4HLYA

The complex crystal structure of the dna binding domain of virf-1 from the oncogenic kshv with dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
KASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K9
publication title The crystal structure of the DNA-binding domain of vIRF-1 from the oncogenic KSHV reveals a conserved fold for DNA binding and reinforces its role as a transcription factor.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Dna binding protein/dna
total genus 30
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hlyA00
2YX4A 3RPUA 1XD7A 1XGSA 3C18A 1BC8C 1KYZA 5CVVA 4EGZA 2EV5A 2IP2A 2C6YA 2IPQX 2ZFWA 4R1HA 2ETHA 4UV8A 3LQRA 3E6MA 3DF8A 4ENKA 5L3CA 1BIBA 3SFZA 1ZGAA 1YO5C 5D5UB 4KUMA 3ZMSA 1P4XA 1IN4A 5LGTA 4WXHA 1TQIA 2VT3A 4D0PA 5HDGA 1R22A 2XHKA 4OMZA 2M87A 3L7WA 2VOOA 1KU2A 4ZYEA 2F5DA 2STTA 4M9XA 2PMHA 4EM1A 3WGIA 3I59B 4ENMA 3F21A 4B8XA 4TV7A 1KQ8A 3EYYA 2PJPA 1REPC 1J75A 3Q5FA 5F6FA 3WTTC 2P7VB 3P9KA 5LGUA 4M6XA 2ISYA 3GVAA 4OIRF 2XKPA 1J5YA 1JHHA 4QLCU 4OMYA 5E1WA 1XSVA 1IZ1A 1JHFA 2AXLA 2CG4A 1ON1A 3FM5A 4BYYA 2V1UA 3J7AO 1FP2A 2A5YB 3QPTA 2HS5A 4PGHA 4EV0A 2LKPA 3GF2A 5HLGA 1G3YA 1ZG1A 1K7AA 3BROA 1I1SA 4CHUA 4EQQA 1I5ZA 1ZRFA 4L9JA 4LMYA 2X4HA 2IW5A 1LJ9A 2G9WA 1BOAA 3R0AA 3QP5A 2DK8A 5FB2A 4HQEA 1Z91A 2XKOA 1IN5A 4LG0B 3F8NA 2E1CA 4NB5A 1FBQA 1PP8F 4R79A 1FYLA 1J59A 3CUQB 1CF7B 4GYIA 4KN7X 3J81K 4P55A 1YIOA 4IXAA 2EJRA 3TO9A 2QZ8A 2DPDA 2BEOA 1Q1HA 3RJPA 1T38A 3T0YA 1G3SA 2VBZA 4OIQF 1V3FA 5D5VB 1E2XA 3FHZA 5DUKA 5BMZA 2Z99A 3WGHA 1DUXC 1OYWA 3V8KA 1P4AA 5F1RA 1RUNA 1HW2A 1T2KA 4MQVA 1HW1A 1BI3A 4AIJA 3EQLF 5ILSA 3PQJA 4UVCA 4G6QA 2XRNA 1J9IA 3EYIA 5K5RA 3T8RA 4A2UA 4KDPA 3WG9A 2UXXA 3ZMDA 2W57A 4LK0F 1D8KA 2DK5A 1OMIA 4I0BA 3ZN1A 1IN8A 3P9IA 5J6XA 3O6BB 1DPUA 2ZJ2A 3KP5A 4BHCA 2G7UA 4ON0A 4WWCA 3MZHA 3S2WA 3ABTA 1ZRCA 3ZMZA 5ICCA 1IN7A 2PBIA 2DAOA 1O3QA 3QOPA 3BY6A 3FXQA 2BV6A 1O57A 1U5TA 3HTUA 1U3EM 1ZH5A 4BH9A 5JHUA 1YW9A 2EFQA 3E6DA 1P6RA 3V7SA 1HSJA 2XV4S 2Q0OA 3LAPA 4KIGA 5F64A 3TOAA 2UXNA 1BM9A 1HBXG 5CYVA 3ML6A 1O7FA 1VTNC 3QP6A 1R23A 4YG2F 3VB2A 4LLGF 1PDNC 2F5FA 3HRMA 5E20A 3ZMUA 2ISZA 2M5WA 2EFNA 2Z9OA 1YG2A 1KU7A 2RV8A 5LGNA 1IXSB 2FOKA 5HLHA 2STWA 4HA8A 3CUOA 3ECHA 3ISPA 4B09A 2HWVA 4WF2A 4KMUX 5HVQC 5ILVA 1S7OA 2XAGA 1K78A 3ZMVA 4HX4A 2E7XA 5IT9K 4N0BA 2GXGA 3PFIA 3NEUA 4Z2YA 3WTWC 3F6OA 5JFRA 2GQQA 3M9AA 4OINF 1SD4A 5DYMA 2A3SA 1KU3A 4M6YA 2NNYA 2CW0F 3IRRA 1O3TA 1YFHA 1ZLKA 1FC3A 3W6JB 5E8GA 1QZYA 1SD5A 1G4DA 1KU9A 3I53A 2EFPA 3HHGA 1E17A 1FX7A 4U7BA 3I0TA 2VONA 4NQWA 1FNNA 2WV0A 4Q48A 5CVJA 2GA2A 