4HLQB

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
b'PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
total genus 51
structure length 172
sequence length 172
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlqB00
4DSUA 3HJNA 1XB2A 3ND9A 2WPDA 3G82C 2O5VA 5JJIA 2NPIA 3KKMA 1TU3A 5AUPB 3CBQA 2R9VA 1KI3A 2OCPA 3AVYA 2WJIA 3BH0A 5CIQA 2MMCA 1CKEA 5AK0A 2WJVA 3RNLA 1OH8A 3AH8A 2GEDA 2WJGA 2ZQ5A 4NYJR 5CJ2A 1GDDA 1HE8B 3T35A 3HDTA 3ZDQA 4FCVA 1Q22A 4BASA 3NEJA 1J8YF 4WW0A 2JATA 4PZYA 1G3QA 3CNNA 5DO9A 1IXRC 1FP6A 1VIAA 4DLZA 1U94A 4EPVA 5AUNB 2NG1A 3U2QA 4ZDIA 1OE0A 2EWWA 4W9MC 4CF7A 1ZYUA 1X6VA 2ZUDA 2BCGY 5G41A 4KFTA 5E4FA 3WNBA 1HURA 1DOAA 2B7CA 3R8FA 1CF4A 1XTRA 3SHWA 2Q3FA 5HKKD 5HE9A 1EFCA 5G40A 3M0EA 4ABYA 5J4YA 2FGJA 2WKRA 1OB2A 4AYXA 1RVDA 2VHJA 1J90A 1JXOA 3A37A 4RD1A 5HCNA 5JJLA 1GAJA 2BOVA 4TMZA 2NPFA 1W2HA 1VG8A 5FBVB 4HAVA 1VYTA 3LQQA 1QF9A 2C9CA 2J59A 1JPNA 3TH5A 1RZ3A 1XD8A 3ONWA 3Q7PA 4PC7A 3TSZA 4EQ6B 1F2TA 1RW4A 1X8KA 3PEWA 2BIFA 3FKSD 1QG2A 1L7VC 1RE0A 2VP0A 3CRRA 3GJ8A 4NU0A 2CHVA 4EUNA 3MRSA 2ERYA 4LYFA 5CM8B 3FWYA 3A1WA 3FKSA 2AFHE 1SKQA 4B47A 2WOJA 1KAGA 4TTRA 4EKDA 5JEDA 2NZJA 1X8JA 5DLQC 3REGA 1NY5A 3FMIA 121PA 3GFPA 1VG9B 4EJSC 1XXHE 2ZJYA 3TRFA 1NBME 4HB0A 4WBSA 3DM5A 2CE7A 2F3TA 1IN7A 1SXJE 3OIUA 5KSOA 3SNHA 1CULC 1G64A 1KJYA 5FOXA 5KPJA 4PZLA 4LX0A 2YYZA 2LKDA 3WNDA 4QBFA 4LPSA 2O8DB 1X1RA 1E9CA 3DL0A 1E1QD 2ZRJA 4R9UC 5DI9A 3ZIAD 3ADDA 1OIXA 4D82A 1XMIA 3QF4A 3MWKA 2IYRA 2ZRCA 3UMSA 2XXAA 1E1QA 3ZIAA 5K8LA 3L8ZA 2QZ4A 2P6RA 4Y0AA 2ZI6A 3ND8A 4OK5A 5IK2D 2QM8A 4G5OA 1E9RA 2JLWA 1VCIA 2ZTSA 1UKYA 3IBGA 1YZQA 2QPAA 3PVSA 2ZANA 4FW9A 4JL8A 4XVRA 4D81A 5C1BA 4S2EA 1WBBA 1A1VA 3FVQA 421PA 5EE3A 1CJKC 1E2NA 2HDNB 4K81B 3T12A 3BJIC 2EFCB 3ZZUA 1ZD8A 4NCIA 5L3VA 4IOLA 4Q9KA 1R5NA 4YONB 2EYQA 2GVZC 2XTZA 5B2ZA 3T5DA 5AWFC 3BFKA 3MFYA 4Q02A 1T9HA 5AJYA 5DHAA 1XWIA 3DZDA 3EZ2A 2NTYC 3SS8A 1XPOA 4AG5A 1XTSA 5CLQA 2ZE7A 4HAWA 8OHMA 1M7GA 1DAFA 1AQUA 1UDWA 1YQTA 3RS2A 2IL1A 4ASUA 5BQ5A 3OE7A 1A7JA 1AQYA 1NJFA 2REXB 5TMPA 1C4OA 3T5GA 2MSDB 2DY1A 5AJZA 1G6OA 2C9YA 3I73A 4HI0E 4DB4A 4HB2A 4OK3A 2KJQA 4HB3A 1N6LA 1NLYA 5H70A 1XD2B 3CH4B 2VP9A 4XSGA 2H7VA 5FL7D 1H8ED 2PZEA 2BDTA 2V8OA 2V6IA 2QNRA 2XTNA 5FOTA 4DSNA 1KO1A 5EE0A 4C7OB 3AV0B 1E2DA 4IKEA 1KK3A 1GTVA 1IXZA 2OCYC 1KDOA 1R5BA 1Z6TA 3VU9A 4DLWA 3CUEF 4JLMA 1II8B 4NYIR 3R9XA 2HF9A 4Q66C 5KOYA 2P6UA 1E2MA 5GVSA 4TTQA 3VKGA 3R20A 4PQFA 1QRAA 4QJ4A 4PHGA 4PC6A 5EQTA 5FBLB 1TF7A 2JJ1D 1GRQA 3GCGA 3OF5A 5JRJA 2WV9A 3DMNA 2Z5FA 1PUJA 2JJ1A 3PUZA 1CXZA 1P2SA 4PHFA 1P2VA 1Z28A 1WXQA 2C99A 1BMFD 4PPFA 4JYBA 2VF7A 4DWJA 3IHWA 3IEVA 1KDRA 2BMDA 1OXVA 1KOFA 4UQOA 1NBMD 2IF2A 1SXJD 1N25A 4C0BA 4CRWB 2ZRFA 5EE5B 3FYHA 2QM7A 4D4LA 4F93B 1XPUA 1Z8FA 1R10A 4FI3C 4GL2A 1OPXA 3L0SA 3AUYA 4IDQA 1DVRA 2QSZA 1GL9B 1NBMA 4GMXA 1SXJA 5E7IA 3NKVA 3K70D 3QY0A 2CNWD 4EPTA 5AR1A 5E7JA 1IN6A 1W4BA 3B7GA 5IRCD 3SJZA 1TMKA 5FTLA 2JAQA 2F9LA 1LB1B 3GJ6A 1U2RA 4TMXA 1E9BA 2VRWA 1ZUHA 2Q21A 5CJPA 4AYWA 1ZCAA 1GRNA 3RDPA 3K8YA 2RGAA 1COWD 3LBNA 3U4QB 1ESNA 4QGGA 1DAKA 4ZPXA 3VKWA 2WMNB 1N5JA 4ZCIA 1UKZA 4MKFA 3QENA 4W7SA 4D0NA 2IUTA 2XJ9A 4QM7A 2JLQA 1COWA 5E3HA 2ZS9A 3I61A 4A92A 2QEQA 3WMGA 2V55B 4KFSA 1ZU4A 4JVLA 4B6FA 3B1ZA 3HYRA 2ZR9A 2GETA 4JBYA 5JSZA 4KODA 1IJFA 2DFNA 2OESA 4HB4A 1XU4A 4Z8YA 3RRYA 2R65A 1JQJC 4L9SA 1JEDA 1RRPA 4QGHA 4TMWA 3VFDA 1FX0B 3AQ4A 4QJ5A 3LBIA 5F98A 4GPTA 5FUWA 4MGIR 4BEBA 5GJBA 2H17A 2QUZA 4PX9A 5JS7A 5L3QA 2GEUA 4DT1B 2IYSA 1KGDA 1WA5A 1NVXQ 3QF4B 4YDSA 1G8GA 3CIOA 2J0UA 2IUSA 4FCWA 2XXAB 1LFDB 2ZRAA 1D6JA 3A1SA 4URWR 3KQKA 2G9NA 1WCV1 2CBZA 2HF8A 3ZS8A 5LD2B 2ONKA 3CZPA 3M1IA 1UKEA 2ZRIA 3NDPA 2FFHA 2YHSA 4B74A 4HDCA 4LI0A 4A1FA 4WA7A 1JQLB 5G3YA 3K0FB 3W5JA 3QG1A 1XMVA 2V54A 1JJVA 1TF5A 1G9XA 4A0HA 2XX3A 4ZO4A 1KSFX 1F3OA 2ZI5A 2DFLA 2FNAA 5SZHB 4GDFA 3OZXA 2ODBA 4CEHA 3WP1B 3B8HA 4NP6A 2VEDA 1X8LA 4N0EA 1UDXA 1G17A 5IF9A 2ZIAA 2DBYA 2FA9A 5EUMA 3VR4A 2ZSAA 3VKHA 5FPHA 4CEJA 4HUQA 4RZXA 3SZRA 2FU5C 3BC1A 3UMRA 3QI2A 1NIPA 4JJZA 2JLSA 4YDHB 3VQTA 4GRAA 3V4FA 4ILEA 4NCNA 4TSFD 5JS8A 3QG5A 2OBMA 2VIIA 3U3KA 2DR3A 2HYDA 1R8SA 2FPMA 3RWOA 2WWYA 1NF3A 1S3SA 3LVQE 4LC0A 5IDVA 3T34A 4YMWA 2BBSA 1T5IA 3ASYA 4LOAA 1CBUA 4Q18A 1S3GA 521PA 2D7DA 1RYHA 1GKIA 4KO8A 5HZHA 2E1RA 5TV2A 4JSYA 4M9SA 2IYWA 4LHYA 4PO9A 2QQ0A 3QUSA 3THOA 5ELXA 2IYZA 2RHMA 4V03A 3IO5A 3SFZA 2O8BA 3WBJA 2G0NA 3ZZ0A 4OHVA 2A5DA 2NIPA 1TQ2A 1T3LA 2I1VB 3LAWA 4RD2A 1NVUQ 1G4AE 3KKOA 4HLQB 5JRZA 3W5IA 2IEYA 2O8CA 2QT1A 4NCKA 2OFOA 4TQUS 1WMSA 4II7A 1SHZA 3GLIA 1RPZA 1KI6A 3GPLA 5J5CA 2JLUA 1SXJC 4W5JA 3ADCA 2GCOB 1L8QA 2FFBA 2GAAA 3ZD7A 4EFNA 5E95A 3TUIC 1DARA 3AVWA 1YR6A 1U90A 1N5KA 4OL0A 2AXNA 4R71A 3Q72A 3P27A 4ZIRA 3K70C 3KKQA 3MJRA 1Z0IA 5LPNA 1RC8A 1KO8A 4HAYA 1MKYA 2OCAA 2PX0A 4KV9A 4OI2A 1XNJA 3IBYA 2H18A 4DXAA 4DCVA 3H86A 4PAQA 1IXSB 2D62A 4JT4A 4KVGA 3CR8A 1C9KA 2OCBA 4IFEA 3RYTC 1NRJB 1OXSC 3K0SA 3PITA 1NSFA 1Z0DA 2WKPA 1W7AA 1CR2A 4Z51A 1UPTA 