4HLYA

The complex crystal structure of the dna binding domain of virf-1 from the oncogenic kshv with dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
KASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the DNA-binding domain of vIRF-1 from the oncogenic KSHV reveals a conserved fold for DNA binding and reinforces its role as a transcription factor.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Dna binding protein/dna
molecule keywords K9
total genus 30
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hlyA00
4UNOA 1EH8A 4RGSA 4ESJA 3WTSC 3SHFA 2XKPA 3GF2A 2P8TA 3L7WA 2OD5A 4M9SA 4RAZA 4OMZA 1ZG5A 1JGSA 4S04A 5AIQA 1QZZA 3J81K 2UWMA 3ZMUA 5ICCA 2K86A 3BROA 3HHHA 3RTRA 2VXZA 4BQAA 4EGYA 1D3YA 4P55A 2OQGA 1YFHA 3R0AA 3FXQA 1SD7A 5FLXK 1FZPB 2YX4A 1HKSA 4CYDA 4NQWA 2XRNA 2HZTA 2KIUA 2VOPA 5K5RA 3AAFA 3FMSA 4U0VA 2W24A 4LLNA 2P6SA 3T8TA 3HSEA 1QO0D 4YIFA 1G3SA 3CUQB 3MZHA 4M72A 2ZMEA 1ZGJA 1O7FA 3E6MA 2FXAA 1KU2A 3KEOA 4Q4ZF 1BI1A 3L09A 3QP5A 3I53A 2EK5A 4JK1X 2BV6A 3D5LA 2A6EF 4JQFA 1L0OC 1BJAA 4EJWA 1ZAOA 2P7VB 2ZFWA 1GXPA 1MKMA 2ZCWA 3KLNA 2ZJ2A 3T0YA 2PEXA 4LFUA 4EGZA 1TNTA 4OIQF 2W57A 3BPVA 2DT5A 1YLFA 3R6SA 2F2EA 3OV8A 4M73A 3HOSA 1AOYA 1ZH5A 3I58A 2PBIA 1YQAA 3TQNA 2PJPA 1Z91A 1HBXG 4M6XA 2XASA 2GAUA 3GXOA 1UHWA 4HV5A 1IN5A 3JW4A 2H6BA 1QBJA 3I5UA 1RUOA 4HA8A 4CZZA 3JTGA 2J5OA 3T8RA 1T38A 3VODA 3MAJA 3WE2A 2W85A 4OU0A 1SMYF 2FRHA 2F5CA 1R1UA 1ZREA 1GHCA 2J5PA 5LBQA 4MGRA 2DI3A 1FBQA 1FPQA 3R61A 3I64A 5CVVA 4CXFA 3BJAA 1V3FA 1TLHB 4RB1A 1ZYRF 1OYWA 1W5SA 1KA8A 1KGSA 2L02A 3S2WA 1U5TC 2M45A 1MJAA 1USTA 1BN5A 5HS7A 4HAMA 2ISZA 4FX0A 3DV8A 2ZNZA 5KVRA 3ZMDA 2P5KA 3KETA 3DP7A 3E6CC 4ZYHA 2DAOA 4A6EA 4KN7X 3E5QA 5DEQA 2FBHA 4ZZDA 3F8BA 5LHIA 2QUFA 2TDXA 2CG4A 1RNLA 2JTVA 1TQPA 3DXJF 4RGRA 3BJ6A 5D4RA 4HYEA 3V8LA 2XUBA 2EV6A 4KIFA 1MD0A 1YW8A 1FNNA 2VC0A 5TJJA 5HLIA 4XBFA 3JSOA 5K1YA 2R7DA 3RKWA 3ZMVA 4BH9A 2PLYA 3SQNA 3LQQA 1XB4A 3KP5A 2QZ8A 5E1WA 2GWRA 3HTSB 4LB6B 1ULYA 2EFOA 1Z9CA 3GYHX 3TO9A 4ESBA 1P2FA 4UHTA 2V79A 1BC8C 2IA1A 2DTRA 1WQ2A 1XDSA 1XSVA 2MH2A 4KA4A 1ON1A 2LKPA 3KZYA 5DV5A 4R1HA 3M9AA 5E8GA 4HQEA 3GO5A 1H9GA 1T39A 2QWWA 1PDNC 5D4SA 4MTEA 1HKTA 1FYKA 3CO7C 4OMYA 2XV4S 2P4WA 2A68F 4L5IA 1GVJA 4L0ZB 2F5FA 3B02A 3EETA 5EEGA 4RB0A 3GFJA 3TOBA 2HGCA 4ZYGA 3R60A 5BMZA 1JHHA 3TOAA 4RB2C 3E6BA 3ABUA 2NNNA 1BI2A 3HSRA 5IT9K 2E7WA 2XAFA 2HYFA 4EM1A 3SXYA 4LG0A 4RGUA 3IRQA 5D5XB 1IRFA 2DLLA 1U78A 1LJ9A 3DF8A 1J7KA 2CWEA 2GQQA 1H0MA 1LDKB 3SZTA 3FWEA 3G73A 3FM3A 2VT3A 1DPRA 1K78A 2DW4A 2XKOA 5CYVA 4ETSA 3QOPA 5HS8A 3BJOA 3E97A 5HS9A 4LB5A 3QU3A 3Q5FA 3CTAA 3N4MA 4NHJA 4YIIA 2E1NA 4BHBA 3V7CA 4HDVA 5BS6A 1XDUA 3WTYC 5L3DA 3BOQA 1J5YA 4QWQA 4AD9A 2STWA 3R4KA 1J75A 4L0YB 2X4HA 3KP7A 4B8XA 1XN7A 1T98A 3HRMA 4U88A 3F8CA 1XMAA 5LEKA 5DUIA 1P4AA 3O6BB 3RPUA 1DP7P 1J9IA 1S8NA 2M5WA 4I98B 4L9JA 1QNTA 3CUQA 3GLXA 2DQRA 3D0SA 1D8JA 1F4KA 1MDMB 4GO1A 3TO6A 1FP2A 4HW0A 4G6QA 1IN4A 2A61A 1V4RA 5CVUA 3QPHA 3I54A 3LFKA 4CICA 3O3KA 1MDMA 4U0YA 1HW2A 2ZXJA 1FBUA 3EDPA 2M87A 1IN8A 2C6YA 3WTUC 4Q47A 4BHCA 4IRGA 1U5TA 4P5OA 4GCVA 4YFNF 1YYVA 4QLCU 3C1DA 2W84A 2FE3A 1G6NA 1LEBA 2IJLA 3N97A 3GEZA 2HQRA 4AIKA 4BYYA 2RGVA 2IP2A 2Y48A 4AIJA 1YTYA 2Q2EA 1BIBA 1X3UA 1XMKA 4MQVA 4L5JA 1MGTA 5ERIA 1K6OA 4A6DA 3RKYA 1R1VA 1W4MA 4OIOF 4CDGA 2VN2A 4A5NA 1UFMA 1KYWA 1XD7A 4DNCA 3BPXA 2O03A 2EFWA 1KQ9A 1R7JA 3WGIA 3FXRA 3O2PE 5LRSA 1IW7F 3WG9A 4HLXA 1G3TA 4EM0B 5D6EA 3GZ6A 2LSOA 3K1NA 2R7FA 4LJZF 5ILUA 3ERED 1OPCA 3IHUA 3FMRA 2H27A 5CVIA 2YX7A 1WI9A 4FT8A 4H0EA 3L00A 4ZYDA 3DFGA 4UVBA 4R8HA 3CO6C 1MJ9A 2KRFA 1IAWA 2EJRA 1R36A 2WC2A 1CF7A 3J80Z 1QGPA 4P96A 3ZQ7A 5AIPA 2Y0MA 2DU9A 4OOIA 1JE8A 1MJBA 2EFNA 5AONA 4IHTA 4I02A 3P9KA 1P6RA 2EV0A 5LRRA 4IPAA 2Z9OA 2GIVA 3K1PA 3JAMZ 3K69A 2KKOA 1W7PD 3QRFF 2CW0F 3ABTA 2HTSA 3LA3A 3ULQB 4G7ZF 1S7OA 3KE2A 3FX3A 3CDHA 1Z7UA 3P9CA 4FHTA 3GWZA 2FSWA 2F5DA 1S7AA 2JRTA 3RIRA 2ISYA 3WTXC 3ZP5A 1L3LA 3HTUA 3ISPA 1B4AA 2JZYA 1ZG3A 5DCMB 4A0YA 2GXBA 2CQKA 3RYPA 1S6LA 4OINF 1O3RA 4OIRF 1GXQA 2Z99A 1W7PA 1TNSA 1KYZA 3BWGA 2FNPA 2OZUA 3TKYA 1R58A 2RNJA 4BHPA 3GFMA 2PMUA 4I7HA 2Z5UA 2RKHA 2AS5F 4IF4A 1FYLA 5FFXA 3F72A 2OU2A 3REOA 2GXGA 4NB5A 1Z6RA 5D6FA 1P92A 1OKRA 3M7GA 1IN6A 4I0BA 3M8EA 4PCQA 4HOBA 4RS8A 3FF5A 1LQ1A 1CGPA 1ZARA 5A2QZ 4Z2YA 5D5UB 4M9ZA 1YS7A 1K7AA 3PFIA 3Q9VA 4ASNA 4WK8F 5L3FA 3H3UA 2OA4A 1ZRDA 2QQ9A 4LLLA 1G3WA 2G7HA 3MQ0A 1W7PB 3BY6A 1SD4A 2Z33A 3LAJA 3DPTA 2L4MA 2RC4A 1FWZA 2LF7A 4L9VA 5DYMA 2QYOA 4MEXF 3DEUA 1P4WA 3KP3A 3Q9SA 2XAQA 1IXRC 4K2EA 3V7SA 3BP8A 4KICA 1W5TA 1LB2A 2E1CA 1ZHFA 3EYIA 2HR3A 2MD5A 5HDNA 1IZ1A 4Q48A 5E17F 5DD8A 4KIBA 1BI3A 2HKXA 1UB9A 1I27A 1D8KA 1O7LA 4N0BA 3IKVA 4O6JA 1BC7C 2QLZA 2ADUA 2XAHA 2YR2A 2MBFA 3E5UA 3T5XA 5BQTA 2IPQX 4XSXF 4N9IA 3VFZA 1LDJA 1R22A 4LG0B 3HUGA 1DUXC 3TDZC 3M8FA 3RI4A 1ZG1A 4P9UA 3WTTC 2XROA 2PFBA 1U6GA 3LA7A 1K78B 1HSTA 5HLHA 3WU0A 4ENNA 4MNUA 3VEPA 2H6CA 5E8IA 1SFXA 5A2QK 1T0FA 2XIGA 4M6YA 2HFHA 2IRFG 4L18B 2B0LA 5HOOA 4RGXA 1R00A 4L9NA 1H9TA 1ZN2A 2G9WA 5IT3A 5EEHA 2DBBA 3CUQC 3E6DA 5H20A 1TTYA 3ML6A 3K0LA 1OMIA 4I0AA 3F8NA 3MZYA 1ODDA 3RKXA 3WTVC 4GYIA 2FBIA 3WTZA 2GA2A 5H6QA 2VONA 4XRFA 3H92A 5DDGA 2Y75A 3RYRA 1SFEA 1RUNA 1FP1D 2FA5A 1J59A 4YG2F 1IXSB 3R0JA 4EMSA 4Q5SF 3IWFA 3IWZA 1OR7A 5CVJA 1G3YA 3NRVA 3ECOA 2QQBA 1PUEE 1FY7A 4KN4X 2EB7A 4AVPA 3WGGA 2A3SA 2QVOA 4PZJA 4UVAA 1SD5A 2JPCA 3LWFA 5FD5A 5LGUA 6PAXA 3EUHA 4MEYF 3GUDA 1NHAA 2VODA 3JAMK 4UVCA 2FNAA 2ZMEB 3E5XA 3P9IA 2DFIA 4HQMA 2VT2A 4RAYA 4A12A 5HDKA 1DDNA 2NAZA 3LSTA 3CUOA 2VC1A 3B73A 1WSUA 4LK0F 3I71A 5FD6A 1U8RA 2YU3A 1SFUA 3KP4A 3P7NA 1I1SA 3BZ6A 1E2XA 1FLIA 1QPMA 4CHUA 2AXLA 2LDUA 3V4GA 2DO7A 5L3GA 4LGWA 3F8MA 3NQOA 4HX8A 4HBLA 4U7BA 3F3XA 2IW5A 3L9FA 1B9MA 4DQ2A 5ILSA 2DK5A 2WWYA 5H6RA 4EV0A 1HQCA 4HLYA 4EM2A 2X0LA 5L3EA 2NNYA 3V8KA 3E3VA 2FMYA 1I6XA 1SMTA 3H3ZA 3K9TA 3WE3A 3ZMSA 2QBYB 1FC3A 2O3FA 3C3WA 5D8KB 1ON2A 3KCCA 3V7RA 2VOOA 2R3SA 5JR3A 2YSRA 3J80K 5LEJA 1LEAA 4IRHA 4TV7A 1XGOA 4IRIA 2A6HF 5E18F 4XLNF 1K79A 4RB3C 2Z3YA 2O6GE 5LHGA 1KQ0A 4KT5C 3W6JB 1XGNA 2GZWA 5ILVA 2DK8A 4G7OF 1HW5A 2HWVA 4IXAA 2H94A 4BAYA 5D5VB 1O57A 2FU4A 2JT1A 1T2KA 1YS6A 3GFLA 1FX7A 5E1ZB 1O3QA 5F64A 1FYMA 1B1BA 3WGHA 3HRSA 1RIOH 2FBKA 3KP2A 2DQLA 1UHMA 2IA0A 1B59A 2HEOA 1TQMA 3I4PA 4MHGA 4OIPF 4BNCA 3M1EA 1REPC 3TDUC 4G9YA 1IXCA 5JFRA 2V1DA 1LNWA 3COAC 4M74A 2PMHA 1EH6A 2BGCA 1HXDA 3ZMZA 2HYGD 4AIHA 4WCGA 4KIGA 1ZRFA 3IL2A 5J8CA 1AWCA 2RQPA 2ETHA 1KU9A 1E17A 2E7XA 2RVCA 1XCBA 3GVAA 2XHKA 3F8FA 2CSOA 1ZRCA 1BBYA 3L2CA 3GX4X 2KIFA 2BYVE 5JVTA 4KYWA 3IC7A 4CGZA 2L01A 1F5TA 4E70A 3RPQA 1R5GA 2HKOA 5BPDA 1OYIA 2L54A 1HSJA 1C0WA 2OBPA 1XCVA 2XAGA 1EH7A 2EFQA 1FSEA 2O61A 4LLGF 1U3EM 4BXUA 1J0RA 1QZYA 2QQAA 5LGNA 2LNBA 4O5VA 4HX7A 2P5VA 4HF2A 1WRJA 2UZKA 1CF7B 2Q8KA 4WXHA 4ENMA 2DPUA 4CO8A 1SAXA 1KQ8A 3U1DA 5ED4A 4LK1F 2UXNA 3GZ5A 4B09A 5LGTA 1XGMA 2HS5A 1TW3A 3KP6A 5HLGA 3K1MA 4GGGA 2MA3A 3HSFA 2VBZA 2ZBKA 2O8XA 3KFWX 2PG4A 1YIOA 1R23A 4F7ZA 4O3MA 1YO5C 2M1BA 2CYYA 4I2OA 1P4XA 4D0PA 2CO5A 2VBXA 4EJVA 1Z1DA 2FOKA 2K4JA 1LVAA 5FO5A 1T6SA 4UV9A 3RJPA 2FMLA 2KJCA 2EV5A 3WODF 2D1VA 4GXOA 3T1BA 4XLPF 1USSA 4YFKF 2MLKA 3W6KB 4EJUA 2M30A 3F22A 5LHHA 1Z6TA 4UUVA 1O3SA 5D5WB 5L3CA 2MLGA 4PDKA 1BOAA 2W25A 5JHUA 4EJOA 5BPIA 2MH9A 2D45A 1OYYA 2CGPA 2COMA 2KIMA 5TRDA 2EA4A 3ELKA 2D2WA 5K5OA 5J6XA 2QBYA 3ECHA 2MC3A 3QAHA 2Q0OA 4KUMA 1QQIA 1TW2A 4M9XA 3ZN1A 3GW2A 5E20A 1R5HA 1Z05A 5FGMA 1F9NA 2YPRA 4LD5A 4N9HA 1BIAA 3K2ZA 1A04A 4WX9A 2XAJA 2ZNYA 5F1RA 2EWNA 1SD6A 5KK1A 2JSCA 1KU7A 4WWCA 2OZ6A 1BI0A 2CFXA 2K7LA 2OAZA 4A0XA 4GYGA 2IVMA 3SZPA 2XVCA 4HZFA 2O0YA 4WXCA 3I59B 1LDDA 2K02A 4KNYA 2GA1A 4G94A 4AWXB 4A0ZA 2A69F 4ON0A 1FOKA 2OQRA 2ZKZA 5ICEA 3HOTA 4U0WA 2L4AA 3KLOA 5K5QA 5DCFA 3KEQA 1JXSA 2F5EA 3NEUA 1STZA 1XSXA 3ZN0A 1PP8F 5DCMA 2L3DA 2UXXA 1D5VA 2P6TA 2ESNA 1DPUA 4ENKA 2H09A 4M71A 1HW1A 1VTNC 3GFIA 1Y0UA 5J8FA 3WTWC 4IHSA 4HDUA 1IF1A 1YW9A 4Y13A 5CJ9A 1IUYA 3HIFA 3CJNA 2QM3A 2ELHA 2NRAC 4G8XA 4ESFA 2JPBA 3ZMTA 5FB2A 1FT9A 3QU6A 3FM5A 1FBSA 4HV6A 2VE9A 1J2XA 1WWXA 2QENA 4Y15A 2VBWA 2WTEA 1B6AA 2EFPA 1S3JA 4HF0A 3LQRA 3KZZA 4YFXF 1HKQA 1S29A 1WKMA 4S05A 3J7AO 5DD4A 2HOEA 1XSDA 5DUKA 4U7DA 1U5TB 4EVIA 2ESHA 4JBAA 3EQLF 5HDGA 3BDDA 3JSPA 1I5ZA 2D1HA 2HQNA 4UV8A 3QP6A 3TO7A 2V6CA 4XSZF 5FFZA 3F23A 1UCRA 3LA2A 1ONVA 3U9GA 1ZGAA 3JTHA 3C18A 4MQ9F 4Y17A 2IT0A 2IA2A 2RDPA 2BBYA 5CLSA 5CVRA 5BOXA 1TBXA 5IT9Z 4EQQA 3MFKA 1IN7A 3DPLC 4ZZLA 3IKTA 4ZYEA 3EYYA 3PQKA 2RV8A 1U2WA 3ROUA 1ZLKA 3I59A 1JHFA 4I09A 4R79A 5LLQA 1R1TA 1O3TA 3LAPA 3V8JA 3I0TA 5HVQC 2HTJA 2FF4A 1PP7U 4KMUX 5ICFA 2BEOA 4IJAA 4EJTA 2ZO4A 2FQ3A 2K4BA 2PN6A 1RI7A 2A07F 1I1GA 4HX4A 5L3BA 4A5MA 4P9FA 4UXNA 3HYIA 3PQJA 3OOPA 3VB2A 3FZVA 4I01A 5FLXZ 1KU3A 3F6OA 2DPDA 3G3ZA 1MZBA 3SFZA 3CLOA 2FEZA 4L9TA 3C7JA 4G7HF 2P5LC 2V9VA 4WXDA 2HDCA 1F1ZA 4FX4A 4PGGA 4LMYA 2KJBA 2STTA 3VOEA 2XGXA 3DQVC 4A2UA 2PI0A 1G4DA 3HRTA 3MWMA 5ICGA 1EV7A 2VE8A 4HF1A 3HRUA 3FXUA 3ZPLA 2NS0A 5E1XA 4KDPA 2LF8A 1B9NA 2A5YB 3MCZA 3RDIA 3WU1B 2P7CB 3MEXA 2V1XA 5F6FA 2BE5F 2K27A 2PQ8A 1YW7A 1TQIA 4G6DA 4KFCA 2G7UA 3DKWA 4PGHA 1Q1HA 5D8LB 4KMFA 2M8EA 4MTDA 1IRGA 4ZH4F 3F6VA 3J81Z 1ZLJA 3U2RA 2VBYA 2WV0A 1XGSA 1RZ4A 2ACJA 3FHZA 3F21A 2V1UA 4ENJA 2RN7A 3FMQA 4WF2A 1YG2A 4IVNA 3QPTA 2NYXA 3HHGA 2EA2A 3TGNA 1BM9A 5JI6A 3IRRA 1FSHA
chains in the Genus database with same CATH superfamily
2M0MA 4UNOA 4NBQA 1EH8A 4RGSA 4FCYA 1AHDP 4QSHA 4ESJA 4HNTA 3PFYA 3OYBA 3WTSC 4ZC3A 3SHFA 5FRMA 3HC7A 2CQNA 3GTGJ 2XKPA 5GAEJ 3GF2A 5B66C 3AG3H 2P8TA 3L7WA 3DBHB 2Q1ZB 2OD5A 3CCSI 4M9SA 4UB6C 4C3IJ 4RAZA 4OMZA 1ZG5A 1JGSA 5KCMA 1QA6A 4ITVA 2VI6A 3ERMA 4S04A 3QYBA 5AIQA 1BW6A 1QZZA 1A6IA 1WI3A 3J81K 2UWMA 3ZMUA 5ICCA 2E2IJ 2K86A 3BROA 3HHHA 3RTRA 1T33A 2LY2A 2VXZA 1PJRA 3PIOF 4BQAA 3QPSA 4EGYA 2MW8A 1D3YA 1VQ9I 4P55A 2OQGA 1YFHA 1MIJA 3R0AA 2EIJH 4S0HB 2HVSA 3FXQA 4IKFA 1SD7A 3OIPA 5DTDA 5FLXK 1FZPB 3TL4X 2YX4A 1HKSA 4BQNA 2X6OA 1YJ9I 3CCYA 4CYDA 4NQWA 2XRNA 2HZTA 2HOSA 2KIUA 2VOPA 5CPRB 5K5RA 3AAFA 3FMSA 1LVKA 1OCOH 4U0VA 1VFCA 3HPGA 4XORA 2W24A 4LLNA 4AM3A 2P6SA 1IJWC 3I3LA 1RETA 3W6VA 3GTJJ 3T8TA 3HSEA 3S15J 1QO0D 4YIFA 2QF7A 1G3SA 1VQ4I 1JUMA 1TWHJ 1OLTA 3CUQB 3QODA 4AU7A 3MZHA 3BCBA 1A31A 4M72A 1JKQC 4BE2A 1SVMA 5LD2C 3OYFA 3BTIA 2ZMEA 1ZGJA 1O7FA 3ZR8X 3LSMA 3BG6A 3E6MA 1YX5A 2DTZA 5IOZA 2FXAA 4XONA 1KU2A 3KEOA 4OAZA 4Q4ZF 1BI1A 3M1CA 1TL8A 3L09A 2XAUA 2LBFA 1MMSA 3QP5A 5C3EJ 3I53A 2EK5A 4JK1X 2BV6A 1SFKA 3D5LA 1MBEA 2FJ1A 2A6EF 1MBHA 4MFEA 4JQFA 1L0OC 5FKNA 4C3HJ 5C4XJ 1BJAA 4EJWA 1BOBA 5J4VA 1ZAOA 2P7VB 2ZFWA 1Q1VA 1GXPA 2L5QA 3H5AA 2HVRA 3HUGB 1MKMA 4XKCA 2ZCWA 2V1NA 2NVUB 2DA1A 4J19A 3KLNA 2ZJ2A 3MZ8A 3T0YA 4BEHA 2PEXA 2KT0A 2BY1A 4LFUA 4M6VA 4EGZA 1TNTA 2E19A 2XSJC 4OIQF 2VPLA 4BXXJ 3I4MJ 2W57A 2LKSA 2DT5A 1T56A 3BPVA 5J4YA 3VWBA 3HL2A 1TT5B 1YLFA 3R6SA 2JWTA 2F2EA 3L2UA 5FRNA 1EKEA 1RPWA 3OV8A 1K6YA 4M73A 3HOSA 4A93J 1AOYA 1ZH5A 3I58A 4DW6A 2PBIA 1YQAA 3CDIA 3TQNA 2PJPA 1Z91A 1HBXG 2LY9A 3CCRI 3A4CA 4M6XA 2QCOA 1U0JA 2ZXHA 2XASA 1TP4A 2GAUA 3GXOA 3OY9A 1UHWA 4HV5A 3VYUB 1IC8A 1F36A 1IN5A 3JW4A 1LFPA 2H6BA 1ETOA 2EPFA 1QBJA 2ZSIB 3I5UA 1RUOA 4HA8A 2LFBA 4YELA 4BBRJ 4CZZA 3JTGA 2J5OA 3T8RA 1T38A 3D5SC 3VODA 2MD0A 3MAJA 2E71A 4E7IA 2IGNA 3WE2A 2R7VA 2W85A 1OCRH 4OU0A 3OIOA 1SMYF 2FRHA 2DA5A 3BTCA 2UV1A 2F5CA 3VYRB 2F4IA 1R1UA 2R0QC 1ZREA 1GHCA 4JX4A 2FX0A 2J5PA 5LBQA 4MGRA 1VQLI 3OYIA 2DI3A 2XF6A 1FBQA 1FPQA 3R61A 2F48A 4NDLA 3I64A 5CVVA 2QSHX 4CXFA 3BJAA 4I99C 3JRFA 