3H3ZA 2ZCWA 4O3MA 4I2OA 1XMKA 1UHWA 2P8TA 5DCMA 4RAZA 3K69A 4ASNA 3ECOA 1DDNA 1RNLA 1SD7A 3JSOA 2O3FA 1FOKA 2JTVA 2JT1A 1UCRA 1I27A 2RGVA 4XSXF 2EA4A 4WCGA 2W25A 3L2CA 4A0ZA 4PZJA 3L09A 4G8XA 1P2FA 2DPUA 2P5KA 4BAYA 2HOEA 1Z05A 1R5GA 2GAUA 3KP4A 5TJJA 3HIFA 1ZLJA 4HW0A 4FX4A 1P4WA 1BI0A 1XDSA 1AWCA 3K1PA 3KP3A 1WKMA 1TQPA 2ZBKA 4HF1A 2DT5A 4IHSA 4KMFA 4FT8A 4PDKA 1B9MA 1MKMA 3F22A 5FD5A 2COMA 4I98B 1HW5A 2FQ3A 1YS7A 1PUEE 4EMSA 4ZYHA 3IRQA 2L4AA 1YW7A 4GO1A 1XGMA 1FYMA 1FP1D 2DQRA 2DI3A 2VOPA 3KZYA 2PMUA 2DO7A 1IF1A 2D2WA 2MBFA 5HDNA 1H0MA 3DXJF 3BJOA 4M72A 3QU6A 2V1DA 1ZREA 2DW4A 4AWXB 4AD9A 5A2QZ 2K4BA 3DV8A 3L9FA 4ZH4F 2OBPA 1X3UA 4WXCA 4HF2A 4BQAA 4HAMA 1B4AA 2IJLA 3LAJA 2FSWA 4P5OA 5KK1A 4Y15A 4CZZA 2IA0A 2HFHA 4H0EA 3ZQ7A 2XAFA 3DQVC 2FNAA 1ZAOA 4YIFA 4E70A 3DKWA 1BIAA 2R7FA 2VBYA 4G94A 2ZXJA 3HRTA 4XRFA 3GFLA 2PN6A 2M1BA 1D3YA 3WTZA 1JE8A 3MFKA 4LB6B 1IN6A 1H9TA 1BI1A 3D0SA 3HUGA 3WE2A 5BPDA 1MZBA 2JRTA 2R3SA 3E97A 4U88A 3GFJA 1FSHA 2XAQA 2BBYA 2V9VA 3R6SA 2MLKA 2PEXA 5IT3A 1FSEA 4N9HA 3T1BA 2QUFA 2J5PA 1YW8A 1HSTA 3I59A 1XMAA 3FMQA 5K5OA 3JAMZ 5LHHA 3BPVA 1XN7A 3QAHA 3OV8A 5LHGA 2HQNA 5DEQA 1LNWA 2LNBA 2QQAA 3TDZC 4MTEA 3ELKA 1G6NA 4EJTA 3GZ5A 3F8CA 3EDPA 5EEHA 2HEOA 4L0ZB 1ONVA 2XUBA 3ROUA 1F5TA 2HTSA 1O3RA 2A61A 2FA5A 4RGSA 1ODDA 2OAZA 5H6QA 3LA3A 5E17F 3MZYA 3EETA 1R00A 3MQ0A 4RB0A 1EH7A 4EM2A 1ZHFA 3WGGA 2K4JA 3R61A 1MJBA 4LGWA 3BP8A 1J0RA 2KIUA 1IRFA 1LDDA 1NHAA 4HDVA 2Z3YA 4CGZA 3C7JA 4IPAA 1QO0D 3V4GA 4EJVA 4LG0A 4HZFA 3SZPA 1IRGA 4U0VA 2XIGA 2PQ8A 3CUQA 3I71A 1CF7A 5FLXK 4M9ZA 1BBYA 3O3KA 4MHGA 3J80Z 2V1XA 2MLGA 3R60A 2FF4A 2BE5F 2KIFA 3MCZA 3M1EA 1SAXA 4ESBA 4RB2C 2UWMA 5K1YA 2IVMA 3SQNA 2G7HA 4M9SA 4HLXA 5L3DA 4G7ZF 2BYVE 3LSTA 2D1HA 4KNYA 4KFCA 4KT5C 3JW4A 4GGGA 2MC3A 2OZ6A 2FMLA 2HZTA 2HDCA 3I4PA 5K5QA 3HHHA 5E8IA 2VC1A 1HKTA 2EB7A 3V8JA 2ACJA 3TGNA 3G3ZA 3I58A 2GWRA 4I02A 3WTUC 3O2PE 4LJZF 4YFKF 4O5VA 2NYXA 3JSPA 1K79A 5H6RA 5D8KB 2WWYA 2M45A 3MEXA 1GHCA 3BWGA 5HS8A 3SZTA 3GO5A 1EV7A 1Y0UA 2A69F 3L00A 1LEAA 2OU2A 3E6BA 3JTGA 5D5WB 3DFGA 2AS5F 4EJWA 1Z9CA 5LEKA 2NAZA 2Y0MA 3I64A 3WTSC 1XGOA 3H3UA 5D6EA 3FMSA 1OYIA 3RPQA 2GA1A 1T39A 1ZG3A 1ULYA 4I09A 1U2WA 1FPQA 4CICA 5LRSA 5D4RA 4KYWA 1FLIA 1B59A 3LA2A 4UHTA 2TDXA 1LDKB 4XBFA 2O0YA 1YLFA 4U0WA 5FFXA 3K2ZA 2JSCA 1AOYA 1OKRA 4AIKA 1FYKA 2JZYA 3ABUA 1D5VA 1T6SA 2UZKA 1TW3A 4BNCA 1P92A 1USSA 5LLQA 4DNCA 4P9FA 3AAFA 4RAYA 1TW2A 1S7AA 5ERIA 4KA4A 1EH6A 3DPTA 2FRHA 4M74A 5JVTA 2E1NA 3IWFA 3GYHX 2P7CB 4N9IA 5D8LB 2PFBA 2MA3A 5A2QK 2ZMEB 4I01A 2WTEA 2RNJA 2Q8KA 5HDKA 5L3GA 2HYGD 2O6GE 2DQLA 2HKXA 