHMA 1H23A 4RORA 1U7XA 1VE5A 5IJ9B 3MIIA 2P2DA 1Q7BA 3QFSA 4A5OA 4YC7A 1PUIA 2AQIA 3C48A 4GLBA 4A03A 3ZHBA 2REBA 4BWVA 5AESA 2GRUA 3BWCA 5F2OA 4K6OA 2GAFA 2IW1A 2JEYA 3FGOA 1QH9A 3SJUA 4HGOA 4DC9A 2DR2A 2XUIA 3DZ8A 1TEZA 2LR0A 3VNQA 5JSZB 1MX1A 3K2IA 4KDCA 4DCPA 3IVRA 4WEOA 1DC6A 3HR7A 2E4ZA 2Q2VA 2X8LA 4RJKA 1JJAA 3OZRA 2DFNA 1ZGBA 2HU5A 4E07A 1JX6A 3E3NA 4I5GA 2F1HA 7YASA 2CV0A 1C1DA 2CBZA 1C30B 2FOXA 3NO4A 3JQGB 4FKMA 2HLNA 5AHXA 4ZEXA 4I9UA 4CDRA 2ZBFA 3IELA 3EZXA 3W9BA 4BV2A 3QPAA 1DKUA 1P4JA 1JDNA 5K3CA 2C2ZA 2XUGA 2BDUA 1HETA 3G0GA 4H4EA 4TYMA 1E4EB 2XKBA 3PXXA 2NO7A 1P1JA 3D3WA 1GV1A 4Y6RA 5IC5A 3UT6A 4F84A 2Z1DA 1G8SA 2TRSB 4OIMA 5TPWA 4KQ1A 4CQLB 1RACA 3IPLA 2WJVA 3TZBA 3OT5A 3DVAA 3RT9A 2OTCA 2OZEA 1SXJD 2Z3ZA 1A7JA 3KDSE 4YXWA 3RH0A 3WLHA 3IDFA 4I08A 3VR3A 4D46A 2BHRA 1QBGA 1ADJA 2IZZA 1RAFA 2YV3A 4GXTA 4NPCA 1Y5NA 2WD7B 4HOYA 3AL3A 1R4MB 1ST2A 3MGBA 1EH5A 3H0KA 3ND6A 2VNSA 1SC4A 4BJ6A 1KKUA 3IE0A 5F1YA 4KN9S 4LY9A 3M8KA 3UJ8A 4IXMA 3ZOZA 2WUWE 4RAQA 1RM3A 3AFMA 2I65A 4YAJA 1CD5A 1HY3A 1Y8CA 2GPWA 2Z4RA 3FUVA 2ZIWB 3U7QB 4C9BA 5FUQA 3WAGA 4ZQIA 3LM8A 1R0LA 1UDAA 2Q50A 4L7VA 4KR9A 4CKWA 5ES3A 5E8RA 1WUYA 1GWNA 3HCFA 3WRXC 2R5NA 5KMGB 4WHMA 4Z4FA 2Z8YA 4F85A 1DCFA 2OE2A 4ND2A 1VSVA 5HF8A 3WJ1A 5IN4A 1IHYA 5FLYA 3LLVA 3DXYA 1ARZA 2IJGX 4V1CI 3TCNA 3WHLA 1GILA 4Z53A 2O9JA 1JG7A 1BEUB 1KEZA 1HSZA 3HBJA 2RKBA 4FE7A 3W3ZB 2WJZB 3DDUA 1O6CA 3N0XA 4BFVA 3N2GB 1Z8NA 3EASA 2A0KA 2C1ZA 4MW7A 3GUHA 5IJ9A 3AVWA 2O5EA 3GUUA 4R2JA 3VKVA 3CQ9A 4B6GA 3ERCA 3GCXA 1M6NA 4ZXPA 5JCXA 1MB4A 2G4VA 1UOPA 1QRAA 2G9NA 5LYYA 4AMZA 4CFSA 4K81B 1IY0A 3GFOA 3RM3A 3FJ1A 1MT3A 4G23A 3R3JA 1N5JA 4MV0A 3CF2A 7ABPA 3HDYA 1GITA 3UGTA 4UTVA 4NCBA 4GWKA 3P9PA 3PEFA 3IEUA 3OQNA 2ZCUA 4PTYA 1DAFA 4WCDA 5E9AA 