4RAFA 1V3FA 1TLHB 3GLLA 4RB1A 3DKYA 1ZYRF 5FKMA 4HSTA 4E7ZA 3DU6A 3HOYJ 1OYWA 2GOXB 1W5SA 1KA8A 1MH4A 1KGSA 1FTTA 2L02A 1XS9A 2QGUA 3S2WA 1U5TC 3OSGA 2M45A 1MJAA 2RNGA 3VPRA 1USTA 3QQAA 3CQZJ 1BN5A 5HS7A 4HAMA 2ISZA 4FX0A 4MIMA 3DV8A 1WCMJ 2ZNZA 2X48A 4A69C 5KVRA 1MBFA 3ZMDA 2Y31A 4DGWB 2DJNA 2P5KA 3G6EI 3KETA 3DP7A 3E6CC 2D5VA 4ZYHA 2DAOA 4A6EA 3PNVA 4KN7X 3E5QA 2Y69H 5DEQA 2YU9J 3DCFA 5M5YJ 2IS2A 2FBHA 4ZZDA 3SFIA 3F8BA 5LHIA 2QUFA 2TDXA 2CG4A 3FDYA 1RNLA 2JTVA 1TQPA 3DXJF 5J40A 4RGRA 1B72A 3BJ6A 5D4RA 4HYEA 1RESA 1IUFA 3V8LA 2ZXWH 5DM6F 1ZKGA 2XUBA 3BZKA 3EPZA 2EV6A 4KIFA 1MD0A 4QPQA 1YW8A 3KYCB 4F3QA 1FNNA 1MMNA 5IY5H 2VC0A 4E6KG 2NOGA 5TJJA 5HLIA 2Y9ZA 3K4MA 5F0HA 1Y56A 4XBFA 2K5CA 4IL6C 3JSOA 5K1YA 1NH3A 2V4JC 2R7DA 2WAFA 3RKWA 3ZMVA 4BH9A 4ZDOA 3S1RJ 2PLYA 3JRCA 3RQIA 3CDLA 1LFUP 3OS0A 3SQNA 2E36A 1ZGWA 3LQQA 1D5YA 1XB4A 5JHFA 3KP5A 2QZ8A 5E1WA 3CJTB 3FBNB 4DYRA 3PUFA 5KNLA 2LK2A 2GWRA 2G0EA 4LB6B 3HTSB 1ULYA 2EFOA 4HSRA 1Z9CA 3GYHX 3TO9A 4ESBA 4E7HA 2M9HA 3BG3A 3GZNB 1P2FA 4UHTA 2V79A 1BC8C 2IA1A 2DTRA 1WQ2A 1XDSA 2W82A 1XSVA 2OCEA 5TGTA 4BDZA 2MH2A 2ME6A 1VI0A 4KA4A 3S3OA 1ON1A 1Z3YA 2Y2ZA 2GM4A 2K9LA 2KHMA 2LKPA 3KZYA 3FK6A 5DV5A 3VDXA 2L9RA 4R1HA 3M9AA 1Z3XA 5E8GA 4HQEA 5C4JJ 5M5WJ 2ZB9A 3GO5A 1H9GA 1T39A 3JRIA 4Y33A 2QWWA 3ZQGA 1PDNC 3X2QH 3AG4H 3JRDA 5D4SA 4MTEA 2P0WA 1FYKA 1HKTA 1FOWA 3CO7C 4OMYA 2XV4S 4DYCA 2P4WA 1JUPA 2KISA 2A68F 2KP6A 1GVJA 4L5IA 3CMAI 1ZR2A 4L0ZB 2F5FA 3OYEA 3B02A 2EILH 4A3CJ 3U1KA 4PSWA 2MYSA 3JRAA 3BCAA 3EETA 5EEGA 3BTJA 3ZQQA 4RB0A 5J1YA 2E1MC 1TWFJ 3GFJA 3TOBA 2DFEA 2OUMA 2HGCA 4B3AA 4ZYGA 2FQ4A 3R60A 5BMZA 1JHHA 5E3NA 3MKZA 1TWAJ 2JVGA 3TOAA 4E7LA 1OFCX 4RB2C 4KJZA 4A3IJ 5IYBJ 3E6BA 3ABUA 3HXLA 2NNNA 1BI2A 3HSRA 5IT9K 1NTCA 4JX6A 4XRSA 4XK4A 2E7WA 1ZTRA 2WV1A 3W2WA 1G8XA 2VLAA 2B63J 3OR2C 2XAFA 1ETWA 2HYFA 5F04A 1HDPA 3BLYA 1RR8C 4EM1A 3SXYA 4OAYA 4LG0A 4RGUA 4L5EA 2VKDA 3IRQA 5D5XB 1IRFA 2DLLA 1U78A 2NS8A 1LJ9A 1SANA 3DF8A 3ZQLA 1J7KA 2CWEA 1I50J 3DEEA 3H0GJ 2GQQA 1H0MA 4C30A 2DDBA 5B5EC 1LDKB 3SZTA 2K40A 3FWEA 2VKVA 2MG4A 2JRMA 4EATA 3FM3A 2VT3A 1DPRA 2OC6A 2W7NA 3G73A 3G71I 1K78A 2DW4A 5FLVA 2XKOA 5CYVA 4ETSA 3FXMA 3QOPA 5HS8A 3BJOA 4M3BA 3CCLI 4A3LJ 1QVUA 3E97A 3Q0WA 1APLC 2JA8J 5HS9A 3WU2C 1R9TJ 1SAUA 4HG2A 2QEXI 3QU3A 4LB5A 3Q5FA 3CTAA 4BU2A 4AIDA 3N4MA 4NHJA 4YIIA 3OMYA 2CFOA 2E1NA 2VPRA 4BHBA 5IYDJ 3V7CA 4HDVA 3GTQJ 5BS6A 1XDUA 4RLQA 5E79C 3S1MJ 3WTYC 5L3DA 5JVGF 3BOQA 5EF6A 4F92B 3PO2J 1J5YA 4QWQA 3S2HJ 3L2WA 4AD9A 2DA4A 2R5ZB 3R4KA 1NK3P 2STWA 3G4SI 1J75A 3CMYA 3MKWB 1W0UA 4L0YB 5GTIC 5FKOA 2X4HA 1VQKI 3KP7A 1WHUA 1YRNB 4B8XA 1UMQA 3RQ4A 1XN7A 3LSKA 1T98A 3HRMA 3CC7I 2OCCH 4U88A 3F8CA 3ESWB 1XMAA 2XF7A 1LKXA 5LEKA 1V5FA 5DUIA 2E60A 1P4AA 2IGOA 3O6BB 3RPUA 2ELKA 1DP7P 1J9IA 4JP0A 4BUPA 1S8NA 2M5WA 4I98B 4V2GA 1MW7A 4L9JA 1QNTA 3CUQA 2OTJI 2CRGA 1Y6IA 3GLXA 2DQRA 3ZQCA 2R7XA 3D0SA 1D8JA 1F4KA 1MDMB 3PJRA 3HM5A 5HNHA 3SEQA 3ASNH 4PK4A 4GO1A 4PJLA 3TO6A 4ANJA 1FP2A 4HW0A 4RA2A 4G6QA 4W97A 1U9OA 2CU7A 4XLFA 1IN4A 3HEFA 2YS9A 1O4XA 2A61A 1V4RA 5CVUA 3QOEA 3QPHA 3I54A 4B48A 3LFKA 5TISC 4CICA 3IH3A 3O3KA 1MDMA 1MNEA 1NK2P 1FOYA 3PNTA 4XOPA 4U0YA 1HW2A 2ZXJA 3CP2A 1FBUA 3EDPA 2M87A 1IN8A 2C6YA 3WTUC 2COBA 3FBIB 4Q47A 4BHCA 4IRGA 1U5TA 1G59A 1JKOC 4P5OA 2HDWA 4GCVA 4YFNF 3RPUD 4NC8A 1YYVA 4RAGA 4QLCU 3C1DA 2W84A 2FE3A 3S8PA 2H1LA 3K2AA 1G6NA 1Y39A 1LEBA 1WFXA 1SC7A 2IJLA 4N4OB 2IAIA 3N97A 1QVTA 1RC9A 1WJEA 2HQRA 2WAQA 3GEZA 4AIKA 3K4KA 4BYYA 4IO9F 3OYCA 3IH4A 1IRZA 3BR6A 2RGVA 1FEXA 3WHCA 1EF4A 2LD5A 2IP2A 2GIZA 2HYJA 2QA4I 2Y48A 3AKZA 3BQZA 4AIJA 1YTYA 1SVLA 2K3PA 2Q2EA 1BIBA 2E35A 2LR8A 3BG9A 1X3UA 1XMKA 4XM3A 4MQVA 4L5JA 1MGTA 2AQFA 3CJRB 4Y4RA 3UNGC 3ZCOA 5ERIA 3CC4I 1K6OA 1HC8A 2WB1N 1FJLA 2WADA 4A6DA 3RKYA 1NG6A 4I76A 2IS4A 1R1VA 3HOZJ 1W4MA 4OIOF 3HOUJ 1MBJA 4CDGA 2VN2A 4A5NA 3SDGA 1UFMA 3OYKA 1KYWA 1XD7A 5E3MA 2ZXIA 4DNCA 3BPXA 1QPIA 1UAAA 2PMZN 2O03A 3H9GA 4B47A 2EFWA 2DMNA 3FXLA 1KQ9A 1R7JA 2IXSA 3WGIA 4RM3A 3FXRA 2K9MA 5K7HA 3U21A 3DBLB 2JSPA 3O2PE 3LSPA 2CW8A 5LRSA 2BXYA 1XPXA 1ETYA 3J7YJ 2UUZA 4PJJA 1IW7F 2CQQA 3WG9A 4HLXA 2F5VA 2L9VA 2R7TA 1G3TA 2HOAA 2FD5A 4GFBA 4EM0B 5D6EA 4G6TB 2DOEA 3BQYA 2LSOA 5F27A 3GZ6A 3K1NA 2X6YA 3L1PA 2E34A 1Z77A 2R7FA 4LJZF 4IHYA 5ILUA 3J7AY 3ERED 1MMGA 4D7MA 1OPCA 2BVLA 3IHUA 3FMRA 3PSFA 2IGMA 4Z6YA 2H27A 3LSRA 4XRMA 4CCLA 5CVIA 2YX7A 1WI9A 3A01A 3MVPA 4FT8A 2ELJA 4H0EA 2OJED 3L00A 4QPOA 4BQQA 2OF7A 2V7FA 3E0JB 3G2BA 5FJ8J 4ZYDA 3DFGA 2MABA 3FIWA 4UVBA 5E3LA 4R8HA 3M8JA 3CO6C 1MJ9A 1MMDA 2KRFA 1IAWA 4A3GJ 2EJRA 1R36A 4RBOA 2JA2A 2WC2A 1CF7A 1F43A 1FIPA 3J80Z 1QGPA 3NAUA 4BL0B 4P96A 3ZQ7A 1OCPA 5AIPA 2Y0MA 1WJAA 2DU9A 2IEKA 4OOIA 2KFDA 2M4GA 1JE8A 1MJBA 2EFNA 3HPHA 5AONA 2LTPA 1Y1WJ 4IHTA 4I02A 1IRXA 2HVQA 4FISA 1UJ8A 3P9KA 5GP9A 1XX5A 4M3DA 1P6RA 4NUBA 3SZGA 2EV0A 5LRRA 4IPAA 2Z9OA 2GIVA 4CCJA 2JA7J 3K1PA 3JAMZ 3K69A 2NVQJ 1X1PA 4DZPA 1EJ9A 2HNHA 2KKOA 1W7PD 1ERDA 2Y30A 3QRFF 2DT7B 3BG7A 5IP9J 1D0ZA 2CW0F 2EIMH 3ABTA 2HTSA 2TRTA 3NARA 2XPVA 2V9PA 3LA3A 3ULQB 4G7ZF 4C3JJ 1S7OA 3KE2A 3FX3A 3CDHA 1Z7UA 3P9CA 4FHTA 3GWZA 2FSWA 2M34A 2F5DA 1S7AA 2JRTA 3RIRA 1HLVA 3KYLA 1QHGA 2ISYA 4ABZA 3WTXC 2K85A 3ZP5A 1NG7A 1L3LA 1T0FC 3HTUA 3ISPA 1B4AA 3VSLA 4PJ0C 2K3FA 4IQ4A 3H1CA 2CV1A 2JZYA 1ZG3A 5DCMB 4A0YA 2GXBA 2CUJA 3FKJA 2CQKA 2WBMA 3RYPA 1S6LA 4OINF 1O3RA 2H1KA 4CZCA 4XLAA 2A6TA 4OIRF 1GXQA 3KEYA 2Z99A 1W7PA 1TNSA 1KYZA 3TP0A 2E1MB 3BWGA 4ZDLA 2FNPA 2LP0A 2OZUA 2DOFA 1B8IB 3W2VA 3TKYA 1R58A 2RNJA 1CQTA 2VB6A 4BHPA 3GFMA 1YOVB 1X1CA 2PMUA 3A0BC 4I7HA 2Z5UA 1DGWY 2RKHA 2AS5F 2ME0A 3QWLA 3S1NJ 4XMYA 4IF4A 4Y52J 1FYLA 2MSYA 3CLQA 5FFXA 3ONQA 4H4KC 3F72A 2OU2A 3REOA 2GXGA 2BW3B 2R7ZJ 4NB5A 1Z6RA 1B72B 4C2UA 5D6FA 1T08B 2X85A 2KIQA 4CUGA 2CQ7A 1P92A 2LBFB 3K4BA 2WAEA 5KAIC 1W36C 1OKRA 3HGGA 3M7GA 1IN6A 2EZHA 4I0BA 3OYGA 1E3OC 3M8EA 1YX3A 2LC2A 4PCQA 4AC0A 1KZHA 3OYDA 1AU7A 4HOBA 4CCOA 2L7MP 2ICWG 1MMAA 2VJIA 4RS8A 3VSKA 3FF5A 1LQ1A 1VNDA 1CGPA 1ZARA 5A2QZ 3IP4B 3MMYB 4Z2YA 1U9NA 3S3NA 4D5FA 3EUAA 5D5UB 1I3AA 4DOZA 4M9ZA 1LPQA 3JRGA 1YS7A 2BY2A 3GTMJ 1IDZA 1V5GA 2ZC2A 1K7AA 3PFIA 1BW5A 3L2RA 4YEJA 2JQ7A 3Q9VA 1GT0C 4BACA 1JKPC 1HF0A 2WA0A 1OISA 2BY0A 2RAEA 4ASNA 4WK8F 1D1CA 1GV2A 1JTXA 5L3FA 3H3UA 2OA4A 3TMOA 1ZRDA 3V42A 2F4MB 2KRHA 3KPHA 1OQYA 2QQ9A 4LLLA 1G3WA 2G7HA 3K4CA 3MQ0A 1TWCJ 1W7PB 3BY6A 1SD4A 2XPUA 4F91B 2EZIA 1K4TA 2Z33A 2H8RA 4DZJA 3DPTA 3LAJA 2RC4A 2L4MA 1QZEA 2KZVA 1FWZA 1X19A 2LF7A 4L9VA 5DYMA 2QYOA 4MEXF 3DEUA 1P4WA 4D9JA 1Y0NA 3KP3A 3Q9SA 3BR5A 3W2AA 2NVXJ 2FOWA 1V5EA 3ABKH 2XAQA 1IXRC 2DMPA 4K2EA 3CJQB 1I6HJ 1ACIA 3V7SA 1HDDC 3BP8A 5KAFC 1SFOJ 4KICA 2CMPA 3WHBA 1POGA 1W5TA 1LB2A 2E1CA 1ZHFA 3F0CA 5DM7F 5EG0A 2M8GX 3EYIA 1LE8B 2HR3A 3G1OA 4IEJA 2MD5A 4A3FJ 2XC7A 2CUEA 1BR1A 1IZ1A 5HDNA 1GVDA 4Q48A 3LSIA 5E17F 5EG0B 1VQMI 3KZIC 2LVSA 5DD8A 4KIBA 1BI3A 2HKXA 3ABLH 3HB9A 3HKZN 1UB9A 1I27A 1ZELA 1JGGA 1D8KA 1O7LA 1JJ8C 2DYSH 4N0BA 3IKVA 2JUCA 3MD2A 1P7IA 2ZMEC 2VXDA 4O6JA 3WG7H 3SDBA 1BC7C 2QLZA 4B43A 4XICA 3JRHA 2ADUA 3MN2A 3H0DA 2XAHA 2KPMA 1YIJI 2CW7A 2YR2A 3OS2A 2MBFA 3E5UA 1R6RA 3T5XA 5BQTA 2Z1DA 2IPQX 1X3WB 2DMTA 3Q3SA 4XSXF 4N9IA 3VFZA 1LDJA 1R22A 2L7ZA 4LG0B 4X6AJ 4UUTA 1R49A 3CC2I 3HUGA 2LH9A 1DUXC 3TDZC 3M8FA 3RI4A 3LFUA 5JLWA 1ZG1A 4P9UA 3AFHA 3WTTC 4V2FA 2XROA 4LIUA 2PFBA 1U6GA 3LA7A 1K78B 1MH3A 2M3AA 2CJJA 3HJEA 2R7QA 1HSTA 1W5CC 3E7LA 2O8KA 5HLHA 2DA7A 1Z7LA 1N25A 3WU0A 4ENNA 4MNUA 1YJWI 3VEPA 2H6CA 5E8IA 4Y3OA 1BR4A 1SFXA 3N05A 5A2QK 1T0FA 2XIGA 5GPAA 4M6YA 1ETQA 2HFHA 2IRFG 3TEDA 2LKXA 1UHSA 1QRYA 4L18B 2R5YA 3JR9A 2B0LA 4RLFA 4RGXA 5HOOA 1R00A 4E7JA 2PMZA 4JYKA 4L9NA 3D1NI 1H9TA 1ZN2A 2XF5A 2G9WA 2JK3A 4CCMA 5IT3A 1UELB 2M4KA 5EZHA 4A3MJ 5EEHA 2DBBA 4C9YA 4FASD 2XGEA 3HZJA 1VQ7I 3CUQC 3E6DA 2ZJRF 4GRIA 5H20A 1TTYA 5EGOA 1IV8A 2LG4A 3ML6A 3K0LA 1OMIA 4I0AA 1IO2A 2N8GA 3BTLA 3F8NA 3CCEI 1GUUA 3MZYA 2VQLA 1ODDA 3RKXA 2AXTC 2JJ7A 3WTVC 2W48A 4UB8C 4GYIA 2FBIA 4M3EA 1X4PA 3WTZA 3IV5A 1H89C 2RQQA 2GA2A 5H6QA 1JT6A 4EEFG 5DS9A 1G2HA 2LRDA 2EIKH 2VONA 1YHQI 2R93J 4XRFA 2R7UA 3H92A 1PVEA 5DDGA 2Y75A 3MKLA 3DU5A 3RYRA 1SFEA 1RUNA 1FP1D 2WB1A 2FA5A 5F0FA 2X6XA 4YG2F 1J59A 1IXSB 1DU0A 3PNYA 3R0JA 4EMSA 2BOLA 4Q5SF 3IWFA 3IWZA 4IOCF 1OR7A 4UUSB 5CVJA 1ZQ3P 1G3YA 3NRVA 4F55A 1BL0A 4XNFA 4NC6A 3ZGKA 3ECOA 2QQBA 1PUEE 1FY7A 3ABMH 4KN4X 2EB7A 4AVPA 1T95A 2DN0A 1R5ID 2PJRB 1R71A 4Y7NJ 3WGGA 3DWLE 4QIWN 1TT0A 2A3SA 2QVOA 1D1BA 4PZJA 4UVAA 3HG9A 3Q0UA 1SD5A 2JPCA 1DU6A 3LWFA 5FD5A 1S7EA 5LGUA 3OIQA 2ZJPF 1WH7A 5JLXA 6PAXA 3EUHA 4MEYF 3CF2A 3GUDA 1R4NB 2XGCA 1NHAA 2VODA 2X51A 1ETXA 2Z16A 3JAMK 2ECCA 1I3QJ 4UVCA 2FNAA 2ZMEB 3E5XA 3P9IA 2DFIA 4HQMA 3BC8A 2VT2A 3FXOA 3BR0A 4RAYA 4XLHA 4A12A 5HDKA 2XRLA 1WJ5A 1R4MB 1DDNA 3ZQHA 2NAZA 4XR6A 3LSTA 1YE9A 3CUOA 2VC1A 3ZQIA 4BXFA 3B73A 2K9SA 1YRNA 2DFFA 2VQCA 1WSUA 4LK0F 2EBIA 3I71A 5FD6A 2XB0X 1ITYA 1OCCH 3H5RA 1U8RA 2YU3A 4NNJA 4BY1J 1RR7A 1SFUA 2PJRA 3KP4A 5CKTA 3P7NA 1I1SA 1VZ0A 3BZ6A 3AL0B 4NQWB 1E2XA 1VQ8I 1FLIA 1QPMA 4CHUA 2AXLA 2Y9YA 2F6CA 3DBRB 2LDUA 2MC4A 2DOAA 3V4GA 5J1UA 3GTKJ 1UG2A 1XTAA 4MFDA 3W3CA 2DO7A 5L3GA 4LGWA 2DA2A 2W1OA 3F8MA 2EH3A 3BT9A 3NQOA 1X3ZB 4HX8A 3QYEA 4HBLA 4AUXA 4YIRX 4U7BA 5K7FA 1D0XA 4XOTA 3F3XA 1GDTA 2IW5A 3L9FA 4IOAF 1B9MA 4DQ2A 1LE8A 1PUFB 4P1WA 5ILSA 1H88C 1VF9A 2DK5A 4DYQA 1UZCA 2KDOA 4E7KA 2YUSA 4C2MJ 2WWYA 5H6RA 3DTIA 4EV0A 2W00A 1HQCA 4II2A 4HLYA 4EM2A 2X0LA 5L3EA 4E4HA 2NNYA 3V8KA 3E3VA 4CCKA 2BHZA 2FMYA 1I6XA 1SMTA 1E0EA 1RKWA 3H3ZA 3K9TA 3WE3A 3ZMSA 2QBYB 1FC3A 1GV5A 2O3FA 3C3WA 3LMMA 4W1UA 5D8KB 1X1AA 3FISA 1ON2A 3FK7A 3KCCA 3O8HA 4J01A 1P9QC 3V7RA 4ZTFA 4B3XA 2R3SA 2VOOA 4KITB 1X2MA 4HEA2 4XKBA 2KLOA 3QPLA 5JR3A 2YSRA 3K4JA 2QSFX 2K9QA 4BE0A 4M3GA 1M1EB 2R7OA 3J80K 5LEJA 1LEAA 4IRHA 4TV7A 1XGOA 4IRIA 1KONA 3K4LA 2A6HF 5E18F 3OYHA 1BR2A 3GMEA 4BDYA 4XLNF 1K79A 2M2EA 4RB3C 2W4SA 1E3PA 2Z3YA 3A2KA 3DLLF 2EQRA 2O6GE 5LHGA 3NWSA 1KQ0A 1PUFA 4KT5C 3W6JB 2OPTA 4PJNA 1XGNA 2GZWA 3G1MA 5ILVA 2DK8A 4G7OF 2M7BA 1HW5A 2HWVA 4IXAA 4BS9A 1I39A 2H94A 2M0CA 5F0CA 4BAYA 2HPMA 3S16J 5D5VB 1O57A 2FU4A 4JX5A 1N78A 2JT1A 1T2KA 1YS6A 2XSDC 1N77A 5J1RA 3GFLA 3A01B 5IP7J 1GLNA 3I55I 2ZFUA 4DJAA 1FX7A 5E1ZB 1O3QA 3K6GA 3QYFA 1TZLA 5F64A 2M7AA 1FYMA 1B1BA 3A02A 3HRSA 3FKIJ 3WGHA 2FBKA 3KP2A 1RIOH 4B1RA 2GXAA 2DQLA 1UHMA 2IA0A 3I56I 1RRJA 1B59A 2VL8A 1Y1VJ 2HEOA 1TQMA 1VQ5I 3GTLJ 3Q0VA 3I4PA 4MHGA 4BNCA 1B8IA 4OIPF 3FHNA 2HQAA 2GBYA 4BBSJ 4KISA 3OR1C 3M1EA 1REPC 3TDUC 2VIXA 2CQXA 4G9YA 1IXCA 4D7NA 1XG1A 5JFRA 2V1DA 2H8WA 5B1BH 4LITA 1LNWA 1MBKA 3COAC 3C2GA 2KL4A 4M74A 2PMHA 2WY8Q 3OL4A 1EH6A 2BGCA 1HXDA 2JA5J 3ZMZA 2HYGD 3D5RC 5B1AH 4AIHA 4WCGA 4KIGA 1ZRFA 4PFOA 1OR7C 2X1EA 5J8CA 3IL2A 1K83J 1AWCA 2RQPA 3ZOBA 5GAGJ 3L2QA 3JRBA 4CSWA 2ETHA 2AHQA 2HZDA 3VYTB 2LLKA 1KU9A 2NOJB 1E17A 2E7XA 3OL3A 2RVCA 3GTPJ 1ETVA 4FE4A 3I4NJ 3RZDJ 1S5LC 1XCBA 3GVAA 2XHKA 3F8FA 1W36D 4AYBN 1H8AC 3O8GA 2CSOA 4A3EJ 3DTEA 3BZCA 1ZRCA 1BBYA 3L2CA 3GX4X 2Y0SA 4BJ5C 5IYCJ 2KIFA 2HDDA 2BYVE 5JVTA 4FTHA 4KYWA 3IC7A 4CGZA 4D1QA 2L01A 1F5TA 2V6EA 3M3YJ 1V54H 2DT6A 2XPWA 4E70A 3RPQA 1DQUA 1Y8QB 1R5GA 1HCRA 2HKOA 5BPDA 1DP3A 3M4OJ 5FKKA 1OYIA 2L54A 1HSJA 1EA3A 1C0WA 3CCQI 5M3FJ 1D0YA 2OBPA 2DXIA 1XCVA 2XAGA 3CESA 2R7SA 1EH7A 2EFQA 1FSEA 2O61A 4XL9A 4LLGF 1U3EM 3S1QJ 5CQGA 4BXUA 2DJIA 3H9QA 1FTZA 1J0RA 3ZRGA 1RKTA 1QZYA 2QKLB 5EGOB 1UG0A 2QQAA 5LGNA 2KRCA 3HGYA 2ZJQF 2LNBA 4O5VA 3SJMA 4HX7A 2ZSHB 2CV2A 2DMUA 2P5VA 2X9DA 4FE7A 4LIVA 1BJZA 2R92J 1E3HA 4HF2A 3AG1H 1WRJA 2UZKA 1CF7B 2PX9A 