4M71A 1A04A 2RDPA 1F4KA 1R58A 1IXCA 2QYOA 5ED4A 5E18F 4EM0B 5DD4A 4IF4A 4A6DA 3R0JA 1MDMA 3HSEA 3ZN0A 4BHBA 3FXRA 2YSRA 4LLLA 5LRRA 1W5SA 3ZP5A 3GLXA 4UVBA 4DQ2A 3RKWA 1LDJA 2XROA 3IC7A 1KQ0A 2A6EF 3F8FA 4JK1X 1MDMB 1XGNA 1RUOA 2H09A 3DEUA 3HRUA 3I5UA 3EUHA 5DDGA 3GZ6A 3TDUC 5AIQA 1FBUA 4A12A 2VBWA 4LFUA 2DBBA 1KGSA 2VE9A 4ZZLA 3QPHA 4UUVA 3NQOA 2FBKA 4A0XA 1W7PD 4KICA 2CGPA 4L0YB 1TNSA 4CXFA 1U5TC 3JAMK 3HTSB 2L3DA 4ESJA 1WI9A 3IWZA 5BS6A 3CLOA 5CVRA 2CQKA 3FM3A 1TNTA 3G73A 2V6CA 3KP6A 1U78A 3HOTA 4Q5SF 3W6KB 2HYFA 2FBHA 1YYVA 3V8LA 1SMYF 3WE3A 4GCVA 1XCBA 4L9VA 2H94A 2YR2A 3IKVA 2H27A 2MD5A 4EJOA 1I1GA 2CO5A 2IA2A 4RB3C 4RGUA 4KN4X 2HR3A 4UVAA 2ZKZA 1S8NA 5BPIA 4MGRA 2XAJA 1USTA 2M8EA 5L3BA 5CVIA 3E5UA 3E5QA 1XSDA 5LBQA 1MD0A 5HS7A 2K86A 3U1DA 1OYYA 1ZARA 2FEZA 4A6EA 3GFMA 4IRGA 1ZRDA 1K6OA 2K02A 3KCCA 1QQIA 1O3SA 2E7WA 4G9YA 4I0AA 2QWWA 2CWEA 4FHTA 4UV9A 4LK1F 2VXZA 3F3XA 2OA4A 2DFIA 1B9NA 1TTYA 4CO8A 1QBJA 3I54A 3K1NA 4AVPA 5J8CA 5L3FA 3MAJA 3WTYC 2CFXA 2QLZA 1DP7P 3J80K 4ZZDA 4MQ9F 5CJ9A 5IT9Z 1IW7F 3QU3A 3GEZA 1SFEA 1F1ZA 1EH8A 2OZUA 1W7PB 1T0FA 3F8MA 2Z33A 2XAHA 3BJ6A 2Y75A 2KIMA 1JGSA 3GFIA 2Z5UA 1L3LA 4G7HF 5ILUA 1GVJA 2DTRA 2HTJA 4L5JA 4BHPA 2P6SA 2PI0A 3RI4A 1UHMA 2VT2A 2R7DA 1SMTA 2P4WA 3B73A 5ICEA 2K7LA 1KYWA 2IA1A 3KLNA 2NRAC 3GXOA 2HKOA 3LFKA 1BI2A 1FZPB 1XB4A 4YFNF 2L54A 1XDUA 4Q4ZF 4WK8F 4IRIA 4P9UA 1MJAA 2EFWA 1S6LA 5HS9A 1R1VA 2B0LA 4PCQA 2K27A 4QWQA 3BPXA 3F6VA 2FU4A 6PAXA 1V4RA 3CO7C 3WTVC 2FE3A 4M73A 3TKYA 3JTHA 3D5LA 1FY7A 3NRVA 1FWZA 5E1ZB 2KKOA 3K0LA 2KRFA 3KZZA 2H6BA 4RS8A 5D5XB 3CO6C 5TRDA 2P5VA 1XCVA 2EA2A 4MNUA 3VEPA 5HOOA 4CDGA 2RKHA 2FBIA 3GWZA 5BQTA 2FMYA 3Q9SA 3LQQA 1B6AA 4WXDA 1Z6TA 2O61A 2NS0A 4KIBA 4IVNA 4L9NA 2W84A 2YU3A 3TQNA 2ZNYA 4ZYGA 3MWMA 2HGCA 4G6DA 2M30A 5LEJA 4IHTA 5LHIA 3HOSA 1Z1DA 2W24A 4IRHA 1PP7U 2NNNA 3K1MA 4GXOA 3GX4X 4FX0A 4P96A 2GXBA 3RIRA 1HKQA 1BN5A 2LDUA 3RKYA 4ENNA 2VBXA 2ESHA 2EFOA 4RGRA 3M8FA 2JPBA 4LD5A 2FXAA 2VC0A 3WTXC 3ULQB 1DPRA 1IAWA 1OR7A 1FBSA 4L18B 3K9TA 2QQBA 2DLLA 4U0YA 3REOA 3HSRA 2CSOA 1IXRC 2L4MA 2YPRA 1WRJA 1YS6A 1WWXA 1J7KA 2RN7A 3WU0A 3KLOA 1O7LA 2L02A 4LLNA 5FGMA 1JXSA 3HSFA 1QNTA 1TBXA 5DCFA 1LVAA 3ZPLA 1G3TA 2ADUA 2O03A 1QPMA 1R1TA 3KP2A 3E3VA 2XASA 3FF5A 1KQ9A 1RIOH 4JBAA 1RZ4A 3M7GA 3CJNA 1J2XA 3Q9VA 1QZZA 1SFXA 2OQRA 3F72A 2ELHA 4L5IA 1STZA 1WQ2A 1QGPA 2QVOA 3RYRA 5BOXA 2VE8A 5DV5A 1WSUA 1SFUA 3ZMTA 3VOEA 2F5EA 2VODA 3RTRA 1CGPA 4AIHA 2A07F 1HQCA 3VFZA 2X0LA 3IKTA 3KP7A 1W4MA 3LA7A 3PQKA 2KJCA 2Y48A 3LWFA 2A6HF 4LB5A 1R7JA 1FT9A 3BDDA 3T5XA 4YFXF 1GXPA 2YX7A 3TOBA 4HYEA 4XLPF 4HF0A 