4HLQB

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
molecule keywords TBC1 domain family member 20
total genus 51
structure length 172
sequence length 172
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlqB00
1DAGA 3SE0A 3RYTC 1OIWA 1NVVR 2A5FA 1NMYA 3FB4A 2ORVA 2FH5B 2VSXA 1XXHA 1OH8A 1CP2A 2C03A 5FR1A 1R8QA 1XJQA 1UADA 4G5QA 4PHHA 2NO1A 4ZCLA 3RLFA 1C9KA 3THYA 4U00A 3BD9A 4ZDIA 2R6GA 4BFVA 5JRZA 3QG1A 4GDFA 2EU8A 1YQTA 4OYHA 1HT1E 3AF2A 4QBIA 4R2IA 3TAUA 3TVDA 1CTQA 4FXPA 1N6PA 1U8AA 2ZYTX 1CR4A 4M1KA 1F2TB 1JR3E 2HF9A 3NBFA 5TMPA 1G7CA 1R0WA 3C8UA 1G3UA 3AF1A 3B2EA 4WZBE 4GT1A 1VIYA 5LBIA 4A8JC 1QDEA 3TE6A 4BRUA 3R9XA 1N5JA 1N5LA 4RFSB 2XOKD 4HAVA 3N70A 1TF5A 2C9YA 2ZUCA 3CKLA 3VNVA 5FTMA 1TU3A 2F1IA 2EFGA 4TSFA 1P2TA 4V0LA 3OIWA 4LYHA 1Q12A 4RD0A 4NCIA 3WBJA 2QEQA 2VP6A 3X1DA 5LB4A 4EJSA 2HT6A 1N6OA 1QRAA 3B1YA 2BDTA 2P2LA 3GJXC 4IVPA 1YR8A 4PZZA 4D2IA 1DTSA 1N6RA 1UKZA 4YDHB 4BFTA 3H84A 1QHIA 3LH5A 4JZKA 5JI2E 4XVUA 3KJEA 1KDPA 4TYYA 4NTZA 1U9IC 3U4QA 3TR5A 1G3QA 4G5OA 4QRHA 1E9BA 3V4FA 3FMIA 3EPKA 3QF4A 1XEWX 2E87A 4GMDA 2CCGA 2C77A 3K0FA 1KI8A 4Q9KA 1LS1A 2QN6A 1SQ5A 2CBZA 3Q72A 4M53A 4Q48A 4LOAA 2D06A 2XB2A 3T1VA 1S3SA 1D2EA 1DO2A 4FWIB 4AYWA 2D2EA 2IUSA 5L3QA 1P2VA 4JT4A 2WJJA 3Q5EA 4Z1MD 1E9FA 4DDUA 2ZRJA 4LUCA 2FGJA 1XPOA 2WWFA 2BMFA 5K8LA 2NZJA 5E7IA 1Z6TA 4DEYA 3H4MA 2AWOA 2O8FA 1Q0UA 3EIHA 2CL7X 3NH9A 1RKBA 3U7EB 2G88A 3U6KA 4A15A 3AVUA 1VYTA 4QGGA 2PCJA 2ZJ8A 3I4LA 4ASUD 5J4VA 1BMFD 1G41A 2KB0A 2IYUA 3PQCA 5H70A 821PA 2A2ZA 3CM0A 1GITA 3DOFA 2W6JA 1KKLA 3ND8A 5DI9A 2RHDA 5JJIA 4CGZA 1XTQA 2WWGA 2ZEJA 1MO4A 4WAUA 2IXGA 2VO1A 2VF8A 4ACBA 1KI7A 3JZAA 1KDRA 3QG5A 1M7HA 5D3QA 5KYKA 2A5DA 1RPZA 2ZXUA 1IXRC 2ZSEA 3MJRA 1XRJA 1KI1A 4XWKA 4WVFA 2ZRMA 2PEYA 1EK0A 4BASA 1C4OA 5F98A 2ZANA 1ZP6A 4P4SA 4PHFA 5D3MB 5DN6A 3R9IA 2I1QA 4LY6A 4I99A 5KPDA 2EWVA 4B34A 2C9CA 2QBYB 5FTLA 3L0OA 2FOLA 2NO6A 5FBRB 4TTQA 4ZPXA 5FUWA 2GF0A 2GZHA 2ERXA 4UNQA 5F9HA 1WF3A 2BM0A 1EESA 3HU1A 3OEHA 4P31A 1YZKA 5A4JA 2EVWX 4Q18A 1N6HA 2WMNB 5DN6D 5AK0A 5JLJA 4NCNA 5AUQA 3U6BA 1KO4A 5FUXA 1Q3HA 3BBPA 5P21A 3BERA 5FI1B 4ZO4A 3BS4A 1I4LD 2YOHA 1E2MA 1S9DA 4Q01A 1XPUA 2GJ8A 4NHOA 1E2NA 4UXJA 2AL7A 5EZ5A 3M4YA 3T5GA 1I4TD 1Q57A 3GMTA 3NTUA 2OHFA 1UKYA 2ZSAA 4XOIA 3RWOA 1HA3A 4CZ2A 3CRMA 1LB1B 2QE7D 3BK7A 4GOKA 3W5IA 4GI7A 1ZU4A 4JVNA 2ZYVX 1G1MA 2QQEA 4KV9A 4L9SA 3P20A 4XIGS 3ZD7A 5J4HA 2QI9C 4LBVA 1A2KC 1VIAA 4NZYA 3RRNA 5JCPA 4WXRA 4YXWA 5A5GA 2XITA 3WMFA 3OEED 4OHZA 4B48A 4LHYA 1E2LA 5CLLA 3RS2A 2DPXA 1KJZA 4KYIB 5CB6A 4EKDA 4PQRA 5JECA 1EXMA 4P33A 2FPMA 2VLIA 2GJSA 5CIWA 4B6FA 5CDFE 4V03A 3QY0A 4JLDA 4PQFA 4FMDB 4IOKA 4L9WA 3KB1A 2FFAA 3QVUA 4C0JA 1IN5A 3GEHA 4JL5A 5IDVA 5EE1A 3TNFA 4E09A 2ORIA 5DIFA 3RSOA 4WZ6A 5B64A 1JR3D 1SVOA 4H1VA 4I1UA 5CJ2A 1JJ7A 1CR0A 2WBLC 2A5YB 2HLDD 4MYUA 2D3WA 2V55B 1UFQA 3KKNA 2ASEA 2KJQA 1D2MA 1VKJA 5FOSA 2IHYA 4W7SA 1ZM9A 1P7CA 2VA8A 1NLZA 4JLPA 2VP2A 1M1YE 2QAJA 4N0EA 3TSOA 3FFAA 3AVYA 2ZRLA 1JXMA 3ZZTA 3RS7A 2TMKA 4WW0A 2OAQ1 1NI3A 4RD6A 2IS1A 4M21A 4G0NA 4HDQB 1X8JA 4LSGA 4A2WA 5JCZA 3SJZA 4B32A 2J0SA 3U60B 3K0CC 2CMKA 4HUQA 1IY0A 3DZ8A 5HTKA 4CW7A 2H1LA 4KFSA 3B1XA 4WA7A 2BCJQ 1E6CA 1QBKC 2G1KA 3Q7PA 2OILA 1AK2A 1Q44A 2WIBA 2ZR9A 3A4MA 3OIYA 3HPQA 2XXAA 3UKDA 1Z6YA 2G1JA 3Q5DA 4D0NA 1XMSA 3ADCA 3BH0A 4DLUA 3AV0B 4D4MA 1W7AA 4L4UA 3A1UA 2RGNA 3P32A 4Q9HA 4Z8XA 3VNUA 1QZXA 2GILA 4IOJA 2PT5A 3WYGA 2QY9A 2P6RA 3ZD6A 3O8BA 5TDHA 5H1YA 1A2BA 3LLUA 3LV8A 3X2SA 1WP9A 3WNDA 2F9MA 3C15C 4G1UC 2QP3A 4HUTA 1GUAA 1VYUA 4HAXA 3SJAA 4Z8YA 4B2IA 4DBLC 1XEXB 4PHTA 1OIVA 2X1VA 3ADBA 2WKRA 4RD4A 3SS8A 2X2FA 4NONA 5E7MA 2QENA 1P60A 1IXSB 4HAWA 3Q85A 3T61A 1CJKC 3I8XA 2WSMA 3ZVLA 3H86A 1J8YF 3T15A 3FMFA 5CK4A 2O8DA 4KFUA 5A0FA 5JWRA 2O8CA 1TQ4A 1X86B 3KZ1E 4RKEA 4A0GA 1HTWA 4MRSA 1DS6A 5L3SB 5DGXA 4B3XA 4TL9A 3CPEA 1IN7A 4XD7A 1FPMA 3PUZA 1TF2A 1W48A 4LJ7A 2YWEA 2J7PD 2G3YA 2J59A 1E2IA 1W49A 2O52A 3LW8A 4Z1MA 4EPXA 4V02A 3RRZA 3VR5A 2BOVA 2R6DA 4MDFA 4EPWA 1PLJA 2IF2A 2QM8A 3VTKA 1N0WA 2F43A 4ABYA 3I5YA 1S1CA 1P5ZB 4PZLA 2AXPA 4D0GA 4EPTA 3AF3A 1U0JA 2C2HA 4C0HA 1ZRHA 2XNDD 4Q4AB 3F3YA 3BAFA 3U5ZB 1T5IA 1EGAA 2RGCA 4C9BA 2H8KA 2N46A 1EFRA 1G4UR 2W00A 4PANA 5DO9A 4NCHA 2DWQA 4ESVA 1DAEA 1W1WA 4JL6A 2QL6A 4XJXA 4C0AC 4M1OA 1KI6A 4I4LA 4M1YA 4LV8B 2ZS9A 2J45A 1WDTA 4TYWA 1VCMA 2WWHA 2XSZA 3K9HA 4PC3A 1S1MA 2WAXA 2ZE6A 4HSEA 2XOKA 4Q21A 5TB5A 1KSGA 2RH5A 2GAOA 1KDTA 2ODEA 2IBMA 3RS0A 5FH9A 3CNLA 1P61B 3FPAA 3LW7A 3ZQ6A 1K8RA 3MUFA 3NC1C 1UBGA 1ZAKA 2QM7A 1U0HC 4P3YA 4KLZA 3RDPA 4IVQA 4BFYA 5AUPB 4OQFA 1KZGB 3GEEA 2P5SA 3QKTA 3TUIC 4V0OA 1LFDB 2G6BA 2QAGB 2R2AA 1KTVA 1JAHA 2F7SA 3QSYA 1Y3AA 4GL2A 4C7OB 4HLUA 1P73A 1US8A 1QHXA 3AP2A 3D6TB 2ZS7A 3CIOA 4YMUA 2GBLA 3PEYA 3M0EA 5EXPA 3U3KA 3WMGA 3T12A 3QE0A 1NY6A 1X8LA 2WSSD 2FFBA 4DCVA 5FTKA 1YZTA 4ZV4A 3OIVA 1F60A 2J46A 4TMWA 5AJZA 3VR2A 4CEHB 3CZQA 2BBSA 4LJ4A 3ETLA 3FTQA 1R2QA 1XTIA 4DCTA 4NL4H 2ORWA 3LFUA 3A4NA 4B71A 2ZUBA 1K5DA 3LNCA 