2Q8KA 3E1SA 5LFAA 1K61A 2VQHA 4WXHA 4ENMA 1N75A 4CO8A 1SAXA 2R4GA 4FQGA 2DPUA 1KQ8A 1JT0A 3PIPF 3U1DA 5ED4A 2VJ4A 2A5WA 4LK1F 2UXNA 3GZ5A 4B09A 5LGTA 1AKHB 1XGMA 2HS5A 4A3BJ 1TW3A 3GBGA 1ENHA 3KP6A 5HLGA 3K1MA 4AVZA 3CCJI 4GGGA 2DA3A 4ZYAA 2MA3A 2X1DA 2JN6A 5HODA 2OV7A 3H5NA 3HSFA 2DODA 2VBZA 2ZBKA 2O8XA 4BJ6C 3KFWX 2IS6A 2PG4A 3K4NA 4X1EA 1YIOA 1R23A 4F7ZA 4O3MA 1YO5C 2ID6A 2MGQA 2M1BA 2NS7A 9ANTA 3K70D 2KDZA 4IQJA 1YITI 2CYYA 3ZQFA 4I2OA 1P4XA 1Z0XA 2CO5A 2VBXA 4D0PA 4EJVA 4ZTJA 2AO9A 2FOKA 1Z1DA 1MNMC 1VQPI 2HXIA 2K4JA 1LVAA 5FO5A 1T6SA 2CS3A 4UV9A 3RJPA 3S17J 2FMLA 2IGKA 2KJCA 2EV5A 2LYCA 5J3LA 4DBRA 2R5ZA 1OCTC 3WODF 1SEUA 2D1VA 3DKXA 4GXOA 4XLEA 4ZJZA 3T1BA 4XLPF 1USSA 4U87A 2LREA 2O7OA 2NVTJ 4YFKF 2MLKA 3W6KB 4EJUA 2M30A 5K7ZA 3F22A 5LHHA 1Z6TA 4UUVA 1O3SA 4NC7A 5D5WB 1MSFC 5L3CA 4A3DJ 2EINH 2MLGA 4PDKA 3DEWA 3OOUA 2MFZA 1BOAA 1WVRA 1D1AA 1WZ2A 1LFBA 2W25A 5F08A 5JHUA 2V9KA 4EJOA 3LSHA 2BZTA 5BPIA 2MH9A 2D45A 4HPQA 1AKHA 1OYYA 4XN0A 2CGPA 2COMA 2ID3A 2QKMB 2KIMA 3OYAA 5TRDA 3RZOJ 1YJNI 2EA4A 3ELKA 3HBLA 2D2WA 1IV6A 4BEHB 5K5OA 3CZ6A 2BXZA 5J6XA 2K9NA 1OJLA 3PM1A 2L0KA 2QBYA 3ECHA 2MC3A 3QAHA 2Q0OA 3LSGA 4KUMA 4FETA 4E7SA 1QQIA 3K7AJ 3K70C 1TW2A 3GTOJ 4M9XA 3ZN1A 5HLTA 3C2HA 2HI3A 1A6QA 3GW2A 5E20A 1R5HA 2BY3A 4LOCA 4I6ZA 1Z05A 5FGMA 1F9NA 4CA0A 2HXOA 5GAHJ 3CCUI 2YPRA 5CQEA 3OYLA 1A36A 2BW3A 3M07A 3AG2H 2O5RA 4LD5A 4IHWA 4N9HA 1BIAA 2I8DA 2HOTA 1FMWA 4MO7A 3K2ZA 1A04A 2LMDA 4WX9A 2XAJA 1WJBA 1MBGA 5EZGA 5FROA 3B6CA 2ZNYA 5F1RA 2EWNA 1SD6A 5KK1A 3IUOA 2JSCA 1KU7A 4WWCA 2OZ6A 3KIOA 2JA6J 1ORKA 3A03A 1BI0A 2CFXA 2K7LA 4XRSG 2OAZA 2E2HJ 1FMVA 4A0XA 4GYGA 1OCZH 3EUKL 1WPKA 2IVMA 2Z2SB 1WJCA 3SZPA 2XVCA 4HZFA 2O0YA 4WXCA 3I59B 4CYCB 4CH7A 3CCMI 3HDDA 1LDDA 4BQOA 2P81A 4RM2A 2R5YB 2K02A 2XB5A 2XDVA 4KNYA 3IH2A 1X2NA 2BHYA 4C2TA 2GA1A 4G94A 4AWXB 4A0ZA 1SVOA 2A69F 1HOMA 4ON0A 1FOKA 4BE1A 2OQRA 2ZKZA 5ICEA 3HOTA 4RMNA 3S2DJ 5EJCA 4U0WA 2GLOA 2L4AA 3KLOA 1K4SA 5K5QA 5DCFA 2E1OA 3OS1A 4YRVA 3NWTA 5BNGA 3KEQA 2VUMJ 2F5EA 3NEUA 1JXSA 1STZA 5F1JA 1XSXA 3ZN0A 1LUJB 4HNUA 1PP8F 5DCMA 2L2OA 1WH5A 2L3DA 2UXXA 3DTKA 1D5VA 1AA7A 2P6TA 3OYJA 2ESNA 5KHDA 2KMUA 1DPUA 4ENKA 1S9HA 2NVYJ 2WAQN 2H09A 3S3MA 2DFHA 3CF5F 3FXKA 3OYMA 4M71A 1HW1A 1VTNC 2E2JJ 2DMQA 3PO3J 3GFIA 1Y0UA 3OWTA 1VQ6I 2DDAA 3BG5A 5FLMJ 5J8FA 3WTWC 3P5JA 1Y8RB 1MNDA 4HDUA 1IF1A 4IHSA 1YW9A 4Y13A 3DLAA 4B44A 4CCNA 5HNFA 3CCVI 3PSIA 1JJ6C 3LSJA 5CJ9A 5GPCA 1QHHD 1IUYA 2CUFA 3VYSB 3HIFA 5IPAA 3CJNA 3HKZA 2QM3A 2ELHA 5J47A 2NRAC 4G8XA 4ESFA 2JPBA 4OWRB 2OTLI 2CUZA 3ZMTA 2FUG2 4M3FA 5FB2A 1FT9A 2NXNB 3F9KA 4XKWA 4BKXA 3QU6A 3S14J 3FM5A 1FBSA 2VJJA 1S72I 4HV6A 2VE9A 1J2XA 1WWXA 2QENA 4Y15A 3H35A 2VBWA 4KT6A 3RCOA 4IHXA 1V55H 2WTEA 1B6AA 3A0HC 2EFPA 1S3JA 4HF0A 2F4OB 2B7EA 5C44J 3LQRA 1VQNI 3KZZA 1YI2I 1Z21A 4YFXF 1HKQA 1S29A 1WKMA 3I9V2 4AYBA 4S05A 3J7AO 5DD4A 2HOEA 1X4OA 1XSDA 5DUKA 2V26A 4U7DA 2VJ5A 5E3OA 1U5TB 5IOYA 2B9SA 4EVIA 2ESHA 4JBAA 2R7RA 3EQLF 5HDGA 3ASOH 3BDDA 3FXJA 3TW7A 3JSPA 1A35A 1I5ZA 2D1HA 3SEZA 2HQNA 3J7ZI 4HNVA 4UV8A 1PYVA 3S93A 3QP6A 3RKQA 3TO7A 2V6CA 4XSZF 2E5NA 3PUBA 4BGDA 5FFZA 2KQRA 3BR2A 2Y0SN 1JTYA 1ZR4A 1X58A 1UCRA 3F23A 3BR3A 3LA2A 1ONVA 3U9GA 3H3VK 1IGNA 1ZGAA 2JMWA 2EZKA 3JTHA 3C18A 4MQ9F 4QTRA 4RDUA 4UY8I 5EEAA 4Y17A 2IT0A 3PL8A 2IA2A 2RDPA 3LNQA 3LOCA 1FOXA 1W1WE 2BBYA 4BY7J 3CP8A 4PSXA 2XGDA 5CLSA 3L2VA 5CVRA 5BOXA 2WY7Q 1QU3A 1TBXA 3CD6I 5IT9Z 4ZDPA 4EQQA 3MFKA 1IN7A 3DPLC 5EYRA 4ZZLA 4ZYEA 5EDNA 3IKTA 3EYYA 1XC5A 2BVMA 5M5XJ 3PQKA 3UR3C 2RV8A 4IZZA 3HOVJ 1U2WA 3ROUA 1ZLKA 3I59A 1JHFA 4I09A 4CYCA 4R79A 5LLQA 1R1TA 1O3TA 3LAPA 2CH0A 3DPUA 2L7FP 3V8JA 3I0TA 5HVQC 4A3KJ 3OYNA 1WJFA 2HTJA 2FF4A 3SYTA 4PJMA 1PP7U 4KMUX 1IG7A 1Z67A 5ICFA 4II3A 4UUSA 2BEOA 2EZLA 3JCUC 4IJAA 4EJTA 3CMEI 2ZO4A 2FQ3A 2K4BA 5FKLA 3RSNA 1U8BA 2PN6A 2VQGA 1RI7A 3EUHC 1I1GA 2A07F 4HX4A 1X1BA 5L3BA 4A5MA 4P9FA 3KYDB 2JVHA 4DBQA 2DA6A 3IAS2 1BA5A 4F52A 4UXNA 3HYIA 3LL7A 2DYRH 1DGRM 3OOPA 3PQJA 1TC3C 2IBDA 3VB2A 3FZVA 2A05A 1A5JA 4I01A 5FLXZ 1KU3A 3F6OA 2DPDA 2AQEA 1JUSA 2E5ZA 4MLOA 2KZGA 1X1DA 2Q2EB 3G3ZA 1IDYA 1ETKA 1MZBA 3SFZA 3TW6A 3CLOA 2LOOA 2FEZA 2L7KA 3B6AA 3C7JA 4L9TA 1JI8A 4G7HF 3G1LA 2P5LC 2V9VA 2QSGX 4WXDA 4XIDA 2HDCA 1F1ZA 4FX4A 2I5UA 1W0TA 4PGGA 1J09A 5B3SH 1MSEC 4LMYA 2KJBA 2STTA 4V19K 3VOEA 2XGXA 3DQVC 1T8IA 4A2UA 2PI0A 2QQ8A 3KX2A 2VKEA 2TCTA 4D5CA 1G4DA 2VASA 3HRTA 2L9SA 3MWMA 5GTHC 3HOWJ 2HPIA 3IAM2 4XLCA 1FIAA 5ICGA 1EV7A 2HQ5A 3UKGA 1XMXA 1WJDA 2VE8A 3MKYB 3HOXJ 2O9LA 1TWGJ 2HU9A 4HF1A 4IX7A 3HRUA 3A1YA 3H9JA 3FXUA 3ZPLA 2NS0A 5E1XA 3TP3A 4PFPA 4KDPA 2LF8A 1B9NA 2A5YB 3MCZA 3RDIA 4F93B 3WU1B 2ECBA 4G12A 3S32A 2P7CB 3MEXA 2X1CA 1P7JA 2V1XA 5F6FA 4PUSA 2BE5F 2VKHA 2K27A 2PQ8A 1YW7A 1TQIA 4G6DA 4KFCA 2G7UA 2GOMA 3DKWA 4PGHA 4XKVA 2R7WA 2X6WA 1Q1HA 3K10A 3AL0C 4XN3A 5IP6A 3OSFA 5D8LB 4KMFA 4DIQA 1JKRC 2M8EA 4MTDA 1IRGA 4ZH4F 3F6VA 4B4CA 3J81Z 3JREA 1ZLJA 3U2RA 2VBYA 4HRIA 2WV0A 3BR1A 1XGSA 1RZ4A 2ACJA 1HA8A 2JUGA 3C2BA 3H36A 4LG3A 3TBIA 3FHZA 3F21A 4XQFA 2V1UA 2IS1A 2DCEA 4ENJA 2RN7A 3FMQA 4WF2A 4BJTA 4GDFA 1WGXA 4JOMA 3GCMA 4X0GA 2LY1A 2RREA 5H2FC 1YG2A 5M3MJ 4IVNA 5GADJ 3CMMA 4N4NB 2I10A 4IHVA 1ZK8A 3QPTA 2NYXA 3HHGA 2CV0A 4J00A 2EA2A 3TGNA 1BM9A 3ZXSA 4A3JJ 2L9NA 5JI6A 3IRRA 1FSHA 1VQOI
chains in the Genus database with same CATH topology
4UNOA 1EH8A 4RGSA 4ESJA 3WTSC 3SHFA 2XKPA 3GF2A 2P8TA 3L7WA 2OD5A 4M9SA 4RAZA 4OMZA 1ZG5A 1JGSA 4S04A 5AIQA 1QZZA 3J81K 2UWMA 3ZMUA 5ICCA 2K86A 3BROA 3HHHA 3RTRA 2VXZA 4BQAA 4EGYA 1D3YA 4P55A 2OQGA 1YFHA 3R0AA 3FXQA 1SD7A 5FLXK 1FZPB 2YX4A 1HKSA 4CYDA 4NQWA 2XRNA 2HZTA 2KIUA 2VOPA 5K5RA 3AAFA 3FMSA 4U0VA 2W24A 4LLNA 2P6SA 3T8TA 3HSEA 1QO0D 4YIFA 1G3SA 3CUQB 3MZHA 4M72A 2ZMEA 1ZGJA 1O7FA 3E6MA 2FXAA 1KU2A 3KEOA 4Q4ZF 1BI1A 3L09A 3QP5A 3I53A 2EK5A 4JK1X 2BV6A 3D5LA 2A6EF 4JQFA 1L0OC 1BJAA 4EJWA 1ZAOA 2P7VB 2ZFWA 1GXPA 1MKMA 2ZCWA 3KLNA 2ZJ2A 3T0YA 2PEXA 4LFUA 4EGZA 1TNTA 4OIQF 2W57A 3BPVA 2DT5A 1YLFA 3R6SA 2F2EA 3OV8A 4M73A 3HOSA 1AOYA 1ZH5A 3I58A 2PBIA 1YQAA 3TQNA 2PJPA 1Z91A 1HBXG 4M6XA 2XASA 2GAUA 3GXOA 1UHWA 4HV5A 1IN5A 3JW4A 2H6BA 1QBJA 3I5UA 1RUOA 4HA8A 4CZZA 3JTGA 2J5OA 3T8RA 1T38A 3VODA 3MAJA 3WE2A 2W85A 4OU0A 1SMYF 2FRHA 2F5CA 1R1UA 1ZREA 1GHCA 2J5PA 5LBQA 4MGRA 2DI3A 1FBQA 1FPQA 3R61A 3I64A 5CVVA 4CXFA 3BJAA 1V3FA 1TLHB 4RB1A 1ZYRF 1OYWA 1W5SA 1KA8A 1KGSA 2L02A 3S2WA 1U5TC 2M45A 1MJAA 1USTA 1BN5A 5HS7A 4HAMA 2ISZA 4FX0A 3DV8A 2ZNZA 5KVRA 3ZMDA 2P5KA 3KETA 3DP7A 3E6CC 4ZYHA 2DAOA 4A6EA 4KN7X 3E5QA 5DEQA 2FBHA 4ZZDA 3F8BA 5LHIA 2QUFA 2TDXA 2CG4A 1RNLA 2JTVA 1TQPA 3DXJF 4RGRA 3BJ6A 5D4RA 4HYEA 3V8LA 2XUBA 2EV6A 4KIFA 1MD0A 1YW8A 1FNNA 2VC0A 5TJJA 5HLIA 4XBFA 3JSOA 5K1YA 2R7DA 3RKWA 3ZMVA 4BH9A 2PLYA 3SQNA 3LQQA 1XB4A 3KP5A 2QZ8A 5E1WA 2GWRA 3HTSB 4LB6B 1ULYA 2EFOA 1Z9CA 3GYHX 3TO9A 4ESBA 1P2FA 4UHTA 2V79A 1BC8C 2IA1A 2DTRA 1WQ2A 1XDSA 1XSVA 2MH2A 4KA4A 1ON1A 2LKPA 3KZYA 5DV5A 4R1HA 3M9AA 5E8GA 4HQEA 3GO5A 1H9GA 1T39A 2QWWA 1PDNC 5D4SA 4MTEA 1HKTA 1FYKA 3CO7C 4OMYA 2XV4S 2P4WA 2A68F 4L5IA 1GVJA 4L0ZB 2F5FA 3B02A 3EETA 5EEGA 4RB0A 3GFJA 3TOBA 2HGCA 4ZYGA 3R60A 5BMZA 1JHHA 3TOAA 4RB2C 3E6BA 3ABUA 2NNNA 1BI2A 3HSRA 5IT9K 2E7WA 2XAFA 2HYFA 4EM1A 3SXYA 4LG0A 4RGUA 3IRQA 5D5XB 1IRFA 2DLLA 1U78A 1LJ9A 3DF8A 1J7KA 2CWEA 2GQQA 1H0MA 1LDKB 3SZTA 3FWEA 3G73A 3FM3A 2VT3A 1DPRA 1K78A 2DW4A 2XKOA 5CYVA 4ETSA 3QOPA 5HS8A 3BJOA 3E97A 5HS9A 4LB5A 3QU3A 3Q5FA 3CTAA 3N4MA 4NHJA 4YIIA 2E1NA 4BHBA 3V7CA 4HDVA 5BS6A 1XDUA 3WTYC 5L3DA 3BOQA 1J5YA 4QWQA 4AD9A 2STWA 3R4KA 1J75A 4L0YB 2X4HA 3KP7A 4B8XA 1XN7A 1T98A 3HRMA 4U88A 3F8CA 1XMAA 5LEKA 5DUIA 1P4AA 3O6BB 3RPUA 1DP7P 1J9IA 1S8NA 2M5WA 4I98B 4L9JA 1QNTA 3CUQA 3GLXA 2DQRA 3D0SA 1D8JA 1F4KA 1MDMB 4GO1A 3TO6A 1FP2A 4HW0A 4G6QA 1IN4A 2A61A 1V4RA 5CVUA 3QPHA 3I54A 3LFKA 4CICA 3O3KA 1MDMA 4U0YA 1HW2A 2ZXJA 1FBUA 3EDPA 2M87A 1IN8A 2C6YA 3WTUC 4Q47A 4BHCA 4IRGA 1U5TA 4P5OA 4GCVA 4YFNF 1YYVA 4QLCU 3C1DA 2W84A 2FE3A 1G6NA 1LEBA 2IJLA 3N97A 3GEZA 2HQRA 4AIKA 4BYYA 2RGVA 2IP2A 2Y48A 4AIJA 1YTYA 2Q2EA 1BIBA 1X3UA 1XMKA 4MQVA 4L5JA 1MGTA 5ERIA 1K6OA 4A6DA 3RKYA 1R1VA 1W4MA 4OIOF 4CDGA 2VN2A 4A5NA 1UFMA 1KYWA 1XD7A 4DNCA 3BPXA 2O03A 2EFWA 1KQ9A 1R7JA 3WGIA 3FXRA 3O2PE 5LRSA 1IW7F 3WG9A 4HLXA 1G3TA 4EM0B 5D6EA 3GZ6A 2LSOA 3K1NA 2R7FA 4LJZF 5ILUA 3ERED 1OPCA 3IHUA 3FMRA 2H27A 5CVIA 2YX7A 1WI9A 4FT8A 4H0EA 3L00A 4ZYDA 3DFGA 4UVBA 4R8HA 3CO6C 1MJ9A 2KRFA 1IAWA 2EJRA 1R36A 2WC2A 1CF7A 3J80Z 1QGPA 4P96A 3ZQ7A 5AIPA 2Y0MA 2DU9A 4OOIA 1JE8A 1MJBA 2EFNA 5AONA 4IHTA 4I02A 3P9KA 1P6RA 2EV0A 5LRRA 4IPAA 2Z9OA 2GIVA 3K1PA 3JAMZ 3K69A 2KKOA 1W7PD 3QRFF 2CW0F 3ABTA 2HTSA 3LA3A 3ULQB 4G7ZF 1S7OA 3KE2A 3FX3A 3CDHA 1Z7UA 3P9CA 4FHTA 3GWZA 2FSWA 2F5DA 1S7AA 2JRTA 3RIRA 2ISYA 3WTXC 3ZP5A 1L3LA 3HTUA 3ISPA 1B4AA 2JZYA 1ZG3A 5DCMB 4A0YA 2GXBA 2CQKA 3RYPA 1S6LA 4OINF 1O3RA 4OIRF 1GXQA 2Z99A 1W7PA 1TNSA 1KYZA 3BWGA 2FNPA 2OZUA 3TKYA 1R58A 2RNJA 4BHPA 3GFMA 2PMUA 4I7HA 2Z5UA 2RKHA 2AS5F 4IF4A 1FYLA 5FFXA 3F72A 2OU2A 3REOA 2GXGA 4NB5A 1Z6RA 5D6FA 1P92A 1OKRA 3M7GA 1IN6A 4I0BA 3M8EA 4PCQA 4HOBA 4RS8A 3FF5A 1LQ1A 1CGPA 1ZARA 5A2QZ 4Z2YA 5D5UB 4M9ZA 1YS7A 1K7AA 3PFIA 3Q9VA 4ASNA 4WK8F 5L3FA 3H3UA 2OA4A 1ZRDA 2QQ9A 4LLLA 1G3WA 2G7HA 3MQ0A 1W7PB 3BY6A 1SD4A 2Z33A 3LAJA 3DPTA 2L4MA 2RC4A 1FWZA 2LF7A 4L9VA 5DYMA 2QYOA 4MEXF 3DEUA 1P4WA 3KP3A 3Q9SA 2XAQA 1IXRC 4K2EA 3V7SA 3BP8A 4KICA 1W5TA 1LB2A 2E1CA 1ZHFA 3EYIA 2HR3A 2MD5A 5HDNA 1IZ1A 4Q48A 5E17F 5DD8A 4KIBA 1BI3A 2HKXA 1UB9A 1I27A 1D8KA 1O7LA 4N0BA 3IKVA 4O6JA 1BC7C 2QLZA 2ADUA 2XAHA 2YR2A 2MBFA 3E5UA 3T5XA 5BQTA 2IPQX 4XSXF 4N9IA 3VFZA 1LDJA 1R22A 4LG0B 3HUGA 1DUXC 3TDZC 3M8FA 3RI4A 1ZG1A 4P9UA 3WTTC 2XROA 2PFBA 1U6GA 3LA7A 1K78B 1HSTA 5HLHA 3WU0A 4ENNA 4MNUA 3VEPA 2H6CA 5E8IA 1SFXA 5A2QK 1T0FA 2XIGA 4M6YA 2HFHA 2IRFG 4L18B 2B0LA 5HOOA 4RGXA 1R00A 4L9NA 1H9TA 1ZN2A 2G9WA 5IT3A 5EEHA 2DBBA 3CUQC 3E6DA 5H20A 1TTYA 3ML6A 3K0LA 1OMIA 4I0AA 3F8NA 3MZYA 1ODDA 3RKXA 3WTVC 4GYIA 2FBIA 3WTZA 2GA2A 5H6QA 2VONA 4XRFA 3H92A 5DDGA 2Y75A 3RYRA 1SFEA 1RUNA 1FP1D 2FA5A 1J59A 4YG2F 1IXSB 3R0JA 4EMSA 4Q5SF 3IWFA 3IWZA 1OR7A 5CVJA 1G3YA 3NRVA 3ECOA 2QQBA 1PUEE 1FY7A 4KN4X 2EB7A 4AVPA 3WGGA 2A3SA 2QVOA 4PZJA 4UVAA 1SD5A 2JPCA 3LWFA 5FD5A 5LGUA 6PAXA 3EUHA 4MEYF 3GUDA 1NHAA 2VODA 3JAMK 4UVCA 2FNAA 2ZMEB 3E5XA 3P9IA 2DFIA 4HQMA 2VT2A 4RAYA 4A12A 5HDKA 1DDNA 2NAZA 3LSTA 3CUOA 2VC1A 3B73A 1WSUA 4LK0F 3I71A 5FD6A 1U8RA 2YU3A 1SFUA 3KP4A 3P7NA 1I1SA 3BZ6A 1E2XA 1FLIA 1QPMA 4CHUA 2AXLA 2LDUA 3V4GA 2DO7A 5L3GA 4LGWA 3F8MA 3NQOA 4HX8A 4HBLA 4U7BA 3F3XA 2IW5A 3L9FA 1B9MA 4DQ2A 5ILSA 2DK5A 2WWYA 5H6RA 4EV0A 1HQCA 4HLYA 4EM2A 2X0LA 5L3EA 2NNYA 3V8KA 3E3VA 2FMYA 1I6XA 1SMTA 3H3ZA 3K9TA 3WE3A 3ZMSA 2QBYB 1FC3A 2O3FA 3C3WA 5D8KB 1ON2A 3KCCA 3V7RA 2VOOA 2R3SA 5JR3A 2YSRA 3J80K 5LEJA 1LEAA 4IRHA 4TV7A 1XGOA 4IRIA 2A6HF 5E18F 4XLNF 1K79A 4RB3C 2Z3YA 2O6GE 5LHGA 1KQ0A 4KT5C 3W6JB 1XGNA 2GZWA 5ILVA 2DK8A 4G7OF 1HW5A 2HWVA 4IXAA 2H94A 4BAYA 5D5VB 1O57A 2FU4A 2JT1A 1T2KA 1YS6A 3GFLA 1FX7A 5E1ZB 1O3QA 5F64A 1FYMA 1B1BA 3WGHA 3HRSA 1RIOH 2FBKA 3KP2A 2DQLA 1UHMA 2IA0A 1B59A 2HEOA 1TQMA 3I4PA 4MHGA 4OIPF 4BNCA 3M1EA 1REPC 3TDUC 4G9YA 1IXCA 5JFRA 2V1DA 1LNWA 3COAC 4M74A 2PMHA 1EH6A 2BGCA 1HXDA 3ZMZA 2HYGD 4AIHA 4WCGA 4KIGA 1ZRFA 3IL2A 5J8CA 1AWCA 2RQPA 2ETHA 1KU9A 1E17A 2E7XA 2RVCA 1XCBA 3GVAA 2XHKA 3F8FA 2CSOA 1ZRCA 1BBYA 3L2CA 3GX4X 2KIFA 2BYVE 5JVTA 4KYWA 3IC7A 4CGZA 2L01A 1F5TA 4E70A 3RPQA 1R5GA 2HKOA 5BPDA 1OYIA 2L54A 1HSJA 1C0WA 2OBPA 1XCVA 2XAGA 1EH7A 2EFQA 1FSEA 2O61A 4LLGF 1U3EM 