4MA4A 1D2MA 2CHQA 4Q9IA 3TAUA 4ESHA 2C78A 3K0AA 1D9ZA 4B35A 3SQXA 4AC9A 2AWOA 4DC9A 1OH7A 4EFLA 4IVRA 2QMOA 2BHRA 3N2IA 3WRXC 1L2TA 3QVVA 4ITRC 1OJLA 5FPKA 3U5ZB 1E2GA 1T8UA 4JBXA 4A2PA 5M04A 3IQWA 1RRFA 2GK6A 2F1JA 1BKDR 3N70A 4C0QC 3AVTA 2CK3A 4KLNA 2CVHA 3OEEA 2HJVA 4Z1MA 5P21A 4TZ0A 2ZUBA 2BCJQ 1G3RA 1T5LA 1P75A 3DPUA 4MUAA 4M1WA 3HU3A 3EARA 1H8HD 1OYWA 4KI0A 1XJQA 4AD8A 4QHYA 2W2XA 2IYTA 2A3RA 2W6JD 1R8QA 5DIFA 5L3QB 3RSLA 1ZIOA 3KL4A 5JWOA 2HXYA 3WBKA 4IW3B 2QENA 1H8HA 4Q4AA 1SKYB 1MABB 5DH9A 2G3YA 4A4DA 4R2HA 2ZREA 2VTKA 1Q21A 2GKSA 1SULA 4MRRA 4DLYA 2EFHB 1E1RD 2ZJOA 3EAQA 2ORVA 1W49A 1LNZA 3K09A 3BRWD 2GJ8A 1T8TA 5IT5A 2V1UA 3CNLA 1GVNB 4P31A 4US2R 1E1RA 1II9A 2O0HA 1Z0JA 1LS6A 2J7KA 1T6NA 4A2QA 1W36B 4L16A 4FMDB 4NYIQ 1MV5A 4JJKA 1DTSA 2WWHA 2P67A 5CDFE 4E5UA 4GNKA 4M21A 4OHWA 4MRPA 2OE2A 2QAGA 2AR7A 3N5CA 1NL3A 3CWQA 4B76A 5BYKA 4KXFB 2PCJA 2ZVQX 3C41J 5JZVA 5AJWA 4CEHB 3C14C 2IA5A 2GRJA 3UK6A 2VLIA 1H65A 2ZYTX 4TL8A 1QZXA 1VCNA 3NC0C 4M22A 1R7RA 4DEYA 2V9PA 3CZQA 1W4CA 3Q7QA 1BO6A 4GSYA 4E03A 1E3MA 3DHWC 5DE3A 1N0WA 5JECA 3B9PA 1E9SA 4LBWA 4LHXA 2ORWA 1DAHA 1PV4A 2H5EA 2AKAB 5KO2A 4DBLC 3C15C 2JJ2A 4MH0R 1I2DA 3NC1C 3BD9A 3PIRA 3SR0A 2G83A 2GJSA 4M9QA 1I4TD 4Q19A 4A0GA 3CX6A 5IHPA 1TPZA 2XNDD 5EXPA 1W4RA 4RKEA 5EP3A 4LRWA 1VHTA 2XNDA 1Q0UA 4LJ9A 5FUVA 4LGMA 5HR5A 2GNOA 1VPLA 3O8DA 4GBMA 1Z63A 2CLDX 4QBHA 4HZIA 5FL3A 1GKUB 4QNMA 2QGZA 3KJEA 4US0R 3GLIB 4BFXA 1RJ9B 4DLUA 3O8BA 2CEAA 4ZI2A 2DHRA 1HQYE 1UM8A 5FBRB 5B64A 4C2TA 3FB4A 1XCGB 4B3GA 1X86B 4B3XA 2QPTA 5EJEA 5BXQC 3NBZC 1S9HA 5LB2A 4ZIRB 2FSIA 1D9XA 1U98A 1W5SA 4TYNA 1WB9A 5FI0B 4G5SA 2H57A 4C0LA 2VHUA 2J7PD 4EQ6A 2JIZD 1FTSA 3PEUA 5CK4A 4EFMA 2V1XA 3C8UA 2D3WA 2UKDA 4PQRA 2VO1A 4JSTA 1E2EA 1YR8A 2AFIE 2J7PA 2OEPA 4CIDA 5FR1A 2VHCA 4TMVA 4NTZA 1GL7A 3ZYCA 5C2JB 3DO6A 4LV8B 1UBEA 3QKSA 4WXRA 1G7CA 4D0GA 4GMDA 4OQMA 3PUWA 1OXTA 3OAAD 1KKLA 2RH5A 4LJ8A 4RD4A 2BVNA 3K0AB 1IY2A 2GEVA 4PHTA 3PUVA 2GA8A 1F5NA 4YMUA 1GKYA 3ECCA 2FZ4A 2ZRHA 4JLKA 1NG1A 2NZ8A 5TARA 3GMTA 3I32A 1IM2A 4CZ2A 2ZROA 1FMLA 2J45A 3RRNA 3B78A 2HXSA 2ZS7A 3CKLA 4PAMA 5CDFA 3A6PC 1NIJA 4JMPA 5AJXA 3LNCA 3AVVA 4AYTA 3A1VA 3EC1A 3IPYA 3U6BA 3BE4A 5KU1A 2IT1A 3K09C 4GZLA 1SVOA 5F9HA 5DYGA 3V4RA 3A1TA 3AVOA 5A5GA 1NLFA 3E2IA 1ZRHA 2PEZA 3LQRA 4XIGS 2QA5A 4Q03A 3SJCA 3KQHA 2I3BA 4B71A 1E9AA 1QHNA 3TUZC 3W6NA 1N6IA 1TF2A 3PEYA 1E2JA 4A8JB 3KFVA 3CRW1 4JVSB 4GP7A 1YRAA 2HT6A 2QAGC 1U81A 1SVMA 4DDUA 4OKSA 3ZQJA 2GXQA 3KDSE 2Q6TA 4RJLA 4F7WA 6Q21A 1FNMA 1OV4A 1Y63A 2QTVB 2F43B 1ZNYA 2PJZA 1GL6A 4BPBA 3D31A 1Q1ZA 2R44A 2ZJBA 3I3SR 1TUEA 2ODEA 4KBGA 1AS0A 1Q57A 2QMEA 1DADA 2ATXA 2WPDD 2HUPA 1KY3A 5KNDA 2BM0A 2EU8A 1RFLA 3EG5A 2B6HA 2DCUA 3IHLA 4KYUA 4WOPA 4BZXA 2C98A 1HUQA 4AKGA 1Y3AA 2XZLA 2WBLC 2GK7A 1YZGA 1KMHB 2ZITA 1YJ5A 4GOKA 4C7OA 1VCOA 4L5BA 3X1XA 1XPRA 3W8NA 4OQNA 3CW2A 3NTUA 3RRZA 3P4XA 1HT2E 3PG5A 4HLCA 1II8A 1K6MA 1OH6A 2W0MA 2HYIC 2NO7A 4UKDA 1OFIA 1CP2A 3MWYW 1EGAA 4DCNA 3BXZA 3KJIA 2FGKA 3RWMB 3U7FB 2ZRPA 1QHSA 2QROA 2JGNA 3BAFA 3B9QA 4N3NA 2ZSEA 5KHOC 3BBPA 5EXSA 1EXMA 2WMOB 3VR1A 4FIDA 3TVDA 1Q1EA 3F0TA 3IIJA 4RZUA 4ON9A 5FOSA 1P60A 2GTPA 1GOTA 2VHQA 4C2UA 1WRBA 1XP8A 1YZUA 2GCPA 4GOXA 2FEMA 1P9WA 4TYPA 4A15A 4JLVA 1A2KC 1WP9A 1NI3A 4XD7A 1XCPA 1XZQA 4Q48A 2VF8A 4GFDA 4DDTA 2QRZA 3IGFA 1D8TA 3QE0A 4OQXA 2P5SA 1G1MA 1Z5ZA 1D2EA 3EX7C 2C2HA 1KYIA 5KSZA 1U8YA 1E32A 5EP1A 3MGCA 2BEJA 3RC3A 2DB3A 2FSGA 4M9XA 2F9MA 1D2NA 3T06B 1P61B 1MO5A 2HLDA 4TYQA 1XTKA 2QY9A 3Q3JB 4P0TA 1CJUC 4PC1A 3LLMA 4FINA 1AZSC 1FUUA 3U4QA 4U00A 1G5RA 2GXSA 3ZH9B 3GEHA 2WWIA 4BLOA 4B73A 4MGZR 3LFUA 1G3MA 1XJCA 2V3CC 4CGZA 1WQ1R 3QKSB 5JEEA 2JLXA 2RGBA 5EUQB 4JVMA 4LY6A 2IUUA 4RCYA 3MWLA 4C0SA 5B58C 4C0KA 1FX0A 1G6HA 3DMDA 4BZPA 1Z0KA 2IS4A 4JYCA 5DHFA 4OHZA 2GHIA 3TR5A 3DDCA 1LF5A 1ANKA 2QMUA 3B85A 2CJWA 2R6CA 3QQ5A 3N2EA 4IJMA 4PQYA 4V0LA 4DT1A 4DZZA 1WF3A 4A9AA 2CCJA 3V9PA 3BOSA 2VSXA 221PA 2V7QA 3GFOA 2JCSA 1G7RA 2ZSBA 3LO5A 2ZE6A 3HYTA 2A9KA 3ZVNA 2VQSA 5DN6A 5J4LA 3J81k 1Q3TA 4DCTA 2EYUA 5KNCA 2C9OA 4B2IA 2W58A 4H9GA 3K0FA 2HEIA 4NCJA 1FL9A 2OZEA 4B34A 3WHKA 4ERNA 3OEHA 1G7TA 3FMPB 3WXMA 1VKJA 1J7KA 2OFXA 3I4LA 1ZM3A 3BB4A 5SZJA 1E2FA 2N1BA 4A6PA 1RIFA 4O25A 4NPHA 1IAQA 1E98A 4RD6A 1SGWA 4B75A 5EE9A 1JAIA 2RGCA 5J40A 2ZYVX 2RHDA 4ASUD 3OE7D 2NGRA 4IOJA 1U9IA 4DUGD 2QORA 1E6CA 1Z0AA 3LXRA 3HU1A 1G18A 2NO6A 3WY9A 1SKYE 1T0JB 4RY2A 1DBSA 4DVGA 4M1KA 4B2LA 4C0HA 4DUGA 3K0CA 2X1VA 3Q85A 4E22A 1U0HC 2DFKB 4LWZA 2DWPA 2G77B 2JLZA 5L3SB 2B92A 2PZGA 3UKDA 621PA 4LYHA 4MUBA 1XTQA 2QPOA 4BLSA 1VECA 1SVKA 1ZINA 4WVFA 4TLCA 4CEIA 4RFSB 2W2VA 4PAOA 4QFMA 1Q3HA 4KSCA 2WVJA 1DAEA 3NG1A 4BFTA 1G291 3D6TB 3GJ0A 1TQ4A 2L0XA 1PLJA 1AM4D 4P4TA 2AKYA 2BWJA 2ZRNA 1S9DA 1W4AA 2ZR0A 2BBOA 1KSHA 2Z43A 5H68A 3RS0A 1GNRA 2ZUCA 2KSQA 2ZE8A 1IN8A 3T1TA 2XAUA 4LV6A 4F92B 4POAA 4TMTA 4DSTA 3O8RA 3TIFA 3GJ5A 1DE0A 1KI9A 1DELA 4I1OA 1YZTA 3HWSA 1GG2A 4M9ZA 2FSFA 3SDZA 2J46A 2D7CA 3B13B 1MO4A 2GCOA 1XFAA 5BYJA 