1E79D 2FN4A 1OT3A 2QMUA 4PC6A 4G01B 1J8MF 2QPOA 4F92B 1KI6B 5JRJA 5EXTA 1CEEA 2A7QA 3AF4A 3EIEA 1BMFA 2PJZA 5DLQC 1OB2A 2OXCA 2QTHA 3MWYW 2ZI5A 1OE0A 5FPHA 2JLRA 1XPRA 3D7MA 3FHCB 1VMAA 4TSFD 5KNCA 2WTUA 3SYNA 4URZR 3CPJB 3O8DA 2ZRGA 3KB2A 1RVDA 1PLKA 4N0DA 4RZXA 1PUJA 2OEPA 5K8TA 2HDNB 4FMCF 2PZFA 4YMTA 4JBXA 1WXQA 3J81k 1P75A 4ERNA 3FWYA 3TSZA 4HYYA 3RAPR 4IRUB 1RRFA 2ZRBA 4PC1A 4EQ6A 3TIFA 2ZI7A 1KSHA 5LPNA 4QNRA 3WHKA 2QT1A 2V9PA 2I4IA 2JA1A 2XZOA 1FQJA 1R6BX 2QP4A 2VH5R 4RVCA 5AWFC 2E1RA 3BFXA 5BYJA 3ZDQA 3TW4A 3AEZA 3WP1B 4PR0A 3U3MA 2XEXA 4ZKEA 4JYBA 1Z5ZA 4P0TA 3B78A 5LD2B 5L3RA 4DT1B 2GXUA 1YVDA 1G8GA 1G8PA 1TNDA 2HCJB 1JJVA 3SQXA 5EP2A 4YQFA 1JECA 3CF6R 2VIIA 2WMOB 5EUQB 1BH2A 4G5RA 4DUGD 1FP6A 5B57C 1NP6A 2ZJ5A 1VDZA 2AN9A 2G0TA 4Q1CA 4TL6A 4B44A 4HI0E 3A1SA 1FUKA 2AHOA 3KDSE 4ZI3A 4PHGA 3UIEA 2XZLA 1AZTA 4D26A 1WQ1R 4A2PA 1AGPA 1G3RA 3CF2A 4FINA 2EFEB 3GJ7A 2CE7A 2I3BA 1CRQA 3PFIA 2ONJA 1ETUA 2QAGC 3ZVMA 2PEZA 4QHSA 1UBFA 1DVRA 4LJ8A 4YLGA 2YWGA 5TV2A 1F48A 5HZHA 3IEVA 5EQTA 1KMQA 1R0YA 3ICQB 2QGZA 2YHSA 2YVUA 4DCUA 1HYQA 2O8EB 1T0JB 5G53C 4JJZA 3CX7A 1IBRA 1M2OB 2QPAA 1JPJA 1L4YA 5AUOB 2GZDA 3AQ4A 4Y0VA 1P62B 5KNDA 5FUVA 2HEIA 4C3ZA 4IXNA 5DHFA 3F8TA 3B1ZA 3FYHA 4UXHA 4BFXA 1I4DD 2OLKA 2J3EA 3EC1A 1G7TA 1H8EA 3NEYA 1XJCA 3MMPA 3SFVA 3AVVA 1Q20A 1V5WA 2F1JA 4F4IA 1NLYA 1KJWA 5EE5B 3AH8A 3TK1A 3OAAD 3HDTA 4DZZA 4NYMQ 4C0KA 4KHZA 2QP9X 3IUYA 1E2PA 3OE7D 4GRAA 4A8JA 2HCBA 4C0SA 3TLXA 1W0KD 2QZ4A 3HPRA 2NMVA 2XNDA 3AUXA 3W34A 4TMXA 4CYMA 2FX3A 1GIAA 1Z0AA 3EASA 4IEEA 3DZDA 1GFIA 1KSFX 1ZM3A 3QPUA 4C2UA 1N0UA 1ZNYA 4JBWA 2GCPA 1N5IA 1W46A 2JLWA 2CL0X 1G64A 3A36A 1OYWA 1NMXA 2ZQ5A 5H68A 4BLTA 2OV2A 4OQMA 4CEJA 5FL3A 2A5JA 5G41A 2WV9A 3E2IA 4FD2A 3T1OA 3NBYC 4IW3B 5FPSA 3CWZA 5HPYB 3GLHA 2BV3A 2W0MA 3AB3A 3GJ8A 5C4MA 1S8FA 4OKSA 1XMVA 2H5EA 4Q1BA 4CEJB 1OB5A 4LHZA 3VFDA 1R8SA 2ZSFA 3K9NA 5JFGA 1E79A 4JSTA 1W36D 1D6JA 5JZVA 4AY2A 5KSZA 3P4XA 1MH1A 421PA 4YMVA 3A1WA 3QXJA 3VHXA 2ZU0C 2IT1A 1I2DA 4TT3D 4HB4A 1G5PA 2OAP1 4ZDKA 1T6NA 4FMBB 2W58A 5HZKA 1TF7A 1VG8A 3IILA 1GTVA 2V7QD 4C0QC 5KDDA 3HP1A 1DE0A 1XF9A 1TAGA 2NO0A 3Q8XB 4MITA 5TVKA 2BEKA 4LRWA 4RD3A 3GLIA 4IVRA 4CEIA 2DFLA 3LBIA 5FPKA 1GILA 1TL7C 1G3MA 4LHVA 1GNQA 2OCYC 4LHXA 2BIFA 3BGWA 4JLKA 4XTRA 4QNMA 4BZQA 2JLXA 4OI2A 2IEZA 2H16A 4IOLA 1XP8A 3X1ZA 1G16A 3IIMA 3VKWA 3TGPA 3HR8A 1W36B 2F3RA 2IYYA 4MKGA 1R10A 2KSQA 4OHWA 1E9SA 1Q1BA 4KFTA 2QROA 1N3BA 4L5BA 1E69A 3GJ3A 5KOYA 3E5HA 3EZFA 3OEEA 1RW4A 2GXSA 4ESHA 4XWAA 3VU9A 1W47A 3IQWA 3BRWD 1YR7A 4II7A 4NH0A 2WICA 4Q47A 4X8LA 2JATA 2JIZA 1J70A 1IJEA 1XBTA 2F6RA 2WOOA 4BFZA 3ZZ0A 4EQ6B 3KQHA 3CX6A 1JR6A 1E1RD 1G21E 1A7JA 2ZI3A 2GVDC 2AFHE 2ZYWX 4ARZA 4KO8A 2CHQA 3MWLA 4KBGA 5SZJA 2QORA 5G3YA 3ZIAD 5JWOA 2Q9BA 5AR1A 2N42A 5E95A 1TU4A 4KVAA 2G9NA 4H9GA 1II0A 2ZJOA 3V4RA 2IYRA 3C5HA 3FKSA 2VF7A 4MYHA 4DCSA 2D7DA 3GCGA 2JJ2A 2JASA 4CEIB 3MG9A 4FMDF 3ZIAA 4RD2A 1JI0A 4DHEA 3ONWA 2L0XA 5AJYA 2GVZC 3AVOA 4D0LB 1Z47A 4PX9A 2VP9A 4MRVA 1P3JA 1ZD1A 3K0CA 4CEHA 2QSZA 1DOAA 1KO1A 4URYR 3BFVA 3SEAA 4C0BA 1Y63A 2VSFA 3NH6A 3ZZUA 1W0JD 2XXAB 2AFIE 1NRJB 2VP4A 4LJ5A 4DDTA 3OEHD 4DDVA 1M7BA 2ZE8A 4HLCA 1OH6A 1AKEA 1GRQA 1ZD9A 1MKYA 3L82B 4HAZA 3CB4A 2ZRHA 2GJKA 2JLZA 1E9AA 1L2TA 1RRGA 1OJLA 2UVQA 1II8A 4IDPA 2H7VA 1OFUX 2QU8A 2ATXA 5FL7A 1KKMA 4D82A 4OI1A 1Z0IA 521PA 1VHLA 4P32A 1JB1A 4RD1A 1W0KA 3AF0A 3CF0A 3MWKA 1E0AA 5JS7A 1RC8A 1ZIPA 3JVVA 4JL8A 2QE7A 1SXJD 2QPTA 2ZM5A 3TUJC 4FIDA 1IONA 1RRCA 1G5RA 1VPLA 1G8YA 4JIMA 4E07A 2I1VB 3WYAA 5FFMA 3DM5A 3THXA 2Q9AA 4BEBA 1GM5A 3EWAA 2CLSA 3NHAA 2ZI6A 3U2QA 3U7GA 4Q00A 3OAAA 1SVKA 2VL7A 5BQ5A 3UWKA 1Z0DA 3GD7A 2KWIA 4AK9A 4RZUA 3IKJA 3MWJA 3IPYA 2CLCX 4QL3A 1MT0A 1U98A 2GEDA 5FOWA 3EXAA 3SYLA 5CM8B 1H8HD 1Z08A 4B76A 1NSFA 5E3HA 3NIBA 2Z0MA 4KBFA 1T0HB 3W9YA 5L3VA 2YZ2A 1JQJC 1CJMA 3BIFA 1KI2A 3KJHA 5FPTA 3W8RA 2FU5C 3BXZA 3OE7A 2CVHA 4TMVA 1SKYE 2YC4C 1SXJA 4O2LA 3THOA 3AVWA 1TEVA 2Q21A 3GQBA 4M8NE 3CZPA 4A6PA 2VBCA 4Q66C 5KSPA 2Y8EA 2IYLD 2UZ3A 4LV5B 2V7QA 3KKOA 5FI0B 3GLHE 4A8JB 4BE7B 4AKHA 1E2QA 5BWMA 2VYFA 4W5WA 1TADA 3GJ6A 3W8NA 3BJIC 3DPUA 1S4QA 2A3RA 2DWPA 4XVRA 3Q7QA 3GLIE 4NCJA 1II9A 4PC7A 3HJNA 1KK1A 4C4PA 1EX6A 2GEUA 5L3SA 4KU4A 3NC0C 1AIPA 1LY1A 4OHVA 1E9DA 4AIIA 2OUKA 1K6MA 3CNOA 1YZNA 1EG7A 1JEEA 4AKGA 3MAAC 4Q7LA 2NQ2C 3HU3A 3AKCA 1SVLA 2BCGY 2B6HA 1CBUA 4LZZA 2W6IA 3PG5A 4OI4A 3VR1A 2BJVA 3DMDA 2WKPA 1GAJA 1GSIA 2NPIA 3CO5A 1CJTC 1N6KA 3EZ2A 5HE8A 3DO6A 4Q5IA 2GHIA 621PA 2B7BA 4ZCMA 2BM1A 3RS3A 3R9WA 1OH5A 4QGHA 4NU0A 4BECA 4QGAA 1E99A 3CRW1 3F5FA 2PLRA 1HE8B 3C4JA 1FTSA 2V4ZA 1FFHA 4BPBA 2OXRA 2OFXA 1NF3A 3TQFA 1ZUNB 2VTKA 1OF1A 3OFND 1E4YA 5HR5A 1DARA 1NIJA 2ZVPX 3SNHA 1IY1A 4AYXA 1F6BA 3ZH9B 2AX4A 4KSCA 1DBSA 4PO1A 3QKSA 1GDDA 1UF9A 2FA9A 2QMOA 1HV8A 1ZNZA 3VHLB 3U3JA 2ZAOA 1YE8A 4D4LA 3EA5A 3TSWA 3DDCA 3CH5A 3QKRA 3PITA 1WMSA 5F3WB 4JLMA 3EZ7A 1UBEA 2GF9A 3NEJA 4KSBA 4TQ9A 4PC2A 1E0SA 3EWSA 2ODNA 3KJGA 3LO5A 4KLNA 4B35A 1HEIA 1KSJA 