1R5HA 4ETSA 4Q47A 2LF7A 4S05A 3FWEA 3E6CC 3HRSA 3CUQC 3FXUA 3P9CA 4OU0A 2MH2A 1HXDA 1U6GA 3R4KA 5HLIA 2ZMEA 1G3WA 3BZ6A 2CYYA 5CLSA 1L0OC 5FD6A 4HV6A 2OD5A 4S04A 3CDHA 3GUDA 2PG4A 5H20A 3DP7A 4HDUA 2RVCA 2ESNA 2P5LC 5JR3A 1U5TB 1Z7UA 2BGCA 5FLXZ 5FFZA 4OIOF 1TLHB 1R36A 2H6CA 1HKSA 2PLYA 1D8JA 4UXNA 3KE2A 2KJBA 5JI6A 2WC2A 2F2EA 3V7CA 2V79A 4F7ZA 1C0WA 3TO7A 1XSXA 4HX7A 2XGXA 3KEQA 1YTYA 3J81Z 1ZG5A 4RGXA 1ON2A 5DUIA 3F8BA 1H9GA 3TO6A 4ZYDA 3FMRA 4EVIA 4UNOA 2L01A 4A5MA 4JQFA 2FNPA 1F9NA 5KVRA 3SHFA 3COAC 1LEBA 1I6XA 4EGYA 2W85A 2DU9A 4IJAA 4HLYA 1R1UA 1K78B 4HV5A 2P6TA 5J8FA 4I7HA 1S29A 3KEOA 3M8EA 5ICGA 2ZO4A 2O8XA 2EK5A 3H92A 5AIPA 2LSOA 3OOPA 4NHJA 5AONA 1LB2A 5D4SA 2EV0A 3QRFF 3RDIA 1MJ9A 4MTDA 3N97A 1BC7C 5FO5A 2GIVA 5ICFA 4R8HA 4RB1A 2ZNZA 4Y13A 1U8RA 2OQGA 3IL2A 4A0YA 4HOBA 3C1DA 1OPCA 2J5OA 2GZWA 4ESFA 1UB9A 1GXQA 3T8TA 4HBLA 5EEGA 3DPLC 4U7DA 3BJAA 4WX9A 5E1XA 5DCMB 2VN2A 4XSZF 1SD6A 3KFWX 4Y17A 3GW2A 5D6FA 2QBYA 2QENA 3FX3A 3U9GA 1ZYRF 4KIFA 3CTAA 3F23A 2RQPA 1IUYA 3WODF 2IRFG 2QQ9A 2A68F 1ZGJA 1S3JA 1ZN2A 4EJUA 2QBYB 2LF8A 2MH9A 3RKXA 4GYGA 3KETA 4BXUA 4K2EA 4G7OF 4ENJA 1B1BA 2RC4A 2XVCA 2EWNA 3BOQA 3ERED 3N4MA 2HQRA 1W7PA 2QM3A 3P7NA 1TQMA 3U2RA 3SXYA 4HQMA 1MGTA 4A5NA 3VODA 2D45A 5L3EA 1KA8A 4HX8A 2D1VA 3C3WA 4O6JA 4YIIA 3HYIA 4OIPF 3RYPA 4OOIA 1W5TA 5DD8A 2IT0A 3IHUA 1T98A 4MEYF 2Q2EA 5CVUA 4MEXF 4CYDA 1BJAA 2F5CA 3E5XA 3WU1B 3FZVA 4XLNF 1LQ1A 4L9TA 1YQAA 1RI7A 3B02A 3V7RA 1UFMA 4PGGA 1Z6RA 2JPCA 2EV6A
chains in the Genus database with same CATH superfamily
2YX4A 4C3IJ 3RPUA 3OS1A 1W36C 2F5VA 1WI3A 2Y31A 4HRIA 3C2BA 1XD7A 4BXFA 1XGSA 1N25A 3C18A 1SVLA 1G2HA 1BC8C 1KYZA 3FK6A 1BOBA 2ZXWH 3VYSB 5J1RA 5CVVA 5CPRB 4HSRA 4J01A 3C2HA 2E2IJ 1VQKI 1VNDA 4EGZA 2M7BA 2EV5A 2IP2A 2C6YA 2IPQX 3MN2A 1RKWA 2ZFWA 4R1HA 2L9VA 2ETHA 4XKCA 4UV8A 3LQRA 2LREA 3MKWB 2CMPA 2JA5J 3E6MA 3DF8A 2E5NA 3HUGB 4ENKA 5L3CA 1BIBA 3SFZA 2Z16A 1BR1A 1ZGAA 1YO5C 5D5UB 5EG0A 4KUMA 3OMYA 3ZMSA 3BR1A 1P4XA 2B9SA 3S15J 1FIPA 1IN4A 1MMNA 2WAQA 5LGTA 4WXHA 1JI8A 3DTIA 1WH5A 5FRMA 1TQIA 2VT3A 4DIQA 3K4NA 5HDGA 4D0PA 1R22A 2XHKA 3K4CA 4OMZA 1X1CA 3ABKH 3LSKA 3AL0C 2M87A 2L7FP 3L7WA 3ZQQA 2VOOA 1ZQ3P 2N8GA 1KU2A 1DGRM 3K4KA 4ZYEA 4BJ6C 2F5DA 5J4VA 2STTA 4M9XA 2PMHA 4EM1A 3WGIA 3SZGA 3I59B 3WG7H 4E6KG 3V42A 4ENMA 3F21A 4B8XA 4TV7A 5B3SH 1KQ8A 1ZGWA 4ANJA 3EYYA 2PJPA 1W1WE 2V9PA 1YJNI 2L0KA 3Q5FA 1J75A 1REPC 1MBHA 1G8XA 4XM3A 5F6FA 3WTTC 2P7VB 3P9KA 3A01A 5LGUA 4M6XA 1WJBA 2ISYA 2UV1A 3GVAA 4OIRF 5M5YJ 4A3DJ 2XKPA 3HL2A 2R7RA 1J5YA 1JHHA 2KIQA 4S0HB 4J00A 4QLCU 4F93B 5B1BH 4XRSA 3OL3A 4OMYA 