2CXXA 4IXMA 4V0NA 5FPTA 2IYLD 1MO6A 2QT0A 3CF6R 5KSYA 3HU2A 4A82A 3LV8A 5DI3B 4UXHA 3EWAA 1SVSA 2P3SA 4BEJA 2ANCA 1TAGA 2IW3A 2PMKA 4XWOA 3UANA 1VMAA 2CHGA 2E9SA 3B82A 3I92A 4LBYA 1CS4C 3I5YA 2WJHA 1W0JA 1I4LD 2ZEJA 1W5TA 2IK8A 2O0KA 3KFXA 1KO5A 2CLCX 1G5TA 2PT5A 3A4MA 3CR7A 2W2TA 3AF3A 3RABA 3DM9B 1CU1A 2J41A 2RGXA 4HDOB 5FTJA 5AJVB 4MYCA 1U8ZA 5CLLA 2AD1A 2R6FA 3THXA 3GLIE 2G1KA 4D4KA 1J2JA 4U02A 5TY0A 3THWB 4MQBA 4URZR 3NVAA 2BM1A 4DCUA 5DNYB 5CYPA 2IXEA 2OILA 3L0OA 1M1YE 4M1MA 1TU4A 2RMKA 2XTMA 4P33A 4LSGA 2YWHA 3NH6A 2Z0MA 2KE5A 4PO1A 3ZVLA 1A4RA 3W3AA 1OF1A 1UEJA 1VIYA 2GZDA 3DKPA 1VHLA 1N0VC 2QP9X 1KI4A 1NN0A 5A0FA 1CEEA 5LD2C 1NMZA 3AP1A 4MRSA 5KDDA 3RS4A 1ZD9A 3AP3A 3AP2A 2CJWB 4K46A 4AKHA 4QRHA 2UVQA 3CNOA 2GF0A 1RRGA 2DYKA 1I4DD 4HAZA 1Q1QA 1MABA 3JZAA 4LHWA 2FWRA 1VG1A 2FEOA 4DCSA 3I1FA 1UKVY 2G1JA 1II0A 1E0SA 2XZOA 2WM9B 1KDTA 2VL7A 3MWJA 4RVCA 2AL7A 3IEUA 3IO3A 4AIIA 1W36D 3Q5DA 4WZAE 1ZUIA 3I8XA 5EXTA 1EESA 1AZTA 1J99A 1FTNA 3ZVRA 1YE8A 3AB3A 1B0UA 1NN5A 1U9IC 2HCBA 4L15A 2WOOA 4D6PA 1KNXA 3K9GA 1T4GA 4EPRA 1N0UA 1S1MA 4RZ3A 2I4IA 4NYJQ 3K0CC 1E0AA 2ZM5A 1ZM9A 5J4HA 2RGDA 3TK1A 1S96A 2VP5A 3GFTA 3IDQA 3QXCA 4DLRA 4P4SB 4D4MA 1E4VA 3U3OA 4IVPA 3ZJYA 3AF4A 3I62A 3LH5A 4MKHA 4D2IA 3OFND 3QEJA 4MDEA 1LF0A 3GEEA 3TQFA 2EFEB 2YV5A 1NMXA 1ZJ6A 3H0KA 4FMBB 2WWGA 5K8TA 3B1YA 3OFNA 5FTMA 3GJ7A 1UAAA 1Z22A 2VH5R 4Q4HB 5JCZA 5FOVA 4NZYA 3X1ZA 3B2EA 4TTPA 3RHFA 1AS3A 4HLUA 3ZLJA 4Q7LA 1R0WA 3Q9LA 4C0AC 1JR3A 3EASA 4YQFA 4CEIB 4F91B 2G0TA 2FPLA 1EX7A 1B23P 4TLDA 1S0UA 3MUFA 4G5QA 1WDTA 4AKEA 721PA 1UFQA 4OJKA 1M2OB 4Q1FA 1O3YA 3MG9A 2Z83A 1IN5A 1XEXB 2J87A 2Z4SA 4LJ7A 4Q7KA 4X8LA 2YOHA 4ZDJA 2LKCA 4I99A 2W83A 3W6OA 5JLJA 1Z29A 3QIAA 5AUOB 3VHXA 2JLVA 4PC2A 1CJTC 5H8WA 2OUKA 1E79A 4PPGA 4C3ZA 4ZV4A 4C9BA 2CL6X 1RJ9A 3KTAB 4O3MA 1TQ6A 1NP6A 2FH5B 4CW7A 3KUDA 2QE7A 3WYAA 1E94E 2ECKA 2LWIA 1SVIA 2MSEB 3NHAA 3LW8A 2OV2A 4LBZA 1G3IA 1Q20A 4V0KA 2FJUA 2XITA 1PZNA 1TQDA 2WHXA 2ZJZA 2HT1A 4URXR 1X3SA 2J0QA 4JBWA 1PUIA 3L0PA 5FR2A 3PEVA 3NBFA 1FP7A 3X1WA 2V4ZA 4RD0A 1GZSA 5KDOA 2F1IA 1TTTA 5F3WB 2AN9A 1YKSA 1UBCA 3AF2A 3MLEA 1A5TA 4M4SA 4BUJA 4Q4JB 4ARZA 3THXB 3H84A 3HP1A 4Q01A 1E2KA 2DWQA 2GBLA 1EG7A 3CRMA 1OKKD 1M34E 1F6BA 4X8OA 2C03A 2A2ZA 3LLUA 4B3DA 3PUYA 2CK3D 4JS0A 4E07A 4QHSA 3OEED 4Z1MD 1BIFA 1OKKA 1KI7A 4TMKA 3A36A 2OAP1 2C8VA 3FMOB 3O47A 4QKQA 1E2IA 1S8FA 2VSFA 3CLVA 2JDIA 3W90A 3R7WA 4LJ4A 2KBFA 3TE6A 3R8CA 1CRPA 2F6RA 3EZ9A 3WRYC 4Z54A 4DLSA 1LW7A 3GLFB 2P65A 1S4QA 3AKCA 1UADA 1SHKA 5ANRB 4PPNA 4LK2A 4PHHA 3W9YA 2P5TB 2IYYA 4B2PA 1U8AA 3U6KA 4NCHA 2QBYB 1N6KA 3VHLB 3Q5EA 5KDLA 1L4UA 1KJWA 2X8AA 2XNSA 1W36C 1Z07A 4TT3D 4LJAA 1FFHA 4A8JA 3AKDA 2WAXA 4OK6A 1TX4B 2OHFA 3SFVA 3ZQ6A 4PSAA 1P5ZB 4TT3A 1F2UB 4LC1A 1T91A 2Q0HA 3JVUA 1N6OA 4B44A 1GFIA 1Z47A 2VPPA 1ETUA 3TNFA 3ADKA 2F43A 3ZD6A 1VDZA 4RSGA 2OLKA 2D2FA 2ATVA 2AWNA 2RGNA 1W0KD 3KXLA 3LXXA 1R5OA 1U0LA 1VCMA 3X2SA 4TYWA 4GOJA 5CB6A 3UPUA 2IS2A 4WXPA 3KB1A 2A7QA 4XH9B 1QHHB 1W0KA 1SQ5A 4HLUC 1KMQA 3CPEA 4KAXA 4HZUA 1DO0A 1KSJA 4OI0A 3QPUA 1KMHA 4LBVA 2JJ2D 4M1TA 1AIPA 4KFUA 1JR6A 1DPFA 2RKOA 2VP2A 3KKPA 3EC2A 2W6IA 1KZGB 3NH9A 1GM5A 2ZRBA 2YWFA 1EFTA 1LS1A 1GNPA 1AGPA 5B30A 4M1OA 4DRZA 2CL0X 1WBDA 4XWAA 3AUXA 2F1HA 1JXMA 4A0FA 1FPMA 1U0JA 2GXUA 1I2MA 1M8PA 3OIVA 5EE1A 4D80A 4DKXA 2F55A 2YVUA 3FFBA 2QP3A 1QDEA 4G01B 1E2HA 4BE7B 1ZCBA 4OYHA 3PXGA 3IIKA 4YC7A 1F60A 2AD5A 1GITA 1LVGA 4C4PA 2PT7A 3ICEA 3KZ1E 1E2PA 5FOUA 3AVUA 1QHGA 1JALA 2N42A 4OQFA 1Z6XA 3OHMA 2J5XA 3HPQA 5H1YA 3TJZA 4Q7MB 1ZW6A 4B32A 4B3FX 4JLDA 2PJRA 3BH7A 4A36A 1ELOA 2QP4A 3O8CA 1YHNA 2ASEA 5CITA 1K5GA 1C1YA 1NKTA 1MO3A 2FOLA 3K9NA 2Q9CA 4XTRA 5FBQB 5JJKA 4W5HA 3L0IB 1HA3A 4QBIA 2OSBA 4KFRA 4B3CA 5BN4A 4MRNA 5G53C 5HTKA 1J8MF 1SVLA 3TKLA 1BYUA 1EFUA 1OIWA 1P4SA 1P3JA 2GCNA 4Q00A 4F4CA 2OBLA 2ZJ2A 4CT4B 2ZPTX 1OT3A 3ZZTA 5CYOA 3TW4A 4F4IA 1W47A 2YC2C 1KK2A 4LCBA 2XB2A 1N6NA 2ERXA 1Q1BA 1W44A 1N6HA 1NNEA 4G5GA 2KI5A 3BK7A 4ARZB 3K0EA 2YWEA 3T1OA 4XWKA 2X19A 3BWDD 1Z6GA 3RSOA 1A82A 5C4GB 4UNPA 2GAOA 1G8YA 2H8KA 3D8BA 4D4JA 2Q3MA 4UNSA 4HATA 2VYFA 2WZQA 3ZVMA 4UNRA 4KU4A 4LYJA 4BFZA 2IX3A 3NIBA 4P3YA 3P20A 3QXXA 3FTQA 3FOZA 4Q9JA 3VR3A 1NJGA 1P9NA 3W8RA 2A5JA 3VNUA 3R7WB 2C95A 1W46A 2NOAA 4DJTA 5CB8A 3K9HA 3KQNA 4NHOA 4DHEA 1EFRA 1XD9A 4A8JC 5L3RA 1WE2A 2REOA 3QBTA 4M0LA 4QHTA 3EZFA 1DS6A 1P9RA 1PLKA 3NDBB 3B60A 4DSOA 1N5LA 1CR4A 1Q12A 4BFUA 1LTQA 4TLBA 1KI2A 3W3ZB 4NE2A 4YMTA 4HEJA 2KB0A 3ETLA 2BMEA 2IF0A 4YMVA 2ZRDA 3AVXA 3GJXC 3QPWA 4QNRA 3PV0A 1TUIA 3QEOA 4RKFA 2AHOA 2R6AA 4IRUB 5SZIA 3F5FA 4XTCS 5UKDA 4OHYA 5K8UA 4M8NE 3I8SA 1AK2A 1XCMA 3ICQB 2ANBA 4L9WA 1IJEA 2ZI7A 2FFAA 4TL6A 1JJ7A 3MMPA 1OB5A 4HAXA 3DVLA 4QC2A 2ZU6A 3A4LA 1T3HA 2GVDC 3VR6A 1JECA 3SEAA 5L3SA 1FW6A 1KSGA 4BWYA 2J9RA 1W2GA 4ZCMA 3EIQA 3KXKA 1OFUX 4HZUB 3L43A 4QL3A 4RFSA 3SI7A 2OO7A 3L82B 4DEXA 4EPXA 3C5CA 2AX4A 4HLDA 1KZ7B 3QKRA 3UG7A 2IEZA 4BLRA 2CE2X 3GJ3A 4A6XA 2GJKA 5JWHA 2XZPA 2A78A 3S1AB 1ZAKA 3NEYA 