4BXUA 1J0RA 1QZYA 2QQAA 5LGNA 2LNBA 4O5VA 4HX7A 2P5VA 4HF2A 1WRJA 2UZKA 1CF7B 2Q8KA 4WXHA 4ENMA 2DPUA 4CO8A 1SAXA 1KQ8A 3U1DA 5ED4A 4LK1F 2UXNA 3GZ5A 4B09A 5LGTA 1XGMA 2HS5A 1TW3A 3KP6A 5HLGA 3K1MA 4GGGA 2MA3A 3HSFA 2VBZA 2ZBKA 2O8XA 3KFWX 2PG4A 1YIOA 1R23A 4F7ZA 4O3MA 1YO5C 2M1BA 2CYYA 4I2OA 1P4XA 4D0PA 2CO5A 2VBXA 4EJVA 1Z1DA 2FOKA 2K4JA 1LVAA 5FO5A 1T6SA 4UV9A 3RJPA 2FMLA 2KJCA 2EV5A 3WODF 2D1VA 4GXOA 3T1BA 4XLPF 1USSA 4YFKF 2MLKA 3W6KB 4EJUA 2M30A 3F22A 5LHHA 1Z6TA 4UUVA 1O3SA 5D5WB 5L3CA 2MLGA 4PDKA 1BOAA 2W25A 5JHUA 4EJOA 5BPIA 2MH9A 2D45A 1OYYA 2CGPA 2COMA 2KIMA 5TRDA 2EA4A 3ELKA 2D2WA 5K5OA 5J6XA 2QBYA 3ECHA 2MC3A 3QAHA 2Q0OA 4KUMA 1QQIA 1TW2A 4M9XA 3ZN1A 3GW2A 5E20A 1R5HA 1Z05A 5FGMA 1F9NA 2YPRA 4LD5A 4N9HA 1BIAA 3K2ZA 1A04A 4WX9A 2XAJA 2ZNYA 5F1RA 2EWNA 1SD6A 5KK1A 2JSCA 1KU7A 4WWCA 2OZ6A 1BI0A 2CFXA 2K7LA 2OAZA 4A0XA 4GYGA 2IVMA 3SZPA 2XVCA 4HZFA 2O0YA 4WXCA 3I59B 1LDDA 2K02A 4KNYA 2GA1A 4G94A 4AWXB 4A0ZA 2A69F 4ON0A 1FOKA 2OQRA 2ZKZA 5ICEA 3HOTA 4U0WA 2L4AA 3KLOA 5K5QA 5DCFA 3KEQA 1JXSA 2F5EA 3NEUA 1STZA 1XSXA 3ZN0A 1PP8F 5DCMA 2L3DA 2UXXA 1D5VA 2P6TA 2ESNA 1DPUA 4ENKA 2H09A 4M71A 1HW1A 1VTNC 3GFIA 1Y0UA 5J8FA 3WTWC 4IHSA 4HDUA 1IF1A 1YW9A 4Y13A 5CJ9A 1IUYA 3HIFA 3CJNA 2QM3A 2ELHA 2NRAC 4G8XA 4ESFA 2JPBA 3ZMTA 5FB2A 1FT9A 3QU6A 3FM5A 1FBSA 4HV6A 2VE9A 1J2XA 1WWXA 2QENA 4Y15A 2VBWA 2WTEA 1B6AA 2EFPA 1S3JA 4HF0A 3LQRA 3KZZA 4YFXF 1HKQA 1S29A 1WKMA 4S05A 3J7AO 5DD4A 2HOEA 1XSDA 5DUKA 4U7DA 1U5TB 4EVIA 2ESHA 4JBAA 3EQLF 5HDGA 3BDDA 3JSPA 1I5ZA 2D1HA 2HQNA 4UV8A 3QP6A 3TO7A 2V6CA 4XSZF 5FFZA 3F23A 1UCRA 3LA2A 1ONVA 3U9GA 1ZGAA 3JTHA 3C18A 4MQ9F 4Y17A 2IT0A 2IA2A 2RDPA 2BBYA 5CLSA 5CVRA 5BOXA 1TBXA 5IT9Z 4EQQA 3MFKA 1IN7A 3DPLC 4ZZLA 3IKTA 4ZYEA 3EYYA 3PQKA 2RV8A 1U2WA 3ROUA 1ZLKA 3I59A 1JHFA 4I09A 4R79A 5LLQA 1R1TA 1O3TA 3LAPA 3V8JA 3I0TA 5HVQC 2HTJA 2FF4A 1PP7U 4KMUX 5ICFA 2BEOA 4IJAA 4EJTA 2ZO4A 2FQ3A 2K4BA 2PN6A 1RI7A 2A07F 1I1GA 4HX4A 5L3BA 4A5MA 4P9FA 4UXNA 3HYIA 3PQJA 3OOPA 3VB2A 3FZVA 4I01A 5FLXZ 1KU3A 3F6OA 2DPDA 3G3ZA 1MZBA 3SFZA 3CLOA 2FEZA 4L9TA 3C7JA 4G7HF 2P5LC 2V9VA 4WXDA 2HDCA 1F1ZA 4FX4A 4PGGA 4LMYA 2KJBA 2STTA 3VOEA 2XGXA 3DQVC 4A2UA 2PI0A 1G4DA 3HRTA 3MWMA 5ICGA 1EV7A 2VE8A 4HF1A 3HRUA 3FXUA 3ZPLA 2NS0A 5E1XA 4KDPA 2LF8A 1B9NA 2A5YB 3MCZA 3RDIA 3WU1B 2P7CB 3MEXA 2V1XA 5F6FA 2BE5F 2K27A 2PQ8A 1YW7A 1TQIA 4G6DA 4KFCA 2G7UA 3DKWA 4PGHA 1Q1HA 5D8LB 4KMFA 2M8EA 4MTDA 1IRGA 4ZH4F 3F6VA 3J81Z 1ZLJA 3U2RA 2VBYA 2WV0A 1XGSA 1RZ4A 2ACJA 3FHZA 3F21A 2V1UA 4ENJA 2RN7A 3FMQA 4WF2A 1YG2A 4IVNA 3QPTA 2NYXA 3HHGA 2EA2A 3TGNA 1BM9A 5JI6A 3IRRA 1FSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UNO A;  1EH8 A;  4RGS A;  4ESJ A;  3WTS C;  3SHF A;  2XKP A;  3GF2 A;  2P8T A;  3L7W A;  2OD5 A;  4M9S A;  4RAZ A;  4OMZ A;  1ZG5 A;  1JGS A;  4S04 A;  5AIQ A;  1QZZ A;  3J81 K;  2UWM A;  3ZMU A;  5ICC A;  2K86 A;  3BRO A;  3HHH A;  3RTR A;  2VXZ A;  4BQA A;  4EGY A;  1D3Y A;  4P55 A;  2OQG A;  1YFH A;  3R0A A;  3FXQ A;  1SD7 A;  5FLX K;  1FZP B;  2YX4 A;  1HKS A;  4CYD A;  4NQW A;  2XRN A;  2HZT A;  2KIU A;  2VOP A;  5K5R A;  3AAF A;  3FMS A;  4U0V A;  2W24 A;  4LLN A;  2P6S A;  3T8T A;  3HSE A;  1QO0 D;  4YIF A;  1G3S A;  3CUQ B;  3MZH A;  4M72 A;  2ZME A;  1ZGJ A;  1O7F A;  3E6M A;  2FXA A;  1KU2 A;  3KEO A;  4Q4Z F;  1BI1 A;  3L09 A;  3QP5 A;  3I53 A;  2EK5 A;  4JK1 X;  2BV6 A;  3D5L A;  2A6E F;  4JQF A;  1L0O C;  1BJA A;  4EJW A;  1ZAO A;  2P7V B;  2ZFW A;  1GXP A;  1MKM A;  2ZCW A;  3KLN A;  2ZJ2 A;  3T0Y A;  2PEX A;  4LFU A;  4EGZ A;  1TNT A;  4OIQ F;  2W57 A;  3BPV A;  2DT5 A;  1YLF A;  3R6S A;  2F2E A;  3OV8 A;  4M73 A;  3HOS A;  1AOY A;  1ZH5 A;  3I58 A;  2PBI A;  1YQA A;  3TQN A;  2PJP A;  1Z91 A;  1HBX G;  4M6X A;  2XAS A;  2GAU A;  3GXO A;  1UHW A;  4HV5 A;  1IN5 A;  3JW4 A;  2H6B A;  1QBJ A;  3I5U A;  1RUO A;  4HA8 A;  4CZZ A;  3JTG A;  2J5O A;  3T8R A;  1T38 A;  3VOD A;  3MAJ A;  3WE2 A;  2W85 A;  4OU0 A;  1SMY F;  2FRH A;  2F5C A;  1R1U A;  1ZRE A;  1GHC A;  2J5P A;  5LBQ A;  4MGR A;  2DI3 A;  1FBQ A;  1FPQ A;  3R61 A;  3I64 A;  5CVV A;  4CXF A;  3BJA A;  1V3F A;  1TLH B;  4RB1 A;  1ZYR F;  1OYW A;  1W5S A;  1KA8 A;  1KGS A;  2L02 A;  3S2W A;  1U5T C;  2M45 A;  1MJA A;  1UST A;  1BN5 A;  5HS7 A;  4HAM A;  2ISZ A;  4FX0 A;  3DV8 A;  2ZNZ A;  5KVR A;  3ZMD A;  2P5K A;  3KET A;  3DP7 A;  3E6C C;  4ZYH A;  2DAO A;  4A6E A;  4KN7 X;  3E5Q A;  5DEQ A;  2FBH A;  4ZZD A;  3F8B A;  5LHI A;  2QUF A;  2TDX A;  2CG4 A;  1RNL A;  2JTV A;  1TQP A;  3DXJ F;  4RGR A;  3BJ6 A;  5D4R A;  4HYE A;  3V8L A;  2XUB A;  2EV6 A;  4KIF A;  1MD0 A;  1YW8 A;  1FNN A;  2VC0 A;  5TJJ A;  5HLI A;  4XBF A;  3JSO A;  5K1Y A;  2R7D A;  3RKW A;  3ZMV A;  4BH9 A;  2PLY A;  3SQN A;  3LQQ A;  1XB4 A;  3KP5 A;  2QZ8 A;  5E1W A;  2GWR A;  3HTS B;  4LB6 B;  1ULY A;  2EFO A;  1Z9C A;  3GYH X;  3TO9 A;  4ESB A;  1P2F A;  4UHT A;  2V79 A;  1BC8 C;  2IA1 A;  2DTR A;  1WQ2 A;  1XDS A;  1XSV A;  2MH2 A;  4KA4 A;  1ON1 A;  2LKP A;  3KZY A;  5DV5 A;  4R1H A;  3M9A A;  5E8G A;  4HQE A;  3GO5 A;  1H9G A;  1T39 A;  2QWW A;  1PDN C;  5D4S A;  4MTE A;  1HKT A;  1FYK A;  3CO7 C;  4OMY A;  2XV4 S;  2P4W A;  2A68 F;  4L5I A;  1GVJ A;  4L0Z B;  2F5F A;  3B02 A;  3EET A;  5EEG A;  4RB0 A;  3GFJ A;  3TOB A;  2HGC A;  4ZYG A;  3R60 A;  5BMZ A;  1JHH A;  3TOA A;  4RB2 C;  3E6B A;  3ABU A;  2NNN A;  1BI2 A;  3HSR A;  5IT9 K;  2E7W A;  2XAF A;  2HYF A;  4EM1 A;  3SXY A;  4LG0 A;  4RGU A;  3IRQ A;  5D5X B;  1IRF A;  2DLL A;  1U78 A;  1LJ9 A;  3DF8 A;  1J7K A;  2CWE A;  2GQQ A;  1H0M A;  1LDK B;  3SZT A;  3FWE A;  3G73 A;  3FM3 A;  2VT3 A;  1DPR A;  1K78 A;  2DW4 A;  2XKO A;  5CYV A;  4ETS A;  3QOP A;  5HS8 A;  3BJO A;  3E97 A;  5HS9 A;  4LB5 A;  3QU3 A;  3Q5F A;  3CTA A;  3N4M A;  4NHJ A;  4YII A;  2E1N A;  4BHB A;  3V7C A;  4HDV A;  5BS6 A;  1XDU A;  3WTY C;  5L3D A;  3BOQ A;  1J5Y A;  4QWQ A;  4AD9 A;  2STW A;  3R4K A;  1J75 A;  4L0Y B;  2X4H A;  3KP7 A;  4B8X A;  1XN7 A;  1T98 A;  3HRM A;  4U88 A;  3F8C A;  1XMA A;  5LEK A;  5DUI A;  1P4A A;  3O6B B;  3RPU A;  1DP7 P;  1J9I A;  1S8N A;  2M5W A;  4I98 B;  4L9J A;  1QNT A;  3CUQ A;  3GLX A;  2DQR A;  3D0S A;  1D8J A;  1F4K A;  1MDM B;  4GO1 A;  3TO6 A;  1FP2 A;  4HW0 A;  4G6Q A;  1IN4 A;  2A61 A;  1V4R A;  5CVU A;  3QPH A;  3I54 A;  3LFK A;  4CIC A;  3O3K A;  1MDM A;  4U0Y A;  1HW2 A;  2ZXJ A;  1FBU A;  3EDP A;  2M87 A;  1IN8 A;  2C6Y A;  3WTU C;  4Q47 A;  4BHC A;  4IRG A;  1U5T A;  4P5O A;  4GCV A;  4YFN F;  1YYV A;  4QLC U;  3C1D A;  2W84 A;  2FE3 A;  1G6N A;  1LEB A;  2IJL A;  3N97 A;  3GEZ A;  2HQR A;  4AIK A;  4BYY A;  2RGV A;  2IP2 A;  2Y48 A;  4AIJ A;  1YTY A;  2Q2E A;  1BIB A;  1X3U A;  1XMK A;  4MQV A;  4L5J A;  1MGT A;  5ERI A;  1K6O A;  4A6D A;  3RKY A;  1R1V A;  1W4M A;  4OIO F;  4CDG A;  2VN2 A;  4A5N A;  1UFM A;  1KYW A;  1XD7 A;  4DNC A;  3BPX A;  2O03 A;  2EFW A;  1KQ9 A;  1R7J A;  3WGI A;  3FXR A;  3O2P E;  5LRS A;  1IW7 F;  3WG9 A;  4HLX A;  1G3T A;  4EM0 B;  5D6E A;  3GZ6 A;  2LSO A;  3K1N A;  2R7F A;  4LJZ F;  5ILU A;  3ERE D;  1OPC A;  3IHU A;  3FMR A;  2H27 A;  5CVI A;  2YX7 A;  1WI9 A;  4FT8 A;  4H0E A;  3L00 A;  4ZYD A;  3DFG A;  4UVB A;  4R8H A;  3CO6 C;  1MJ9 A;  2KRF A;  1IAW A;  2EJR A;  1R36 A;  2WC2 A;  1CF7 A;  3J80 Z;  1QGP A;  4P96 A;  3ZQ7 A;  5AIP A;  2Y0M A;  2DU9 A;  4OOI A;  1JE8 A;  1MJB A;  2EFN A;  5AON A;  4IHT A;  4I02 A;  3P9K A;  1P6R A;  2EV0 A;  5LRR A;  4IPA A;  2Z9O A;  2GIV A;  3K1P A;  3JAM Z;  3K69 A;  2KKO A;  1W7P D;  3QRF F;  2CW0 F;  3ABT A;  2HTS A;  3LA3 A;  3ULQ B;  4G7Z F;  1S7O A;  3KE2 A;  3FX3 A;  3CDH A;  1Z7U A;  3P9C A;  4FHT A;  3GWZ A;  2FSW A;  2F5D A;  1S7A A;  2JRT A;  3RIR A;  2ISY A;  3WTX C;  3ZP5 A;  1L3L A;  3HTU A;  3ISP A;  1B4A A;  2JZY A;  1ZG3 A;  5DCM B;  4A0Y A;  2GXB A;  2CQK A;  3RYP A;  1S6L A;  4OIN F;  1O3R A;  4OIR F;  1GXQ A;  2Z99 A;  1W7P A;  1TNS A;  1KYZ A;  3BWG A;  2FNP A;  2OZU A;  3TKY A;  1R58 A;  2RNJ A;  4BHP A;  3GFM A;  2PMU A;  4I7H A;  2Z5U A;  2RKH A;  2AS5 F;  4IF4 A;  1FYL A;  5FFX A;  3F72 A;  2OU2 A;  3REO A;  2GXG A;  4NB5 A;  1Z6R A;  5D6F A;  1P92 A;  1OKR A;  3M7G A;  1IN6 A;  4I0B A;  3M8E A;  4PCQ A;  4HOB A;  4RS8 A;  3FF5 A;  1LQ1 A;  1CGP A;  1ZAR A;  5A2Q Z;  4Z2Y A;  5D5U B;  4M9Z A;  1YS7 A;  1K7A A;  3PFI A;  3Q9V A;  4ASN A;  4WK8 F;  5L3F A;  3H3U A;  2OA4 A;  1ZRD A;  2QQ9 A;  4LLL A;  1G3W A;  2G7H A;  3MQ0 A;  1W7P B;  3BY6 A;  1SD4 A;  2Z33 A;  3LAJ A;  3DPT A;  2L4M A;  2RC4 A;  1FWZ A;  2LF7 A;  4L9V A;  5DYM A;  2QYO A;  4MEX F;  3DEU A;  1P4W A;  3KP3 A;  3Q9S A;  2XAQ A;  1IXR C;  4K2E A;  3V7S A;  3BP8 A;  4KIC A;  1W5T A;  1LB2 A;  2E1C A;  1ZHF A;  3EYI A;  2HR3 A;  2MD5 A;  5HDN A;  1IZ1 A;  4Q48 A;  5E17 F;  5DD8 A;  4KIB A;  1BI3 A;  2HKX A;  1UB9 A;  1I27 A;  1D8K A;  1O7L A;  4N0B A;  3IKV A;  4O6J A;  1BC7 C;  2QLZ A;  2ADU A;  2XAH A;  2YR2 A;  2MBF A;  3E5U A;  3T5X A;  5BQT A;  2IPQ X;  4XSX F;  4N9I A;  3VFZ A;  1LDJ A;  1R22 A;  4LG0 B;  3HUG A;  1DUX C;  3TDZ C;  3M8F A;  3RI4 A;  1ZG1 A;  4P9U A;  3WTT C;  2XRO A;  2PFB A;  1U6G A;  3LA7 A;  1K78 B;  1HST A;  5HLH A;  3WU0 A;  4ENN A;  4MNU A;  3VEP A;  2H6C A;  5E8I A;  1SFX A;  5A2Q K;  1T0F A;  2XIG A;  4M6Y A;  2HFH A;  2IRF G;  4L18 B;  2B0L A;  5HOO A;  4RGX A;  1R00 A;  4L9N A;  1H9T A;  1ZN2 A;  2G9W A;  5IT3 A;  5EEH A;  2DBB A;  3CUQ C;  3E6D A;  5H20 A;  1TTY A;  3ML6 A;  3K0L A;  1OMI A;  4I0A A;  3F8N A;  3MZY A;  1ODD A;  3RKX A;  3WTV C;  4GYI A;  2FBI A;  3WTZ A;  2GA2 A;  5H6Q A;  2VON A;  4XRF A;  3H92 A;  5DDG A;  2Y75 A;  3RYR A;  1SFE A;  1RUN A;  1FP1 D;  2FA5 A;  1J59 A;  4YG2 F;  1IXS B;  3R0J A;  4EMS A;  4Q5S F;  3IWF A;  3IWZ A;  1OR7 A;  5CVJ A;  1G3Y A;  3NRV A;  3ECO A;  2QQB A;  1PUE E;  1FY7 A;  4KN4 X;  2EB7 A;  4AVP A;  3WGG A;  2A3S A;  2QVO A;  4PZJ A;  4UVA A;  1SD5 A;  2JPC A;  3LWF A;  5FD5 A;  5LGU A;  6PAX A;  3EUH A;  4MEY F;  3GUD A;  1NHA A;  2VOD A;  3JAM K;  4UVC A;  2FNA A;  2ZME B;  3E5X A;  3P9I A;  2DFI A;  4HQM A;  2VT2 A;  4RAY A;  4A12 A;  5HDK A;  1DDN A;  2NAZ A;  3LST A;  3CUO A;  2VC1 A;  3B73 A;  1WSU A;  4LK0 F;  3I71 A;  5FD6 A;  1U8R A;  2YU3 A;  1SFU A;  3KP4 A;  3P7N A;  1I1S A;  3BZ6 A;  1E2X A;  1FLI A;  1QPM A;  4CHU A;  2AXL A;  2LDU A;  3V4G A;  2DO7 A;  5L3G A;  4LGW A;  3F8M A;  3NQO A;  4HX8 A;  4HBL A;  4U7B A;  3F3X A;  2IW5 A;  3L9F A;  1B9M A;  4DQ2 A;  5ILS A;  2DK5 A;  2WWY A;  5H6R A;  4EV0 A;  1HQC A;  4HLY A;  4EM2 A;  2X0L A;  5L3E A;  2NNY A;  3V8K A;  3E3V A;  2FMY A;  1I6X A;  1SMT A;  3H3Z A;  3K9T A;  3WE3 A;  3ZMS A;  2QBY B;  1FC3 A;  2O3F A;  3C3W A;  5D8K B;  1ON2 A;  3KCC A;  3V7R A;  2VOO A;  2R3S A;  5JR3 A;  2YSR A;  3J80 K;  5LEJ A;  1LEA A;  4IRH A;  4TV7 A;  1XGO A;  4IRI A;  2A6H F;  5E18 F;  4XLN F;  1K79 A;  4RB3 C;  2Z3Y A;  2O6G E;  5LHG A;  1KQ0 A;  4KT5 C;  3W6J B;  1XGN A;  2GZW A;  5ILV A;  2DK8 A;  4G7O F;  1HW5 A;  2HWV A;  4IXA A;  2H94 A;  4BAY A;  5D5V B;  1O57 A;  2FU4 A;  2JT1 A;  1T2K A;  1YS6 A;  3GFL A;  1FX7 A;  5E1Z B;  1O3Q A;  5F64 A;  1FYM A;  1B1B A;  3WGH A;  3HRS A;  1RIO H;  2FBK A;  3KP2 A;  2DQL A;  1UHM A;  2IA0 A;  1B59 A;  2HEO A;  1TQM A;  3I4P A;  4MHG A;  4OIP F;  4BNC A;  3M1E A;  1REP C;  3TDU C;  4G9Y A;  1IXC A;  5JFR A;  2V1D A;  1LNW A;  3COA C;  4M74 A;  2PMH A;  1EH6 A;  2BGC A;  1HXD A;  3ZMZ A;  2HYG D;  4AIH A;  4WCG A;  4KIG A;  1ZRF A;  