4B6EA 3RHFA 1KYIA 4IJMA 4C7OA 2GK7A 3WRXC 5CK5A 2OCAA 4B3BA 2O8DB 1U0LA 1SVMA 1XEFA 2BC9A 3E1SA 3IO5A 4G5GA 5M04A 1OXTA 4QBHA 3R7WB 1ESNA 1P2UA 1Z8FA 4WXPA 3REFA 3ZLJA 4OI0A 4EFLA 1H8ED 4HAYA 221PA 2WJHA 5DISB 3FVQA 4OK3A 1X1RA 3RNLA 1PJRA 4XTCS 1BYUA 4QHYA 1BO6A 2QAGA 3KQNA 4TLDA 2XZPA 4DC9A 1QHYA 4TQAA 3QVVA 4QJ4A 2R44A 2ZJAA 2DFTA 1US8B 2NGRA 3QIAA 3UMSA 2IYSA 2C8VA 1GG2A 2YWHA 1ZNXA 1SVWA 1HQYE 4Z51A 2RB4A 1OXVA 3SHFA 4GZMA 4PSKA 1W4BA 3GLFA 1P9RA 1GRRA 1DAKA 2ZAMA 3WP0A 4LBWA 3SFZA 3D8BA 1R0ZA 3WNBA 1MRSA 1ONBA 2AD1A 2ANCA 3M1IA 1G8FA 1P2SA 4RJLA 4S2EA 3VU9B 1XDBA 1AQYA 4F93B 2V1UA 4AG5A 1ANKA 1ZM4A 3PUWA 1QHGA 5IK2D 5JHHB 3AVXA 3B9QA 4RY2A 5JBQA 4AURA 1H65A 1UM8A 3WBKA 3PJRA 2QRNA 5AJWA 4TLEA 4JS0A 4LJAA 4YONB 3LX5A 4DSTA 2FG5A 5GJWC 4QGFA 4QKQA 1ZD8A 3RVBA 1SHZA 3TR0A 1JEDA 2W2XA 2BEJA 3QEJA 1VG0B 1XXHE 5FTJA 5KU1A 2ZRIA 3B60A 4LPSA 3EPJA 3BFKA 1IM2A 2IYWA 2OLJA 4AKIA 2V3CC 2WJIA 4NMMA 1S3GA 2BKEA 2ZPTX 2EFCB 1KIMA 5SZHB 1G4AE 1D8TA 4NE2A 1M8PA 4LGMA 2IUUA 3RSLA 4BLQA 1E9CA 3DM9B 3EPHA 1T4GA 3QNUA 3THYB 4X8OA 1QHHA 1NNEA 5JEDA 2BBOA 2K5UA 2ZRAA 4HB3A 1JAIA 2G83A 1O87A 4KODA 3KUCA 5BW8A 3G82C 4W5JA 1PV4A 4QM7A 1M74A 3AP3A 3SOPA 1NVVQ 4HLUC 8OHMA 3WNCA 1U99A 4GFDA 4GP6A 4TZ6A 1COWA 3LQQA 4HUQB 4QBFA 1DPFA 2VSOA 2P67A 3L0IB 4LCBA 1XCMA 3PV0A 1VYVA 2N1BA 4GBMA 4Z54A 1ZW6A 4O25A 5H8WA 5FTNA 1GOTA 3PCRB 3SN6A 2OG2A 1OPXA 3EARA 3CRQA 2OM2A 2QTFA 2J87A 2BMDA 3ZS8A 1Z6AA 2VRWA 1R5BA 3L0PA 1DG3A 4MA4A 4QG7A 2MSDB 1EFCA 2V54A 4IFBA 1RJ9B 5DE3A 5FL7D 2P0EA 1ZM2A 2LWIA 4HZUA 4JSYA 3U4QB 3VKHA 3D31A 1Z07A 2ONKA 4O0MA 3KFVA 2O0KA 4BEJA 4BLRA 1DAFA 2JDID 4U02A 4U5XA 3TAHA 1OXSC 1PLLA 2IC5A 4PFSA 1X8KA 4B43A 1QF9A 3L8ZA 3KQUA 1GNPA 1YRBA 2R6CA 4HZUB 1KZ7B 3TVTA 5ELXA 1N6IA 2XNSA 2D4HA 4HLQB 1T5LA 2MMCA 1UPTA 3K09C 3PVSA 4NKRA 3O8RA 3FDIA 2XTNA 4M9XA 2PLFA 1KMHB 3K1JA 5KTYA 4JLBA 2F43B 5KSYA 2F55A 2BKUA 3ZJYA 4KJZA 2ECKA 1R0XA 4GOXA 3NBXX 4XVQA 2MMGA 4DIDA 4EPRA 5IK2A 1YR6A 2H92A 2R62A 4LJ6A 4DEXA 4A82A 2V1XA 1N0VC 4TYQA 1KMHA 4ACAA 2VHCA 1KK0A 1SXJB 3BH7A 2J0VA 5BXQC 4WZAE 5KSOA 4DKXA 5KUTA 1W5TA 1MRNA 3DKPA 1A1VA 3GLFE 3KKMA 4UNNA 1GVNB 3K9GA 1CIPA 2GWHA 4CVNA 4JVMA 5AJXA 1D9XA 4OJKA 2X8AA 4M22A 5CM9C 3VAAA 2VHUA 4NP6A 1GL7A 1FX0A 3UMFA 2CDNA 5EXSA 3OHMA 1CS4C 5BYKA 2YKGA 3CPHA 3UK6A 1ZM7A 4DSOA 4QC2A 1M34E 3RWMB 1LNZA 3T35A 2PZEA 3SI7A 2WHXA 2ERYA 4Q4AA 3AP1A 4WBSA 3C16C 1W36C 3EA0A 3CR7A 2YV5A 2CE2X 2W0SA 2CCJA 4B47A 2QTVB 2IK8A 4DLRA 2JLVA 4IHQA 2D2FA 3W6NA 1XZPA 2RHMA 3EG5A 1UEJA 4ZIRB 3KQLA 3W3ZB 3NVAA 2EFDB 1B0UA 2GKSA 1RYHA 1NKTA 1Z0KA 4DIEA 3ICEA 2JLYA 1IHUA 3CWQA 4G5SA 4TMTA 1I2MA 1P4SA 3T1TA 4LWZA 2Q3MA 2BMEA 2VPPA 3PIRA 3QXCA 3SJCA 3W6OA 5JSZA 1FL9A 1NMZA 1WRBA 4DJTA 4Q4LA 2HLDA 3E70C 3NHBA 4Q1EA 1UAAA 2XTMA 1OXXK 1UKEA 3I72A 1G8HA 2C99A 1X3SA 3IGFA 3QQ5A 3R7WA 1BOFA 4RFSA 2QG6A 3LWNA 1OXUA 4QM6A 1WBBA 2BMJA 4JKYA 2OBLA 121PA 1U2RA 5SZKB 1S9HA 3ZS9A 3K8YA 1GKUB 1L8QA 2VP0A 2MSEB 3EIQA 2YOGA 1OLOA 2YJTD 3I8SA 2ANBA 4Q1FA 2RGEA 4B73A 2HJVA 1UJ2A 3SZRA 1NY5A 1Z6XA 1W4CA 2XJ4A 1MABA 3ASYA 3FMOB 3LY5A 5CDFA 1X6VA 3CW2A 2WWYA 1U94A 3H1TA 2ZE7A 4JLAA 1GL6A 3RC8A 2JJ1D 4CRWB 4I81A 1YU9A 1ZYUA 3U44B 2WPDD 4IOMA 1BYIA 4BUJA 2P3SA 4UKDA 1T8TA 1E2GA 5FOVA 4Q7JB 1D9ZA 1JXOA 3UATA 1TMKA 3QBTA 5JEEA 4H1UA 1Z28A 4MUAA 5EE9A 5C2JB 1B23P 1XMJA 2W6JD 4N1AA 2ZRNA 2A78A 3V9PA 2OBNA 2WPDA 3K0EA 1NJGA 5K8UA 2DCUA 1NG9A 4X8MA 4YDSA 2PMDA 5TARA 2OBMA 2PT7A 4QFMA 2PL3A 2IW3A 1E2KA 4AC9A 4BWYA 2MSCB 1G5TA 3IDQA 4LJYA 2DB3A 4ZCIA 1OHHA 4DLVA 1MO3A 2FMXA 4GPTA 3F0TA 3AGQA 3A37A 4R9UC 3OFNA 1IJFA 1ZBDA 3M6AA 4US1R 1FNMA 4C2TA 1GKIA 2NO7A 1UKVY 1OFHA 3HYTA 4JYCA 2ODBA 2QNRA 2BBWA 5FOUA 4HDCA 5HCNA 4B74A 2O8BB 2ZVQX 2GJAA 3QXSA 1SXJE 3GJ5A 4PAMA 5EE0A 5KDLA 2F1RA 5FPYA 5J47A 4TLCA 3I62A 5F9FA 3NDPA 4ZDJA 2O5VA 2GDJA 4R98A 1KY2A 4BZXA 4P4TA 4ASUA 3D3QA 4BLSA 1MO5A 1ZU5A 1ZUIA 1D2NA 2HT1A 4HZIA 1EWRA 3L2OB 1OHHD 1T3HA 4JKIA 4PPNA 1DADA 1A4RA 2ZRKA 4LHWA 2ZUDA 3HYRA 1DELA 4MDEA 2ZTSA 1RFLA 2GESA 1IN4A 2PCLA 2JCSA 5HKKA 2D74A 1YZQA 3TKLA 3DOEA 4OK5A 4DLYA 4F4JA 1LW7A 1PVOA 3BH6A 3AM1A 4B75A 3FOZA 4AWXA 4K8OA 3L0SA 3OESA 3TBKA 1P6XA 3LAWA 4TL8A 1NKSA 2IXEA 2IL1A 4LYJA 2WWIA 5EP3A 3C7KA 2D62A 4US2R 3X1XA 1ESMA 1T9HA 3B82A 3LVRE 4LBZA 5CYPA 1XFAA 3NDBB 3KFXA 1WA5A 1YRAA 2GRJA 3H0KA 4UXIA 4CT4B 2RKOA 1FOEB 1KO7A 1QHNA 1RJ9A 1YHNA 2HXSA 4U7DA 4DWJA 1ZIOA 3QUSA 1UDXA 1XEXA 3ZVRA 3K70B 2QQ0A 1CULC 4NYIQ 3CX8A 1AZSC 1JPNA 4IXMA 1WCV1 2A30A 3AKYA 1P72A 3TQCA 3H2YA 1G291 3SJBA 2A5GA 1U9IA 1FTNA 1RRPA 2ZJBA 4XD7D 3K0FB 2O8EA 3G5UA 2REOA 5CLQA 4NYJQ 3PXGA 4FCTA 5GJBA 1DAIA 4Q4JA 4V0MA 2HF8A 1XD8A 3P26A 4L15A 3DMNA 3N2IA 1F2TA 1E2EA 1G20E 2IYVA 1XD2B 4DB4A 3NBZC 4PO9A 4HEJA 2VHQA 4RSGA 2BHRA 2QMHA 4E5UA 2OESA 1E2FA 1ELOA 2X2EA 4Q9LA 3P1JA 4Q1DA 3NWJA 1DAMA 1Z63A 4LC1A 1XXHB 1YZGA 2W83A 4MQBA 2WAYA 1CR1A 2AKYA 3UANA 3VX4A 2DR3A 4A0FA 1YJ5A 2ODWA 4TYPA 4D4KA 3QOFA 4FI3C 3MFYA 2LKDA 1KK3A 2R65A 5FUYA 2YNMA 1F2UA 4PPFA 2UZIR 3LDAA 3K9LA 3IQXA 