4JLOA 3TUJC 5B57C 1BH2A 5J4KA 3PJRA 3B5JA 2PH1A 3RVBA 2CCKA 2ZVPX 4X8HA 2OM2A 1Z3IX 2OAQ1 4EIWA 4ESVA 2O8FA 3EIEA 1G21E 3WMEA 3TQCA 2YZ2A 3FHOA 3H1TA 1MR3F 3AVPA 3BORA 1FQJA 3AKEA 3P1JA 5BW8A 5HPYB 2QRNA 2Q9AA 3EPJA 4XD7D 3H4MA 2J3EA 4G3XA 3QJYA 4KITB 2IXFA 2DWOA 3F3YA 4JLNA 1Z08A 3EPLA 4ZDWA 1QVAA 5C18A 5DI3A 2A5GA 3B1VA 4JKYA 3IIMA 4M1YA 2YKGA 1E4YA 3I72A 1XRJA 3K1JA 2C77A 1KI8A 1NVWQ 2WIAA 2ZXUA 2W0SA 1E2QA 2B21A 2ZAMA 1RRCA 2ZYWX 1NN3A 4L8GA 3X1DA 2BBWA 4JZKA 2HLDD 4ACBA 2QTFA 2PX3A 2OG2A 3PFIA 1JI0A 1YZKA 4QM6A 1OYYA 2GZAA 3GLGA 3U7EB 4F38A 4AY2A 3GLHB 3UIEA 3MAAC 3EA0A 4LJ6A 1M7HA 3G5UA 2FDCA 4I1SA 3NXSA 3U44B 4JLJA 1R0ZA 3IKJA 3RANA 3THWA 1LV7A 1P2TA 3U7HB 3WP0A 1EX6A 5HKKA 4KYIB 4B33A 1NMYA 2WSMA 1ZNWA 3EZ6A 1OLOA 1YZNA 2PL3A 3C4JA 2WIBA 3LBHA 4I1VA 5D3QA 2G6BA 4RFVA 4URYR 2FZLA 3B1XA 3MJHA 3SBDA 2LCFA 1SZPA 4Q1BA 1G19A 1W48A 4KHZA 4PXAA 1YU9A 2VP4A 2V7QD 2IWRA 1G8FA 3FHCB 3VMFA 1NY6A 1P73A 5J47A 3C16C 2GWHA 2IHBA 1ZUNB 2BMFA 3L2OB 5KPDA 5AUQA 2P6NA 4NYMR 2D4HA 1KO7A 1Z6AA 4LV5B 5DN6D 2PBRA 1GSIA 2ZJ5A 3P26A 2ZRMA 4FMCB 3Q8XB 1KNQA 1P7CA 3FMFA 3HR7A 3LX5A 1E9FA 5CK5A 1FMJA 1HEIA 1YZLA 2F3RA 3OEHD 4O2RA 3MCAA 2ZE5A 1HYQA 2ZU0C 2NO1A 4B6EA 2EW1A 3M4YA 4P32A 5FUXA 1XX6A 2O8EB 2ODWA 1W1WA 3GJ4A 4EJSB 4JL5A 1PJRA 1L4YA 1OSNA 4D25A 3CF0A 3P4YA 3LD9A 3GLFE 5F9FA 4NMMA 2O0JA 4P4SA 2ZAOA 4NL4H 4Q21A 4X8MA 2XSZD 4PSVA 4OJQA 4BLPA 2PCLA 1M74A 1R6BX 5IK2A 5KYKA 4DB2A 3E1SA 3TLXA 4EPWA 4TYYA 4D26A 2JASA 4CEJB 4BFVA 4TLAA 2R62A 2ODNA 2XSZA 4QOSA 1JEEA 5FUYA 3UG6A 5L8VA 3CPJB 4AG6A 3QXSA 2IYVA 2KBEA 3C5HA 1QVRA 4U7DA 4Q4HA 1P2UA 2OT3B 2ZRLA 4YXWD 1P72A 1EFHA 1GP2A 4JKIA 4NDZA 4TWZA 3I5XA 1K5DA 2QL6A 4YXWA 5KNBA 2WICA 5LDDC 4WZBE 1G4UR 1KJZA 1YRBA 3H2YA 3QKRB 1JAHA 1ZC4A 3CX8A 2E87A 2OLJA 2ZRKA 4JL6A 3QBVA 2QG6A 5JFGA 1XEXA 3KX2A 1FQKA 2WJYA 1DAGA 3BH6A 1VYVA 1QG4A 5JCPA 3SYNA 4XVQA 1KDPA 4V0OA 2IHYA 2O8FB 2H16A 3BB3A 1KY2A 2Q3HA 3LA6A 2Q9BA 4Q9HA 3FKQA 2QI9C 4DLVA 4FXPA 4Q1DA 3T15A 2JA1A 2ZRGA 2J1LA 3KTAA 5FL7A 1H8EA 3MSXA 3TVTA 3JZMA 2VSOA 1ZM4A 4IDPA 1QBKC 1ZM2A 4OI1A 1FZQA 2R6GA 1G41A 1JR3E 1QHYA 1UF9A 2FX3A 3AEZA 4W5WA 1FOEB 1W0JD 4WZ6A 3LW7A 1G5PA 3NBXX 5TVKA 4DDVA 1ZC3A 4Q1AA 2FMXA 4BFWA 4RZ2A 3TBKA 4EAQA 5KTYA 4TN1A 3IQXA 4O2LA 2WAYA 3K53A 1IY0A 4CDGA 1ZBDA 1UEIA 4QGAA 3V00A 3GLGB 2BJWA 1HTWA 2G88A 2AK3A 4E09A 1KK0A 1E9DA 4Q4JA 1BMFA 5FTNA 1JB1A 2OBNA 3RS7A 4B43A 1LY1A 3A8TA 5FH9A 2H1LA 1ZU5A 2TMKA 1XXHA 4LZZA 3D7MA 3DKVA 1G8PA 3DOFA 4AK9A 4XVUA 2XGJA 2MSCB 2VBCA 2GJAA 3QPVA 5HE8A 4FMCF 3RAPR 3ZS9A 5HZKA 4EPYA 4RCZA 3CX7A 3FFAA 4BQSA 2R8RA 2F7SA 1U99A 2YOGA 1CR0A 2ZI3A 3BB1A 3A58B 1HH4A 2N46A 2JJ8A 4MYUA 1R0XA 2RB4A 2CNWA 1TNDA 2HJGA 1X1SA 4EDHA 3GD7A 3T61A 5JBQA 3MD0A 5G3ZA 1F2TB 3U60B 1Z83A 2FFQA 2UZ3A 3SYLA 3GLFA 2BC9A 1ZNXA 1PVOA 4PZZA 1XJ0A 4TZ6A 2BBTA 2UZIR 4FWIB 3SN6A 4PC3A 2WWFA 2B8TA 3SBEA 2GF9A 1NVVR 3FDIA 4R98A 2IC5A 2QBYA 5GADl 3VTKA 3VR5A 4HYYA 4AURA 2RGGA 3KXIA 4UNNA 1SVWA 1KTVA 1ZP6A 3VAAA 4PTLA 3E70C 4Q1CA 2OXCA 4IDOA 2VHTA 1QHIA 1TL7C 2ZR7A 2YJTD 3UMFA 1F2UA 2ZYUX 4PR0A 3EW9A 1IHUA 1AKEA 3OIYA 2C04A 2QN6A 3T1QA 1K8RA 1IY1A 3REFA 3IILA 5C46F 1Q44A 5D3MA 2QGNA 3SU8A 3TR0A 3BGWA 4XSHA 4V0ME 3TW8B 1FUKA 3SE0A 3BS4A 1OW3B 3TGPA 2X2FA 3SYKA 4I1UA 2R2AA 4CVNA 2A5FA 5FI1B 1QHHA 3AF1A 2RCNA 3GP8A 4N1AA 4GI7A 3JVVA 2BV3A 3EXAA 2IBMA 4GZMA 4NH0A 3UWKA 2D06A 4IEEA 1N6PA 1JR3D 4UJ5A 1KK1A 1YR9A 4TQAA 3AM1A 1S2MA 1G20E 1MOZA 4IEIA 5KSPA 4HSEA 4OHXA 4Z8XA 2GILA 1T0HB 2ZETA 3KQLA 2R6DA 3AGQA 1D5CA 2AXPA 3AKYA 1OXUA 1ODFA 3R9WA 1CRQA 2RGEA 1GRRA 4DLTA 1YR7A 2XEXA 4V02A 5GJWC 5EZ6B 1CR1A 2OFWA 4KVAA 4BRWA 4M53A 3B6EA 2MMGA 2WKQA 1E79D 4BGDA 4Y0VA 3LDAA 2FE4A 4QBGB 3U3JA 1XTIA 4FD2A 3AF0A 3FE2A 2QE7D 3X1YA 4TSFA 1ZMXA 1CJMA 2K5UA 1VG0B 3BIFA 3VU9B 1KKMA 3WYGA 1NSTA 3ADBA 1NG9A 3UWOA 3RC8A 4Q5IA 4IFBA 1G8HA 3T1VA 3FHTA 4TL7A 5DSZA 4JIMA 1DAIA 1R2QA 2YC4C 4MRVA 3EIHA 1F48A 1M6NA 3QVUA 1DAMA 4MDFA 4GP6A 1Z0FA 4KSBA 1DG3A 5JI3E 2NO9A 4MKIA 3U61B 3THYA 4Q9LA 2H92A 4NYMQ 1S1CA 1JPJA 3CH5A 2AK2A 4KLZA 4LHZA 4JLPA 1OIVA 1ZVQA 4TL9A 4YMSA 5A4JA 1MRNA 2EWVA 4LYAA 4MYTA 5F2EA 2IS6A 4DDWA 4DIDA 1XXHB 4IVQA 2EFDB 1OXXK 1KHTA 3CB4A 4UXIA 1SXJB 1CJVC 1NLZA 1HT1E 4UNQA 3L8YA 2ZSFA 4KCGA 2NMVA 4F4JA 2JDID 3HR8A 4JLBA 4OQLA 1G16A 2C5LA 3KQUA 4WAUA 4YLGA 2B8WA 3K70B 3GLHE 1XTJA 1GIAA 3CM0A 1Z2CA 1G7SA 2PEYA 5FBWB 5EP4A 3KKNA 5KUTA 3EPHA 2JEOA 3LY5A 2CCGA 3QF7A 4C30A 4JT2A 4V0MA 2QAJA 1CIPA 2FPKA 2ZJ8A 3QOFA 3SHFA 4OBEA 1N3BA 2OXRA 2PZFA 1RKBA 3R9IA 5LB4A 3B1WA 2IYXA 3EWSA 5DGXA 2FSHA 4LDJA 3UATA 4BFSA 5JSZB 1E0KA 4G5RA 1HV8A 4RD3A 4JVNA 1TADA 1M7BA 2NQ2C 4B3BA 1AKYA 3HPRA 5JHHB 4CYMA 1YVDA 2FN4A 1XEWX 3QKTA 3PUXA 1US8A 4TLEA 3QSYA 3G0HA 4LJ5A 1DEKA 3VX3A 2F1RA 2WWWA 1R4AA 5D3MB 2CDNA 2J0UB 4IDHA 2JLYA 4M2LA 1AA9A 2W6JA 3GQBA 3NHBA 4G1UC 4URUR 1ZM7A 4MGYR 4PPQA 5TXGA 2D2EA 1G3UA 2CLSA 2V6JA 1Z06A 1IOZA 2PMDA 3IUYA 4FCTA 4S35A 4ZDKA 4IOMA 1XMJA 3TSWA 3ASZA 2P0EA 3ZGXA 4BECA 3W6PA 4URVR 2WJJA 3TAHA 2EFGA 2W6ID 