1V5EA 3BC8A 5E1WA 4B47A 1XSVA 1IZ1A 1JHFA 2EINH 4D7NA 2AXLA 4E7SA 2CG4A 1ON1A 3OYIA 1QPIA 3FM5A 4BYYA 1Z0XA 4NC8A 3UR3C 2V1UA 3J7AO 1FP2A 2A5YB 3I55I 3QPTA 2HS5A 5F0CA 2R7QA 4PGHA 4EV0A 3ESWB 2K9SA 3S17J 3A01B 2OV7A 4QPOA 2LKPA 3GF2A 5HLGA 2DMNA 4ITVA 1G3YA 3JRAA 1ZG1A 1K7AA 3BROA 1X1AA 1XC5A 4HNUA 1LPQA 1I1SA 1T0FC 2VPRA 4CHUA 3L2UA 4EQQA 1I5ZA 3NAUA 2ID6A 1ZRFA 3I9V2 5IY5H 1Z21A 4L9JA 4PJ0C 4LMYA 2X4HA 2IW5A 3MKZA 3GCMA 2E71A 3HM5A 3J7ZI 4A3GJ 1IV6A 3BQYA 1LJ9A 2G9WA 3NWTA 1BOAA 3R0AA 1P7JA 2X85A 3S3NA 3PUBA 2E34A 3QP5A 2DK8A 2KDZA 5J3LA 3Q0UA 5FB2A 2OCCH 4XKVA 1Z91A 2XKOA 4HQEA 1IN5A 4LG0B 3F8NA 4FISA 4NB5A 1FBQA 1H8AC 2E1CA 3A2KA 1PP8F 5JLXA 3VSLA 4R79A 2RQQA 2R7VA 1N75A 1FYLA 1J59A 3CUQB 3VYRB 1CF7B 2Y69H 4GYIA 4KN7X 3J81K 4P55A 1YIOA 4IXAA 1D0YA 4IQ4A 2EJRA 3TO9A 3CCLI 1MBGA 2QZ8A 3CJQB 2NS8A 4E7JA 2UUZA 2DPDA 1X4PA 2BEOA 1Q1HA 3RJPA 4EEFG 1T38A 1WJFA 3T0YA 1G3SA 2VBZA 4OIQF 1V3FA 5KAIC 2R5ZA 4CYCB 5D5VB 1E2XA 4DW6A 1ZR4A 2K40A 3FHZA 5DUKA 2OF7A 4AIDA 4C3HJ 4C2MJ 5BMZA 2Z99A 3G6EI 3WGHA 3CCMI 1LVKA 5K7HA 3HOZJ 2HOAA 3ZCOA 2OCEA 1DUXC 1OYWA 3BTJA 1P4AA 2EPFA 3FXLA 3V8KA 3GTGJ 5F1RA 5C4JJ 1RUNA 5M3FJ 1HW2A 1D1AA 1T2KA 4MQVA 2DFFA 1HW1A 2HDDA 1BI3A 4AIJA 2K85A 3TL4X 3EQLF 1NK3P 5ILSA 3PQJA 4UVCA 4G6QA 4ZDPA 1VQ7I 2R5ZB 4BDZA 2XRNA 2FOWA 2NVUB 1J9IA 2HU9A 2WA0A 3EYIA 5K5RA 4D1QA 3T8RA 4B1RA 4A2UA 4KDPA 3AG1H 3HXLA 4KITB 2NS7A 3QYFA 3ZQFA 3WG9A 2CV1A 2UXXA 2FD5A 3ZMDA 2M0MA 2L9NA 2W57A 3OYKA 2V9KA 4B48A 4LK0F 2E1OA 2VXDA 1D8KA 3A0BC 2DK5A 4CZCA 4A3IJ 2IGOA 5M5XJ 3K4JA 5JVGF 2IBDA 1SFKA 2EIKH 3SDBA 1OMIA 4I0BA 3ZN1A 1IN8A 3H9QA 3P9IA 5J6XA 3O6BB 4XORA 4GRIA 4HNTA 1DPUA 2ZJ2A 1UZCA 2HZDA 3OYNA 5EGOB 3KP5A 2X9DA 4BHCA 2G7UA 4ON0A 4WWCA 3MZHA 3OR1C 3S2WA 3ABTA 2B7EA 1ZRCA 1LFBA 3ZMZA 2M0CA 4XMYA 2ID3A 4AC0A 1R71A 2E2HJ 1IC8A 1LFUP 2R7SA 5ICCA 1IN7A 2PBIA 4OAYA 4RAFA 2DAOA 1E0EA 3BQZA 1O3QA 3QOPA 3BY6A 1ENHA 3QQAA 3FXQA 2BV6A 1O57A 1U5TA 2IAIA 3HTUA 4XKWA 3W3CA 5K7FA 4BH9A 1U3EM 1ZH5A 4BQQA 4XIDA 5EZGA 1RKTA 1YW9A 5JHUA 1W0TA 2EFQA 3E6DA 3HGYA 3QPSA 1P6RA 1WHUA 3V7SA 4CCOA 1HSJA 2XV4S 4LIVA 4Y3OA 2Q0OA 3LAPA 4KIGA 5F64A 4KISA 3TOAA 2UXNA 1B72A 2CV2A 1S72I 2BHYA 3H5AA 1BM9A 1HBXG 2COBA 5CYVA 3ML6A 4IL6C 1O7FA 1LUJB 2JK3A 1VTNC 3QP6A 2LKSA 3Q0VA 2LC2A 1MW7A 2XC7A 2XSDC 1R23A 3D5SC 2L9SA 2JUGA 4YG2F 3H3VK 1XTAA 3VB2A 1JUPA 4ZTJA 2O9LA 4LLGF 1PDNC 4YIRX 1YX5A 2F5FA 3A03A 4BBRJ 2MW8A 3HRMA 5E20A 4BKXA 3ZMUA 4BEHA 3MMYB 3OYLA 2M5WA 2EFNA 2ISZA 2Z9OA 3OWTA 1YG2A 1Z3XA 1KU7A 2RV8A 5LGNA 1IXSB 2FOKA 5HLHA 3SEQA 1RESA 1B72B 2STWA 4HA8A 3CUOA 3ECHA 1YRNA 2GOXB 1YJ9I 3W6VA 