1TQ2A 3W3AA 5BN3A 1GP2A 3QBVA 1OIXA 4IEIA 2BWJA 2X19A 4W9MC 2O0HA 4TTPA 3FHTA 3U61B 3T34A 3N2EA 2HYIC 4GOJA 4FW9A 4UNSA 3GJ0A 4Q19A 3RS5A 3GP8A 4LJ9A 3KKQA 1KNQA 1LF0A 5TY0A 1WB9A 2R8RA 1GRNA 1QHSA 2CL6X 2VEDA 1OW3B 1GNRA 4Q9IA 4EIWA 1XZQA 3GLGB 1NN5A 3PUXA 4MGYR 2V8OA 4O3MA 1JR3A 3T1QA 2NZ8A 5LB2A 1XTRA 5AJVB 1G19A 2C9OA 4JBYA 4JLNA 4Q4JB 2CXXA 1E0JA 2AKAB 2GXQA 2P65A 3A1VA 3R8CA 2O8FB 2FPKA 1VCNA 1FW6A 4A0HA 3DVLA 3VMFA 3ZYCA 2J0QA 2FE4A 5EP1A 1NN3A 1AN0A 4KI0A 4E22A 4DDWA 3RRMA 3X1YA 1JNYA 2B21A 2E9SA 5CYOA 3K0SA 1VCOA 1T3LA 4F7WA 2DFKB 3LQRA 4PSVA 2DWOA 2J0UB 4AD8A 3B8HA 3KXLA 2HV8A 4MYTA 2JJ8A 3O47A 5GADl 1P9WA 3TH5A 2JJ1A 2VQSA 4M2LA 4A36A 1Q21A 2ZR7A 2XAUA 4D80A 2GTPA 2R6FA 4B3DA 4XSHA 3L8YA 3CR8A 1E1QA 1NBMA 4G3XA 3WMEA 2QA5A 1IN8A 3DHWC 3OIUA 1SXJC 4ARZB 3T5DA 2RGGA 3FFBA 1XJ0A 1NSTA 3P4YA 3MD0A 2PZGA 4GNKA 2KI5A 4IDQA 4OK6A 1RZ3A 4ZI2A 3VX3A 4AG6A 2IWRA 3QENA 4RCYA 2XSZD 2YWFA 2C96A 2J7KA 3RS4A 6Q21A 1E1QD 1NBMD 1QVAA 1Q1ZA 2IYZA 1S96A 1E2DA 1TEXA 3LBNA 1KY3A 4KFRA 2B8TA 1LF5A 3MLEA 1YZLA 4V0NA 3GLGA 4Q03A 1HQCA 3U44A 2DBYA 1LVGA 2GCOA 1II8B 5CB8A 1OV4A 1M6NA 1RIFA 3CNNA 2F3TA 4O2RA 3QKUA 4JJKA 1G6OA 1Q3TA 5AUNB 1DO0A 5KPJA 5DNYB 4P4SB 5D3MA 1CRPA 1FNNA 1DAHA 1UDWA 2ZR0A 5CITA 1E32A 2R9VA 3EZ9A 4PAQA 5IT5A 4HLDA 1KOFA 4I1SA 2JIZD 4BFSA 5JJKA 2FFHA 2J1LA 2FWRA 1T8UA 2IYQA 3O8CA 4A4DA 4TL7A 2P6UA 1E2HA 2KE5A 3GFOA 2WSSA 1O3YA 1G6HA 3IHWA 4MUBA 1NG1A 1XX6A 3KTAB 4A6XA 1OH7A 1WE2A 4LYFA 1E9RA 1Z2AA 2CCKA 4CDGA 2J7PA 1MO6A 1QHHB 4FCWA 2HJGA 1EFRD 2YC2C 4DRZA 3AKDA 4RFVA 2C78A 1AS0A 3LVQE 4CT5A 3LLMA 3AVPA 3FKQA 1EFUA 1W5SA 1K5GA 4OHXA 5GJCA 4B3CA 3QJYA 1AM4D 1HT2E 3BORA 5DH9A 3KXKA 2SHKA 1ZCAA 4PAOA 5JHGB 1QG2A 2ZSDA 5EZ6B 1XTKA 5GVSA 2J5XA 1F3OA 4MKFA 5EE3A 3ZVNA 2FF7A 4DSNA 5SZIA 3U7FB 4A2QA 4I1VA 4B33A 3A1TA 2RGAA 1GKYA 2B7CA 4LBYA 1HUQA 3C14C 5IHPA 5JS8A 2P5TB 2QSYA 5DHAA 2WWWA 3THXB 3K0AB 3BB1A 2Q3FA 3BB4A 5B58C 4NCKA 4P4UA 4DUGA 2RCNA 4URXR 4DVGA 3EPLA 1CJUC 4DXAA 2WZQA 2OZEA 2ZI4A 3AKEA 2WIAA 3W5JA 1E3MA 2ZJ2A 3QXXA 3IIJA 4IDNA 2G0NA 2DYKA 3ASZA 4JT2A 2NG1A 1ODFA 4EUNA 1TUIA 3C41J 1NJFA 3HR7A 2OFWA 3SR0A 1Z3IX 3SQWA 3FHOA 2AXNA 5FBWB 1AGRA 2A9KA 2J9RA 4RKFA 3MSXA 3BC1A 4PPQA 5B2ZA 1SKYB 4MRPA 1C1YA 4DT1A 2ZYUX 2Z4RA 3R8FA 1CLUA 4MRNA 3B9PA 3OZXA 3BB3A 2CHVA 3LX8A 4L16A 2KBEA 3W90A 1N6LA 3ND9A 2HXYA 3BE4A 1A5TA 4B2PA 3RC3A 4E03A 1W4AA 5J4LA 1NVXQ 2GETA 5C18A 1Q1EA 5FR2A 2J41A 3GEIA 5L8VA 3IEUA 4JLOA 2IX3A 2CNWA 3FGNA 2FSGA 4DLZA 4BZPA 1E4VA 4LV6A 5GJVC 4EJSB 2O8CB 2OO7A 1PZNA 4KCGA 4PO8A 2ATVA 4MYCA 1BKDR 2RGNC 3VR4A 2ZREA 4LDJA 3B85A 4POAA 2GJ9A 2OSBA 4ON9A 3RRYA 3U3RA 2CK3A 1IN6A 3LA6A 1BIFA 1GWNA 3QKRB 4I1OA 4MKHA 3I92A 1R7RA 1N2CE 1UBCA 4EFNA 1XTSA 2H17A 5KDOA 1KI3A 5IRCD 2DY1A 3SDZA 1JBKA 4DLTA 2FSFA 1SULA 2IS4A 5L3QB 1TTTA 2G77B 2FGKA 1AS2A 2FZLA 2Q0HA 2LKCA 3LRPA 3LXRA 2AR7A 3KL4A 4A9AA 3K70C 5J4KA 2ZSBA 3SHWA 4TMKA 4FMCB 1NBME 3DEFA 3BWDD 2REXB 2EQBA 3B5JA 2WJVA 2ZS8A 1NN1A 1CU1A 4KVGA 5C4GB 4R71A 2GA8A 4OL0A 4Y0AA 1IAQA 1AKYA 4ILEA 3THWB 5C1BA 5HKKD 3IBYA 4GMXA 1PUIA 1SHKA 1N6NA 3L43A 4EAQA 4DLSA 4ZIRA 1TPZA 4HDOB 4DLXA 4JLJA 4KXFB 1S0UA 4WIAA 2NIPA 3U7HB 4BQSA 4BLPA 2FDCA 3QF7A 3I32A 1LTQA 1Z0JA 1F2UB 3VR3A 2EYUA 3GJ4A 3IIKA 4RZ3A 3IO3A 4XH9B 1V43A 2J0UA 2HYDA 5DI3A 4NPHA 4F38A 5GVRA 5BN4A 1Q22A 1W2GA 1ZVQA 2PBRA 4MGZR 4CF7A 3DKVA 4IDOA 4ZKDA 2C98A 1KDOA 2P6NA 4M1MA 4QHTA 2OCPA 1ZMXA 2PMKA 4URWR 1M7GA 1EWQA 1YKSA 3WXMA 2ZRPA 1G3IA 4M4SA 2FSIA 2GZAA 1JALA 2IXFA 1FX0B 2OCBA 3A8TA 3ECCA 1E96A 2Q9CA 2H18A 4EFMA 3UPUA 4UQOA 1KO5A 2IHBA 3PENA 1Q1QA 4MH0R 2B92A 4YXWD 2OE2A 3UXMA 4UNRA 2AK3A 3B6EA 4TLBA 2CVFA 4LPKA 5JI3E 2Z4SA 5ANRB 2B8WA 4R7ZA 2Z43A 5DYIA 1E2JA 2ZITA 4DLWA 4CIDA 5K8IA 3Q9LA 2BJWA 4JLVA 3WRYC 4BFUA 5BN5A 4B3GA 3GLFB 5UKDA 2QBYA 4RCZA 4M1TA 2DHRA 3PR1A 1R5OA 4MRRA 4MGKR 2F9LA 2WJYA 1HH4A 4AI6A 1U8YA 2ZJYA 4GP7A 4D25A 3Q3JB 4URUR 2RGBA 2QT0A 4OBEA 3GLIB 1VG9B 2GCOB 2GAAA 2Z5FA 3P27A 3U3OA 4S35A 2XB4A 4V0ME 4W5HA 5G3ZA 1Z6GA 2WKQA 2JAQA 4M9QA 3EAQA 3B13B 2EFHB 1LV7A 4US0R 1NN0A 2O8BA 3TMKA 1BS1A 4RZ2A 3PEUA 2WWXA 3K70D 4Q7KA 3ADDA 4HAUA 2JJ2D 2PX0A 2Z6VA 5F2EA 2WM9B 5E7JA 3VR6A 1QG4A 1KNXA 3QPWA 1AA9A 1OFTA 1FZQA 2C5LA 1VECA 3WHLA 2NOAA 1HURA 1FQKA 1ZNWA 2AK2A 4AKEA 3WYFA 1XTJA 4BLOA 1ZC4A 1CR2A 4BRWA 4EPVA 2QUZA 4IDHA 3TW8B 1ZUHA 5LDDC 2FNAA 3B1WA 4F91B 3GPLA 2EWWA 1MOZA 5EJEA 4OHYA 1Z06A 5EXXA 3AVQA 3PUYA 2AWNA 2IYTA 2FSHA 1CJVC 3CRVA 4OQXA 4Q7MB 5FOXA 4B2LA 1L7VC 2O0JA 3N5CA 2FZ4A 4D4JA 4LK2A 4TZ0A 3ADKA 1NVUQ 2VHTA 1MV5A 5CJPA 3MCAA 1W2HA 1OSNA 1MR3F 4TT3A 1VCIA 4N3NA 1TX4B 1Z83A 1ZJ6A 2JEOA 2Z83A 2LCFA 3KJIA 1A82A 4R2HA 5E4FA 4TQUS 3RABA 5KHOC 1JQLB 1J2JA 2XTZA 1G18A 1HY3A 1L4UA 2D7CA 3IHLA 4ITRC 3UG7A 3V00A 3ZQJA 2RGDA 4GSYA 2IS2A 1J99A 3C5CA 2FPLA 3EZ6A 1TUEA 1DEKA 2W2TA 4C30A 1GZSA 1XB2A 1P9NA 2PH1A 2VP5A 4JVSB 4A0RA 1EX7A 4BFWA 4C0LA 2WOJA 1E1RA 1U90A 3T06B 1LS6A 1XNJA 4JVLA 2GXAA 3KUDA 2BVNA 1U81A 1W0JA 4HB2A 3CUEF 2QRZA 1D5CA 1KAOA 2C95A 4URVR 1F5NA 