3IL2 A;  5J8C A;  1AWC A;  2RQP A;  2ETH A;  1KU9 A;  1E17 A;  2E7X A;  2RVC A;  1XCB A;  3GVA A;  2XHK A;  3F8F A;  2CSO A;  1ZRC A;  1BBY A;  3L2C A;  3GX4 X;  2KIF A;  2BYV E;  5JVT A;  4KYW A;  3IC7 A;  4CGZ A;  2L01 A;  1F5T A;  4E70 A;  3RPQ A;  1R5G A;  2HKO A;  5BPD A;  1OYI A;  2L54 A;  1HSJ A;  1C0W A;  2OBP A;  1XCV A;  2XAG A;  1EH7 A;  2EFQ A;  1FSE A;  2O61 A;  4LLG F;  1U3E M;  4BXU A;  1J0R A;  1QZY A;  2QQA A;  5LGN A;  2LNB A;  4O5V A;  4HX7 A;  2P5V A;  4HF2 A;  1WRJ A;  2UZK A;  1CF7 B;  2Q8K A;  4WXH A;  4ENM A;  2DPU A;  4CO8 A;  1SAX A;  1KQ8 A;  3U1D A;  5ED4 A;  4LK1 F;  2UXN A;  3GZ5 A;  4B09 A;  5LGT A;  1XGM A;  2HS5 A;  1TW3 A;  3KP6 A;  5HLG A;  3K1M A;  4GGG A;  2MA3 A;  3HSF A;  2VBZ A;  2ZBK A;  2O8X A;  3KFW X;  2PG4 A;  1YIO A;  1R23 A;  4F7Z A;  4O3M A;  1YO5 C;  2M1B A;  2CYY A;  4I2O A;  1P4X A;  4D0P A;  2CO5 A;  2VBX A;  4EJV A;  1Z1D A;  2FOK A;  2K4J A;  1LVA A;  5FO5 A;  1T6S A;  4UV9 A;  3RJP A;  2FML A;  2KJC A;  2EV5 A;  3WOD F;  2D1V A;  4GXO A;  3T1B A;  4XLP F;  1USS A;  4YFK F;  2MLK A;  3W6K B;  4EJU A;  2M30 A;  3F22 A;  5LHH A;  1Z6T A;  4UUV A;  1O3S A;  5D5W B;  5L3C A;  2MLG A;  4PDK A;  1BOA A;  2W25 A;  5JHU A;  4EJO A;  5BPI A;  2MH9 A;  2D45 A;  1OYY A;  2CGP A;  2COM A;  2KIM A;  5TRD A;  2EA4 A;  3ELK A;  2D2W A;  5K5O A;  5J6X A;  2QBY A;  3ECH A;  2MC3 A;  3QAH A;  2Q0O A;  4KUM A;  1QQI A;  1TW2 A;  4M9X A;  3ZN1 A;  3GW2 A;  5E20 A;  1R5H A;  1Z05 A;  5FGM A;  1F9N A;  2YPR A;  4LD5 A;  4N9H A;  1BIA A;  3K2Z A;  1A04 A;  4WX9 A;  2XAJ A;  2ZNY A;  5F1R A;  2EWN A;  1SD6 A;  5KK1 A;  2JSC A;  1KU7 A;  4WWC A;  2OZ6 A;  1BI0 A;  2CFX A;  2K7L A;  2OAZ A;  4A0X A;  4GYG A;  2IVM A;  3SZP A;  2XVC A;  4HZF A;  2O0Y A;  4WXC A;  3I59 B;  1LDD A;  2K02 A;  4KNY A;  2GA1 A;  4G94 A;  4AWX B;  4A0Z A;  2A69 F;  4ON0 A;  1FOK A;  2OQR A;  2ZKZ A;  5ICE A;  3HOT A;  4U0W A;  2L4A A;  3KLO A;  5K5Q A;  5DCF A;  3KEQ A;  1JXS A;  2F5E A;  3NEU A;  1STZ A;  1XSX A;  3ZN0 A;  1PP8 F;  5DCM A;  2L3D A;  2UXX A;  1D5V A;  2P6T A;  2ESN A;  1DPU A;  4ENK A;  2H09 A;  4M71 A;  1HW1 A;  1VTN C;  3GFI A;  1Y0U A;  5J8F A;  3WTW C;  4IHS A;  4HDU A;  1IF1 A;  1YW9 A;  4Y13 A;  5CJ9 A;  1IUY A;  3HIF A;  3CJN A;  2QM3 A;  2ELH A;  2NRA C;  4G8X A;  4ESF A;  2JPB A;  3ZMT A;  5FB2 A;  1FT9 A;  3QU6 A;  3FM5 A;  1FBS A;  4HV6 A;  2VE9 A;  1J2X A;  1WWX A;  2QEN A;  4Y15 A;  2VBW A;  2WTE A;  1B6A A;  2EFP A;  1S3J A;  4HF0 A;  3LQR A;  3KZZ A;  4YFX F;  1HKQ A;  1S29 A;  1WKM A;  4S05 A;  3J7A O;  5DD4 A;  2HOE A;  1XSD A;  5DUK A;  4U7D A;  1U5T B;  4EVI A;  2ESH A;  4JBA A;  3EQL F;  5HDG A;  3BDD A;  3JSP A;  1I5Z A;  2D1H A;  2HQN A;  4UV8 A;  3QP6 A;  3TO7 A;  2V6C A;  4XSZ F;  5FFZ A;  3F23 A;  1UCR A;  3LA2 A;  1ONV A;  3U9G A;  1ZGA A;  3JTH A;  3C18 A;  4MQ9 F;  4Y17 A;  2IT0 A;  2IA2 A;  2RDP A;  2BBY A;  5CLS A;  5CVR A;  5BOX A;  1TBX A;  5IT9 Z;  4EQQ A;  3MFK A;  1IN7 A;  3DPL C;  4ZZL A;  3IKT A;  4ZYE A;  3EYY A;  3PQK A;  2RV8 A;  1U2W A;  3ROU A;  1ZLK A;  3I59 A;  1JHF A;  4I09 A;  4R79 A;  5LLQ A;  1R1T A;  1O3T A;  3LAP A;  3V8J A;  3I0T A;  5HVQ C;  2HTJ A;  2FF4 A;  1PP7 U;  4KMU X;  5ICF A;  2BEO A;  4IJA A;  4EJT A;  2ZO4 A;  2FQ3 A;  2K4B A;  2PN6 A;  1RI7 A;  2A07 F;  1I1G A;  4HX4 A;  5L3B A;  4A5M A;  4P9F A;  4UXN A;  3HYI A;  3PQJ A;  3OOP A;  3VB2 A;  3FZV A;  4I01 A;  5FLX Z;  1KU3 A;  3F6O A;  2DPD A;  3G3Z A;  1MZB A;  3SFZ A;  3CLO A;  2FEZ A;  4L9T A;  3C7J A;  4G7H F;  2P5L C;  2V9V A;  4WXD A;  2HDC A;  1F1Z A;  4FX4 A;  4PGG A;  4LMY A;  2KJB A;  2STT A;  3VOE A;  2XGX A;  3DQV C;  4A2U A;  2PI0 A;  1G4D A;  3HRT A;  3MWM A;  5ICG A;  1EV7 A;  2VE8 A;  4HF1 A;  3HRU A;  3FXU A;  3ZPL A;  2NS0 A;  5E1X A;  4KDP A;  2LF8 A;  1B9N A;  2A5Y B;  3MCZ A;  3RDI A;  3WU1 B;  2P7C B;  3MEX A;  2V1X A;  5F6F A;  2BE5 F;  2K27 A;  2PQ8 A;  1YW7 A;  1TQI A;  4G6D A;  4KFC A;  2G7U A;  3DKW A;  4PGH A;  1Q1H A;  5D8L B;  4KMF A;  2M8E A;  4MTD A;  1IRG A;  4ZH4 F;  3F6V A;  3J81 Z;  1ZLJ A;  3U2R A;  2VBY A;  2WV0 A;  1XGS A;  1RZ4 A;  2ACJ A;  3FHZ A;  3F21 A;  2V1U A;  4ENJ A;  2RN7 A;  3FMQ A;  4WF2 A;  1YG2 A;  4IVN A;  3QPT A;  2NYX A;  3HHG A;  2EA2 A;  3TGN A;  1BM9 A;  5JI6 A;  3IRR A;  1FSH A; 
#chains in the Genus database with same CATH topology
 2M0M A;  4UNO A;  4NBQ A;  1EH8 A;  4RGS A;  4FCY A;  1AHD P;  4QSH A;  4ESJ A;  4HNT A;  3PFY A;  3OYB A;  3WTS C;  4ZC3 A;  3SHF A;  5FRM A;  3HC7 A;  2CQN A;  3GTG J;  2XKP A;  5GAE J;  3GF2 A;  5B66 C;  3AG3 H;  2P8T A;  3L7W A;  3DBH B;  2Q1Z B;  2OD5 A;  3CCS I;  4M9S A;  4UB6 C;  4C3I J;  4RAZ A;  4OMZ A;  1ZG5 A;  1JGS A;  5KCM A;  1QA6 A;  4ITV A;  2VI6 A;  3ERM A;  4S04 A;  3QYB A;  5AIQ A;  1BW6 A;  1QZZ A;  1A6I A;  1WI3 A;  3J81 K;  2UWM A;  3ZMU A;  5ICC A;  2E2I J;  2K86 A;  3BRO A;  3HHH A;  3RTR A;  1T33 A;  2LY2 A;  2VXZ A;  1PJR A;  3PIO F;  4BQA A;  3QPS A;  4EGY A;  2MW8 A;  1D3Y A;  1VQ9 I;  4P55 A;  2OQG A;  1YFH A;  1MIJ A;  3R0A A;  2EIJ H;  4S0H B;  2HVS A;  3FXQ A;  4IKF A;  1SD7 A;  3OIP A;  5DTD A;  5FLX K;  1FZP B;  3TL4 X;  2YX4 A;  1HKS A;  4BQN A;  2X6O A;  1YJ9 I;  3CCY A;  4CYD A;  4NQW A;  2XRN A;  2HZT A;  2HOS A;  2KIU A;  2VOP A;  5CPR B;  5K5R A;  3AAF A;  3FMS A;  1LVK A;  1OCO H;  4U0V A;  1VFC A;  3HPG A;  4XOR A;  2W24 A;  4LLN A;  4AM3 A;  2P6S A;  1IJW C;  3I3L A;  1RET A;  3W6V A;  3GTJ J;  3T8T A;  3HSE A;  3S15 J;  1QO0 D;  4YIF A;  2QF7 A;  1G3S A;  1VQ4 I;  1JUM A;  1TWH J;  1OLT A;  3CUQ B;  3QOD A;  4AU7 A;  3MZH A;  3BCB A;  1A31 A;  4M72 A;  1JKQ C;  4BE2 A;  1SVM A;  5LD2 C;  3OYF A;  3BTI A;  2ZME A;  1ZGJ A;  1O7F A;  3ZR8 X;  3LSM A;  3BG6 A;  3E6M A;  1YX5 A;  2DTZ A;  5IOZ A;  2FXA A;  4XON A;  1KU2 A;  3KEO A;  4OAZ A;  4Q4Z F;  1BI1 A;  3M1C A;  1TL8 A;  3L09 A;  2XAU A;  2LBF A;  1MMS A;  3QP5 A;  5C3E J;  3I53 A;  2EK5 A;  4JK1 X;  2BV6 A;  1SFK A;  3D5L A;  1MBE A;  2FJ1 A;  2A6E F;  1MBH A;  4MFE A;  4JQF A;  1L0O C;  5FKN A;  4C3H J;  5C4X J;  1BJA A;  4EJW A;  1BOB A;  5J4V A;  1ZAO A;  2P7V B;  2ZFW A;  1Q1V A;  1GXP A;  2L5Q A;  3H5A A;  2HVR A;  3HUG B;  1MKM A;  4XKC A;  2ZCW A;  2V1N A;  2NVU B;  2DA1 A;  4J19 A;  3KLN A;  2ZJ2 A;  3MZ8 A;  3T0Y A;  4BEH A;  2PEX A;  2KT0 A;  2BY1 A;  4LFU A;  4M6V A;  4EGZ A;  1TNT A;  2E19 A;  2XSJ C;  4OIQ F;  2VPL A;  4BXX J;  3I4M J;  2W57 A;  2LKS A;  2DT5 A;  1T56 A;  3BPV A;  5J4Y A;  3VWB A;  3HL2 A;  1TT5 B;  1YLF A;  3R6S A;  2JWT A;  2F2E A;  3L2U A;  5FRN A;  1EKE A;  1RPW A;  3OV8 A;  1K6Y A;  4M73 A;  3HOS A;  4A93 J;  1AOY A;  1ZH5 A;  3I58 A;  4DW6 A;  2PBI A;  1YQA A;  3CDI A;  3TQN A;  2PJP A;  1Z91 A;  1HBX G;  2LY9 A;  3CCR I;  3A4C A;  4M6X A;  2QCO A;  1U0J A;  2ZXH A;  2XAS A;  1TP4 A;  2GAU A;  3GXO A;  3OY9 A;  1UHW A;  4HV5 A;  3VYU B;  1IC8 A;  1F36 A;  1IN5 A;  3JW4 A;  1LFP A;  2H6B A;  1ETO A;  2EPF A;  1QBJ A;  2ZSI B;  3I5U A;  1RUO A;  4HA8 A;  2LFB A;  4YEL A;  4BBR J;  4CZZ A;  3JTG A;  2J5O A;  3T8R A;  1T38 A;  3D5S C;  3VOD A;  2MD0 A;  3MAJ A;  2E71 A;  4E7I A;  2IGN A;  3WE2 A;  2R7V A;  2W85 A;  1OCR H;  4OU0 A;  3OIO A;  1SMY F;  2FRH A;  2DA5 A;  3BTC A;  2UV1 A;  2F5C A;  3VYR B;  2F4I A;  1R1U A;  2R0Q C;  1ZRE A;  1GHC A;  4JX4 A;  2FX0 A;  2J5P A;  5LBQ A;  4MGR A;  1VQL I;  3OYI A;  2DI3 A;  2XF6 A;  1FBQ A;  1FPQ A;  3R61 A;  2F48 A;  4NDL A;  3I64 A;  5CVV A;  2QSH X;  4CXF A;  3BJA A;  4I99 C;  3JRF A;  4RAF A;  1V3F A;  1TLH B;  3GLL A;  4RB1 A;  3DKY A;  1ZYR F;  5FKM A;  4HST A;  4E7Z A;  3DU6 A;  3HOY J;  1OYW A;  2GOX B;  1W5S A;  1KA8 A;  1MH4 A;  1KGS A;  1FTT A;  2L02 A;  1XS9 A;  2QGU A;  3S2W A;  1U5T C;  3OSG A;  2M45 A;  1MJA A;  2RNG A;  3VPR A;  1UST A;  3QQA A;  3CQZ J;  1BN5 A;  5HS7 A;  4HAM A;  2ISZ A;  4FX0 A;  4MIM A;  3DV8 A;  1WCM J;  2ZNZ A;  2X48 A;  4A69 C;  5KVR A;  1MBF A;  3ZMD A;  2Y31 A;  4DGW B;  2DJN A;  2P5K A;  3G6E I;  3KET A;  3DP7 A;  3E6C C;  2D5V A;  4ZYH A;  2DAO A;  4A6E A;  3PNV A;  4KN7 X;  3E5Q A;  2Y69 H;  5DEQ A;  2YU9 J;  3DCF A;  5M5Y J;  2IS2 A;  2FBH A;  4ZZD A;  3SFI A;  3F8B A;  5LHI A;  2QUF A;  2TDX A;  2CG4 A;  3FDY A;  1RNL A;  2JTV A;  1TQP A;  3DXJ F;  5J40 A;  4RGR A;  1B72 A;  3BJ6 A;  5D4R A;  4HYE A;  1RES A;  1IUF A;  3V8L A;  2ZXW H;  5DM6 F;  1ZKG A;  2XUB A;  3BZK A;  3EPZ A;  2EV6 A;  4KIF A;  1MD0 A;  4QPQ A;  1YW8 A;  3KYC B;  4F3Q A;  1FNN A;  1MMN A;  5IY5 H;  2VC0 A;  4E6K G;  2NOG A;  5TJJ A;  5HLI A;  2Y9Z A;  3K4M A;  5F0H A;  1Y56 A;  4XBF A;  2K5C A;  4IL6 C;  3JSO A;  5K1Y A;  1NH3 A;  2V4J C;  2R7D A;  2WAF A;  3RKW A;  3ZMV A;  4BH9 A;  4ZDO A;  3S1R J;  2PLY A;  3JRC A;  3RQI A;  3CDL A;  1LFU P;  3OS0 A;  3SQN A;  2E36 A;  1ZGW A;  3LQQ A;  1D5Y A;  1XB4 A;  5JHF A;  3KP5 A;  2QZ8 A;  5E1W A;  3CJT B;  3FBN B;  4DYR A;  3PUF A;  5KNL A;  2LK2 A;  2GWR A;  2G0E A;  4LB6 B;  3HTS B;  1ULY A;  2EFO A;  4HSR A;  1Z9C A;  3GYH X;  3TO9 A;  4ESB A;  4E7H A;  2M9H A;  3BG3 A;  3GZN B;  1P2F A;  4UHT A;  2V79 A;  1BC8 C;  2IA1 A;  2DTR A;  1WQ2 A;  1XDS A;  2W82 A;  1XSV A;  2OCE A;  5TGT A;  4BDZ A;  2MH2 A;  2ME6 A;  1VI0 A;  4KA4 A;  3S3O A;  1ON1 A;  1Z3Y A;  2Y2Z A;  2GM4 A;  2K9L A;  2KHM A;  2LKP A;  3KZY A;  3FK6 A;  5DV5 A;  3VDX A;  2L9R A;  4R1H A;  3M9A A;  1Z3X A;  5E8G A;  4HQE A;  5C4J J;  5M5W J;  2ZB9 A;  3GO5 A;  1H9G A;  1T39 A;  3JRI A;  4Y33 A;  2QWW A;  3ZQG A;  1PDN C;  3X2Q H;  3AG4 H;  3JRD A;  5D4S A;  4MTE A;  2P0W A;  1FYK A;  1HKT A;  1FOW A;  3CO7 C;  4OMY A;  2XV4 S;  4DYC A;  2P4W A;  1JUP A;  2KIS A;  2A68 F;  2KP6 A;  1GVJ A;  4L5I A;  3CMA I;  1ZR2 A;  4L0Z B;  2F5F A;  3OYE A;  3B02 A;  2EIL H;  4A3C J;  3U1K A;  4PSW A;  2MYS A;  3JRA A;  3BCA A;  3EET A;  5EEG A;  3BTJ A;  3ZQQ A;  4RB0 A;  5J1Y A;  2E1M C;  1TWF J;  3GFJ A;  3TOB A;  2DFE A;  2OUM A;  2HGC A;  4B3A A;  4ZYG A;  2FQ4 A;  3R60 A;  5BMZ A;  1JHH A;  5E3N A;  3MKZ A;  1TWA J;  2JVG A;  3TOA A;  4E7L A;  1OFC X;  4RB2 C;  4KJZ A;  4A3I J;  5IYB J;  3E6B A;  3ABU A;  3HXL A;  2NNN A;  1BI2 A;  3HSR A;  5IT9 K;  1NTC A;  4JX6 A;  4XRS A;  4XK4 A;  2E7W A;  1ZTR A;  2WV1 A;  3W2W A;  1G8X A;  2VLA A;  2B63 J;  3OR2 C;  2XAF A;  1ETW A;  2HYF A;  5F04 A;  1HDP A;  3BLY A;  1RR8 C;  4EM1 A;  3SXY A;  4OAY A;  4LG0 A;  4RGU A;  4L5E A;  2VKD A;  3IRQ A;  5D5X B;  1IRF A;  2DLL A;  1U78 A;  2NS8 A;  1LJ9 A;  1SAN A;  3DF8 A;  3ZQL A;  1J7K A;  2CWE A;  1I50 J;  3DEE A;  3H0G J;  2GQQ A;  1H0M A;  4C30 A;  2DDB A;  5B5E C;  1LDK B;  3SZT A;  2K40 A;  3FWE A;  2VKV A;  2MG4 A;  2JRM A;  4EAT A;  3FM3 A;  2VT3 A;  1DPR A;  2OC6 A;  2W7N A;  3G73 A;  3G71 I;  1K78 A;  2DW4 A;  5FLV A;  2XKO A;  5CYV A;  4ETS A;  3FXM A;  3QOP A;  5HS8 A;  3BJO A;  4M3B A;  3CCL I;  4A3L J;  1QVU A;  3E97 A;  3Q0W A;  1APL C;  2JA8 J;  5HS9 A;  3WU2 C;  1R9T J;  1SAU A;  4HG2 A;  2QEX I;  3QU3 A;  4LB5 A;  3Q5F A;  3CTA A;  4BU2 A;  4AID A;  3N4M A;  4NHJ A;  4YII A;  3OMY A;  2CFO A;  2E1N A;  2VPR A;  4BHB A;  5IYD J;  3V7C A;  4HDV A;  3GTQ J;  5BS6 A;  1XDU A;  4RLQ A;  5E79 C;  3S1M J;  3WTY C;  5L3D A;  5JVG F;  3BOQ A;  5EF6 A;  4F92 B;  3PO2 J;  1J5Y A;  4QWQ A;  3S2H J;  3L2W A;  4AD9 A;  2DA4 A;  2R5Z B;  3R4K A;  1NK3 P;  2STW A;  3G4S I;  1J75 A;  3CMY A;  3MKW B;  1W0U A;  4L0Y B;  5GTI C;  5FKO A;  2X4H A;  1VQK I;  3KP7 A;  1WHU A;  1YRN B;  4B8X A;  