3ISPA 2JQ7A 4B09A 2HWVA 4WF2A 4IQJA 1TWHJ 2IXSA 4PUSA 4KMUX 3B6AA 3DU5A 5HVQC 1X1BA 1MBFA 5ILVA 3FXKA 1S7OA 2XAGA 4B3AA 1K78A 3ZMVA 4HX4A 5GTHC 3FIWA 1DU0A 4XONA 2E7XA 2E1MB 4N0BA 5IT9K 2GXGA 4EATA 3PFIA 4BEHB 3NEUA 4Z2YA 3WTWC 1U9NA 3QWLA 1MMAA 1G59A 3F6OA 5JFRA 2GQQA 1YRNB 2JVGA 3M9AA 4OINF 2NOJB 1SD4A 3BLYA 5DYMA 2A3SA 2P81A 1VI0A 1KU3A 4M6YA 1FMVA 2CW0F 2NNYA 3IRRA 2X1DA 1O3TA 3OYJA 4PK4A 1YFHA 4Y4RA 3ZRGA 1ZLKA 3OIOA 1FC3A 3W6JB 3BTCA 1QZYA 1SD5A 5E8GA 1G4DA 3JREA 1KU9A 3I53A 2EFPA 3W2AA 3FKJA 3HHGA 1E17A 1FX7A 1RR7A 4U7BA 3I0TA 2GM4A 2VONA 4NQWA 2DA5A 2R5YA 2HOSA 3IAS2 1FNNA 2WV0A 4Q48A 5CVJA 2GA2A 3H3ZA 3HG9A 3PO2J 2ZCWA 4O3MA 2FUG2 5E3NA 4I2OA 1QA6A 1XMKA 2CUEA 1UHWA 2P8TA 5DCMA 5GAGJ 2R7XA 4RAZA 1WH7A 3K69A 2L9RA 2ZXIA 4ASNA 2FX0A 3ECOA 4FE4A 4W1UA 3BG3A 2CH0A 1DDNA 1RNLA 4BDYA 4FETA 1SD7A 3JSOA 2O3FA 2HVSA 2VQCA 2OC6A 1FOKA 2JTVA 2JT1A 1UCRA 1LE8A 1I27A 1JTXA 2RGVA 4XSXF 3A0HC 3RCOA 2EA4A 4WCGA 2YU9J 3DEWA 2W25A 4A0ZA 3L2CA 4PZJA 3L09A 3OY9A 4G8XA 2ME0A 1P2FA 2DPUA 2XF6A 2ZMEC 2P5KA 1A35A 4BAYA 2LY9A 4DZJA 3CD6I 2IS1A 2HOEA 1Z05A 1R5GA 1VQMI 1V5FA 5GADJ 2GAUA 3KP4A 5TJJA 3HIFA 1ZLJA 4ZDOA 3X2QH 4HW0A 4FX4A 1P4WA 4N4OB 1BI0A 2HQ5A 2FJ1A 1JJ8C 1XDSA 1AWCA 3K1PA 2LRDA 3KP3A 1WKMA 1TQPA 2ZBKA 1XS9A 4HF1A 2DT5A 1AKHB 2EZIA 2NVQJ 4IHSA 4KMFA 4FT8A 4PDKA 1B9MA 1HDDC 1MKMA 4M6VA 3F22A 3OIQA 1WCMJ 1W5CC 5FD5A 2COMA 4I98B 2DMUA 1HW5A 2FQ3A 1YS7A 1FOYA 1PUEE 1IJWC 4EMSA 2BOLA 3IP4B 4PJNA 2DN0A 4ZYHA 1OFCX 3IRQA 2L4AA 4HG2A 1YW7A 4GO1A 1QVUA 1XGMA 1B8IA 1WPKA 1T33A 4E7KA 1FYMA 1FP1D 2DQRA 4M3GA 5KAFC 2DI3A 2ZJPF 2VOPA 3EUKL 3KZYA 2PMUA 2DO7A 1RRJA 3ASNH 4Y33A 1IF1A 2D2WA 2MBFA 5HDNA 1H0MA 2LFBA 3DXJF 3BJOA 4M72A 2CW7A 2VJIA 3QU6A 2V1DA 1ZREA 2DW4A 4AWXB 4XR6A 4AD9A 5A2QZ 1WZ2A 2K4BA 3DV8A 1MSEC 2DA1A 3L9FA 4ZH4F 2OBPA 4AM3A 2CJJA 1X3UA 3BTLA 4WXCA 3OSFA 5IYBJ 1MNDA 4HF2A 2MD0A 4XLAA 5IP6A 4BQAA 4HAMA 3WU2C 1B4AA 1SEUA 3AL0B 2IJLA 4A3JJ 2P0WA 2ELKA 2F4OB 2FSWA 3LAJA 4P5OA 5B66C 1MBEA 3CDIA 1JGGA 5KK1A 3DEEA 4Y15A 4CZZA 1QRYA 2IA0A 2HFHA 4H0EA 1ETVA 3ZQ7A 1DU6A 2XAFA 1R5ID 2FNAA 3DQVC 2TCTA 5BNGA 1ZAOA 4YIFA 1X2NA 4E70A 1IG7A 3CCUI 2I5UA 3DKWA 4M3EA 1BIAA 2R7FA 3CF5F 2VBYA 1EKEA 4G94A 3CP2A 1NG7A 2ZXJA 3LFUA 2AO9A 4QSHA 2VI6A 3HRTA 3PO3J 4XRFA 4N4NB 3TMOA 3GFLA 2PN6A 2Y0SN 2X6YA 2M1BA 1D3YA 3JRFA 3WTZA 4E7HA 1JE8A 3MFKA 3CLQA 4LB6B 2VKDA 1IN6A 4FQGA 1VFCA 1H9TA 1BI1A 3D0SA 3HUGA 5EZHA 1Z7LA 2GXAA 3GTJJ 3WE2A 1WVRA 2LLKA 3H36A 5BPDA 1MZBA 2F4MB 1BW6A 2JRTA 2R3SA 3E97A 3PJRA 3DLAA 3HZJA 4U88A 3CQZJ 5LD2C 2K9LA 3QODA 4B4CA 3BG6A 3GFJA 3DTEA 1HLVA 4D7MA 1FSHA 3GLLA 