2BKUA 2REBA 3M6AA 3EZ7A 4Q4LA 1KAOA 3TMKA 1UBGA 3P32A 1OHHD 1GWNA 1OFHA 4WIAA 2WTUA 2QU8A 1E96A 3KJGA 4PFSA 4A0RA 1R0YA 4BRUA 2ZJAA 1N5IA 2O52A 4AI6A 2W00A 1MRSA 2GJ9A 3LWNA 1OHHA 2A5YB 3LVRE 3RS3A 3S1AA 4UJ3A 3UXMA 4HAUA 1TEXA 2QTHA 2ZS8A 1BYIA 4ZKEA 3QKUA 1OH5A 1FNNA 2SHKA 4ZKDA 4H1UA 1KI1A 4L4UA 3E5HA 5FFMA 1JBKA 1ZD1A 1A2BA 2VP6A 4HUQB 4LUCA 4OI4A 4P4UA 4U5XA 1VTKA 2ZI9A 3PR1A 5GJVC 3TSOA 2IXGA 1AN0A 3D3QA 1OFTA 5BN5A 3VNVA 1N6RA 3U3MA 4MGKR 2EQBA 1NN1A 3DOEA 4UXJA 5FPYA 3U3RA 1UBFA 2YOFA 1BOFA 2QSYA 1UJ2A 1HQCA 5LBIA 1XBTA 3PENA 4MITA 4FWTA 1O87A 1Z6YA 2QQEA 3BERA 5JMTA 1QHXA 5FTKA 2GDJA 4HDQB 5GJCA 1Z2AA 1E99A 4LHVA 4B48A 4O0MA 4MYHA 1EWRA 2Y8EA 3PCRB 2FF7A 821PA 5DISB 3IPXA 1XF9A 2YWGA 1CLUA 1E69A 1T3SA 1BS1A 2GZHA 3FGNA 4NBSA 4Q47A 4QGFA 4XJXA 4LPKA 4H1VA 5JHGB 4I81A 4Q1EA 3WMFA 2IS1A 1KIMA 2I1QA 1ESMA 3SOPA 2B7BA 2O8BB 2ZI4A 2DPXA 2CL7X 4ZCLA 1XEFA 4A2WA 3GLHA 1AGRA 4PSKA 5EZ5A 2D74A 1AS2A 1ZNZA 2HCJB 2EVWX 2O8CB 5JWRA 2GBLC 4IXNA 4HUTA 3U44A 2J0SA 1NVVQ 3W34A 4AWXA 1KI6B 3THYB 1IONA 4PANA 3RRMA 2BMJA 2CVFA 5BWMA 2ONJA 3K9LA 1XMSA 5GVRA 3AGPA 3F8TA 4ACAA 1TEVA 2PLRA 5EP2A 5TDHA 4DLXA 2ORIA 1GNQA 3CPHA 1MH1A 4BLTA 3C7KA 3PQCA 2J0VA 4K8OA 3OESA 1KO4A 1EWQA 2WSSD 5DYIA 2X77A 4M1SA 5K8IA 4DIEA 4D0LB 4QXAA 3DEFA 1RYFA 1ZIPA 4XOIA 3QNUA 1E2LA 1EK0A 1PLLA 5FOWA 4BFYA 4NKRA 2JIZA 3U7GA 2WSSA 3GLGE 1EFRD 3FPAA 2WWXA 4IHQA 4MKGA 4IOKA 4QJ3A 4ZI3A 5J4VA 4JLAA 4US1R 3EA5A 4G0NA 3QXJA 3NBYC 3VX4A 2CMKA 2NO0A 1ONBA 1XZPA 3CONA 4I4LA 1N2CE 1P62B 3KUCA 1IBRA 4J0QA 2A30A 4KBFA 3CF2A 3WNCA 3QXHA 2JLRA 2X2EA 2Z4RA 3OAAA 3SJBA 3BFVA 4TQ9A 2O8DA 3LX8A 1HE1C 3CWZA 2BJVA 1P6XA 2O8EA 1E9EA 2GESA 4N0DA 2FG5A 4EJSA 4AKIA 4C0JA 5JI2E 3LRPA 1XDBA 2XJ4A 3A1UA 4Q7JB 5TB5A 1CTQA 2HV8A 4PO8A 4FMDF 4LJYA 2RGNC 3RLFA 2XOKD 3CRVA 1DO2A 1AJEA 2YINC 1DG1G 2IYQA 2ZSDA 2KWIA 4QG7A 5CIWA 3AVQA 1US8B 3BFXA 4R2IA 4BLQA 1V43A 2XOKA 3WYFA 3WHLA 3KB2A 5SZKB 1XEWY 4Q4AB 2QMHA 2VA8A 2P2LA 2GXAA 1JNYA 1E0JA 3NWJA 3GEIA 4FN5A 2YNMA 4R7ZA 5BN3A 4NONA 1NKSA 2Z6VA 3SQWA 5C4MA 3CRQA 3VR2A 1GUAA 2DFTA 1HY3A 4CT5A 5CM9C 3SJAA 3CO5A 2BKEA 3DZ8A 1IN4A 2BEKA 1V5WA 2IYUA 4KJZA 5FPSA 1GILA 1VYUA 3OIWA 2C96A 3RS5A 3KJHA 4GT1A 4IDNA 2QAGB 2FV8A 5HCIA 2RAPA 3A4NA 3EPKA 5EXXA 2PLFA 1IQPA 2XB4A 2IWHA 3SC3A 1MT0A 4BZQA 1XD2A 5E7MA 1J70A
chains in the Genus database with same CATH superfamily
1OFUA 1PK7A 5EYPB 2VZLA 3AV3A 1C81A 5EPEA 3CVXA 5JJIA 3CBQA 3RK0A 2I8CA 1GEGA 2N47A 1HNNA 1M8GA 1UQRA 4UOQA 1QYIA 3WLSA 1CKEA 5AK0A 4CIAA 4DNFA 5TS3A 1B8NA 4LF5B 1BAPA 3GGGA 3O2NA 2OBBA 4CIVA 3Q8LA 1TZMA 1UWCA 3AH8A 1NASA 1T0BA 3B1JA 4UMDA 1NYQA 4ENRA 2VTBB 2P2DA 5TGTA 3K5HA 4BBJA 4MKRA 2BF7A 3WL6A 3CLRD 3ZDQA 3R7AA 2P9HA 1U63A 3QP9A 1Q22A 2XT6A 3MUOA 4A0QA 4IRMA 1PK8A 1G3QA 1YS2X 2X22A 4L72A 1IXRC 2HLHA 4WEQA 1VIAA 4UPDA 1I3OA 1U94A 3FTPA 2ZM6B 1Z6ZA 4CMBA 4UDOA 2JRLA 4RMJA 4MI3A 2EWWA 5JRDS 2MTBA 5DASA 4CE6A 3OZVA 5EMNA 5FV7A 5G0VA 1ZYUA 2P9CA 1X6VA 5BW4A 3RK1A 4DDMA 2BCGY 3WNBA 2OR3A 5MN5A 1HURA 1DOAA 3PSHA 1C3OA 1TKCA 5AW1A 1CF4A 2PGNA 3FYUB 4HR7A 5AJUA 1V48A 3SHWA 3WKCA 1FTQA 3EEBA 5BV1A 3R5XA 2HJWA 3HM2A 4HRYA 4W9NC 5CR9A 3RFXA 2FGJA 2WKRA 3NFYA 4UHFA 3UJ7A 4WPGA 4BGEA 1DI0A 4YJ2F 2ZIVB 3A37A 5HCNA 3DFUA 5JJLA 1GAJA 4DQVA 3QX3A 3ORHA 4YRNA 1VG8A 1PTJC 2PX4A 4EO4A 4YRZA 4HGYA 1VYTA 4IDBA 2HAEA 1QF9A 7ADHA 3LPLA 1Z36A 3TH5A 1XD8A 4EQ6B 1NHWA 3IUQA 1FNDA 4N7BA 4N47A 3PEWA 1QYXA 2BIFA 2O48X 2Q4BA 2Q1UA 3BILA 2ET6A 3GFBA 4ZQEA 2EC5A 1QKKA 3GT4A 4PX2A 3GJ8A 1Z45A 2I4LA 4LS3A 2G04A 3TEMA 3WSTA 2O9JA 2XNCA 3P9KA 4KB5A 3TOXA 3GPBA 1YHZA 3OM9A 5KYWA 4J0KA 1X8JA 2DUNA 3MTAA 3REGA 2RH4A 4G0MA 3ABOB 4D8TA 3VJKA 3TDMA 1YS6A 3A4VA 1XXHE 2ZJYA 1NBME 3WXBA 3DM5A 2CE7A 3M1AA 4KC0A 1I14A 1PWZA 5KSOA 4RK5A 4RH3A 1CULC 1G64A 2E4ZA 3NT4A 4PZLA 2YYZA 2LKDA 3CUTA 3O4FA 1Z6PA 3WNDA 4B83A 3DVAA 3DLCA 1D4ZA 3TLGB 3NJ8A 5DI9A 5CG1A 3ZIAD 2GM5A 3I6MA 3N6VA 1BG6A 2AT1A 3P9XA 4XM1A 3U3ZA 3U39A 1BWPA 4N03A 4F2PA 1OIXA 2XH8A 1VJ5A 3QF4A 3A11A 2JHFA 3ZIAA 4KE7A 2PWPA 3KCQA 3TW8A 2ZI6A 3ND8A 2ZLBA 3WGLA 2QM8A 4ALKA 1O9BA 3KDAA 1E9RA 3BF8A 1OBOA 1VCIA 2YIVX 2ZTSA 4KH0A 5U4QA 1SUAA 4JL8A 4D81A 4XVRA 4PICA 4FE3A 5L40A 3FX2A 2MCFA 2R96A 3OQOA 3JYQA 4L3OA 3JVEA 1WBBA 5ITWA 5KB3A 2XMDA 5L3VA 1TM2A 2LCQA 4RF5A 3ZZUA 2HBQA 3OPYI 2EYQA 3DO8A 1WD7A 4JD5A 3H18A 4MB2A 5L7YA 1T9HA 1XWIA 4HYTA 2NTYC 1XPOA 1PNQA 1XTSA 2D8AA 3BWMA 3LBAA 5A6SA 2IJGX 1M7GA 1JWAB 1LQUA 3C1TA 4NBWA 4CKEA 2GBIA 4RACA 2OOSA 1UDWA 3GJRA 5KHOC 4I3HA 1Y5MA 4BN0A 2B5OA 2DX7A 1A7JA 2VNAA 1M2KA 3O74A 3SY8A 3HLTA 2CUTA 5E9AA 1C4OA 1TD1A 3H8JA 3L06A 5DEOA 3R7LA 3ISVA 4MQFA 2WLSA 3BCSA 4YRCA 1G6OA 2I4MA 1E1MA 3I73A 1IBKB 3GAMA 2G36A 4HB3A 1C41A 1PTKA 4BLWA 3AEQB 3B6IA 4AUMA 3CH4B 2VP9A 3ZHOA 3BK2A 5FL7D 3K32A 2TSYB 2BDTA 2CV2A 5CBPA 2PX5A 5FOTA 4BNGA 4DSNA 4DPLA 4J1SA 1B41A 2UVPA 4C7OB 2WVAA 3KZMA 1RHKA 1E2DA 1N7GA 2A4KA 3PFWO 3QYFA 4IKEA 1KK3A 2EIXA 2PZLA 4M0UA 3IRVA 4ZAWA 3RJ9A 4JLMA 1WUJS 4J2HA 4NYIR 1MHTA 3ZHBA 4EITA 3V4PB 2AN5A 