1XCGB 1ZC3A 3PEWA 5CIQA 4Q9JA 3OF5A 3SYKA 3K0AA 1IOZA 4XWOA 3FKSD 2YINC 2RMKA 1AJEA 3W6PA 1WBDA 1CKEA 721PA 4EPYA 3B7GA 4OQNA 3NG1A 2GK6A 2ZU6A 1T91A 2IUTA 2QMEA 2XGJA 3G0HA 2UKDA 3JZMA 4M1SA 3KX2A 1OFIA 4PTLA 1OKKA 2GCNA 2ZRDA 2NPFA 1RE0A 1J90A 4PZYA 3THWA 3KQKA 1ZCBA 4QJ5A 3EX7C 1Z29A 3GLHB 1CF4A 4QJ3A 1SZPA 1IY2A 4NBSA 2ZIAA 1Z2CA 4KYUA 2RAPA 3CBQA 1FP7A 3QPVA 3LXXA 3QF4B 2GBLC 3UWOA 3CLVA 4D81A 4TLAA 3I73A 5IF9A 4QXAA 1VHTA 4M0LA 2W6ID 4UJ3A 2R6AA 4NYJR 2FEMA 2QGNA 3B1VA 5J4YA 3MJHA 5KNBA 3REGA 2NTYC 3QEOA 4LYAA 4EDHA 3EW9A 2Q3HA 1OKKD 3NKVA 1HE1C 5FBQB 4DB2A 5JJLA 2KBFA 5FBVB 1SKQA 1VG1A 4M9ZA 4NYIR 4TWZA 1TQ6A 1EFHA 4EJSC 1COWD 2XX3A 4D6PA 4QBGB 2AD5A 1E98A 4K81B 2IS6A 2OFOA 1MABB 1Z22A 2PJRA 1N25A 3QKSB 4HB0A 5FOTA 3UG6A 5JMTA 2YOFA 1QVRA 2RGXA 4YMSA 1E9EA 3LD9A 1XWIA 1KO8A 4GZLA 3VKGA 3IPXA 5G40A 3KXIA 3MRSA 1AQUA 4TN1A 4PPGA 3SBEA 3HU2A 1J7KA 4FN5A 1SVSA 4QOSA 3K53A 2ZRCA 5DI3B 1NL3A 2EYQA 1U8ZA 4JMPA 3KTAA 2XJ9A 4FCVA 1KAGA 4NYMR 3I3SR 1KK2A 1W4RA 2NO9A 2ZRFA 2CHGA 2FJUA 4Q4HA 3RANA 3S1AB 2IF0A 2H57A 3GFTA 3I61A 1W44A 5EP4A 4UNPA 2IEYA 5JSZB 1KJYA 2IWHA 3WY9A 5KO2A 2C04A 1IXZA 5J40A 3EC2A 4A92A 1FMLA 3VQTA 1G9XA 4L8GA 2CNWD 2BBTA 2ZE5A 4XSGA 5FBLB 1GL9B 3TRFA 1XMIA 5J5CA 1RYFA 2REBA 4B3FX 4IKEA 2IYXA 1TQDA 4PQYA 1CXZA 2VHJA 3TUZC 1EFTA 1ZINA 5TXGA 2CK3D 4DSUA 1XD9A 4LI0A 5JWHA 2WJGA 3BOSA 4NDZA 5B30A 4FWTA 1E94E 3I1FA 3QXHA 3FE2A 3NXSA 3HWSA 2ZETA 3IBGA 4UJ5A 4DCNA 1KHTA 1KI9A 1N5KA 4Q1AA 2ZROA 1FUUA 4IFEA 4LX0A 4PXAA 1OYYA 1SGWA 2CJWA 3ZGXA 3PUVA 2V6IA 3KKPA 1G7SA 2YYZA 3FMPB 5C46F 1UEIA 1XEWY 1R5NA 4YMWA 4LC0A 3AUYA 4Q4HB 4TTRA 3S1AA 1DG1G 2PX3A 5HE9A 1KI4A 1XU4A 1VTKA 1AS3A 4TMZA 4YC7A 1H8HA 2V6JA 2CJWB 1YZUA 1FMJA 1S2MA 3MGCA 3R20A 2WVJA 3TJZA 4WOPA 3LBHA 2GNOA 3CRRA 1G17A 3GFPA 3SC3A 2JDIA 1NLFA 1SVIA 2HUPA 2OT3B 3K09A 4M1WA 4MGIR 3UMRA 5EUMA 1T3SA 3JVUA 1R4AA 3SBDA 5HCIA 1YR9A 4ZDWA 4F4CA 1NIPA 4OJQA 1NVWQ 4M9SA 3GLGE 3A4LA 2ZI9A 4A1FA 2X77A 4MKIA 4HATA 2FEOA 3A58B 3DL0A 4AYTA 1G7RA 3X1WA 4OQLA 2GEVA 3QI2A 3SU8A 1KGDA 2W2VA 1IQPA 1E0KA 4K46A 5LD2C 3PEVA 3A6PC 2EW1A 4TYNA 2ZJZA 3CONA 5DSZA 1Z0FA 4J0QA 2F1HA 4BGDA 2JLSA 3AVTA 2Q6TA 4X8HA 3CH4B 2DFNA 4PSAA 2IA5A 4Q02A 5DYGA 1XD2A 2CEAA 2FFQA 1X1SA 4KITB 2JLUA 2CLDX 4V0KA 4KAXA 2FV8A 1XCPA 3AGPA 2JGNA 3I5XA 2JLQA
chains in the Genus database with same CATH superfamily
3PQEA 4MP3A 2JF0A 1RM4A 2DSTA 3FB4A 3PPIA 2FH5B 3I05A 3M3HA 5EVCA 2R7MA 3THSA 1K88A 3M34A 2VSXA 1XXHA 1XQWA 2VAWA 2JFZA 3EPJA 3C70A 2XUZA 1YS1X 3WK5A 3EIUA 4ZT2A 2NO1A 4IHKA 3OIDA 4BCDA 3SYTA 4CCYB 4ZDIA 4HGOA 3Q98A 4QBIA 3COZA 2YWJA 2OV3A 4G1VA 2FSVA 1C50A 2H2AA 5AMXA 1CTQA 1T2DA 3OLXA 4GI5A 2ZYTX 4UBJA 1CR4A 5E0KB 3MBIA 2HF9A 1JR3E 4UE2A 5LQAA 3H5LA 5TMPA 4NHEA 3MUOA 2I22A 1G3UA 4OJYA 1E62A 3AF1A 3RQIA 2OBYA 4EG4A 3F6EX 1C0EA 4G84A 4FZ5A 1QDEA 3TE6A 4BRUA 4HGZA 2JVKA 3R9XA 5HEKA 1N5LA 3C3PA 5DCWA 1IZZA 1N8KA 1T4MA 2F17A 3N70A 6LDHA 2ZUCA 3CKLA 4QEZA 3R3ZA 2EFGA 2FP4B 3OIWA 4CMAA 1CUBA 1QYDA 1C1DA 1JFLA 4NCIA 4CKEA 2VP6A 1Q3KA 5LB4A 1CY6A 2W2LA 4ZANA 3I52A 2HT6A 3H13A 3WS7A 5HRAA 2CV0A 5ED0A 3KWFA 1IUPA 4OATA 3THRA 3R09A 4IGKA 4LAFA 3A9UA 4GOMD 5I8ZA 5IBQA 4H59A 3SZ3A 2GVNA 3TR5A 4QRHA 4RA9B 2I6TA 3RM3A 1B14A 1PZHA 1M6VA 1ZRMA 3KSMA 3U0BA 2J3LA 5LCXA 2CCGA 3RROA 3SY8A 4GI2A 2I6QA 1Q6ZA 3FJOA 4L4ZA 1XZEA 5EZYF 3E1GA 4X9XA 1LTHR 4G0PA 1DDIA 4AYWA 1DO2A 5EGNA 3KE8A 5L3QA 1Q7RA 2IUSA 5BN3B 1N2HA 2WJJA 1KVQA 4K9DA 4MUEA 4EP1A 2TSYB 4R84A 4L0CA 1XNGA 1QFJA 2XBLA 1N2XA 1TPYA 2XNCA 1OX6A 2QOEA 3B48A 2Z6AA 3OT5A 1XPOA 2WWFA 5E7IA 1V5GA 3QY9A 1Z6TA 5HJ2A 2QQGA 3R76A 2GHTA 4DEYA 3A2KA 5ELMA 3EIHA 2HWXA 3H4VA 3MJCA 2WUEA 5ALUA 5JPIA 4F9EA 1RKBA 3U6KA 1W34A 3AVUA 3HO8A 1RI5A 1SC4A 1S4MA 2RAVA 3FPJA 4QGGA 2HGSA 2C7QA 2PL1A 3LBAA 4S2UA 4KR7A 5AKEA 2DQZA 4OJMX 3GLUA 2KB0A 5H70A 3HFJA 3INGA 3PXBA 3HUEA 1GITA 4C4XA 1KKLA 2POCA 4CGZA 3ZEIA 1XTQA 2Y9MB 5KYNA 1JHXA 4Y3UA 4BGIA 2PZKA 3AG5A 3AR9A 1KI7A 2P9HA 1KDRA 2Q1SA 3JZAA 3QG5A 5D3QA 1MTZA 2XCQA 3RWBA 4IRMA 3SNKA 5M2QA 2Y68A 3FDXA 1CUFA 1F0NA 1AUQA 2ZXUA 4RM2A 5ICSA 2PEYA 1X1BA 4IJVA 4NV0A 4PHFA 1O96A 2I2FA 2I1QA 4D02A 2PIDA 4NNOA 5CFPA 1PJQA 4NZNA 4Y6RA 3L1VA 3PC6A 3KEGA 4ITVA 4RA9A 3D0OA 5AM2A 2IBSA 1S89A 4D9BA 3S0JA 4W8OA 1U7DA 2OECA 2FWAA 1WLSA 2Q8QA 3EXFA 4MV1A 5A9TA 4TTQA 2FMIA 3RFTA 2GZHA 3FIJA 2Q3EA 3HU1A 3OEHA 2EVWX 2PMCA 4HXFB 4LTMA 3ERCA 5JLJA 3TL3A 5JV5A 4NJOA 1X7WA 1IK4A 3G68A 3U6BA 1RWNA 1FK8A 3PZRA 2IEIA 3ESYA 4MV7A 3BBPA 3G2OA 4AY6A 2E5LB 2UYOA 2DWUA 1I4LD 1UBTS 4NPCA 1IE3A 1M1YA 5FLXA 3VDRA 4WLFA 2GJ8A 4G24A 1UFVA 5EZ5A 2W43A 1PFWA 1Q57A 1T0PA 4PW0A 2FMKA 2VWPA 4HNRA 4XOIA 4CZ2A 1W9MA 2XMSA 3CRMA 3HCFA 4CGYA 1LB1B 1PG0A 2VPXA 3L92A 4GOKA 2CYCA 2F4VB 4GE3A 4PE5B 4Z9YA 1TK3A 4AXXA 4FX2A 1NP7A 2QQEA 4KV9A 4N0QA 4XIGS 3DMYA 5KYUA 3UFBA 1VZ2A 2XYHA 3IP9A 2QI9C 3OM0A 4QYIB 4CL0A 5HKAA 1RJWA 5J4HA 4FFLA 1WVIA 3JWIA 4DIBA 3ACBA 3JYLA 2XITA 5AXAA 5EUCA 3OEED 4B48A 2CF5A 4LHYA 3AFGA 3KP1A 4KXQA 3DLAA 5C31A 1Y8QA 1FDTA 1KJZA 