5J4YA 3S1RJ 2XAQA 1I50J 2BBYA 4D5CA 2XSJC 2V9VA 3E7LA 3R6SA 2DYRH 2MLKA 2BHZA 3PUFA 4D5FA 2PEXA 3CESA 3BR5A 5CQGA 5IT3A 2CUFA 2ZSHB 1FSEA 4N9HA 3T1BA 2QUFA 2J5PA 1YW8A 1HSTA 3I59A 1UELB 1XMAA 3FMQA 4YRVA 5K5OA 3JAMZ 2LBFB 5LHHA 3BPVA 2JA6J 1OCRH 1A5JA 4GDFA 4DZPA 4A3BJ 1UJ8A 2VKEA 1XN7A 3S8PA 3N05A 1YE9A 3RQIA 1X3WB 3QAHA 3OV8A 2CUZA 2KISA 2JA8J 5LHGA 2HQNA 3JRGA 3SFIA 3CDLA 3BZKA 1QVTA 5DEQA 1A36A 2I8DA 1LNWA 2LNBA 2QQAA 3TDZC 1ETWA 5FKNA 1R4NB 4MTEA 3VDXA 2W7NA 3ELKA 1G6NA 4EJTA 3GZ5A 3HKZN 2JMWA 3F8CA 3OYAA 3PNVA 4F92B 3EDPA 5CQEA 4C2UA 1V54H 2KPMA 5EEHA 3GMEA 2HEOA 4IKFA 4L0ZB 1AHDP 1ONVA 2XUBA 3A02A 3HOUJ 3ROUA 1MBKA 4JX5A 2CV0A 1I3AA 1F5TA 1IO2A 2E36A 2HTSA 1O3RA 4CH7A 2A61A 3LNQA 4RM3A 2X6XA 2FA5A 3FHNA 4RGSA 1ODDA 2OAZA 2IEKA 2HYJA 4MO7A 3GBGA 4XKBA 5H6QA 2KHMA 1JJ6C 2B63J 3LA3A 1Y1VJ 3S16J 2Y30A 5TGTA 5E17F 2LMDA 3MZYA 2KRHA 3EETA 3PNTA 1R00A 4RLFA 3MQ0A 4RB0A 4BQNA 5F27A 1EH7A 3FK7A 4EM2A 1ZHFA 4ABZA 3WGGA 4XQFA 2K4JA 4FCYA 3R61A 1MJBA 1KONA 3AFHA 2QQ8A 4LGWA 2R7ZJ 2DOAA 1XMXA 2EIJH 1FEXA 3BP8A 3OSGA 1J0RA 2F48A 4AU7A 3CMMA 2KIUA 1IRFA 4FTHA 2O5RA 1LDDA 1TWCJ 5JHFA 1NHAA 4HDVA 2Z3YA 4CGZA 3C7JA 4IPAA 4IEJA 3S2DJ 1QO0D 3IAM2 4HPQA 3V4GA 4EJVA 4LG0A 5E3LA 4HZFA 3SZPA 1IRGA 3FKIJ 4BBSJ 4U0VA 2XIGA 1YHQI 3G1OA 3DCFA 2PQ8A 4UB8C 2D5VA 2F4IA 1OLTA 2V26A 3CUQA 1PYVA 2LOOA 3I71A 1CF7A 5FLXK 2R7WA 1D0XA 1VQ9I 3CC2I 2K9QA 1WJCA 4M9ZA 1WJAA 3JRDA 3QYEA 1BBYA 3O3KA 4MHGA 3J80Z 3EUAA 2V1XA 2E35A 2MLGA 3R60A 2FF4A 4CYCA 2L2OA 2BE5F 3LMMA 2KIFA 3HKZA 3CMEI 3MCZA 1MIJA 4BS9A 1MMSA 4JX4A 3M1EA 1SAXA 4ESBA 1NTCA 4RB2C 1OCZH 4NC6A 2UWMA 4JP0A 5K1YA 3DU6A 1GV5A 5IOZA 3ZXSA 2A05A 2IVMA 4AUXA 3SQNA 1TT5B 2G7HA 4M9SA 4HLXA 3LSHA 1X4OA 5L3DA 4G7ZF 2E60A 2BYVE 3LSTA 4BY7J 2D1HA 2L7MP 1GDTA 4KNYA 4BXXJ 2W82A 2VB6A 1HDPA 2CW8A 1N78A 1VQ8I 2W48A 4KFCA 4KT5C 2X1EA 3JW4A 1FJLA 4GGGA 2MC3A 4C9YA 4A3KJ 2OZ6A 1MMDA 2FMLA 4PSWA 2V6EA 2HZTA 3ZQHA 2HDCA 1TL8A 1TZLA 4BE2A 2QGUA 3I4PA 5K5QA 4DGWB 3HHHA 4PSXA 5E8IA 2K3PA 2VC1A 1HKTA 3LL7A 3H9JA 2EB7A 3L2QA 3V8JA 2ACJA 3TGNA 2NVYJ 3G3ZA 3I58A 2GWRA 2WBMA 4I02A 3ZQGA 3WTUC 2CU7A 3O2PE 2VLAA 1X19A 4LJZF 4YFKF 1VQ4I 1F36A 4O5VA 1KZHA 3O8HA 2NYXA 3JSPA 2X6WA 1K79A 4LITA 5H6RA 5D8KB 2M45A 3MEXA 2WWYA 2EILH 4DJAA 1GHCA 3BWGA 5HS8A 3SZTA 1X2MA 2NVTJ 3GO5A 1EV7A 4RLQA 1Y0UA 2A69F 4E7IA 3VYUB 5EGOA 3L00A 1LEAA 2OU2A 3E6BA 3JTGA 5D5WB 5FJ8J 3DFGA 2AS5F 1IUFA 4EJWA 2XAUA 1JUSA 1NH3A 3PSIA 4LIUA 1Z9CA 5LEKA 2NAZA 2Y0MA 3I64A 3WTSC 3L1PA 2AXTC 1XGOA 4YELA 3H3UA 4IX7A 5D6EA 1MH3A 4CCKA 3O8GA 4CCNA 3FMSA 1OYIA 1RC9A 1OISA 3RPQA 2XGCA 4FE7A 4I76A 2GA1A 5EEAA 