4KXLA 3WRYA 4LAFA 1RJEA 5KYWA 1CRLA 5GVRA 1B7GO 2H92A 2XD9A 2FQXA 2XUKA 3V48A 2GPTA 1NMYA 4RTPA 1X8KA 5IK2A 3ND8A 1X1QA 4DJJA 1R5JA 5IUJC 3RVPA 1C30A 3R4VA 2J0SA 1DKMA 2ZRNA 4BGIA 1YU6A 5F51A 2BHSA 2O4UX 1VG0B 2GD6A 3I2KA 3KUUA 3PQCA 2FK8A 2JJ2D 2WNSA 1JLRA 3E22B 2GOYA 1E4EA 4R2WA 5BXYA 2O57A 4Z4EA 1PKEA 5F4BA 3GPBA 1MCZA 3EIEA 3NETA 3T3MB 3LKBA 5SYMA 1VLVA 2JI6A 1H8HA 2XTMA 1NX9A 2A92A 3M6IA 3QOFA 4CQLA 5CCDA 3GL9A 3H2BA 2C9CA 4K9LA 3UNXA 1N7IA 4MLDA 2V7GA 2QTCA 3C45A 2P68A 3V97A 1K68A 5LD2C 1F38A 2P8SA 4Z4GA 2ST1A 2WD7A 2FE1A 2RAFA 1XJ0A 4RK1A 4QRDA 4RIFA 3RAJA 2XW6A 3AX6A 1P2DA 1HT3A 1R9MA 3CIOA 1J90A 4C76A 3PL5A 1EP1B 2C92A 2X8BA 3C5WP 3S81A 3W2GA 3LXMA 2P62A 2X1VA 1UBMS 4RIGA 4O2BB 4U2EA 1JKFA 1G66A 3BEOA 1B8NA 3K8YA 2VHWA 3CW8X 4F7WA 1NA5A 2YHUA 4OO3A 5A4FS 4K6MA 1XWFA 2XUDA 4P8RA 3OM8A 2D7CA 3PENA 4W8HA 3TXXA 1X3SA 2YC2C 1F4PA 1H5QA 5ALXA 3VDQA 3V1YA 5A04A 4G25A 3SMVA 3ZJYA 3OTQA 4R81A 4RHEA 1AZWA 1U2GC 4EENA 4BVBA 1QF9A 5AVJA 1IN4A 1DINA 1S2NA 1NC1A 2GPJA 3IHWA 3N2GA 4LSMA 1EEHA 1P1CA 2EQBA 4Q3EA 1DG3A 2JCBA 4QYIA 3UWDA 2IQ5A 3EIQA 4MVJM 3FVRA 1XCLA 1LJUA 4BRZA 1MVOA 3F3YA 2JLSA 4QA9A 3H3XA 1NMQA 1E7YA 1U5AA 1ZXXA 2ZSIA 3KOUA 5G02A 3I39X 1FVXA 4HSEA 4EP1A 5ICSA 3U49A 2FGJA 4FQ8A 1ZC3A 2WP8J 3K05A 4KQEA 4ZXFA 3G2PA 1P31A 2A9FA 5LA6A 2ORVA 4YFYA 2PMBA 5ESDA 5MGNA 3TG2A 1XRRA 2YV1A 1EE1A 2OKGA 2ZUUA 3ONWA 2DXIA 2AFHE 3NBXX 5H80A 1UK7A 1XEAA 3M0EA 5FQNA 1G59A 3N8NA 2GN0A 4FXOA 1EDEA 2WJPA 4KEAA 4KLCA 3ZYZA 2Q2QA 1T1EA 3R3XA 1N2GA 3AOEA 1TO1E 3DLBA 1QS0B 2ODTX 2NV2B 4X54A 1RCTE 1OA1A 3E22A 1LVHA 4BOYA 4PLCA 4F9FA 3C98A 1IB6A 2FW8A 1OWMA 3KQSA 4MA0A 1ZGAA 4DNQA 5GGXA 1PFGA 1BDBA 3A3NA 3ROEA 2ISSD 1MO6A 4RZHA 3KU1A 2O4CA 4QREA 1A2BA 4AFNA 2PX5A 4JL6A 3GUYA 5TDHA 4UNQA 3GNLA 3FA2A 