5GVSA 4E5PA 4F8EA 3JSAA 1MGOA 3FDXA 4I55F 5F5NA 3RFFA 4IWXA 2V4UA 2JJ1D 1IHDA 4YWHA 5FDFA 4GLBA 4ZALA 1HZZA 3K8OE 4W5NA 3GUYA 1YZ3A 1IZ0A 1Y1KE 3IVXA 3BWBA 3P19A 2JJ1A 4P5PA 5F78A 1ORHA 1TFRA 1WXQA 2C99A 2EZUA 2JIBA 4OXNA 5M7EA 5FPQA 2VF7A 3D5TA 5AM3A 3SWWA 4MO2A 4B9EA 3VJLA 3JQAD 3OCUA 4ND7A 1WEHA 5K09A 2BMDA 5K8JB 3OT1A 4LMBA 3MUNA 1FRVA 2GZRA 4FQ8A 1ZOPA 4XYEA 4LEIA 1Y37A 2HQOA 3NOQA 3SIPA 2ZYIA 1XPUA 1QLHA 3IA7A 3KSMA 5EE5B 4GL2A 1R10A 2OC9A 3FWPA 3JQAA 1OPXA 2BFBA 1BGVA 3OVMA 1GL9B 4EL5A 2J85A 3G23A 4WGFA 5E7IA 4ZT2A 5HRAA 2BPOA 4U2KA 1G66A 4L9RA 4DBLE 2XBMA 2CNWD 5H9VA 4ZCQA 4MICA 5IUKC 2V6BA 2IPLA 3F2IA 2EKLA 1CF9A 2YS7A 3QLJA 5KOJA 1T5HX 3A1CA 2QZZA 5KYYA 5HFJA 3S3TA 4JUAA 1RJGA 5TF0A 4LHSA 2DBRA 3VZQA 2VRWA 5ENVA 3TMAA 4KGXA 1ZUHA 3FTDA 4DPKA 5CJPA 1NQ5A 2HBZA 1I6MA 4M7PA 2ZUFA 1OD6A 3M6LA 5CPFA 2BGGA 2VHEA 1M73E 1FMCA 2NYRA 2Q5QA 4BRSA 1P7VA 1ESNA 1RYZA 2ZIXA 3KIPA 4ZPXA 3VKWA 1N5JA 1ZKMA 2XTJA 3O21A 4ZCIA 5KOIA 4G5HA 4GS5A 4AKGA 1W581 3RVKA 3N8IA 3EQZA 3F6SA 1W30A 5A3RA 3CLUD 1T9AA 3C3XA 3MCUA 4RLHA 4Q6BA 3OKCA 2IP1A 4JVLA 2C5GA 3WB0A 1NUHA 3B1ZA 3ZV3A 4B6FA 4JBYA 4EHJA 5ICEA 2ECQA 3PXDA 4KODA 2FMTA 4LZAA 1L4GA 5FA5A 1IJFA 2OESA 3Q9UA 1FZTA 3RRYA 3SQLA 1JQJC 1OX4A 4TMWA 3LBIA 4OGKA 3H3FA 4PX9A 3DDSA 1GN9A 5L3QA 2X14A 1KGDA 3GO4A 4BBPA 4HN9A 1WA5A 2ADMA 2H2WA 1O0CA 3RSHA 1PSZA 5CHYA 4LOHA 4YDSA 5WRFA 2KYRA 3FJYA 2IUSA 4KDRA 3UY4A 4DV5B 3CTMA 3O8QB 2QJTA 4F6CA 2IDJA 5I3CA 1PFUA 4EW2A 1KXZA 4FDTA 2VNKA 2XKJE 3DL7A 3ZS8A 2VDKB 2C5HA 2G1PA 1XEAA 3M1IA 3CZPA 3PNVA 1UKEA 2ZRIA 3NDPA 5F5LA 3N87A 1FDUA 3TPCA 3LIIA 2Q1TA 2ARKA 4WA7A 5IWAB 4C5BA 3W5JA 3QG1A 1EWTA 3R0QA 2O2XA 3PX2A 2V54A 1K0UA 3NTOA 5IJ0B 3ND6A 4OHKA 3VO8A 1RPAA 2G25A 3ZXIA 5IANA 1NTOA 1TZCA 3BAZA 4ZO4A 2EGHA 3EN0A 4GP9A 5DNCA 2P6OA 5L4LA 2HA3A 3EDOA 1CSEE 1HYHA 1RPTA 2C2XA 1JQBA 2AHRA 2OVFA 1J9GA 1AKVA 5T41A 3TZQA 3OQ1A 1FFEA 4JI3B 3B8HA 1U5CA 3M33A 2VEDA 4N0EA 1M5RA 5IAGA 2RAVA 3U31A 2OYCA 1H3EA 2DBYA 2FA9A 4PLCA 5EUMA 1YFZA 2GH1A 2PVPA 3VR4A 5K6AA 2GCGA 5BNFA 1GYQA 4HUQA 4CEJA 4FC6A 3SZRA 3F3MA 1T35A 2DPMA 2FU5C 3JQPA 4AJ1A 3ZY4A 4REOA 3QSGA 2FLKA 3O75A 1U4NA 4YDHB 1JMKC 3BSSA 3OETA 3BHJA 3VUEA 3IXQA 2WK1A 1UBRS 5TEWA 5CLHA 1YIOA 4ILEA 2Q1XA 1KJNA 3BXGA 3U3KA 2DZDA 3HV2A 4M0MA 1OGYA 2XQKA 2FQXA 2BHLA 1YULA 2R2GA 4FHZA 4IX9A 3LVQE 1L9XA 1HWYA 1BE6A 3R2JA 5EHGA 3T34A 4HNHA 2ZZMA 1T5IA 2MSWA 3CKKA 4BZWA 3NVKI 4LOAA 1WUYA 1S3GA 1LPBB 3MK31 4O4IA 2CYBA 1BCRB 1GKIA 1LV8A 4MWOA 4UE3S 3CEHA 3EF3A 2J5KA 4Y1FA 4LHYA 3OZAA 2FW7A 2XADA 4Q3LA 5IKMA 1P0CA 3SFZA 1EEHA 5LSAA 2O8BA 3ZUPA 3WBJA 3EXFA 1N7HA 1YA6A 2PZJA 1DGQA 1KP2A 2BEWB 2PUVA 2RI0A 5CFZA 1NVUQ 3KKOA 5AVYA 5I9TA 5JRZA 3W5IA 2IEYA 3INYA 3PXAA 4WZZA 1P0QA 4FGSA 2LVBA 2OFOA 1UZMA 1CQIB 2P27A 4L0MA 1A9PA 5T8KC 3WWEA 4Z99A 3PNKA 1RPZA 5J5CA 2XDQA 3S7ZA 3T8YA 1SXJC 4PLFA 5AVVA 1Z74A 1A5SB 4B6QA 3AF6A 1YK0A 4OXQA 2GCOB 4M8SA 1L9KA 2FFBA 2FFJA 2A0KA 4Q37A 4B0PA 4DY6A 3DLTA 5E2BA 1UZUA 1U90A 2M6KA 3ESRA 2AXNA 4TTVA 4TX1A 2C3UA 1SPBS 3IEPA 1RQ7A 2Q1YA 4F2WA 1Z0IA 1ODKA 4NS4A 1GFZA 5LPNA 1RC8A 1TLLA 3JTMA 4KGZA 4WNAA 4HEHA 1MKYA 3UUFA 1QP8A 1TTQB 4RH1A 4BVEA 4N6NA 4DXAA 4ZHQB 1AQ6A 2Q3BA 3G7NA 3EMKA 4PAQA 4WNCA 2D62A 4F3YA 4BC0A 2OCBA 3RYTC 4I5DA 1YS1X 5AKIA 2GYUA 5KZMB 2A9RA 1WW3A 1QIEA 2XA2A 4BNMA 1ZCZA 3Q3IA 4X6XA 3AHDA 4XDZA 1UPTA 3G0IA 3OUZA 4E3WA 3PDUA 3FM9A 1R4MB 3N8DA 1EQUA 2C78A 3K0AA 4DVJA 3AG6A 3TM5A 2DH6A 1SCNE 2KS6A 3EVNA 4FP9A 4RQTA 3TOZA 1VJCA 4N3CA 4AB1A 2F59A 1QIJA 2GI4A 3QBEA 5CGQB 3G2IA 4ZXPA 5HQ3B 3W8DA 5BR4A 1EK2A 1MW8X 3A9WA 5FPKA 1E2GA 1T8UA 3U5ZB 3GW8A 4URFA 1FSSA 5DGHA 3IQWA 1RRFA 3N70A 2F1JA 5BSTA 3T9CA 4DAEA 1RWXA 5B3KA 3SVZA 1E3IA 3F2VA 3VISA 1XZAA 3OEEA 5P21A 2BCJQ 2MYUA 2OY0A 1VSQA 3I83A 1U8XX 4M1WA 3ZN2A 4IV5A 1UK6A 4PRYA 3BHNA 3EARA 5BVGA 1ZOSA 4KI0A 1U2QA 1KJ9A 1XJQA 2W2XA 2YV2A 2A3RA 3V3KA 4EWLA 4FJ0A 3OPYA 4MS3A 2FJPA 2FXVA 3DL2A 5DTIA 3OJOA 1GY8A 1QGUA 1SBIA 1XKXA 4TGLA 4PN3A 4LFCB 3UV6A 4A4DA 2VTKA 2GKSA 3GEGA 1SULA 4DLYA 4X3CA 4PZDA 4OGFA 3TW6A 1UODA 3AR3A 1LNZA 5FF9A 5BSVA 1FP4B 2D0OB 1EGMB 1GVNB 2FWIA 5AVOA 4HY3A 1ST3A 4RQBA 3DAFA 4AJKA 3O82A 4MI9A 1A9QA 2W6ZA 1CUXA 3DAOA 1R4ZA 3C3EA 1EIZA 3DCYA 3LPCA 3WGTA 4A2QA 1U0FA 4EB8A 4L73A 1XUOA 2B0CA 3KLOA 4YFYA 3E9CA 1ZITA 4E5UA 2G5GX 4GNKA 3UF0A 1UWKA 3H97A 4M21A 1JILA 3LG2A 4OHWA 1HNWB 3K0KA 4LZNA 2AR7A 2WLTA 3EVBA 4QDOA 3EG9B 4PYMA 3WMRA 1NL3A 4YASA 3CWQA 3WBBA 5BYKA 3I9KA 5JZVA 1BA3A 5KNCD 4CEHB 5AJWA 1VPVA 2ZSIA 1HDXA 5A02A 2A9FA 2GRJA 3UK6A 4YRIA 1H65A 3ZZ1A 1C3EA 1LWNA 4ZJPA 1HE3A 4X3OA 1VE9A 5FIUA 2WHPB 4XVHA 4DEYA 4HVCA 2EERA 3CN9A 1UZAA 4GSYA 4AJIA 3UJ8A 3SM9A 2QLNA 2JLBA 1ZICA 4QVGA 1NHGA 4ZICA 1P0FA 1JT9A 3QLTA 3LWDA 4MQEA 1DTWA 4IY1A 2V3WA 3GD5A 5CFOA 1PV4A 3ZDEA 1PNOA 3OWHA 4MH0R 1U8FO 1JEAA 4H7IA 5THQA 3QNWA 6PFKA 5EESA 3NC1C 3OM0A 2AOTA 3SZGA 4BWGA 3Q87B 4PRLA 4UM8B 4M9QA 1CUUA 1I4TD 1OZ0A 2EBFX 4DMUB 3D3EA 4GLFA 1YS7A 4CLOA 1T4CB 1J9ZA 1ZXXA 1DEHA 3CX6A 1TPZA 2XNDD 3HLYA 4HP8A 4INJA 1EQAA 