1VXRA 4DTIA 2R1TB 3NU1A 1YJCA 4B6FA 4EKDA 5JECA 5KNBD 2A4KA 4KDRA 5B5SA 1Z88A 4KGDA 4V03A 5CXQA 1BE8A 1ODCA 3L7YA 1C2YA 2BFCA 4RLSA 4YRSA 2VT2A 3IXMA 4FNMA 3UW1A 4IOKA 1Z75A 4FS3A 4L9WA 3HG7A 4MP6A 5DPMA 2HJWA 1ZIDA 3UPDA 2QTTA 4C0JA 2YRFA 1F0PA 4F2DA 2XYPA 3F97A 4PCUA 1I1QB 4F5DA 3CE6A 2Q2QA 4FSDA 4YVFA 3WIOA 3WIDA 4F1WA 3BK1A 1XELA 4YT4A 4HL6A 5DBEX 4CLOA 1SELA 1TCAA 1ZZGA 2XZDA 4HX5A 2JJYA 3RGWS 5K3FB 1SVOA 4I1UA 1CR0A 2AJTA 4J1QA 5HJ5A 2IDKA 2CNKA 3AHDA 5B2EA 3RIEA 3KKNA 5ARDA 2O8NA 2ASEA 2KJQA 3PL1A 2B25A 4O4HB 5A1JA 5IAEA 2RI1A 4PYQA 1T6ZA 5C7LO 3BWCA 5IJ9A 5K03A 1TTHA 3FFAA 4LXYA 3AVYA 2ZRLA 1W29A 2XI4A 3ZHVA 5CFZA 4IIGA 4QG3A 3W3AH 2Q3DA 4KOAA 4ZO9A 4M21A 4G0NA 4HDQB 3WZ2A 1P7YA 3KYIB 4EJ6A 4RXTA 1QONA 1U6IA 2GEBA 2Q27A 4O33A 3UAWA 5K7SA 1IY0A 3Q8MA 2QVZX 4ND1A 4Q24A 3B1XA 5MGBA 4GVLA 2V9ZA 2XVMA 5HF8A 4BO6A 4X65B 4JI2B 2BZ0A 4INJA 1S2NA 1LLUA 4AWAA 3NBMA 1DOZA 3A4MA 2ZR9A 1M1UA 2A1TR 4D8UA 4QQKA 1NW3A 2E6KA 2ZULA 1Z6YA 1TLLA 4KQKA 1VLMA 2CF6A 2H0RA 1L5SA 3E7PA 3MTGA 3QUQA 2H06A 3BH0A 3NJ4A 2F4NA 2X1HA 4L4UA 5LBTA 2WSIA 5TPWB 2CSUA 2QZZA 2YV2A 4IWYA 3O9MA 3R5KA 3PP8A 1USUA 2QR2A 2GTHA 3CKYA 3L6RA 2WQ6A 3NPAA 5DX1A 1U65A 1UPAA 4HDNB 2EKZA 3DLIA 1BN7A 3LLUA 4J1SA 5AHXA 5K3EA 3RT7A 1L7QA 4O3FA 1MGPA 4EHBA 1WV1A 4MQ5A 4G1UC 3C1UA 5T41A 3LUCA 1VJ0A 4HAXA 4MO9A 3SJAA 4NI5A 1HFJA 1X39A 5TRTA 4CM4B 4B2IA 2AZ4A 1IWBB 4DBLC 3G9QA 2AFIB 3KUUA 1RXSA 2WKRA 3I39X 1UFOA 3NBUA 3VHQA 4LDNA 1P3Y1 3IVGA 4NONA 5E7MA 2YL2A 5BWOA 1P60A 1CVLA 1X7YA 3KCQA 4CMBA 5BVGB 2NXCA 3Q85A 4U2KA 1HLFA 1F8YA 1Z5PA 3H86A 1J8YF 1V26A 1HOTA 1V5EA 5LOVB 2HJRA 4DILA 4KFUA 3WQHA 3L02A 1X86B 4G5XA 3U19A 1TLTA 4DANA 3AY6A 1DS6A 3BL8A 4X00A 5CDTA 3FNBA 5DGXA 4DG9A 1ONNA 1NTRA 3CPEA 3GW8A 1FPMA 1T2AA 4UBNA 3DHEA 1W48A 3OSUA 4N3CA 2YWEA 4BOYA 5A9SB 3JARB 2JBWA 1RQRA 2OCIA 2J59A 1PL7A 3FPLA 4QPZA 4MVJA 2P9GA 2UVPB 3LDFA 2VSQA 1SUIA 2GAJA 2G9UA 4TVBA 1X1DA 5EJ9A 1OR8A 4J7XA 1C9DB 1P0FA 1KXZA 5IPFA 1GQRA 5L40A 2E4XA 1RHMA 5TS2A 1R9MA 2IHUA 1N0WA 3LYLA 2HXGA 2LDXA 3G2JA 5I9TA 1S1CA 3N0RA 4EPTA 2HBRA 2C7OA 1R88A 2H5JA 4FGJA 3AF3A 1RJEA 3UT6A 4ZVQA 5BMVA 1ZRHA 4Q4AB 2CUTA 4X71A 3EVDA 3L1HA 3BAFA 4JUCA 3V4SA 1F9EA 3KT0A 3A7DA 2FCRA 1IPFA 2H8KA 1EFRA 1G4UR 2V7PA 3BRSA 3GRYA 1T2NA 3G79A 1AGYA 4N8EA 1T0UA 1DAEA 4PZCA 4RQAA 5JS2A 4ZHQA 1DV1A 5BSEA 4M1OA 1KI6A 1DMRA 2Q0QA 4I4LA 2ZS9A 2DUWA 2J45A 4ZREA 3TLKA 3ZOKA 4Z49A 3K9HA 1NASA 4PC3A 4D9JA 2WAXA 5AI4A 4P7BA 4HSEA 2XOKA 3OMLA 5JYDA 2GAOA 4LY0A 4JROA 2IBMA 1RPAA 3RVQA 1FP1D 5FH9A 1Y7HA 1RM3A 2WT9A 1FMCA 2OD2A 4QRDA 4EA7A 4I9UA 4QYMA 3K2BA 3MUFA 2O1WA 2XVYA 3TOCA 1ZAKA 1G8KA 2QM7A 1Y0BA 1U0HC 2BMWA 3MGAA 3QVSA 4CFZA 5BSKA 1AXGA 1QUFA 1P77A 2OQIA 3UF0A 4KPYA 2P5SA 1MFZA 3QKTA 2I33A 4DNOA 3A27A 4YIHA 2ZYHA 2QAGB 3BK2A 3RAJA 5ALDA 4OXRA 5BMOA 1KTVA 1JAHA 2AR0A 4AMUA 4E15A 1Y3AA 3QSYA 2P6PA 1P1KA 1S2IA 4R6WA 1ABFA 1QHXA 1US8A 1ZESA 1SPXA 2DKNA 4LJRA 2UVPA 3GDWA 2BHNA 4KN5A 3U3KA 5B6PA 1ZBQA 2VCEA 2XDWA 3ZU4A 4DRXA 1CP3A 4DCVA 1X8LA 5F52A 5BUZA 1K08A 5TR9A 1AZWA 2CSXA 5FTKA 2NUBA 1YZTA 2PKXA 1JBQA 3SLKA 1F60A 1JJBA 2J46A 3E9YA 3R75A 4KWCA 3VR2A 3W2FA 1MP0A 4CEHB 3CZQA 1OZ0A 2BBSA 1U5AA 2DX7A 1QX4A 1Z4LA 4BO1A 2XZTA 1P4HA 1HYBA 2UUPA 3HKEB 3KZXA 3LPLA 4NL4H 4DCTA 4RTPA 2ORWA 3DH0A 4Y9TA 4JODA 4Y8VA 2QUBA 3PCXA 4B71A 2ZUBA 4DRXB 1I2CA 2IBTA 1XZLA 3EDRA 2FN4A 1OT3A 1C3OB 2CV1A 2J4CA 4G01B 4WBNB 1GHTA 4TYNA 4E21A 3AF4A 3LUKA 2CHFA 2PJZA 3EGDA 2OXCA 2QTHA 3TSAA 3MWYW 3SG0A 1XPRA 2AQHA 5ECGC 2FPRA 4Z0PA 2AN4A 3HCBA 4GWLA 1VKRA 3SYNA 1PDWA 5DMHA 3WLQA 4QICA 3DL7A 1AHNA 4XFDA 3HVKA 1R64A 1SN7A 1TM3E 3MINB 1RVDA 1XZCA 3G2IA 4DL9A 1PUJA 5K8TA 2HDNB 5I8WA 1NRWA 1Z73A 4WNAA 1CF9A 3A2LA 4UATA 2OZLB 2OUIA 3TSZA 4DGSA 2X2PA 3TQIA 3KK0A 1O4VA 4LKRA 1UBOS 3CGGA 4RTLA 4B84A 1I3LA 1HE5A 2QXYA 2YFHA 1MJFA 3O9VA 4IXTA 4F96A 1NE7A 1BD3A 1EUDA 5JMOA 2XZOA 2Q0XA 5K6TA 1FQJA 2UZ0A 1I3NA 2VDNB 1K4KA 1PEAA 1V95A 3U7RA 5AWFC 4S0XA 4ZOLB 2QZJA 3JPWA 4ZODA 4YV0A 2FN8A 3AEZA 2JZCA 3U3MA 4JZYA 3LOQA 4JT8A 4FYMA 4PG6A 4JYBA 1DX9A 5LYJF 4ES6A 1NT2A 4PQEA 3VJMA 1SCKA 2AKEA 4DLNA 5LD2B 3HCRA 3I83A 3U7JA 4DT1B 4O5AA 1WXEA 1R0RE 1G8GA 4HNSA 4KRFA 4DYVA 1CUYA 1UPBA 2HBZA 2VA9A 3E35A 4DCCA 3OPXA 1JJVA 4E70A 4ENPA 4RHEA 2DF8A 3SQXA 2VIIA 5BQXA 2VJYA 3LQ1A 3SKVA 1BH2A 3OG9A 1V3VA 4Y2VA 2HOQA 2SKDA 4HEA6 4JD5A 4Q1CA 2VJBA 4MXDA 1IBSA 3MOGA 3STYA 4BJHB 5CAEA 2CVZA 1FUKA 4QYXA 3OQMA 3UPTA 3MD9A 1AZTA 4A2PA 3CF2A 2CLOB 4YP9A 3EUFA 2G6TA 3BKXA 3U09A 4O4LB 2O7NA 2R85A 2WNSA 3I42A 4MW9A 3PNQA 2QM0A 2ONJA 4O59O 3ZKWA 4C7XA 1E1NA 5JI3E 1QIDA 2BH9A 3DYBA 2J9ZB 3ZHTA 2NV2B 2IGTA 3HM2A 3IIEA 4YLGA 3RVNA 5L53A 2HMTA 3IEVA 1N1EA 2X9NA 5CHYA 3N2KB 4KR9A 5BPFA 1H2EA 4BXOA 1KMQA 1R0YA 1J5EB 2YHSA 4DCUA 2O8EB 2IDMA 1NNUA 1WS6A 2IHZA 2Q3BA 5G0UA 1IBRA 2CJPA 2VF2A 2QPAA 2Q4EA 3V8PA 4BVFA 4FB4A 9ATCA 1JFSA 2IEBA 3OQBA 5F3RA 4BQRA 1O57A 4DA8A 1L3CA 1L7EA 3KYCA 4Y7CA 4HQLA 3K71B 1H0SA 4DTCA 1MJGA 4U9HS 1S01A 4V0RA 3H05A 4PAGA 3EY9A 3MYYA 3MXOA 4UXHA 4MQFA 