1UMQ A;  3RQ4 A;  1XN7 A;  3LSK A;  1T98 A;  3HRM A;  3CC7 I;  2OCC H;  4U88 A;  3F8C A;  3ESW B;  1XMA A;  2XF7 A;  1LKX A;  5LEK A;  1V5F A;  5DUI A;  2E60 A;  1P4A A;  2IGO A;  3O6B B;  3RPU A;  2ELK A;  1DP7 P;  1J9I A;  4JP0 A;  4BUP A;  1S8N A;  2M5W A;  4I98 B;  4V2G A;  1MW7 A;  4L9J A;  1QNT A;  3CUQ A;  2OTJ I;  2CRG A;  1Y6I A;  3GLX A;  2DQR A;  3ZQC A;  2R7X A;  3D0S A;  1D8J A;  1F4K A;  1MDM B;  3PJR A;  3HM5 A;  5HNH A;  3SEQ A;  3ASN H;  4PK4 A;  4GO1 A;  4PJL A;  3TO6 A;  4ANJ A;  1FP2 A;  4HW0 A;  4RA2 A;  4G6Q A;  4W97 A;  1U9O A;  2CU7 A;  4XLF A;  1IN4 A;  3HEF A;  2YS9 A;  1O4X A;  2A61 A;  1V4R A;  5CVU A;  3QOE A;  3QPH A;  3I54 A;  4B48 A;  3LFK A;  5TIS C;  4CIC A;  3IH3 A;  3O3K A;  1MDM A;  1MNE A;  1NK2 P;  1FOY A;  3PNT A;  4XOP A;  4U0Y A;  1HW2 A;  2ZXJ A;  3CP2 A;  1FBU A;  3EDP A;  2M87 A;  1IN8 A;  2C6Y A;  3WTU C;  2COB A;  3FBI B;  4Q47 A;  4BHC A;  4IRG A;  1U5T A;  1G59 A;  1JKO C;  4P5O A;  2HDW A;  4GCV A;  4YFN F;  3RPU D;  4NC8 A;  1YYV A;  4RAG A;  4QLC U;  3C1D A;  2W84 A;  2FE3 A;  3S8P A;  2H1L A;  3K2A A;  1G6N A;  1Y39 A;  1LEB A;  1WFX A;  1SC7 A;  2IJL A;  4N4O B;  2IAI A;  3N97 A;  1QVT A;  1RC9 A;  1WJE A;  2HQR A;  2WAQ A;  3GEZ A;  4AIK A;  3K4K A;  4BYY A;  4IO9 F;  3OYC A;  3IH4 A;  1IRZ A;  3BR6 A;  2RGV A;  1FEX A;  3WHC A;  1EF4 A;  2LD5 A;  2IP2 A;  2GIZ A;  2HYJ A;  2QA4 I;  2Y48 A;  3AKZ A;  3BQZ A;  4AIJ A;  1YTY A;  1SVL A;  2K3P A;  2Q2E A;  1BIB A;  2E35 A;  2LR8 A;  3BG9 A;  1X3U A;  1XMK A;  4XM3 A;  4MQV A;  4L5J A;  1MGT A;  2AQF A;  3CJR B;  4Y4R A;  3UNG C;  3ZCO A;  5ERI A;  3CC4 I;  1K6O A;  1HC8 A;  2WB1 N;  1FJL A;  2WAD A;  4A6D A;  3RKY A;  1NG6 A;  4I76 A;  2IS4 A;  1R1V A;  3HOZ J;  1W4M A;  4OIO F;  3HOU J;  1MBJ A;  4CDG A;  2VN2 A;  4A5N A;  3SDG A;  1UFM A;  3OYK A;  1KYW A;  1XD7 A;  5E3M A;  2ZXI A;  4DNC A;  3BPX A;  1QPI A;  1UAA A;  2PMZ N;  2O03 A;  3H9G A;  4B47 A;  2EFW A;  2DMN A;  3FXL A;  1KQ9 A;  1R7J A;  2IXS A;  3WGI A;  4RM3 A;  3FXR A;  2K9M A;  5K7H A;  3U21 A;  3DBL B;  2JSP A;  3O2P E;  3LSP A;  2CW8 A;  5LRS A;  2BXY A;  1XPX A;  1ETY A;  3J7Y J;  2UUZ A;  4PJJ A;  1IW7 F;  2CQQ A;  3WG9 A;  4HLX A;  2F5V A;  2L9V A;  2R7T A;  1G3T A;  2HOA A;  2FD5 A;  4GFB A;  4EM0 B;  5D6E A;  4G6T B;  2DOE A;  3BQY A;  2LSO A;  5F27 A;  3GZ6 A;  3K1N A;  2X6Y A;  3L1P A;  2E34 A;  1Z77 A;  2R7F A;  4LJZ F;  4IHY A;  5ILU A;  3J7A Y;  3ERE D;  1MMG A;  4D7M A;  1OPC A;  2BVL A;  3IHU A;  3FMR A;  3PSF A;  2IGM A;  4Z6Y A;  2H27 A;  3LSR A;  4XRM A;  4CCL A;  5CVI A;  2YX7 A;  1WI9 A;  3A01 A;  3MVP A;  4FT8 A;  2ELJ A;  4H0E A;  2OJE D;  3L00 A;  4QPO A;  4BQQ A;  2OF7 A;  2V7F A;  3E0J B;  3G2B A;  5FJ8 J;  4ZYD A;  3DFG A;  2MAB A;  3FIW A;  4UVB A;  5E3L A;  4R8H A;  3M8J A;  3CO6 C;  1MJ9 A;  1MMD A;  2KRF A;  1IAW A;  4A3G J;  2EJR A;  1R36 A;  4RBO A;  2JA2 A;  2WC2 A;  1CF7 A;  1F43 A;  1FIP A;  3J80 Z;  1QGP A;  3NAU A;  4BL0 B;  4P96 A;  3ZQ7 A;  1OCP A;  5AIP A;  2Y0M A;  1WJA A;  2DU9 A;  2IEK A;  4OOI A;  2KFD A;  2M4G A;  1JE8 A;  1MJB A;  2EFN A;  3HPH A;  5AON A;  2LTP A;  1Y1W J;  4IHT A;  4I02 A;  1IRX A;  2HVQ A;  4FIS A;  1UJ8 A;  3P9K A;  5GP9 A;  1XX5 A;  4M3D A;  1P6R A;  4NUB A;  3SZG A;  2EV0 A;  5LRR A;  4IPA A;  2Z9O A;  2GIV A;  4CCJ A;  2JA7 J;  3K1P A;  3JAM Z;  3K69 A;  2NVQ J;  1X1P A;  4DZP A;  1EJ9 A;  2HNH A;  2KKO A;  1W7P D;  1ERD A;  2Y30 A;  3QRF F;  2DT7 B;  3BG7 A;  5IP9 J;  1D0Z A;  2CW0 F;  2EIM H;  3ABT A;  2HTS A;  2TRT A;  3NAR A;  2XPV A;  2V9P A;  3LA3 A;  3ULQ B;  4G7Z F;  4C3J J;  1S7O A;  3KE2 A;  3FX3 A;  3CDH A;  1Z7U A;  3P9C A;  4FHT A;  3GWZ A;  2FSW A;  2M34 A;  2F5D A;  1S7A A;  2JRT A;  3RIR A;  1HLV A;  3KYL A;  1QHG A;  2ISY A;  4ABZ A;  3WTX C;  2K85 A;  3ZP5 A;  1NG7 A;  1L3L A;  1T0F C;  3HTU A;  3ISP A;  1B4A A;  3VSL A;  4PJ0 C;  2K3F A;  4IQ4 A;  3H1C A;  2CV1 A;  2JZY A;  1ZG3 A;  5DCM B;  4A0Y A;  2GXB A;  2CUJ A;  3FKJ A;  2CQK A;  2WBM A;  3RYP A;  1S6L A;  4OIN F;  1O3R A;  2H1K A;  4CZC A;  4XLA A;  2A6T A;  4OIR F;  1GXQ A;  3KEY A;  2Z99 A;  1W7P A;  1TNS A;  1KYZ A;  3TP0 A;  2E1M B;  3BWG A;  4ZDL A;  2FNP A;  2LP0 A;  2OZU A;  2DOF A;  1B8I B;  3W2V A;  3TKY A;  1R58 A;  2RNJ A;  1CQT A;  2VB6 A;  4BHP A;  3GFM A;  1YOV B;  1X1C A;  2PMU A;  3A0B C;  4I7H A;  2Z5U A;  1DGW Y;  2RKH A;  2AS5 F;  2ME0 A;  3QWL A;  3S1N J;  4XMY A;  4IF4 A;  4Y52 J;  1FYL A;  2MSY A;  3CLQ A;  5FFX A;  3ONQ A;  4H4K C;  3F72 A;  2OU2 A;  3REO A;  2GXG A;  2BW3 B;  2R7Z J;  4NB5 A;  1Z6R A;  1B72 B;  4C2U A;  5D6F A;  1T08 B;  2X85 A;  2KIQ A;  4CUG A;  2CQ7 A;  1P92 A;  2LBF B;  3K4B A;  2WAE A;  5KAI C;  1W36 C;  1OKR A;  3HGG A;  3M7G A;  1IN6 A;  2EZH A;  4I0B A;  3OYG A;  1E3O C;  3M8E A;  1YX3 A;  2LC2 A;  4PCQ A;  4AC0 A;  1KZH A;  3OYD A;  1AU7 A;  4HOB A;  4CCO A;  2L7M P;  2ICW G;  1MMA A;  2VJI A;  4RS8 A;  3VSK A;  3FF5 A;  1LQ1 A;  1VND A;  1CGP A;  1ZAR A;  5A2Q Z;  3IP4 B;  3MMY B;  4Z2Y A;  1U9N A;  3S3N A;  4D5F A;  3EUA A;  5D5U B;  1I3A A;  4DOZ A;  4M9Z A;  1LPQ A;  3JRG A;  1YS7 A;  2BY2 A;  3GTM J;  1IDZ A;  1V5G A;  2ZC2 A;  1K7A A;  3PFI A;  1BW5 A;  3L2R A;  4YEJ A;  2JQ7 A;  3Q9V A;  1GT0 C;  4BAC A;  1JKP C;  1HF0 A;  2WA0 A;  1OIS A;  2BY0 A;  2RAE A;  4ASN A;  4WK8 F;  1D1C A;  1GV2 A;  1JTX A;  5L3F A;  3H3U A;  2OA4 A;  3TMO A;  1ZRD A;  3V42 A;  2F4M B;  2KRH A;  3KPH A;  1OQY A;  2QQ9 A;  4LLL A;  1G3W A;  2G7H A;  3K4C A;  3MQ0 A;  1TWC J;  1W7P B;  3BY6 A;  1SD4 A;  2XPU A;  4F91 B;  2EZI A;  1K4T A;  2Z33 A;  2H8R A;  4DZJ A;  3DPT A;  3LAJ A;  2RC4 A;  2L4M A;  1QZE A;  2KZV A;  1FWZ A;  1X19 A;  2LF7 A;  4L9V A;  5DYM A;  2QYO A;  4MEX F;  3DEU A;  1P4W A;  4D9J A;  1Y0N A;  3KP3 A;  3Q9S A;  3BR5 A;  3W2A A;  2NVX J;  2FOW A;  1V5E A;  3ABK H;  2XAQ A;  1IXR C;  2DMP A;  4K2E A;  3CJQ B;  1I6H J;  1ACI A;  3V7S A;  1HDD C;  3BP8 A;  5KAF C;  1SFO J;  4KIC A;  2CMP A;  3WHB A;  1POG A;  1W5T A;  1LB2 A;  2E1C A;  1ZHF A;  3F0C A;  5DM7 F;  5EG0 A;  2M8G X;  3EYI A;  1LE8 B;  2HR3 A;  3G1O A;  4IEJ A;  2MD5 A;  4A3F J;  2XC7 A;  2CUE A;  1BR1 A;  1IZ1 A;  5HDN A;  1GVD A;  4Q48 A;  3LSI A;  5E17 F;  5EG0 B;  1VQM I;  3KZI C;  2LVS A;  5DD8 A;  4KIB A;  1BI3 A;  2HKX A;  3ABL H;  3HB9 A;  3HKZ N;  1UB9 A;  1I27 A;  1ZEL A;  1JGG A;  1D8K A;  1O7L A;  1JJ8 C;  2DYS H;  4N0B A;  3IKV A;  2JUC A;  3MD2 A;  1P7I A;  2ZME C;  2VXD A;  4O6J A;  3WG7 H;  3SDB A;  1BC7 C;  2QLZ A;  4B43 A;  4XIC A;  3JRH A;  2ADU A;  3MN2 A;  3H0D A;  2XAH A;  2KPM A;  1YIJ I;  2CW7 A;  2YR2 A;  3OS2 A;  2MBF A;  3E5U A;  1R6R A;  3T5X A;  5BQT A;  2Z1D A;  2IPQ X;  1X3W B;  2DMT A;  3Q3S A;  4XSX F;  4N9I A;  3VFZ A;  1LDJ A;  1R22 A;  2L7Z A;  4LG0 B;  4X6A J;  4UUT A;  1R49 A;  3CC2 I;  3HUG A;  2LH9 A;  1DUX C;  3TDZ C;  3M8F A;  3RI4 A;  3LFU A;  5JLW A;  1ZG1 A;  4P9U A;  3AFH A;  3WTT C;  4V2F A;  2XRO A;  4LIU A;  2PFB A;  1U6G A;  3LA7 A;  1K78 B;  1MH3 A;  2M3A A;  2CJJ A;  3HJE A;  2R7Q A;  1HST A;  1W5C C;  3E7L A;  2O8K A;  5HLH A;  2DA7 A;  1Z7L A;  1N25 A;  3WU0 A;  4ENN A;  4MNU A;  1YJW I;  3VEP A;  2H6C A;  5E8I A;  4Y3O A;  1BR4 A;  1SFX A;  3N05 A;  5A2Q K;  1T0F A;  2XIG A;  5GPA A;  4M6Y A;  1ETQ A;  2HFH A;  2IRF G;  3TED A;  2LKX A;  1UHS A;  1QRY A;  4L18 B;  2R5Y A;  3JR9 A;  2B0L A;  4RLF A;  4RGX A;  5HOO A;  1R00 A;  4E7J A;  2PMZ A;  4JYK A;  4L9N A;  3D1N I;  1H9T A;  1ZN2 A;  2XF5 A;  2G9W A;  2JK3 A;  4CCM A;  5IT3 A;  1UEL B;  2M4K A;  5EZH A;  4A3M J;  5EEH A;  2DBB A;  4C9Y A;  4FAS D;  2XGE A;  3HZJ A;  1VQ7 I;  3CUQ C;  3E6D A;  2ZJR F;  4GRI A;  5H20 A;  1TTY A;  5EGO A;  1IV8 A;  2LG4 A;  3ML6 A;  3K0L A;  1OMI A;  4I0A A;  1IO2 A;  2N8G A;  3BTL A;  3F8N A;  3CCE I;  1GUU A;  3MZY A;  2VQL A;  1ODD A;  3RKX A;  2AXT C;  2JJ7 A;  3WTV C;  2W48 A;  4UB8 C;  4GYI A;  2FBI A;  4M3E A;  1X4P A;  3WTZ A;  3IV5 A;  1H89 C;  2RQQ A;  2GA2 A;  5H6Q A;  1JT6 A;  4EEF G;  5DS9 A;  1G2H A;  2LRD A;  2EIK H;  2VON A;  1YHQ I;  2R93 J;  4XRF A;  2R7U A;  3H92 A;  1PVE A;  5DDG A;  2Y75 A;  3MKL A;  3DU5 A;  3RYR A;  1SFE A;  1RUN A;  1FP1 D;  2WB1 A;  2FA5 A;  5F0F A;  2X6X A;  4YG2 F;  1J59 A;  1IXS B;  1DU0 A;  3PNY A;  3R0J A;  4EMS A;  2BOL A;  4Q5S F;  3IWF A;  3IWZ A;  4IOC F;  1OR7 A;  4UUS B;  5CVJ A;  1ZQ3 P;  1G3Y A;  3NRV A;  4F55 A;  1BL0 A;  4XNF A;  4NC6 A;  3ZGK A;  3ECO A;  2QQB A;  1PUE E;  1FY7 A;  3ABM H;  4KN4 X;  2EB7 A;  4AVP A;  1T95 A;  2DN0 A;  1R5I D;  2PJR B;  1R71 A;  4Y7N J;  3WGG A;  3DWL E;  4QIW N;  1TT0 A;  2A3S A;  2QVO A;  1D1B A;  4PZJ A;  4UVA A;  3HG9 A;  3Q0U A;  1SD5 A;  2JPC A;  1DU6 A;  3LWF A;  5FD5 A;  1S7E A;  5LGU A;  3OIQ A;  2ZJP F;  1WH7 A;  5JLX A;  6PAX A;  3EUH A;  4MEY F;  3CF2 A;  3GUD A;  1R4N B;  2XGC A;  1NHA A;  2VOD A;  2X51 A;  1ETX A;  2Z16 A;  3JAM K;  2ECC A;  1I3Q J;  4UVC A;  2FNA A;  2ZME B;  3E5X A;  3P9I A;  2DFI A;  4HQM A;  3BC8 A;  2VT2 A;  3FXO A;  3BR0 A;  4RAY A;  4XLH A;  4A12 A;  5HDK A;  2XRL A;  1WJ5 A;  1R4M B;  1DDN A;  3ZQH A;  2NAZ A;  4XR6 A;  3LST A;  1YE9 A;  3CUO A;  2VC1 A;  3ZQI A;  4BXF A;  3B73 A;  2K9S A;  1YRN A;  2DFF A;  2VQC A;  1WSU A;  4LK0 F;  2EBI A;  3I71 A;  5FD6 A;  2XB0 X;  1ITY A;  1OCC H;  3H5R A;  1U8R A;  2YU3 A;  4NNJ A;  4BY1 J;  1RR7 A;  1SFU A;  2PJR A;  3KP4 A;  5CKT A;  3P7N A;  1I1S A;  1VZ0 A;  3BZ6 A;  3AL0 B;  4NQW B;  1E2X A;  1VQ8 I;  1FLI A;  1QPM A;  4CHU A;  2AXL A;  2Y9Y A;  2F6C A;  3DBR B;  2LDU A;  2MC4 A;  2DOA A;  3V4G A;  5J1U A;  3GTK J;  1UG2 A;  1XTA A;  4MFD A;  3W3C A;  2DO7 A;  5L3G A;  4LGW A;  2DA2 A;  2W1O A;  3F8M A;  2EH3 A;  3BT9 A;  3NQO A;  1X3Z B;  4HX8 A;  3QYE A;  4HBL A;  4AUX A;  4YIR X;  4U7B A;  5K7F A;  1D0X A;  4XOT A;  3F3X A;  1GDT A;  2IW5 A;  3L9F A;  4IOA F;  1B9M A;  4DQ2 A;  1LE8 A;  1PUF B;  4P1W A;  5ILS A;  1H88 C;  1VF9 A;  2DK5 A;  4DYQ A;  1UZC A;  2KDO A;  4E7K A;  2YUS A;  4C2M J;  2WWY A;  5H6R A;  3DTI A;  4EV0 A;  2W00 A;  1HQC A;  4II2 A;  4HLY A;  4EM2 A;  2X0L A;  5L3E A;  4E4H A;  2NNY A;  3V8K A;  3E3V A;  4CCK A;  2BHZ A;  2FMY A;  1I6X A;  1SMT A;  1E0E A;  1RKW A;  3H3Z A;  3K9T A;  3WE3 A;  3ZMS A;  2QBY B;  1FC3 A;  1GV5 A;  2O3F A;  3C3W A;  3LMM A;  4W1U A;  5D8K B;  1X1A A;  3FIS A;  1ON2 A;  3FK7 A;  3KCC A;  3O8H A;  4J01 A;  1P9Q C;  3V7R A;  4ZTF A;  4B3X A;  2R3S A;  2VOO A;  4KIT B;  1X2M A;  4HEA 2;  4XKB A;  2KLO A;  3QPL A;  5JR3 A;  2YSR A;  3K4J A;  2QSF X;  2K9Q A;  4BE0 A;  4M3G A;  1M1E B;  2R7O A;  3J80 K;  5LEJ A;  1LEA A;  4IRH A;  4TV7 A;  1XGO A;  4IRI A;  1KON A;  3K4L A;  2A6H F;  5E18 F;  3OYH A;  1BR2 A;  3GME A;  4BDY A;  4XLN F;  1K79 A;  2M2E A;  4RB3 C;  2W4S A;  1E3P A;  2Z3Y A;  3A2K A;  3DLL F;  2EQR A;  2O6G E;  5LHG A;  3NWS A;  1KQ0 A;  1PUF A;  4KT5 C;  3W6J B;  2OPT A;  4PJN A;  1XGN A;  2GZW A;  3G1M A;  5ILV A;  2DK8 A;  4G7O F;  2M7B A;  1HW5 A;  2HWV A;  4IXA A;  4BS9 A;  1I39 A;  2H94 A;  2M0C A;  5F0C A;  4BAY A;  2HPM A;  3S16 J;  5D5V B;  1O57 A;  2FU4 A;  4JX5 A;  1N78 A;  2JT1 A;  1T2K A;  1YS6 A;  2XSD C;  1N77 A;  5J1R A;  3GFL A;  3A01 B;  5IP7 J;  1GLN A;  3I55 I;  2ZFU A;  4DJA A;  1FX7 A;  5E1Z B;  1O3Q A;  3K6G A;  3QYF A;  1TZL A;  5F64 A;  2M7A A;  1FYM A;  1B1B A;  3A02 A;  3HRS A;  3FKI J;  3WGH A;  2FBK A;  3KP2 A;  1RIO H;  4B1R A;  2GXA A;  2DQL A;  1UHM A;  2IA0 