2DJIA 2BEUA 2R1TA 4HNAA 4PLHA 2F2TA 1KDZA 4K3UA 1R4NA 4L74A 5AQEA 1ECLA 5C8YA 3X44A 5CT4A 3J7TA 4HC4A 5E0OA 5EMLA 3RVQA 1P6QA 2XNDA 4B6GA 1TA4A 2BGKA 4LGMA 3HBNA 4OYRA 1AKQA 4RPHA 4UMVA 3TTTA 4EI2A 5HR5A 1QOPB 3C5WP 3I0NA 3O8DA 4MRMB 5EJFA 1ZXLA 2CLDX 1X77A 3TQSA 1ZR4A 1VJ0A 1E5DA 4GYWA 3AETB 1JLRA 1NVKA 3KOMA 4JU8A 1GGNA 3PNYA 4C7XA 3KKEA 4NZOA 3GLIB 4NXNB 3O8BA 4WNYA 2HMVA 4KNYA 2CEAA 1TCCA 3EGEA 4UFNA 4HXYA 5B64A 4L7VA 2Q5FA 4NBTA 2A59A 4YA6A 4NFHA 5TQ2A 1OBHA 2IZ7A 1YTUA 2WWRA 1A8SA 4G85A 5FA8A 1TMOA 5BXQC 3NBZC 2VYND 3NGXA 4HPJB 5JAQA 4S12A 2FSIA 1D9XA 4KWEA 4DNXA 3TI7A 1C1HA 3ANSA 4GI2A 1MLDA 5H0IA 2D6FA 2H57A 4PGAA 5ARBA 5EKDA 4Z4FA 4P8RA 2VYNA 4I14A 2JIZD 3MMXA 3PEUA 2HRDA 5CK4A 4YNBA 4JBGA 1R6TA 3ZDCA 2P91A 4R3UC 4F3RA 4F3TA 3Q6NA 1MA3A 1SEVA 3O9ZA 3KSRA 4IGFA 4RHXA 3MJSA 3IDZA 4B9AA 5IAOA 1ZZGA 2FSVC 3HXOA 1OC4A 3IOCA 4RGVA 4RE5A 4AUEA 4G36A 5FR1A 5JV5A 3TDKA 4NTZA 2JGLA 3A6GA 1Z2PX 1V9SA 3R40A 2EWMA 4F2HA 2PH7A 5FOQA 4LV8B 1JIKA 5LVAA 1SAYA 2FZ5A 2H1RA 3DZJA 3WGGA 4XXHA 1F5SA 2ISSD 3BREA 1KKLA 3OAAD 1XE3A 4LJ8A 1U2TA 2OYSA 3ELBA 3U62A 2FR8A 1CC1S 5DJ5A 2GEVA 3Q3HA 4KO4S 4PHTA 1NUUA 3PUVA 4KIUA 2P0AA 5LKAA 2X5NA 3OZCA 4ZOLA 3SBXA 1GADO 4OJYA 1JZQA 3VHQA 3R3SA 3DE4X 3T3GA 3TYXA 3H2ZA 3ZJ5A 1FMLA 2J45A 4TXLA 2GYYA 6GPBA 3B78A 3R5SA 3RVDA 2CUZA 4RKWA 2NQTA 2ZS7A 4L95C 5BUCA 3A6PC 3UEOA 3WDSA 3WNQA 4DCOA 1SCQA 4AYTA 4C4RA 1P1IA 3AVVA 1W76A 3IV9A 3DXXA 3BE4A 1JS1X 3MAJA 4KN8A 1DFHA 1QG6A 3HFJA 1AKMA 5JZOA 2GD1O 1UPAA 2VBIA 5DSXA 3PNLA 2WWTA 4CR8A 4ENVA 3AVOA 3JQBC 3V4RA 2QX4A 1MB9A 5E3IA 4F12A 3NWOA 1QYWA 4DFDA 2QRGA 5B4VA 4B71A 4NFSA 3MTEA 3JQ6A 1JDBC 1N9ZA 1LX7A 1N6IA 2G82A 3G8CA 5CCDA 5L7TA 4F9FA 4PAGA 1OVMA 1O5TA 5BWBA 4DIUA 4JVSB 3C0KA 1NJ2A 1YRAA 3OA2A 4GP7A 1J0DA 3BE8A 1SVMA 2AE1A 4UTNA 2G4VA 4D5GA 2SNIE 1K6IA 3ZQJA 5GY7A 1FNMA 3K9FC 2QTVB 2GTIA 3DBHA 4RU1A 1GPJA 4IIXA 1JE0A 1Y6FA 4CU5A 1YV9A 3HVIA 4ER3A 1D6NA 2R44A 4BATA 2ZJBA 3I3SR 1T2NA 3EY4A 5ILQA 5IVDA 2ENWA 1WDWB 2HUPA 3P2EA 1V11A 2CDBA 2YWBA 3VR5H 1TECE 3WA6A 3EG5A 3IHLA 1RFLA 4KYUA 2B6HA 2DCUA 4L0DA 2G1AA 4ZVVA 1NU6A 5IS2A 2AOUB 2XZLA 5CHEA 4MDYA 2BD0A 3GFVA 1SZJG 3FNIA 3ZNOA 2YQ5A 2O7RA 1YZGA 3PS9A 1KMHB 2I1WA 1E89A 3KSDO 4GOKA 5EINA 4BBAA 1JR2A 5LZ9A 2ZUSA 3OWOA 2HRRA 3CW2A 3L6EA 3RRZA 3IL2A 4RTRA 1BX1A 4JP1A 4C89A 4JBIA 1ZCJA 3EXHC 4JOSA 5IFKA 1GFWA 4MQMA 3RC7A 1WV1A 5KCZA 4GVPA 1C3JA 1D7AA 1OFIA 1BE8A 4HDKA 3ONEA 3AOEA 4TWAA 3MWYW 4TV8A 1CS0A 3BXZA 3DXFA 3RE1A 1GDTA 2ZRPA 1A98A 2I54A 1SG9A 3NATA 4H3SA 3QWIA 3PU6A 1EXMA 1RBYA 1ZFNA 1CUJA 3LK7A 3QELB 1XYYA 3G17A 4MWSA 3TSYA 3VR1A 3TVDA 4Z7QB 4ID9A 4XB1A 3HY6A 4Q3OA 3HGQA 4RZUA 1W2WB 3NBMA 3OQBA 2UXBB 2WJZB 4FDUA 3L18A 4OQEA 4HWTA 3QUCA 1M83A 5T3YA 4GOXA 2QNIA 1SBHA 2F62A 2RARA 1MP0A 4DN6A 3AWIA 3PHJA 4GFDA 4Q48A 4DDTA 3EHDA 3IGFA 1D8TA 1TRHA 2RHWA 1WXHA 1V16B 1X7YA 2NVWA 2P5SA 1G1MA 1XAGA 3NHJA 1C9EA 4MRAA 3EX7C 3MUEA 4FYMA 3K9BA 1MXHA 2JK0A 1RXEA 2O23A 4IZOA 1XCBA 2JAPA 3GPCA 1FSFA 1W93A 5CB0A 1OI7A 2WABA 4KMOA 2FSGA 3WISA 5BR8B 4M9XA 5CTAA 1SB9A 1PJ3A 4U0KA 3CLTD 4PYNA 2JC3A 4JR1A 2ZIUB 4FSDA 2HLDA 2QU7A 1YDEA 1T36A 2QY9A 2FOIA 1UIRA 4JITA 3GJQA 4N7JA 2B94A 2KX7A 2B1IA 1J22A 3ETEA 4FFRA 3WGKA 1YRYE 3E3AA 5JU6A 1IUPA 1CUHA 1Y48E 3U80A 4JXXA 3DBRA 1I7DA 3KUUA 4IS2A 2PLNA 2VKTA 4RANA 5A05A 3ZH9B 4CM9D 4QIHA 1PR3A 4B73A 3JZIA 2PT6A 1BXRB 2AMVA 3PHLA 5LNK1 2B9EA 2C29D 4CGZA 3QKSB 1E3EA 3JYNA 2OKGA 3TGWA 5ES4B 4CM9A 1HOTA 1R3DA 3KOYA 4GC5A 3IS3A 3RSGA 3BSFA 3BWVA 3SSNA 4EG5A 1TC1A 3EIUA 4G0XA 4PZEA 4L0CA 1L1EA 4RKQA 2CLKB 1ESZA 1S01A 3AIKA 1QM5A 2NU6A 2UZ1A 3B6MA 5G4KA 1TCVA 1KAQA 3VJRA 2AW5A 3JQGA 4W8HA 1G6HA 2H4YA 3T41A 2IS4A 4CKBB 1BRTA 5DHFA 3F4BA 4LIPD 3STWA 4EBBA 3DDCA 3B85A 1QMPA 2JFHA 2QMUA 3QVTA 4JB2A 5HUQA 2D54A 1NNSA 3L84A 4CF3A 1WF3A 3ETHA 3GAZA 4AL4A 2QGFA 3MB8A 2HHHB 3R0JA 4RIIA 4RH0A 221PA 1OAAA 2V7QA 1LNSA 2HA6A 3CSDA 5IN5A 5G0TA 1B2RA 2ENUA 5FWYA 3HM9A 3ODPA 3LXMA 4YXFA 3LO5A 1G2OA 2O20A 3EPPA 4HRAA 2ZE6A 3K4PA 1W52X 2J9YB 2RBKA 5DN6A 1UFVA 3LUCA 1T3ZA 2EYUA 2PYZA 2C9OA 4OAPA 4A8TA 1IVYA 4F85A 3K6RA 3GH1A 3PQEA 2P40A 3K0FA 3A9TA 4H9GA 1FL9A 3A9RA 4NCJA 4B34A 4YAJA 1QB7A 4ERNA 3ZY2A 4WBNB 2GD0A 5AM1A 3QVMA 3CTPA 4UUQA 2HA4A 5SZJA 5CFMA 4FVTA 1E2FA 3AERB 5HK8A 3S99A 5A9SB 1MHPA 2FKAA 2FPRA 1GL3A 4MCHA 4NJEB 2YXBA 4XCVA 1JAIA 4IUCS 5EE9A 2ZYVX 2RHDA 3BK1A 4ASUD 1RTKA 5JJBA 3KEQA 2NGRA 2BGUA 1TJ4A 2AOWA 4CM7A 1NWCA 1MAAA 1EA5A 5EIWA 4C20A 3AEXA 1SHJA 3STTA 2TMDA 1JEOA 3H99A 4RY2A 2B1JA 1DBSA 5EIHA 2D2XA 3K0CA 2X1VA 2DFKB 4MVJE 3VZRA 3H1FA 5K8CA 3G5TA 3LBFA 3A3PA 3IDOA 3WDMA 1N3LA 2TECE 2DT5A 3LCRA 4LC9A 3MYYA 4OXXA 3LLSA 3T7SA 5LA6A 1KKUA 2WD7B 3EZYA 5ENZA 2GRUA 3BTOA 4IDAA 4QREA 3I04A 3M3DA 4FUQA 5A7HA 4WVFA 3HHPA 3KRTA 2DUUA 4TLCA 4MQUA 3UUEA 3UJNA 4PAOA 4QFMA 1Q3HA 3U26A 4ADSG 2I2WA 3C4QA 2WVJA 2C5FA 2PUHA 3LX4A 4IZIA 3S2IA 3AW9A 3GEBA 1EUCB 3FSEA 2IHTA 1SUBA 1NVEA 2VJMA 3V1MA 4J2TA 1T43A 1KSHA 1DU4A 2I6GA 3DMGA 3H9GA 3ENNA 5H68A 5K6AC 1FRQA 3LY7A 3MJVA 