4WTOA 2ADMA 3UWSA 1D6NA 5AKIA 4F8EA 4XJVA 1G7TA 3PDWA 1H8EA 3TIGA 5IVPA 4BUZA 3HTXA 3KZCA 3AVVA 1OBFO 2F1JA 3W7VA 4F4IA 1KJWA 3I0ZA 3JAMA 2RE8A 1GAEO 1Z2EA 1OWOA 2HX1A 3MWEB 3SDBA 4NXMB 1L1QA 3RSQA 4DZZA 3G5TA 2OD9A 4JJIA 1P91A 4JJ4A 3MHPA 1KKUA 1E2PA 4KHZA 5E3IA 4A8JA 2J85A 3SS9X 4GKAA 2BUCA 3TQQA 1NYQA 4LGCA 2R8BA 1L5LA 2MR6A 1DQSA 1W0KD 2QZ4A 2FJ0A 2Y1XA 3HPRA 3QK7A 4DIOA 1N9KA 1E89A 4PFJA 2Q45A 3F3KA 4WESB 2Y9PB 5CBKA 1Y6QA 3EASA 2P9CA 2Z98A 3ISJA 1QQBA 1KSFX 4JI6B 3RKUA 5FAXA 3VRHA 2EBHX 2VQ6A 4RY9A 4EX7A 2YVQA 1EKXA 3R1IA 1DRWA 3T1NA 2CL0X 5H4HA 1G64A 4ND8B 1TVKA 3BMXA 1EFVB 1OYWA 1NMXA 4LHSA 1TVMA 2IZ1A 3KOXA 1TZBA 4QXPA 4U1RA 1I13A 3FUCA 5H68A 1JTVA 4LGYA 4XX1A 4OQMA 2GN6A 4BLTA 4DR4B 2H9IA 2LCIA 3OTHA 3N2GB 2WV9A 4KVZA 3TRHA 4V1CB 3BHJA 4YMIA 4W5RA 2A4MA 2QW0X 1E3LA 2EEPA 2IZ0A 2R5NA 1CIJA 4IW3B 4CQLA 1NBOA 1QV7A 2AOWA 4J4TA 5DULA 5IM5A 2GF2A 4UPEA 3FPKA 2ZQYA 1VA4A 4ZVSA 3MOIA 2JAUA 2H5EA 3IA2A 3JATA 4OKSA 1DDGA 3RVJA 5AP9A 5A6SA 1AZLA 2GPJA 1PGJA 4AROA 4P93A 3NATA 3VFDA 2Z9BA 1R8SA 2ZSFA 4PZEA 1C8KA 3TJMA 1CT9A 1E79A 1V4NA 5LWHA 1XZKA 2N9UA 4W1QA 3EGIA 2E85A 1TQ8A 2VATA 1HI9A 4LZNA 3RHZA 5FLYA 4XPZA 5KSZA 2JCGA 4Q37A 3A1WA 4IXDA 2ZKLA 3GBSA 1AGNA 1N0HA 2CNNA 2IPOA 2NXNA 2WTEA 1KY4A 5KTRA 1CY4A 3PSAA 4UREA 3RW9A 4AKTA 3W8DA 3RQSA 4Y9UA 4N8SA 1G5PA 2VWHA 3HA5A 4DF3A 2RIRA 2UYQA 3IILA 1GTVA 1QYVA 2V7QD 3GLSA 3PRJA 5FJIA 4E5DA 3AWDA 3NW9A 4RF5A 5TVKA 3BD6A 1H1LB 2BEKA 1PFQA 4RD3A 4TM7A 1NW7A 1T5DX 3CZ4A 3OP1A 1VL0A 3EZLA 3LBIA 5D5PA 1P1IA 1CQIB 1WZIA 1ZVMA 2IOQA 2WAMA 4QUGA 3BGWA 4IINA 2WIJA 2HREA 2P3QA 4BZQA 4JB8A 1XP8A 3NNNA 4HPWA 3UENA 5C5IA 3B3AA 3HNOA 5ITVA 5HK9A 5AVVA 2F59A 4L50A 3QVOA 4KXYA 4QFDA 3D2BA 1LC0A 2PXCA 4MKGA 4ZU6X 1BCRA 5EY5B 4B09A 5GGYA 1UMDA 3ZWKA 2G06A 3ZNPA 4BB6A 1N3BA 2BM9A 4WOCA 2W8ZA 4MS1A 3E5HA 2H63A 2GXSA 5IVDA 4ESHA 1FVHA 2HWWA 1W47A 2WSLA 2X8BA 3DOJA 3VU9A 6AT1A 4BMXA 2CHEA 3LOUA 4UEOA 2JATA 2JIZA 1J70A 3ZYZA 3PFWO 2F6RA 4J3NA 3WLRA 3L7LA 3O74A 2HA7A 2P8SA 3CF4A 1PG5A 4JQCA 5J2TA 1E1RD 2IOFA 3CN9A 3R7BA 3ESBA 1DEHA 2RHBA 3QGMA 1NVBA 2OKCA 1JE0A 2GFIA 2P2GA 3ZI0A 5IU6A 1RAAA 5G3YA 3O03A 3ZIAD 4YMLA 2Q9BA 4MVJG 4BGVA 5JAIA 3V8MA 4DR3B 3R3VA 4QPNA 2WVHA 1ZGGA 1ZXXA 3HB4X 4J7CA 4KVAA 1QP8A 3IPAA 1N77A 2C3OA 5CP8A 1G8JA 2R1ZA 1II0A 1P2DA 5BSRA 4QDZA 3FWKA 2GQ0A 4TGLA 9MHTA 2O14A 3DAFA 3LUDA 2GZ2A 3D6NB 3I76A 3P2MA 4MYHA 4P1ZA 4G4IA 4K6MA 2JASA 4RYDA 1JHOA 2F3UA 4FMDF 1HYHA 2IU4A 3ZIAA 1T15A 3W5UA 4DHEA 2VZ9A 2WV7A 2XYQA 2C4UA 2JAPA 5L9AA 1F14A 1HGXA 3Q88A 4TTJA 4MRVA 4DJAA 4QWMA 1ZNQO 1JBEA 2GBPA 1DP4A 5G0VA 2I91A 3H1GA 4URYR 3BFVA 4BB9A 3VSEA 1HNXB 1JHUA 2VSFA 3NH6A 2HRDA 3DFFA 2XXAB 2AFIE 4DDTA 2VP4A 4LJ5A 4HRAA 2HB6A 2YJZA 3P9XA 2ZXEA 3ZXIA 1AKEA 2BGUA 3I6MA 4H18A 5A06A 1IG3A 3S44A 3WQQA 1F5SA 4ZJZA 3RADC 4HAZA 3R40A 3EBLA 2C3MA 3GV0A 4HEQA 4MPTA 3M6VA 2PWYA 1Y5RA 2ECQA 4UBKA 5COBA 4ZQEA 4XEHA 1E9AA 1L2TA 1LW6E 1ZW1A 3T95A 4D0RA 2UVQA 1II8A 3I58A 4IDPA 2H7VA 1N9GA 3DT6A 4Z2YA 2QU8A 2R8OA 5KQLA 1KKMA 2M32A 3CC8A 3VOTA 1T8YA 4WEQA 3VH3A 1PTKA 4XGNA 3RC1A 5ADUS 3MELA 4KQFA 3MWKA 2H7XA 3AKZA 4JP3A 5JS7A 2BFCB 3P96A 2GPBA 3U4MA 1DBPA 2VTEA 1R4ZA 3DBHB 1RBYA 4BLUA 2QPTA 3FCOA 4S1WA 1JSRA 4XD2A 1IONA 5IMBA 4E07A 1RRCA 2XUFA 1Y82A 3FYUA 2XQVA 5A4AA 1SBQA 4BWVA 2BMAA 3IMGA 4G4GA 4EARA 1PWZA 2RHOA 3EWAA 3NTXA 3WMWA 2ZI6A 1J07A 3OAAA 5DTIA 2H4YA 5IARA 1LC3A 1BRMA 2NXWA 4EI9A 3UWKA 5EFZA 1ECJA 4WZBB 1FMFA 1GKLA 1GY8A 4H7JA 1VHQA 3WDMA 1C3EA 3MWJA 5KVVA 5AK6A 1VKZA 1U98A 2GEDA 2GM3A 1D1TA 1BA3A 4GSKA 4F21A 4AS1A 1YIOA 3SOZA 3GMDA 1WHSA 4B76A 3UC9A 4EVRA 1NSFA 1TB4A 2XDYA 5DNVA 1PNQA 3D3WB 3WWYA 2Z0MA 2G5CA 3AFNA 4BBJA 2MYUA 4A2WA 2JFQA 1HMPA 1CJMA 1JQJC 2V7WA 2ZJ7A 1WHTA 3BIFA 1K8XB 1QKKA 3W8RA 1Q15A 4ISBA 1KYWA 3KOOA 3SR3A 3QOXA 2CVHA 2Q41A 3G02A 1R27A 4AZVA 1M76A 1SB9A 1WMBA 2FXIA 3GQBA 3SS7X 4GR5A 3O83A 2OSVA 4B8YA 1AQ6A 5KSPA 3F46A 3L1JA 2IYLD 2VG8A 3MN1A 5JTUA 3KKOA 4CL3A 4AKHA 2CMDA 3ZE6A 5HZGA 4W5WA 1RKVA 1TADA 2Z2YA 3OO1A 2R3SA 2SKEA 4AZ0B 2ZPAA 2ZKIA 1PT5A 2AVNA 3FDJA 2GD2A 5LOVA 1UCFA 3L0BA 3IRVA 4XVRA 4C88A 2BCEA 3Q7QA 3BEOA 3UB3A 4ECAA 3GLIE 3ZDCA 4HGQA 3M33A 1K63A 4HN9A 4J16C 1XRRA 3HCCA 3QE3A 4R68A 5F78A 3I4FA 4ZP1A 1E9DA 3RJ9A 3WLAA 4XPIA 3C3XA 5LBIA 3ZK8A 5C5CA 2WZDA 5JAPA 2UXDB 4AKGA 1MQ8B 3BX1A 2I6GA 3MAAC 2A1UB 3TBFA 2EWMA 3N8HA 2C2OA 3CW9A 1KMNA 2QVXX 3BGOS 4NR0A 4OUDB 4LZZA 3VR1A 5BOSB 1S5PA 2B4KA 2WKPA 2CUNA 2YMMA 1GAJA 4E5SA 1N6KA 1KYQA 2NZ2A 2AH5A 4GOND 4PYIA 4GW3A 1T3TA 3QU9A 621PA 2XVZA 1DIGA 4UEJA 5CR9A 4RKRA 1JG1A 3RS3A 4MLCA 4ZTUB 1SIOA 4NU0A 4QGHA 4CF5A 4U39A 3PEFA 1UWVA 2B20A 2DY0A 3EVGA 3GP5A 3OTGA 4R41A 1JSLA 1G0OA 5ALQA 5TJHA 4BPBA 4GM1A 3TQFA 1ZUNB 3OFND 1OF1A 2X6RA 2WMDA 2ZVPX 5EERA 4AYXA 5HOEA 5GOTA 5KPJA 1JGTA 1UPXA 2LIPA 1Q7CA 5DSXA 4QUHA 3ZH9B 4WK0B 3DTTA 4ZO8A 1DBSA 4PO1A 1TM1E 3ECAA 2BKXA 1Y1LA 2ID4A 1GDDA 4M0KA 3EXIA 5FA8A 4EHKA 2FR1A 4AF7A 3PLAE 1G2IA 2HIMA 2PV0A 3FOAA 4HX2A 3U3JA 1YE8A 2X5XA 4DJEC 2FX2A 1XDDA 4BVGA 3QP9A 4XB6B 