A;  3I56 I;  1RRJ A;  1B59 A;  2VL8 A;  1Y1V J;  2HEO A;  1TQM A;  1VQ5 I;  3GTL J;  3Q0V A;  3I4P A;  4MHG A;  4BNC A;  1B8I A;  4OIP F;  3FHN A;  2HQA A;  2GBY A;  4BBS J;  4KIS A;  3OR1 C;  3M1E A;  1REP C;  3TDU C;  2VIX A;  2CQX A;  4G9Y A;  1IXC A;  4D7N A;  1XG1 A;  5JFR A;  2V1D A;  2H8W A;  5B1B H;  4LIT A;  1LNW A;  1MBK A;  3COA C;  3C2G A;  2KL4 A;  4M74 A;  2PMH A;  2WY8 Q;  3OL4 A;  1EH6 A;  2BGC A;  1HXD A;  2JA5 J;  3ZMZ A;  2HYG D;  3D5R C;  5B1A H;  4AIH A;  4WCG A;  4KIG A;  1ZRF A;  4PFO A;  1OR7 C;  2X1E A;  5J8C A;  3IL2 A;  1K83 J;  1AWC A;  2RQP A;  3ZOB A;  5GAG J;  3L2Q A;  3JRB A;  4CSW A;  2ETH A;  2AHQ A;  2HZD A;  3VYT B;  2LLK A;  1KU9 A;  2NOJ B;  1E17 A;  2E7X A;  3OL3 A;  2RVC A;  3GTP J;  1ETV A;  4FE4 A;  3I4N J;  3RZD J;  1S5L C;  1XCB A;  3GVA A;  2XHK A;  3F8F A;  1W36 D;  4AYB N;  1H8A C;  3O8G A;  2CSO A;  4A3E J;  3DTE A;  3BZC A;  1ZRC A;  1BBY A;  3L2C A;  3GX4 X;  2Y0S A;  4BJ5 C;  5IYC J;  2KIF A;  2HDD A;  2BYV E;  5JVT A;  4FTH A;  4KYW A;  3IC7 A;  4CGZ A;  4D1Q A;  2L01 A;  1F5T A;  2V6E A;  3M3Y J;  1V54 H;  2DT6 A;  2XPW A;  4E70 A;  3RPQ A;  1DQU A;  1Y8Q B;  1R5G A;  1HCR A;  2HKO A;  5BPD A;  1DP3 A;  3M4O J;  5FKK A;  1OYI A;  2L54 A;  1HSJ A;  1EA3 A;  1C0W A;  3CCQ I;  5M3F J;  1D0Y A;  2OBP A;  2DXI A;  1XCV A;  2XAG A;  3CES A;  2R7S A;  1EH7 A;  2EFQ A;  1FSE A;  2O61 A;  4XL9 A;  4LLG F;  1U3E M;  3S1Q J;  5CQG A;  4BXU A;  2DJI A;  3H9Q A;  1FTZ A;  1J0R A;  3ZRG A;  1RKT A;  1QZY A;  2QKL B;  5EGO B;  1UG0 A;  2QQA A;  5LGN A;  2KRC A;  3HGY A;  2ZJQ F;  2LNB A;  4O5V A;  3SJM A;  4HX7 A;  2ZSH B;  2CV2 A;  2DMU A;  2P5V A;  2X9D A;  4FE7 A;  4LIV A;  1BJZ A;  2R92 J;  1E3H A;  4HF2 A;  3AG1 H;  1WRJ A;  2UZK A;  1CF7 B;  2PX9 A;  2Q8K A;  3E1S A;  5LFA A;  1K61 A;  2VQH A;  4WXH A;  4ENM A;  1N75 A;  4CO8 A;  1SAX A;  2R4G A;  4FQG A;  2DPU A;  1KQ8 A;  1JT0 A;  3PIP F;  3U1D A;  5ED4 A;  2VJ4 A;  2A5W A;  4LK1 F;  2UXN A;  3GZ5 A;  4B09 A;  5LGT A;  1AKH B;  1XGM A;  2HS5 A;  4A3B J;  1TW3 A;  3GBG A;  1ENH A;  3KP6 A;  5HLG A;  3K1M A;  4AVZ A;  3CCJ I;  4GGG A;  2DA3 A;  4ZYA A;  2MA3 A;  2X1D A;  2JN6 A;  5HOD A;  2OV7 A;  3H5N A;  3HSF A;  2DOD A;  2VBZ A;  2ZBK A;  2O8X A;  4BJ6 C;  3KFW X;  2IS6 A;  2PG4 A;  3K4N A;  4X1E A;  1YIO A;  1R23 A;  4F7Z A;  4O3M A;  1YO5 C;  2ID6 A;  2MGQ A;  2M1B A;  2NS7 A;  9ANT A;  3K70 D;  2KDZ A;  4IQJ A;  1YIT I;  2CYY A;  3ZQF A;  4I2O A;  1P4X A;  1Z0X A;  2CO5 A;  2VBX A;  4D0P A;  4EJV A;  4ZTJ A;  2AO9 A;  2FOK A;  1Z1D A;  1MNM C;  1VQP I;  2HXI A;  2K4J A;  1LVA A;  5FO5 A;  1T6S A;  2CS3 A;  4UV9 A;  3RJP A;  3S17 J;  2FML A;  2IGK A;  2KJC A;  2EV5 A;  2LYC A;  5J3L A;  4DBR A;  2R5Z A;  1OCT C;  3WOD F;  1SEU A;  2D1V A;  3DKX A;  4GXO A;  4XLE A;  4ZJZ A;  3T1B A;  4XLP F;  1USS A;  4U87 A;  2LRE A;  2O7O A;  2NVT J;  4YFK F;  2MLK A;  3W6K B;  4EJU A;  2M30 A;  5K7Z A;  3F22 A;  5LHH A;  1Z6T A;  4UUV A;  1O3S A;  4NC7 A;  5D5W B;  1MSF C;  5L3C A;  4A3D J;  2EIN H;  2MLG A;  4PDK A;  3DEW A;  3OOU A;  2MFZ A;  1BOA A;  1WVR A;  1D1A A;  1WZ2 A;  1LFB A;  2W25 A;  5F08 A;  5JHU A;  2V9K A;  4EJO A;  3LSH A;  2BZT A;  5BPI A;  2MH9 A;  2D45 A;  4HPQ A;  1AKH A;  1OYY A;  4XN0 A;  2CGP A;  2COM A;  2ID3 A;  2QKM B;  2KIM A;  3OYA A;  5TRD A;  3RZO J;  1YJN I;  2EA4 A;  3ELK A;  3HBL A;  2D2W A;  1IV6 A;  4BEH B;  5K5O A;  3CZ6 A;  2BXZ A;  5J6X A;  2K9N A;  1OJL A;  3PM1 A;  2L0K A;  2QBY A;  3ECH A;  2MC3 A;  3QAH A;  2Q0O A;  3LSG A;  4KUM A;  4FET A;  4E7S A;  1QQI A;  3K7A J;  3K70 C;  1TW2 A;  3GTO J;  4M9X A;  3ZN1 A;  5HLT A;  3C2H A;  2HI3 A;  1A6Q A;  3GW2 A;  5E20 A;  1R5H A;  2BY3 A;  4LOC A;  4I6Z A;  1Z05 A;  5FGM A;  1F9N A;  4CA0 A;  2HXO A;  5GAH J;  3CCU I;  2YPR A;  5CQE A;  3OYL A;  1A36 A;  2BW3 A;  3M07 A;  3AG2 H;  2O5R A;  4LD5 A;  4IHW A;  4N9H A;  1BIA A;  2I8D A;  2HOT A;  1FMW A;  4MO7 A;  3K2Z A;  1A04 A;  2LMD A;  4WX9 A;  2XAJ A;  1WJB A;  1MBG A;  5EZG A;  5FRO A;  3B6C A;  2ZNY A;  5F1R A;  2EWN A;  1SD6 A;  5KK1 A;  3IUO A;  2JSC A;  1KU7 A;  4WWC A;  2OZ6 A;  3KIO A;  2JA6 J;  1ORK A;  3A03 A;  1BI0 A;  2CFX A;  2K7L A;  4XRS G;  2OAZ A;  2E2H J;  1FMV A;  4A0X A;  4GYG A;  1OCZ H;  3EUK L;  1WPK A;  2IVM A;  2Z2S B;  1WJC A;  3SZP A;  2XVC A;  4HZF A;  2O0Y A;  4WXC A;  3I59 B;  4CYC B;  4CH7 A;  3CCM I;  3HDD A;  1LDD A;  4BQO A;  2P81 A;  4RM2 A;  2R5Y B;  2K02 A;  2XB5 A;  2XDV A;  4KNY A;  3IH2 A;  1X2N A;  2BHY A;  4C2T A;  2GA1 A;  4G94 A;  4AWX B;  4A0Z A;  1SVO A;  2A69 F;  1HOM A;  4ON0 A;  1FOK A;  4BE1 A;  2OQR A;  2ZKZ A;  5ICE A;  3HOT A;  4RMN A;  3S2D J;  5EJC A;  4U0W A;  2GLO A;  2L4A A;  3KLO A;  1K4S A;  5K5Q A;  5DCF A;  2E1O A;  3OS1 A;  4YRV A;  3NWT A;  5BNG A;  3KEQ A;  2VUM J;  2F5E A;  3NEU A;  1JXS A;  1STZ A;  5F1J A;  1XSX A;  3ZN0 A;  1LUJ B;  4HNU A;  1PP8 F;  5DCM A;  2L2O A;  1WH5 A;  2L3D A;  2UXX A;  3DTK A;  1D5V A;  1AA7 A;  2P6T A;  3OYJ A;  2ESN A;  5KHD A;  2KMU A;  1DPU A;  4ENK A;  1S9H A;  2NVY J;  2WAQ N;  2H09 A;  3S3M A;  2DFH A;  3CF5 F;  3FXK A;  3OYM A;  4M71 A;  1HW1 A;  1VTN C;  2E2J J;  2DMQ A;  3PO3 J;  3GFI A;  1Y0U A;  3OWT A;  1VQ6 I;  2DDA A;  3BG5 A;  5FLM J;  5J8F A;  3WTW C;  3P5J A;  1Y8R B;  1MND A;  4HDU A;  1IF1 A;  4IHS A;  1YW9 A;  4Y13 A;  3DLA A;  4B44 A;  4CCN A;  5HNF A;  3CCV I;  3PSI A;  1JJ6 C;  3LSJ A;  5CJ9 A;  5GPC A;  1QHH D;  1IUY A;  2CUF A;  3VYS B;  3HIF A;  5IPA A;  3CJN A;  3HKZ A;  2QM3 A;  2ELH A;  5J47 A;  2NRA C;  4G8X A;  4ESF A;  2JPB A;  4OWR B;  2OTL I;  2CUZ A;  3ZMT A;  2FUG 2;  4M3F A;  5FB2 A;  1FT9 A;  2NXN B;  3F9K A;  4XKW A;  4BKX A;  3QU6 A;  3S14 J;  3FM5 A;  1FBS A;  2VJJ A;  1S72 I;  4HV6 A;  2VE9 A;  1J2X A;  1WWX A;  2QEN A;  4Y15 A;  3H35 A;  2VBW A;  4KT6 A;  3RCO A;  4IHX A;  1V55 H;  2WTE A;  1B6A A;  3A0H C;  2EFP A;  1S3J A;  4HF0 A;  2F4O B;  2B7E A;  5C44 J;  3LQR A;  1VQN I;  3KZZ A;  1YI2 I;  1Z21 A;  4YFX F;  1HKQ A;  1S29 A;  1WKM A;  3I9V 2;  4AYB A;  4S05 A;  3J7A O;  5DD4 A;  2HOE A;  1X4O A;  1XSD A;  5DUK A;  2V26 A;  4U7D A;  2VJ5 A;  5E3O A;  1U5T B;  5IOY A;  2B9S A;  4EVI A;  2ESH A;  4JBA A;  2R7R A;  3EQL F;  5HDG A;  3ASO H;  3BDD A;  3FXJ A;  3TW7 A;  3JSP A;  1A35 A;  1I5Z A;  2D1H A;  3SEZ A;  2HQN A;  3J7Z I;  4HNV A;  4UV8 A;  1PYV A;  3S93 A;  3QP6 A;  3RKQ A;  3TO7 A;  2V6C A;  4XSZ F;  2E5N A;  3PUB A;  4BGD A;  5FFZ A;  2KQR A;  3BR2 A;  2Y0S N;  1JTY A;  1ZR4 A;  1X58 A;  1UCR A;  3F23 A;  3BR3 A;  3LA2 A;  1ONV A;  3U9G A;  3H3V K;  1IGN A;  1ZGA A;  2JMW A;  2EZK A;  3JTH A;  3C18 A;  4MQ9 F;  4QTR A;  4RDU A;  4UY8 I;  5EEA A;  4Y17 A;  2IT0 A;  3PL8 A;  2IA2 A;  2RDP A;  3LNQ A;  3LOC A;  1FOX A;  1W1W E;  2BBY A;  4BY7 J;  3CP8 A;  4PSX A;  2XGD A;  5CLS A;  3L2V A;  5CVR A;  5BOX A;  2WY7 Q;  1QU3 A;  1TBX A;  3CD6 I;  5IT9 Z;  4ZDP A;  4EQQ A;  3MFK A;  1IN7 A;  3DPL C;  5EYR A;  4ZZL A;  4ZYE A;  5EDN A;  3IKT A;  3EYY A;  1XC5 A;  2BVM A;  5M5X J;  3PQK A;  3UR3 C;  2RV8 A;  4IZZ A;  3HOV J;  1U2W A;  3ROU A;  1ZLK A;  3I59 A;  1JHF A;  4I09 A;  4CYC A;  4R79 A;  5LLQ A;  1R1T A;  1O3T A;  3LAP A;  2CH0 A;  3DPU A;  2L7F P;  3V8J A;  3I0T A;  5HVQ C;  4A3K J;  3OYN A;  1WJF A;  2HTJ A;  2FF4 A;  3SYT A;  4PJM A;  1PP7 U;  4KMU X;  1IG7 A;  1Z67 A;  5ICF A;  4II3 A;  4UUS A;  2BEO A;  2EZL A;  3JCU C;  4IJA A;  4EJT A;  3CME I;  2ZO4 A;  2FQ3 A;  2K4B A;  5FKL A;  3RSN A;  1U8B A;  2PN6 A;  2VQG A;  1RI7 A;  3EUH C;  1I1G A;  2A07 F;  4HX4 A;  1X1B A;  5L3B A;  4A5M A;  4P9F A;  3KYD B;  2JVH A;  4DBQ A;  2DA6 A;  3IAS 2;  1BA5 A;  4F52 A;  4UXN A;  3HYI A;  3LL7 A;  2DYR H;  1DGR M;  3OOP A;  3PQJ A;  1TC3 C;  2IBD A;  3VB2 A;  3FZV A;  2A05 A;  1A5J A;  4I01 A;  5FLX Z;  1KU3 A;  3F6O A;  2DPD A;  2AQE A;  1JUS A;  2E5Z A;  4MLO A;  2KZG A;  1X1D A;  2Q2E B;  3G3Z A;  1IDY A;  1ETK A;  1MZB A;  3SFZ A;  3TW6 A;  3CLO A;  2LOO A;  2FEZ A;  2L7K A;  3B6A A;  3C7J A;  4L9T A;  1JI8 A;  4G7H F;  3G1L A;  2P5L C;  2V9V A;  2QSG X;  4WXD A;  4XID A;  2HDC A;  1F1Z A;  4FX4 A;  2I5U A;  1W0T A;  4PGG A;  1J09 A;  5B3S H;  1MSE C;  4LMY A;  2KJB A;  2STT A;  4V19 K;  3VOE A;  2XGX A;  3DQV C;  1T8I A;  4A2U A;  2PI0 A;  2QQ8 A;  3KX2 A;  2VKE A;  2TCT A;  4D5C A;  1G4D A;  2VAS A;  3HRT A;  2L9S A;  3MWM A;  5GTH C;  3HOW J;  2HPI A;  3IAM 2;  4XLC A;  1FIA A;  5ICG A;  1EV7 A;  2HQ5 A;  3UKG A;  1XMX A;  1WJD A;  2VE8 A;  3MKY B;  3HOX J;  2O9L A;  1TWG J;  2HU9 A;  4HF1 A;  4IX7 A;  3HRU A;  3A1Y A;  3H9J A;  3FXU A;  3ZPL A;  2NS0 A;  5E1X A;  3TP3 A;  4PFP A;  4KDP A;  2LF8 A;  1B9N A;  2A5Y B;  3MCZ A;  3RDI A;  4F93 B;  3WU1 B;  2ECB A;  4G12 A;  3S32 A;  2P7C B;  3MEX A;  2X1C A;  1P7J A;  2V1X A;  5F6F A;  4PUS A;  2BE5 F;  2VKH A;  2K27 A;  2PQ8 A;  1YW7 A;  1TQI A;  4G6D A;  4KFC A;  2G7U A;  2GOM A;  3DKW A;  4PGH A;  4XKV A;  2R7W A;  2X6W A;  1Q1H A;  3K10 A;  3AL0 C;  4XN3 A;  5IP6 A;  3OSF A;  5D8L B;  4KMF A;  4DIQ A;  1JKR C;  2M8E A;  4MTD A;  1IRG A;  4ZH4 F;  3F6V A;  4B4C A;  3J81 Z;  3JRE A;  1ZLJ A;  3U2R A;  2VBY A;  4HRI A;  2WV0 A;  3BR1 A;  1XGS A;  1RZ4 A;  2ACJ A;  1HA8 A;  2JUG A;  3C2B A;  3H36 A;  4LG3 A;  3TBI A;  3FHZ A;  3F21 A;  4XQF A;  2V1U A;  2IS1 A;  2DCE A;  4ENJ A;  2RN7 A;  3FMQ A;  4WF2 A;  4BJT A;  4GDF A;  1WGX A;  4JOM A;  3GCM A;  4X0G A;  2LY1 A;  2RRE A;  5H2F C;  1YG2 A;  5M3M J;  4IVN A;  5GAD J;  3CMM A;  4N4N B;  2I10 A;  4IHV A;  1ZK8 A;  3QPT A;  2NYX A;  3HHG A;  2CV0 A;  4J00 A;  2EA2 A;  3TGN A;  1BM9 A;  3ZXS A;  4A3J J;  2L9N A;  5JI6 A;  3IRR A;  1FSH A;  1VQO I; 
#chains in the Genus database with same CATH homology