1C8BA 2XPCA 1OYOA 1C29B 2KLHA 1L5NA 1SC3A 1WVGA 3KB8A 1YFLA 1WUTA 4POAA 4L3VA 4TMTA 3O8RA 1T8RA 1PT6A 4NE9A 1GRCA 4I1OA 5C5EA 3HWSA 3HJFA 3BCUA 3A27A 2Q5CA 1RLIA 3SDZA 5BW5A 2J46A 3B13B 3QFTA 1YHYA 1Q0SA 1X1QA 2CXXA 2VCYA 4IXMA 4P08A 3DNMA 3MGKA 4V0NA 3LUHA 2Q6OA 1N57A 4A82A 3LV8A 1ATZA 4UEKA 3L3BA 2XHZA 4O4LB 4WERA 3DOIA 5COAA 4BEJA 4UBMA 4XWOA 5C32A 4H27A 2IDMA 1HNZB 3I92A 2AG0A 1Y4AE 4LBYA 2XRFA 1BH6A 1QE3A 2G08A 2WJHA 1W0JA 3N6RA 5HS4A 4N01A 1EYZA 4Y2VA 1JQDA 1RI1A 3BIXA 3VO2A 4LSZA 2RC5A 1BS2A 2IIBA 3QJ5A 4F45A 4FKZA 4DUYB 2J9ZB 1AQIA 1YS9A 4LGCA 4LXUA 2DU8A 4X93A 5E9WA 3TS1A 4CTMA 5AVUA 2QLLA 3M7IA 3SX2A 2B9VA 2HA0A 3QM1A 3THXA 5LCXA 2WWVD 3GLIE 2G1KA 3JALA 2WUVA 5FUQA 1J2JA 4U02A 2HM7A 4U5QA 3UT6A 2C4TA 4PN7A 3KALA 2OB2A 3NVAA 4I4CA 3W5AA 3ZE1B 4D7AA 2P41A 3AR4A 4JB3A 3D4BA 5C80A 3HKBB 2Z0MA 1D3AA 2D5AA 3NPAA 3QPAA 1QIGA 4XGKA 1K7EB 2AZMA 5DX8A 4ZC8A 5K20A 1JH9A 5FLKA 1UEJA 2AFRA 3N8NA 2L19A 1BHO1 1HTTA 2Q1SA 2IH2A 1Z68A 2XE8A 3HKDB 1ISJA 1N0VC 1Z5VA 3UJCA 3VOSA 4AMVA 2D7JA 2FVYA 4KIGA 4RIGA 2YZNA 1FFYA 1BU5A 1IIRA 4RPIA 5JCOA 3MW8A 3WGJA 5LD2C 5DYNA 3RIGA 3AP1A 3ABSB 3LQFA 4NULA 3ESDA 1ZH6A 3T9BA 4AIRA 8MHTA 4ETWA 4RWZA 2NADA 1TT5B 2OHVA 4IHJB 3K16A 3E9RA 1JHMA 2IYAA 2JGRA 2FMIA 3CNOA 3WKBA 2GF0A 1ORTA 2YQ4A 3ROEA 4E5NA 4GR4A 3ZTTA 2ZZNA 1ZN9A 3L1UA 5JS6A 1T15A 2GERA 3I1FA 1GGMA 1VP3A 4C87A 5LOVA 1H2YA 1E0SA 3KEFA 4AECA 1AK1A 4KV7A 3VPFA 4PNEA 1KDTA 4G5YA 4RVCA 3D6FA 5AKYA 4FYHA 4AIIA 1W36D 3SXUA 5B53A 1ZBQA 2P68A 2PX6A 4CM4B 2A88A 2OL4A 1EESA 1AUOA 1RWWA 5ESXA 1J99A 1VBMA 4G8JA 4V3BA 3AB3A 1B0UA 1NN5A 1U9IC 4RKYA 4B1FA 2VF2A 4D6PA 5KVCA 4XWTA 1DSSG 1WUIS 4HWSA 3BT7A 4NR0A 1Z7YA 3DPSA 4G81A 1C30B 3KO8A 3R0IA 5D87A 4I1RA 4YCJA 1ZM9A 3OU2A 1PR2A 4GQIA 5J4HA 1RQ2A 3AHFA 2RGDA 3RVLA 1S96A 2VP5A 3IDQA 3WLPA 3FFTA 4P4SB 3MWDB 1N33B 1E4VA 3U3OA 3AF4A 1QFZA 1PX0A 2VDUE 3QEJA 1LF0A 3GEEA 5T64A 3E9QA 3AW8A 2AJDA 2EFEB 2BFEA 2BFWA 4ETNA 1N8TA 4FMBB 5JXGA 4BO7A 2AUTA 3FSRA 2WWGA 4FNGA 3QU5A 3B1YA 4R6XA 1HFWA 1N1MA 2I6XA 4YJ3B 2HHJA 3VSCA 2QYOA 5FTMA 2ZKLA 3NM4A 2ZTUA 1UAAA 1Z22A 3DZBA 4D42A 5HKOA 2XA9A 2UYCA 3N59A 5EJ5A 3FPCA 4CLEA 4PY2A 4REQB 3BL8A 1SELA 2GUWA 3N2NA 3QK7A 4TTPA 5GAJA 2N1MA 1CV2A 1P7WA 1PEYA 3H6HA 1PHPA 1OBVA 4WWHA 4Y8VA 3SEZA 1JG3A 3ULKA 4GKVA 2LPMA 4ES6A 5BSWA 4NESA 4YQZA 4COOA 2F8LA 4YJHA 4IV8A 1G2QA 4WJLA 1B23P 4DLBA 2JIRA 2J33A 2XVAA 1T1GA 3JD3A 4FM9A 1KEPA 4G5QA 1WDTA 2FHSA 3HFSA 1ZA2A 1UFQA 1N8NA 4BN5A 4Q1FA 1MB2A 4H7FA 1A69A 3L7IA 1SUWA 1RMQA 4I9GA 5A2GA 3SKYA 4R05A 2I34A 3CXRA 4HXGA 2DQKA 3HVJA 1L1FA 2LKCA 2XNJA 2W83A 3JZFA 1EK6A 3OZFA 3QIAA 4MINA 1A9XA 2IOQA 3JZDA 5EWJA 3DGFC 3SSOA 5HRCA 5H8WA 1QVZA 1RKVA 3R3XA 4N49A 2CL6X 1RJ9A 5K0FA 1NP6A 3NHUA 1Y4UA 2FH5B 3DZKA 3WYAA 1EK1A 1E94E 1EBUA 2PRIA 5E4YA 2ECKA 4D8WA 4G1BA 1HX7A 2YWCA 3HJGA 2MSEB 2AYYA 1WUHS 3P9NA 2A4MA 2L42A 2OV2A 1G3IA 2DFDA 2GK4A 1Q20A 4IIGA 4V0KA 5FJIA 4F46A 5AHKA 3PYXA 1CUIA 2WHXA 2ZJZA 2HT1A 2E55A 1X3SA 5TPZD 1GPNA 4OBXA 3AR2A 1Z4MA 2RSLA 2I7TA 4A6EA 3S8EA 1PJSA 2QHXA 3L0PA 3RS8A 4YROA 1EJ0A 3T3HA 4BGUA 5JMOA 1IULA 3A2LA 1FP7A 3O91A 4NATA 4ZGWA 4KQ6A 5JD6A 3T5TA 3AR8A 1XLTC 5F3WB 4BLUA 1U5BA 3EUAA 2R79A 1UBCA 5LQDA 3MLEA 4GR5A 1KP9A 4M4SA 4NZPA 1T2UA 4ARZA 3H84A 3HP1A 1CZUA 5ALPA 2DWQA 1W8IA 5LBTA 4JNCA 2IE0A 3C48A 2E6UX 1QB8A 3KT3A 1XZHA 3CRMA 5ERGB 4IR7A 1IXYA 1XZ8A 4ALMA 4X8OA 4XPIB 4E2FA 2HMUA 3LLUA 1R0SA 1XDWA 2CK3D 3GI1A 4JS0A 4KL8S 3R75A 3EYAA 5JCJD 4Z1MD 5ALOA 1TYDE 2AQ8A 4W63A 4B79A 1B8PA 2OAP1 1Y1QA 2PBZA 3E9YA 6LDHA 4M86A 3STHA 3IQDB 3AO0B 3TBHA 4KQ9A 4LJ4A 4OUDB 5PGMA 2VDVE 3UT0A 4IF6A 3ZIDA 5BR1A 4CLRA 5JNSA 1UC8A 4UREA 3WRYC 4QQ8A 4Z54A 4DLSA 3GLFB 4B4VA 1N77A 3ECAA 4G26A 5ANRB 2IUEA 2VA9A 2W2QA 1SFRA 4LK2A 1UANA 2FPIB 1MH9A 1W35A 1VLLA 3FGZA 4WLVA 4UC0A 3W9YA 2BGJA 4YB8A 1QNFA 2I6UA 5K3AA 1X0VA 4B2PA 2BTQA 5HMLA 3ZWOA 2V0GA 1WCXA 1EHCA 2RB5A 3RARA 4D3FA 2B7LA 2BFFB 5FBHA 5HK9A 4HNVA 1WQ4A 3A0UA 2XUZA 1U6IA 3IFSA 4LJAA 4C6HA 4MJLA 3AKDA 2RHOA 3B5IA 4HFNA 1M6HA 1B16A 1GZ4A 4J16A 2JFFA 4OK6A 3T54A 1QLWA 1AA6A 3NOVA 4UUOA 4UE2A 3LHSA 5CCEA 1L8AA 1G20A 1F2UB 1RYMA 4LC1A 5JATA 4BO1A 4IYJA 5EIBD 1Z47A 2PAAA 2YRFA 3HBFA 1ETUA 1KYWA 1MENA 1NI4A 3K1AB 2V8BA 2F43A 5AKXA 3ZD6A 1ZGJA 1MAWA 2OLKA 4YJFB 2VPIA 5KVAA 2D2FA 3PXBA 1U0OC 2ATVA 1D1PA 3HNOA 2PR7A 1NVMB 1P1FA 3KYCB 4AJNA 1BXGA 4HX5A 1W0KD 1HEUA 3D3JA 3P9CA 4JCCA 3UPDA 3ZNQA 5T7BA 2EV9A 4IIDA 3R3HA 2QOEA 2HADA 3UPUA 1H1DA 5F2OA 4IMPA 2IS2A 4UM9B 1FYDA 4LE2A 5AI9A 1W0KA 2K6GA 4BMOB 4KAXA 3GZNB 4EB6B 4J1TC 1DOZA 1Q3KA 2H5IA 5E6UA 5IJWA 2CYAA 1MJHA 2GN9A 2JJ2D 1T1JA 3RUFA 1AIPA 4P3XA 2BFDA 5EMKA 5J5VA 3KKPA 2RKOA 4H1TA 5BQPA 5CA1A 1WS6A 4H0CA 3M9LA 3G2QA 4NOJA 1VI5A 1P4JA 2IHVA 5CT6A 3ZHSA 5JNUA 1GM5A 1XG5A 1T9KA 3V97A 4LNUA 5ECWA 3GNQA 5B30A 4M1OA 3RFVA 2A0FA 1BFDA 4LE1A 4DRZA 2CF5A 2CL0X 5LJIA 1WBDA 4JP8A 4XWAA 1G1AA 3AUXA 3EOBI 5CVVA 1Q83A 1C4WA 4WLEA 2FUKA 5LXTA 2NVUA 1P7YA 2GXUA 2TMYA 3OOHA 3E8MA 4WLUA 2F55A 4CCYB 2YVUA 3ZCRA 2QP3A 3USES 3W04A