3MT0A 5EKTA 5F3WB 2R5FA 3EZ7A 5HRUA 2Z57A 1K3FA 2HDWA 3MUNA 4OL9A 3DLCA 1XFDA 5KREA 2FMFA 1W5BA 1TJYA 4IJMA 5JZSA 1JZTA 4RQBA 2OCAA 4B3BA 2P4SA 4ZAVA 3D6VA 3H19A 5M04A 2XA1A 4G5GA 4U7JA 1JKXA 5IVHA 1X7ZA 3H2GA 4JEIA 4J2HA 4Y2UA 4QBHA 5HFAA 4TXNA 1PT9A 1JQEA 2IPLA 4GYJA 2E48A 2WU4A 1CNFA 4HQRA 1YL7A 3IE1A 1IN1A 3RTAA 3GUHA 1T9AA 4JYAB 1AGXA 1P2UA 2FPSA 4I3FA 1D5WA 3M4XA 5J1TB 3JRWA 5TQ0B 3D4PA 1GNSA 4FEGA 3GEBA 3SC6A 1CV2A 3ZPXA 5KJEA 4D8TA 4MX8A 3ZLJA 2EBUA 1KEEA 2W6OA 1O6BA 3OH8A 2PSHA 3UFXB 1OLXA 2C29D 1BYUA 4IIYA 4ZARA 1BO6A 4GC9A 1HEYA 3DFUA 3L4BC 1QHYA 2LCQA 1GPJA 4WXMA 3QVVA 2Q46A 4NH4A 3NRBA 2ZJAA 4FILA 2PUJA 1US8B 2NGRA 3HLKA 1URPA 3D4NA 1R9GA 5K45A 1SUBA 2XNKA 1OLXB 4HNUA 4D8VA 4KREA 4ZVUA 4R05A 4YCBA 4R0VA 4AX4A 4EHAA 1ZNXA 4OH7A 1SVWA 1JW9B 3JVIA 3LC1O 4A0QA 3GDFA 2JS7A 4Z9AA 3EDMA 4FXOA 4GZMA 3T9DA 4NCBA 2I80A 1GRRA 3T7RA 4GPD1 4OA5A 5DXFA 4ND4A 4E5NA 3SFZA 1O6ZA 5JXHA 1R0ZA 1VE9A 2P69A 4JJEA 1UQTA 4RJLA 1G8FA 5IKMA 5G4KB 2YHBA 5TQ2A 1J0XO 1MC4A 2IY8A 1XDBA 1JAZA 2QD2A 3CX3A 3K0HA 4IIBA 5JBIA 3HXOA 3JWEA 4NNPA 4F85A 2JI9A 1X77A 1YZHA 1C0LA 3D59A 4IDFA 5JHHB 4XX0A 2XCIA 4RY2A 3SP1A 2B9EA 1ADFA 3CT6A 3WBKA 9ABPA 4NF2A 3TLMA 4Z9BA 1QGUB 4OSPA 4TLEA 1OI2A 1JLRA 3H1FA 1LI5A 3VO9A 1U7OA 4ZT5A 4ZCSA 4MQUA 2NNLD 2FG5A 1HQKA 2WSYB 2GTIA 2OHOA 4QKQA 1SHZA 4HDKA 1EMDA 5B1IA 1QR2A 4LDPA 4YPVA 1JXQA 3PFFA 1XZMA 3I45A 4FCCA 5C9ZA 5JQWA 5COAA 3DAHA 1QVWA 2BFMA 1QK4A 4IDCA 3UK0A 8MHTA 1E5TA 3GLQA 4ML3A 3W1VA 4YCLA 4FD3A 5C1DA 2OLJA 4AKIA 1U1CA 3LF2A 4EH1A 1Q11A 2V3CC 4NMMA 1S3GA 1FXWA 8LDHA 1IB6A 1N2SA 2BKEA 2REQA 1G4AE 1ODIA 2WW8A 3GRZA 4OXKA 3VM6A 1ZG3A 2E6UX 2HZ7A 2JIBA 4QXMA 4GO1A 5T3UA 4EHNA 5LQKA 3JCZA 4GX2A 3PGA1 1NBHA 4O4LA 1B2RA 2K5UA 3GNQA 1W5EA 4C08A 3G7UA 2PT9A 4DCGA 3IXLA 4MS4A 4ZEVA 3G82C 3TMYA 3ZQKA 1PV4A 5I4IA 4KWHA 3KQWA 3HJCA 1EVYA 1LXCA 4LOJA 2YBDA 1XR3A 2QIOA 2ZR8A 4PZUA 1A50B 2ZB8A 4D42A 1T9GS 2H7YA 3DB2A 4K2AA 2H0QA 3LGSA 2PLWA 5JYCA 1H0HA 1SQGA 3BTSA 2C7VA 5DGTA 5J2TF 2ZB4A 4MVJP 1DPFA 1Q0TA 3U62A 2ACEA 2P67A 3VPXA 1ODKA 1VJ5A 3ELDA 1ULTA 3WICA 1C0IA 1W88B 3RD5A 1WMEA 4LYGA 5EHQA 3VU0A 5KVSA 3CEAA 4U7FA 1GZ7A 4HAOA 2JIQA 4GBMA 1WXFA 2H9YA 4O25A 4Z54A 4EKYA 3D5QA 1DLIA 5FTNA 4UEKA 1GOTA 3PCRB 4MVJM 4AS3A 4IIHA 3UJ3X 1IDN1 3GYGA 1PJZA 1Q7EA 3CRQA 5K6RA 1SCJA 2YYYA 3MJ4A 4F4UA 5HTOA 2MSDB 4L2IA 5FL7D 2D2XA 3OPVA 4HZUA 5IT9A 2Z5GA 3L40A 4IFTA 3D31A 2DFDA 2Q28A 3VKHA 1QB8A 3F90A 2TMYA 4O0MA 3O4GA 4KQCA 1CY2A 4HQ6A 4BLRA 2C97A 4XWGA 1DAFA 4UFPA 4U02A 1A2OA 1B1CA 1OXSC 1QM5A 2IC5A 3ETEA 4CDRA 3MJSA 3R3XA 5EMJA 2LXNA 1PI3A 1O9BA 4MYSA 4YRTA 4AUEA 2CC2A 3S99A 4D41A 4D99A 4HLQB 1T5LA 1EEXB 1MV8A 2MMCA 2ZTHA 2ISCA 1QIJA 4IQ0A 3UCXA 4NE7A 1NQUA 2I71A 3HA3A 3PNBA 3DD1A 3AR7A 4QPPA 1RQ2A 1CFZA 1YB1A 1HG1A 2C5GA 3EHEA 2BKUA 4BO9A 4BZZA 1EDZA 4GI3A 4L85A 9GPBA 4MQEB 4DIDA 1QG0A 1PSZA 1T5OA 1N2IA 2IHJA 5AVOA 5IK2A 5IKPA 4CUKA 1YR6A 4C4YA 1PJBA 2F90A 1Q7TA 4YRFA 4AL4A 2V1XA 4KN9S 4DR1B 1NXSA 2OZPA 4I55B 1KMHA 3T7AA 5A4DA 2QRVB 1OJ7A 1G66A 1PBNA 1SXJB 1U8FO 1XA3A 2I54A 2JGAA 4WZAE 4WADA 1A8SA 3OZAA 2WVGA 3KKMA 3EMBA 3O8OB 3ND7A 2AT1A 3IR6A 3CWCA 2GWHA 3G17A 4KN8A 1CIVA 3PL5A 2OMEA 1TQHA 3UAOA 1IHOA 5AJXA 1ZONA 1D9XA 2Q1WA 4OJKA 2X8AA 3AERA 4M22A 2O50A 2PH5A 4JI3B 1ZI9A 2OGSA 3E9QA 1TJ4A 3JALB 3M2TA 1FX0A 2CGEA 3AY3A 3PD7A 4QASA 1L8OA 1NFFA 3WJ2A 5U9CA 1CS4C 1XI2A 4ARZA 4CMIB 1U4SA 2AI1A 1WD7A 3OQIA 3SI7A 5H02A 2WHXA 1BW9B 2ZWOA 4MV3A 1GPH1 3MCVA 5YASA 3CJQA 2ONCA 3G49A 4LRTB 1N2BA 1GV1A 1M2FA 3S1LA 3U31A 4TS1A 3K6RA 3P94A 1LRKA 3CGWA 3EA0A 3FW1A 4C3OB 5JZOA 2CE2X 4BBPA 5KYVA 4FE4A 3IE2A 3WHPA 4IX9A 1QOPB 1SR8A 4UTZA 2NSHA 2V58A 1XZPA 3TZCA 1UEJA 2WG1A 6GPBA 5TC4A 1JF8A 4RAQA 2VF5X 1VE6A 5HS6A 1IQ0A 3ZWXA 1M2NA 4FOOA 5I3CA 2Q2VA 4CUJA 4DIEA 1NX6A 2IZOA 3CVWA 4TQGA 3UFXA 4QLBA 5BR7A 1IHUA 2JLYA 3ICEA 2I34A 1AKWA 1UAYA 3CWQA 1P4SA 3T1TA 3NNDA 3EEIA 5L7YA 2Q3MA 3ZLTA 3QXCA 3PIRA 4DQ0A 4YCMA 3KHTA 1BGWA 2Y1FA 2NQTA 3HGMA 2WMYA 4WN3A 2V5UA 1C4KA 3LL4A 4MQEA 3UJPA 4B7ZA 3Q0TA 3FX2A 1UAAA 1U6KA 3HXTA 4Y2GA 4CMJA 2X76A 3I3OA 4P4GA 4W8GA 2XTMA 1OXXK 1UKEA 2OBFA 1G8HA 1KORA 4PNHA 1BMTA 2HBYA 3QQ5A 1BOFA 4RFSA 4ESEA 2XMDA 3UAGA 4IHJB 4MUMA 5DTMA 3LT2A 3WL8A 1WBBA 1V8ZA 1RSZA 1OVGA 3BCHA 1CLEA 1GADO 2ACWA 3A6HA 5BWLA 2JBAA 3T7SA 3ZS9A 3K8YA 3U48A 2Y0EA 1KBZA 1VC2A 1O08A 4YAJA 1RWQA 3I6BA 3UMMA 1OLOA 1CPYA 2YJTD 1Q1AA 3OKCA 1Q92A 3SIWA 1ZJ5A 1O7JA 3O0TA 1CB7A 2O05A 2KX7A 1R0CA 2RGEA 3G8YA 3TB6A 2GCGA 2HJVA 5CHEA 1E3JA 1J09A 1UJ2A 3FPBA 3IP7A 4W9NA 5BN5B 3SZRA 1Z6XA 3JVEA 3UT5A 3TINA 4GX5A 4WA8A 1SBNE 3FMOB 3FFWA 3LY5A 5CDFA 4LMBA 2H8GA 2PGXA 4YDRA 5GMOA 4RENA 2GGSA 1K97A 1M6HA 3QUTA 1RLOA 3KU4A 3A6PC 3RC8A 3JQEA 3QEMB 3S2FA 1ABEA 2ZTLA 4CRWB 4FZRA 3OTOB 3TYXA 4ISCA 1PFGA 3HB9A 4J0GA 4YR9A 1MJGM 5DSTA 5LQRA 3OTIA 2CW5A 4EEZA 1BYIA 2PN1A 3AOEA 4UKDA 4ZYUA 5I5EA 3WNZA 1ODLA 2G09A 5B6IA 1H9CA 1D9ZA 2H1OA 1X19A 3LYAA 4U0JA 2AMFA 2LVBA 2QY6A 3C6XA 4WJZA 4YRQA 3NAMA 4H1UA 1Z28A 4MUAA 1U31A 3CU5A 5C2JB 1B23P