 4UNO A;  1EH8 A;  4RGS A;  4ESJ A;  3WTS C;  3SHF A;  2XKP A;  3GF2 A;  2P8T A;  3L7W A;  2OD5 A;  4M9S A;  4RAZ A;  4OMZ A;  1ZG5 A;  1JGS A;  4S04 A;  5AIQ A;  1QZZ A;  3J81 K;  2UWM A;  3ZMU A;  5ICC A;  2K86 A;  3BRO A;  3HHH A;  3RTR A;  2VXZ A;  4BQA A;  4EGY A;  1D3Y A;  4P55 A;  2OQG A;  1YFH A;  3R0A A;  3FXQ A;  1SD7 A;  5FLX K;  1FZP B;  2YX4 A;  1HKS A;  4CYD A;  4NQW A;  2XRN A;  2HZT A;  2KIU A;  2VOP A;  5K5R A;  3AAF A;  3FMS A;  4U0V A;  2W24 A;  4LLN A;  2P6S A;  3T8T A;  3HSE A;  1QO0 D;  4YIF A;  1G3S A;  3CUQ B;  3MZH A;  4M72 A;  2ZME A;  1ZGJ A;  1O7F A;  3E6M A;  2FXA A;  1KU2 A;  3KEO A;  4Q4Z F;  1BI1 A;  3L09 A;  3QP5 A;  3I53 A;  2EK5 A;  4JK1 X;  2BV6 A;  3D5L A;  2A6E F;  4JQF A;  1L0O C;  1BJA A;  4EJW A;  1ZAO A;  2P7V B;  2ZFW A;  1GXP A;  1MKM A;  2ZCW A;  3KLN A;  2ZJ2 A;  3T0Y A;  2PEX A;  4LFU A;  4EGZ A;  1TNT A;  4OIQ F;  2W57 A;  3BPV A;  2DT5 A;  1YLF A;  3R6S A;  2F2E A;  3OV8 A;  4M73 A;  3HOS A;  1AOY A;  1ZH5 A;  3I58 A;  2PBI A;  1YQA A;  3TQN A;  2PJP A;  1Z91 A;  1HBX G;  4M6X A;  2XAS A;  2GAU A;  3GXO A;  1UHW A;  4HV5 A;  1IN5 A;  3JW4 A;  2H6B A;  1QBJ A;  3I5U A;  1RUO A;  4HA8 A;  4CZZ A;  3JTG A;  2J5O A;  3T8R A;  1T38 A;  3VOD A;  3MAJ A;  3WE2 A;  2W85 A;  4OU0 A;  1SMY F;  2FRH A;  2F5C A;  1R1U A;  1ZRE A;  1GHC A;  2J5P A;  5LBQ A;  4MGR A;  2DI3 A;  1FBQ A;  1FPQ A;  3R61 A;  3I64 A;  5CVV A;  4CXF A;  3BJA A;  1V3F A;  1TLH B;  4RB1 A;  1ZYR F;  1OYW A;  1W5S A;  1KA8 A;  1KGS A;  2L02 A;  3S2W A;  1U5T C;  2M45 A;  1MJA A;  1UST A;  1BN5 A;  5HS7 A;  4HAM A;  2ISZ A;  4FX0 A;  3DV8 A;  2ZNZ A;  5KVR A;  3ZMD A;  2P5K A;  3KET A;  3DP7 A;  3E6C C;  4ZYH A;  2DAO A;  4A6E A;  4KN7 X;  3E5Q A;  5DEQ A;  2FBH A;  4ZZD A;  3F8B A;  5LHI A;  2QUF A;  2TDX A;  2CG4 A;  1RNL A;  2JTV A;  1TQP A;  3DXJ F;  4RGR A;  3BJ6 A;  5D4R A;  4HYE A;  3V8L A;  2XUB A;  2EV6 A;  4KIF A;  1MD0 A;  1YW8 A;  1FNN A;  2VC0 A;  5TJJ A;  5HLI A;  4XBF A;  3JSO A;  5K1Y A;  2R7D A;  3RKW A;  3ZMV A;  4BH9 A;  2PLY A;  3SQN A;  3LQQ A;  1XB4 A;  3KP5 A;  2QZ8 A;  5E1W A;  2GWR A;  3HTS B;  4LB6 B;  1ULY A;  2EFO A;  1Z9C A;  3GYH X;  3TO9 A;  4ESB A;  1P2F A;  4UHT A;  2V79 A;  1BC8 C;  2IA1 A;  2DTR A;  1WQ2 A;  1XDS A;  1XSV A;  2MH2 A;  4KA4 A;  1ON1 A;  2LKP A;  3KZY A;  5DV5 A;  4R1H A;  3M9A A;  5E8G A;  4HQE A;  3GO5 A;  1H9G A;  1T39 A;  2QWW A;  1PDN C;  5D4S A;  4MTE A;  1HKT A;  1FYK A;  3CO7 C;  4OMY A;  2XV4 S;  2P4W A;  2A68 F;  4L5I A;  1GVJ A;  4L0Z B;  2F5F A;  3B02 A;  3EET A;  5EEG A;  4RB0 A;  3GFJ A;  3TOB A;  2HGC A;  4ZYG A;  3R60 A;  5BMZ A;  1JHH A;  3TOA A;  4RB2 C;  3E6B A;  3ABU A;  2NNN A;  1BI2 A;  3HSR A;  5IT9 K;  2E7W A;  2XAF A;  2HYF A;  4EM1 A;  3SXY A;  4LG0 A;  4RGU A;  3IRQ A;  5D5X B;  1IRF A;  2DLL A;  1U78 A;  1LJ9 A;  3DF8 A;  1J7K A;  2CWE A;  2GQQ A;  1H0M A;  1LDK B;  3SZT A;  3FWE A;  3G73 A;  3FM3 A;  2VT3 A;  1DPR A;  1K78 A;  2DW4 A;  2XKO A;  5CYV A;  4ETS A;  3QOP A;  5HS8 A;  3BJO A;  3E97 A;  5HS9 A;  4LB5 A;  3QU3 A;  3Q5F A;  3CTA A;  3N4M A;  4NHJ A;  4YII A;  2E1N A;  4BHB A;  3V7C A;  4HDV A;  5BS6 A;  1XDU A;  3WTY C;  5L3D A;  3BOQ A;  1J5Y A;  4QWQ A;  4AD9 A;  2STW A;  3R4K A;  1J75 A;  4L0Y B;  2X4H A;  3KP7 A;  4B8X A;  1XN7 A;  1T98 A;  3HRM A;  4U88 A;  3F8C A;  1XMA A;  5LEK A;  5DUI A;  1P4A A;  3O6B B;  3RPU A;  1DP7 P;  1J9I A;  1S8N A;  2M5W A;  4I98 B;  4L9J A;  1QNT A;  3CUQ A;  3GLX A;  2DQR A;  3D0S A;  1D8J A;  1F4K A;  1MDM B;  4GO1 A;  3TO6 A;  1FP2 A;  4HW0 A;  4G6Q A;  1IN4 A;  2A61 A;  1V4R A;  5CVU A;  3QPH A;  3I54 A;  3LFK A;  4CIC A;  3O3K A;  1MDM A;  4U0Y A;  1HW2 A;  2ZXJ A;  1FBU A;  3EDP A;  2M87 A;  1IN8 A;  2C6Y A;  3WTU C;  4Q47 A;  4BHC A;  4IRG A;  1U5T A;  4P5O A;  4GCV A;  4YFN F;  1YYV A;  4QLC U;  3C1D A;  2W84 A;  2FE3 A;  1G6N A;  1LEB A;  2IJL A;  3N97 A;  3GEZ A;  2HQR A;  4AIK A;  4BYY A;  2RGV A;  2IP2 A;  2Y48 A;  4AIJ A;  1YTY A;  2Q2E A;  1BIB A;  1X3U A;  1XMK A;  4MQV A;  4L5J A;  1MGT A;  5ERI A;  1K6O A;  4A6D A;  3RKY A;  1R1V A;  1W4M A;  4OIO F;  4CDG A;  2VN2 A;  4A5N A;  1UFM A;  1KYW A;  1XD7 A;  4DNC A;  3BPX A;  2O03 A;  2EFW A;  1KQ9 A;  1R7J A;  3WGI A;  3FXR A;  3O2P E;  5LRS A;  1IW7 F;  3WG9 A;  4HLX A;  1G3T A;  4EM0 B;  5D6E A;  3GZ6 A;  2LSO A;  3K1N A;  2R7F A;  4LJZ F;  5ILU A;  3ERE D;  1OPC A;  3IHU A;  3FMR A;  2H27 A;  5CVI A;  2YX7 A;  1WI9 A;  4FT8 A;  4H0E A;  3L00 A;  4ZYD A;  3DFG A;  4UVB A;  4R8H A;  3CO6 C;  1MJ9 A;  2KRF A;  1IAW A;  2EJR A;  1R36 A;  2WC2 A;  1CF7 A;  3J80 Z;  1QGP A;  4P96 A;  3ZQ7 A;  5AIP A;  2Y0M A;  2DU9 A;  4OOI A;  1JE8 A;  1MJB A;  2EFN A;  5AON A;  4IHT A;  4I02 A;  3P9K A;  1P6R A;  2EV0 A;  5LRR A;  4IPA A;  2Z9O A;  2GIV A;  3K1P A;  3JAM Z;  3K69 A;  2KKO A;  1W7P D;  3QRF F;  2CW0 F;  3ABT A;  2HTS A;  3LA3 A;  3ULQ B;  4G7Z F;  1S7O A;  3KE2 A;  3FX3 A;  3CDH A;  1Z7U A;  3P9C A;  4FHT A;  3GWZ A;  2FSW A;  2F5D A;  1S7A A;  2JRT A;  3RIR A;  2ISY A;  3WTX C;  3ZP5 A;  1L3L A;  3HTU A;  3ISP A;  1B4A A;  2JZY A;  1ZG3 A;  5DCM B;  4A0Y A;  2GXB A;  2CQK A;  3RYP A;  1S6L A;  4OIN F;  1O3R A;  4OIR F;  1GXQ A;  2Z99 A;  1W7P A;  1TNS A;  1KYZ A;  3BWG A;  2FNP A;  2OZU A;  3TKY A;  1R58 A;  2RNJ A;  4BHP A;  3GFM A;  2PMU A;  4I7H A;  2Z5U A;  2RKH A;  2AS5 F;  4IF4 A;  1FYL A;  5FFX A;  3F72 A;  2OU2 A;  3REO A;  2GXG A;  4NB5 A;  1Z6R A;  5D6F A;  1P92 A;  1OKR A;  3M7G A;  1IN6 A;  4I0B A;  3M8E A;  4PCQ A;  4HOB A;  4RS8 A;  3FF5 A;  1LQ1 A;  1CGP A;  1ZAR A;  5A2Q Z;  4Z2Y A;  5D5U B;  4M9Z A;  1YS7 A;  1K7A A;  3PFI A;  3Q9V A;  4ASN A;  4WK8 F;  5L3F A;  3H3U A;  2OA4 A;  1ZRD A;  2QQ9 A;  4LLL A;  1G3W A;  2G7H A;  3MQ0 A;  1W7P B;  3BY6 A;  1SD4 A;  2Z33 A;  3LAJ A;  3DPT A;  2L4M A;  2RC4 A;  1FWZ A;  2LF7 A;  4L9V A;  5DYM A;  2QYO A;  4MEX F;  3DEU A;  1P4W A;  3KP3 A;  3Q9S A;  2XAQ A;  1IXR C;  4K2E A;  3V7S A;  3BP8 A;  4KIC A;  1W5T A;  1LB2 A;  2E1C A;  1ZHF A;  3EYI A;  2HR3 A;  2MD5 A;  5HDN A;  1IZ1 A;  4Q48 A;  5E17 F;  5DD8 A;  4KIB A;  1BI3 A;  2HKX A;  1UB9 A;  1I27 A;  1D8K A;  1O7L A;  4N0B A;  3IKV A;  4O6J A;  1BC7 C;  2QLZ A;  2ADU A;  2XAH A;  2YR2 A;  2MBF A;  3E5U A;  3T5X A;  5BQT A;  2IPQ X;  4XSX F;  4N9I A;  3VFZ A;  1LDJ A;  1R22 A;  4LG0 B;  3HUG A;  1DUX C;  3TDZ C;  3M8F A;  3RI4 A;  1ZG1 A;  4P9U A;  3WTT C;  2XRO A;  2PFB A;  1U6G A;  3LA7 A;  1K78 B;  1HST A;  5HLH A;  3WU0 A;  4ENN A;  4MNU A;  3VEP A;  2H6C A;  5E8I A;  1SFX A;  5A2Q K;  1T0F A;  2XIG A;  4M6Y A;  2HFH A;  2IRF G;  4L18 B;  2B0L A;  5HOO A;  4RGX A;  1R00 A;  4L9N A;  1H9T A;  1ZN2 A;  2G9W A;  5IT3 A;  5EEH A;  2DBB A;  3CUQ C;  3E6D A;  5H20 A;  1TTY A;  3ML6 A;  3K0L A;  1OMI A;  4I0A A;  3F8N A;  3MZY A;  1ODD A;  3RKX A;  3WTV C;  4GYI A;  2FBI A;  3WTZ A;  2GA2 A;  5H6Q A;  2VON A;  4XRF A;  3H92 A;  5DDG A;  2Y75 A;  3RYR A;  1SFE A;  1RUN A;  1FP1 D;  2FA5 A;  1J59 A;  4YG2 F;  1IXS B;  3R0J A;  4EMS A;  4Q5S F;  3IWF A;  3IWZ A;  1OR7 A;  5CVJ A;  1G3Y A;  3NRV A;  3ECO A;  2QQB A;  1PUE E;  1FY7 A;  4KN4 X;  2EB7 A;  4AVP A;  3WGG A;  2A3S A;  2QVO A;  4PZJ A;  4UVA A;  1SD5 A;  2JPC A;  3LWF A;  5FD5 A;  5LGU A;  6PAX A;  3EUH A;  4MEY F;  3GUD A;  1NHA A;  2VOD A;  3JAM K;  4UVC A;  2FNA A;  2ZME B;  3E5X A;  3P9I A;  2DFI A;  4HQM A;  2VT2 A;  4RAY A;  4A12 A;  5HDK A;  1DDN A;  2NAZ A;  3LST A;  3CUO A;  2VC1 A;  3B73 A;  1WSU A;  4LK0 F;  3I71 A;  5FD6 A;  1U8R A;  2YU3 A;  1SFU A;  3KP4 A;  3P7N A;  1I1S A;  3BZ6 A;  1E2X A;  1FLI A;  1QPM A;  4CHU A;  2AXL A;  2LDU A;  3V4G A;  2DO7 A;  5L3G A;  4LGW A;  3F8M A;  3NQO A;  4HX8 A;  4HBL A;  4U7B A;  3F3X A;  2IW5 A;  3L9F A;  1B9M A;  4DQ2 A;  5ILS A;  2DK5 A;  2WWY A;  5H6R A;  4EV0 A;  1HQC A;  4HLY A;  4EM2 A;  2X0L A;  5L3E A;  2NNY A;  3V8K A;  3E3V A;  2FMY A;  1I6X A;  1SMT A;  3H3Z A;  3K9T A;  3WE3 A;  3ZMS A;  2QBY B;  1FC3 A;  2O3F A;  3C3W A;  5D8K B;  1ON2 A;  3KCC A;  3V7R A;  2VOO A;  2R3S A;  5JR3 A;  2YSR A;  3J80 K;  5LEJ A;  1LEA A;  4IRH A;  4TV7 A;  1XGO A;  4IRI A;  2A6H F;  5E18 F;  4XLN F;  1K79 A;  4RB3 C;  2Z3Y A;  2O6G E;  5LHG A;  1KQ0 A;  4KT5 C;  3W6J B;  1XGN A;  2GZW A;  5ILV A;  2DK8 A;  4G7O F;  1HW5 A;  2HWV A;  4IXA A;  2H94 A;  4BAY A;  5D5V B;  1O57 A;  2FU4 A;  2JT1 A;  1T2K A;  1YS6 A;  3GFL A;  1FX7 A;  5E1Z B;  1O3Q A;  5F64 A;  1FYM A;  1B1B A;  3WGH A;  3HRS A;  1RIO H;  2FBK A;  3KP2 A;  2DQL A;  1UHM A;  2IA0 A;  1B59 A;  2HEO A;  1TQM A;  3I4P A;  4MHG A;  4OIP F;  4BNC A;  3M1E A;  1REP C;  3TDU C;  4G9Y A;  1IXC A;  5JFR A;  2V1D A;  1LNW A;  3COA C;  4M74 A;  2PMH A;  1EH6 A;  2BGC A;  1HXD A;  3ZMZ A;  2HYG D;  4AIH A;  4WCG A;  4KIG A;  1ZRF A;  3IL2 A;  5J8C A;  1AWC A;  2RQP A;  2ETH A;  1KU9 A;  1E17 A;  2E7X A;  2RVC A;  1XCB A;  3GVA A;  2XHK A;  3F8F A;  2CSO A;  1ZRC A;  1BBY A;  3L2C A;  3GX4 X;  2KIF A;  2BYV E;  5JVT A;  4KYW A;  3IC7 A;  4CGZ A;  2L01 A;  1F5T A;  4E70 A;  3RPQ A;  1R5G A;  2HKO A;  5BPD A;  1OYI A;  2L54 A;  1HSJ A;  1C0W A;  2OBP A;  1XCV A;  2XAG A;  1EH7 A;  2EFQ A;  1FSE A;  2O61 A;  4LLG F;  1U3E M;  4BXU A;  1J0R A;  1QZY A;  2QQA A;  5LGN A;  2LNB A;  4O5V A;  4HX7 A;  2P5V A;  4HF2 A;  1WRJ A;  2UZK A;  1CF7 B;  2Q8K A;  4WXH A;  4ENM A;  2DPU A;  4CO8 A;  1SAX A;  1KQ8 A;  3U1D A;  5ED4 A;  4LK1 F;  2UXN A;  3GZ5 A;  4B09 A;  5LGT A;  1XGM A;  2HS5 A;  1TW3 A;  3KP6 A;  5HLG A;  3K1M A;  4GGG A;  2MA3 A;  3HSF A;  2VBZ A;  2ZBK A;  2O8X A;  3KFW X;  2PG4 A;  1YIO A;  1R23 A;  4F7Z A;  4O3M A;  1YO5 C;  2M1B A;  2CYY A;  4I2O A;  1P4X A;  4D0P A;  2CO5 A;  2VBX A;  4EJV A;  1Z1D A;  2FOK A;  2K4J A;  1LVA A;  5FO5 A;  1T6S A;  4UV9 A;  3RJP A;  2FML A;  2KJC A;  2EV5 A;  3WOD F;  2D1V A;  4GXO A;  3T1B A;  4XLP F;  1USS A;  4YFK F;  2MLK A;  3W6K B;  4EJU A;  2M30 A;  3F22 A;  5LHH A;  1Z6T A;  4UUV A;  1O3S A;  5D5W B;  5L3C A;  2MLG A;  4PDK A;  1BOA A;  2W25 A;  5JHU A;  4EJO A;  5BPI A;  2MH9 A;  2D45 A;  1OYY A;  2CGP A;  2COM A;  2KIM A;  5TRD A;  2EA4 A;  3ELK A;  2D2W A;  5K5O A;  5J6X A;  2QBY A;  3ECH A;  2MC3 A;  3QAH A;  2Q0O A;  4KUM A;  1QQI A;  1TW2 A;  4M9X A;  3ZN1 A;  3GW2 A;  5E20 A;  1R5H A;  1Z05 A;  5FGM A;  1F9N A;  2YPR A;  4LD5 A;  4N9H A;  1BIA A;  3K2Z A;  1A04 A;  4WX9 A;  2XAJ A;  2ZNY A;  5F1R A;  2EWN A;  1SD6 A;  5KK1 A;  2JSC A;  1KU7 A;  4WWC A;  2OZ6 A;  1BI0 A;  2CFX A;  2K7L A;  2OAZ A;  4A0X A;  4GYG A;  2IVM A;  3SZP A;  2XVC A;  4HZF A;  2O0Y A;  4WXC A;  3I59 B;  1LDD A;  2K02 A;  4KNY A;  2GA1 A;  4G94 A;  4AWX B;  4A0Z A;  2A69 F;  4ON0 A;  1FOK A;  2OQR A;  2ZKZ A;  5ICE A;  3HOT A;  4U0W A;  2L4A A;  3KLO A;  5K5Q A;  5DCF A;  3KEQ A;  1JXS A;  2F5E A;  3NEU A;  1STZ A;  1XSX A;  3ZN0 A;  1PP8 F;  5DCM A;  2L3D A;  2UXX A;  1D5V A;  2P6T A;  2ESN A;  1DPU A;  4ENK A;  2H09 A;  4M71 A;  1HW1 A;  1VTN C;  3GFI A;  1Y0U A;  5J8F A;  3WTW C;  4IHS A;  4HDU A;  1IF1 A;  1YW9 A;  4Y13 A;  5CJ9 A;  1IUY A;  3HIF A;  3CJN A;  2QM3 A;  2ELH A;  2NRA C;  4G8X A;  4ESF A;  2JPB A;  3ZMT A;  5FB2 A;  1FT9 A;  3QU6 A;  3FM5 A;  1FBS A;  4HV6 A;  2VE9 A;  1J2X A;  1WWX A;  2QEN A;  4Y15 A;  2VBW A;  2WTE A;  1B6A A;  2EFP A;  1S3J A;  4HF0 A;  3LQR A;  3KZZ A;  4YFX F;  1HKQ A;  1S29 A;  1WKM A;  4S05 A;  3J7A O;  5DD4 A;  2HOE A;  1XSD A;  5DUK A;  4U7D A;  1U5T B;  4EVI A;  2ESH A;  4JBA A;  3EQL F;  5HDG A;  3BDD A;  3JSP A;  1I5Z A;  2D1H A;  2HQN A;  4UV8 A;  3QP6 A;  3TO7 A;  2V6C A;  4XSZ F;  5FFZ A;  3F23 A;  1UCR A;  3LA2 A;  1ONV A;  3U9G A;  1ZGA A;  3JTH A;  3C18 A;  4MQ9 F;  4Y17 A;  2IT0 A;  2IA2 A;  2RDP A;  2BBY A;  5CLS A;  5CVR A;  5BOX A;  1TBX A;  5IT9 Z;  4EQQ A;  3MFK A;  1IN7 A;  3DPL C;  4ZZL A;  3IKT A;  4ZYE A;  3EYY A;  3PQK A;  2RV8 A;  1U2W A;  3ROU A;  1ZLK A;  3I59 A;  1JHF A;  4I09 A;  4R79 A;  5LLQ A;  1R1T A;  1O3T A;  3LAP A;  3V8J A;  3I0T A;  5HVQ C;  2HTJ A;  2FF4 A;  1PP7 U;  4KMU X;  5ICF A;  2BEO A;  4IJA A;  4EJT A;  2ZO4 A;  2FQ3 A;  2K4B A;  2PN6 A;  1RI7 A;  2A07 F;  1I1G A;  4HX4 A;  5L3B A;  4A5M A;  4P9F A;  4UXN A;  3HYI A;  3PQJ A;  3OOP A;  3VB2 A;  3FZV A;  4I01 A;  5FLX Z;  1KU3 A;  3F6O A;  2DPD A;  3G3Z A;  1MZB A;  3SFZ A;  3CLO A;  2FEZ A;  4L9T A;  3C7J A;  4G7H F;  2P5L C;  2V9V A;  4WXD A;  2HDC A;  1F1Z A;  4FX4 A;  4PGG A;  4LMY A;  2KJB A;  2STT A;  3VOE A;  2XGX A;  3DQV C;  4A2U A;  2PI0 A;  1G4D A;  3HRT A;  3MWM A;  5ICG A;  1EV7 A;  2VE8 A;  4HF1 A;  3HRU A;  3FXU A;  3ZPL A;  2NS0 A;  5E1X A;  4KDP A;  2LF8 A;  1B9N A;  2A5Y B;  3MCZ A;  3RDI A;  3WU1 B;  2P7C B;  3MEX A;  2V1X A;  5F6F A;  2BE5 F;  2K27 A;  2PQ8 A;  1YW7 A;  1TQI A;  4G6D A;  4KFC A;  2G7U A;  3DKW A;  4PGH A;  1Q1H A;  5D8L B;  4KMF A;  2M8E A;  4MTD A;  1IRG A;  4ZH4 F;  3F6V A;  3J81 Z;  1ZLJ A;  3U2R A;  2VBY A;  2WV0 A;  1XGS A;  1RZ4 A;  2ACJ A;  3FHZ A;  3F21 A;  2V1U A;  4ENJ A;  2RN7 A;  3FMQ A;  4WF2 A;  1YG2 A;  4IVN A;  3QPT A;  2NYX A;  3HHG A;  2EA2 A;  3TGN A;  1BM9 A;  5JI6 A;  3IRR A;  1FSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...