2JIQA 2QORA 4JUAA 3FOEC 2YMMA 3QXHA 1H4TA 3KR2A 5DCYA 4ZVNA 3DOEA 1SVMA 2CLOB 4F72A 2FKNA 1HFJA 2VCEA 2ZUDA 5HILA 1RFLA 1CB0A 2WSBA 3P9NA 3TLGB 3WBFA 5I8PA 4HLDA 3VXKA 2JA2A 1U9CA 2ZBQA 1R5OA 1SZCA 1SUCA 4LKOA 2PT9A 4F5EA 5IWCA 1S8AA 1W25A 3DW1X 3UXMA 1DZIA 2CHQA 3KJNA 3B85A 3PC2A 3E5NA 2OV3A 4MWTA 1A1SA 1GL3A 1Q2XA 5JZSA 2CLLB 3PZRA 5DCWA 2VRCD 3TZEA 1XAIA 2HBQA 2ZUFA 3IL2A 1JALA 2FWNA 3MJEA 2DH5A 5HSGA 3QE9Y 3HM2A 3L4BA 5DGCA 5DLPA 1YDGA 5I9IA 3TPCA 2QM0A 3GW8A 2F67A 5FUYA 4JT8A 4PBRA 1NVTA 3N2ZB 1IHDA 2PXXA 2WZDA 4G1FA 4A10A 5ECYA 2J9GA 3C5VA 1ZI6A 4L4RA 1ZVJA 4OHOA 3NHUA 1QCZA 1XF1A 3WTCA 4AKIA 3HDQA 4I4CA 1O97C 1NKTA 1RJ9B 2P4QA 3AW8A 4GPEA 3NBFA 2X1HA 4Q05A 4LOKA 1B8VA 1J4AA 5BWMA 4S1NA 4G24A 2DKFA 3QE2A 3LVFO 3MJRA 4O63O 1Z2PX 1C50A 1EMDA 2VOJA 4MRSA 4X44A 1I13A 4D92A 4P3OA 4L4UA 1ZJ4A 1MOQA 2ZIFA 3NATA 4UDOA 4GLLA 2VK8A 3WDMA 1V4NA 1Y89A 1Z18A 2LKCA 4XRGA 3FTEA 3FLMA 1EKXA 3RGGA 1U1IA 1V3VA 3T7IA 1KRXA 2AG1A 3FAKA 3UICA 1JDBC 1NGSA 2EGUA 4NDAA 2FJ0A 1DJOA 3IUMA 2FW1A 1KQ3A 3E8SA 1CP3A 2GJ8A 3W7BA 4CETA 3B1YA 3R44A 2XMCA 2OQ2A 2DPXA 4DJFC 1D0SA 2OECA 4HB4A 2X4DA 1JQ5A 5FYDA 4WLVA 5IX8A 3WWPA 1Z26A 1KIMA 2DQYA 1ZIYA 3ICOA 2A94A 2OFPA 4MCIA 4RENA 5DTIA 3DEIA 4FVTA 1QS0A 1UOQA 3NBZC 4R51A 1ZJYA 1R12A 3GBVA 3HWWA 4ZVTA 3WHIA 1GQYA 1NXQA 1SB9A 3I6QA 1FU8A 2CVFA 821PA 1GLVA 3D0OA 3U4QB 4HLQB 4I8IA 4V0RA 2IWRA 1YFKA 1R4NA 2Z8ZA 4RVCA 1FXWF 2Q9UA 5TPZA 1KQNA 3PTLA 2HWWA 1JHXA 4BHTA 4MR9B 4OYYA 1VKHA 3I9NA 4R2LA 4OJNA 3ZZUA 1AMOA 3CSDA 2XWBF 3GEEA 1V39A 3CRQA 1LWNA 3EGCA 3LPAA 1JQAA 3NAQA 5GM1A 5TSDA 3TLGA 3ICCA 1VG9B 1CP2A 4B80A 5M04A 1O5IA 2VSOA 5ICGA 5JPDA 1W2GA 1GUYA 1E2EA 5FWYB 1G5HA 2F1OA 3LE8A 4CF4A 3R3SA 3FMIA 1C8BA 1SUEA 2GJ4A 3PKIA 4DBZA 1J07A 1YQWA 5CA1F 2JD1A 4XFJA 1TO2E 3RGWS 1F2UB 3QTBA 4I50B 1T6BY 1EU1A 5FBQB 5IW8A 1B41A 1E99A 3T95A 4RDXA 1ZICA 4CE6A 2XBLA 3UMSA 3T7AA 4DW8A 1SUDA 3T38A 9MHTA 4CUJA 1Z56C 1EXMA 1R6XA 4DUYB 3JY6A 3EMKA 1BU8A 1VHLA 3H5LA 3PHBE 1QIHA 3KVOA 4Q4JB 3LX8A 3OM9A 4K5QA 1WXFA 1NYQA 4WE3A 3SZMA 3ZLTA 5JTTA 1GKLA 5KQMA 4G0NA 1EUQA 1B6RA 4YMUA 3MM4A 2IEIA 5BNTA 5B4UA 4DWOA 2GAAA 1GCOA 3LL4A 1G19A 1Q15A 1U98A 3VO1A 4QECA 1YK1A 4NZNA 3WMRA 4IIHA 3VM6A 5C46F 5KNDD 1R15A 1OX5A 2W8BB 4WFIA 4Y2YA 2YUTA 5C8ZA 5FOSA 1HLDA 1VMKA 2JPDA 2R79A 1CNFA 5CW2A 3RI3A 3PLAE 4N5LA 1XRQA 2ACKA 4Z2AA 1KSJA 4YNBA 5DGHA 3ZHOA 4YRJA 2QG6A 3ZN2A 1GPUA 2VSXA 1BJRE 1UBJS 2JAWA 1L5SA 3ZJTA 1E4YA 1SVKA 3CEMA 4IXWA 1O9BA 2HMTA 4R16A 5EIOA 5SY6A 5KKCA 4ZVVA 2EFJA 4ARUA 1EM6A 4J6FA 2J4FA 4M49A 4Y0NA 3K31A 3D7KA 5ADHA 1FP6A 3ZHVA 4CGZA 4A0HA 5TLSA 2VNIA 4N03A 3RYHB 1MRZA 3U3RA 5KNCH 3UUEA 1TKCA 2RKWA 1TRHA 3I9JA 2Z98A 3U4QA 5AJWA 2Q3LA 1PE0A 4Q66C 4R41A 5FPPA 4L27A 4BWGA 2PGNA 3GFGA 4MR9A 3ROGA 2JARA 2NZWA 5ARDA 1Q22A 5AKYA 2JGAA 3NOVA 3FM9A 3NU1A 2OGZA 2EBHX 1J2YA 3HUEA 1CCWA 3RWOA 1YRAA 3G9ZA 4L8YA 2CZGA 3YASA 1E2IA 1KXJA 4IINA 1K7SN 3RCBA 3RV3A 5JISA 1GP2A 4BRUA 2YVQA 5LZ4A 1BCSB 1UWVA 4IWYA 3ZU5A 1FQJA 1DT3A 4IRMA 1HRKA 4PRKA 4TUYB 3W79A 3ZWQA 4CLRB 4DMUB 1KWGA 3Q9NA 3BWYA 4OF4A 4MH0R 3ZJUA 5FI0B 2OHVA 3HEAA 4KV7A 1NXTA 4N7JA 3VOAA 4CKCA 3KB1A 5HNKA 2QRNA 1M2WA 2QK4A 1H2HA 4FPXA 4TYPA 3TRJA 2LWIA 4QGSA 1WEHA 3GN1A 3IDAA 4I50A 4UTXA 4R7GA 2HUNA 2ZYIA 4CMHA 4BMZA 5JD5A 4YJ2F 4Z49A 3TTYA 5AVSA 3HYNA 5FOVA 2AZMA 1E2KA 4B8ZA 3KZ1E 5CFNA 1RXVA 4I5EA 4L78A 1XLUA 4I2VA 3CLUC 3RSSA 1K89A 1TLTA 5K01A 4Q4JA 1G3MA 1PUJA 5DOVA 2Q49A 3KPUA 5EERA 2X4LA 2ZAMA 121PA 2J0UA 2DYKA 4PNEA 1OA0A 2NO5A 4FMCB 2CK3A 1KYQA 4BCCA 4C0WA 1KHTA 1UFKA 2A7XA 3H6GA 4IXDA 4EARA 2CN1A 1HDRA