1T39A 3OS2A 1ZG3A 3OOUA 1ULYA 4I09A 1U2WA 1FPQA 1RR8C 4C3JJ 3DKXA 4HSTA 4CICA 1DP3A 5LRSA 4XLEA 1R4MB 5D4RA 4KYWA 5FKMA 1FLIA 3HEFA 1B59A 3K2AA 3LA2A 4UHTA 2TDXA 2Y9YA 1LDKB 5F1JA 3I4NJ 2VASA 4XBFA 2O0YA 4AYBN 1YLFA 4U0WA 1QHHD 5FFXA 2X51A 4XOTA 1YIJI 3K2ZA 3GZNB 3K10A 2JSCA 1AOYA 3GTKJ 1X1DA 1OKRA 4AIKA 1FYKA 2JZYA 2BY3A 3G1MA 3ABUA 1D5VA 2GBYA 3ERMA 3HGGA 1K6YA 4OAZA 4I6ZA 3J7YJ 1U8BA 1D5YA 3KYDB 3BG9A 1T6SA 2XB0X 2UZKA 2JA2A 5E3OA 2M2EA 3TW7A 4NBQA 3W2WA 5IPAA 1TW3A 4BNCA 1WJDA 1P92A 2EZKA 3LSIA 3K70D 1USSA 5LLQA 4DNCA 2X1CA 3QPLA 4P9FA 3AAFA 4RAYA 1TW2A 1QZEA 1S7AA 5ERIA 4JYKA 5J47A 1SC7A 4KA4A 2DMTA 3RSNA 2H1LA 1EH6A 4CA0A 1H89C 3DPTA 2FRHA 4M74A 5JVTA 2E1NA 3IWFA 3RKQA 4C2TA 3GYHX 3KYLA 2P7CB 3OYGA 1R9TJ 2CQQA 4N9IA 3WHCA 5D8LB 2PFBA 2MA3A 2ZFUA 5A2QK 1EF4A 2QSGX 1ZKGA 2LYCA 2MABA 2ZMEB 5FKLA 4AVZA 1W36D 4I01A 2WTEA 2RNJA 2Q8KA 5HDKA 5L3GA 2YS9A 3GTOJ 2HYGD 1BR4A 2MFZA 4UUSB 3VWBA 4BY1J 5J40A 2DQLA 2HKXA 1Y1WJ 2O6GE 4M71A 5F04A 4KT6A 1A04A 2RDPA 2DDAA 2DFHA 1S5LC 1F4KA 3PIOF 3CCEI 1R58A 4JOMA 2KRCA 2XB5A 1IXCA 2QYOA 5ED4A 2RAEA 5E18F 4AYBA 4EM0B 1VQ5I 5DD4A 4IF4A 4A6DA 3R0JA 2LK2A 1I3QJ 1TP4A 1MDMA 3HSEA 3IH2A 4RMNA 1OCTC 3ZN0A 3D5RC 4BHBA 1R49A 2PJRB 1JUMA 3FXRA 2DOEA 2GLOA 2YSRA 4IZZA 4LLLA 2QKLB 3JRCA 3JR9A 3AKZA 9ANTA 1NG6A 5LRRA 1W5SA 1NK2P 3ZP5A 3GLXA 4E7LA 4UVBA 2NOGA 3TW6A 2DMPA 3FISA 3G71I 3HDDA 4DQ2A 3RKWA 1LDJA 2K3FA 4HNVA 1YITI 2E19A 2XROA 1OCOH 1KQ0A 3IC7A 2A6EF 3F8FA 4JK1X 1GT0C 3K4BA 1MDMB 2DFEA 1XGNA 1RUOA 1FMWA 2H8WA 1E3HA 2H09A 4XRMA 4F91B 5M5WJ 3DEUA 3LSMA 3HRUA 3I5UA 3EUHA 2HPIA 5DDGA 1Y56A 4E4HA 3HPGA 3GZ6A 3TDUC 5AIQA 4DYRA 2M34A 1FBUA 3FBNB 4XOPA 4A12A 2VUMJ 2VBWA 4I99C 2DBBA 4LFUA 2H8RA 1KGSA 2VE9A 1N77A 3H9GA 3M8JA 3K4MA 3CCRI 4BGDA 1BL0A 4ZZLA 1IV8A 3QPHA 4UUVA 3NQOA 3L2WA 2FBKA 2OTJI 2CQ7A 3HJEA 5IYCJ 1VZ0A 1AKHA 4F55A 2M4GA 1APLC 2L5QA 4A0XA 1W7PD 2EIMH 4KICA 5H2FC 3JRBA 2CGPA 3VYTB 5JLWA 4L0YB 1TNSA 1MBJA 2IS2A 2XPUA 4XNFA 4CXFA 1FOXA 1T8IA 3HOXJ 3Q0WA 3B6CA 1U5TC 5EYRA 2M7AA 3JAMK 3HTSB 2L3DA 4ESJA 3BR6A 1WI9A 3IWZA 5BS6A 3CLOA 4IHYA 3PL8A 1HA8A 2MG4A 5CVRA 2CQKA 3CCQI 3FM3A 1XX5A 3S1QJ 2E5ZA 1TNTA 3G73A 2V6CA 2HOTA 3DTKA 3OYBA 1Y39A 5K7ZA 3LSGA 4IO9F 2WAFA 3KP6A 1U78A 5GPAA 3HOTA 4Q5SF 3W6KB 4A93J 2HYFA 1XPXA 2FBHA 1YYVA 3V8LA 4B3XA 1SMYF 3BG5A 3WE3A 4GCVA 4D9JA 1K4SA 5FROA 4IHVA 5E79C 1PUFB 1XCBA 4L9VA 2H94A 2YR2A 5J1UA 3IKVA 2H27A 1XG1A 2MD5A 4EJOA 4CCJA 1I1GA 2CO5A 2DA7A 2EQRA 2IA2A 4RGUA 4RB3C 1ZELA 4PJJA 5GP9A 4DBQA 2OPTA 4KN4X 2HR3A 3VSKA 2F6CA 2VQHA 4UVAA 1HC8A 2ZKZA 1HOMA 1S8NA 2VJJA 2MC4A 2HI3A 5BPIA 2EZLA 3GTPJ 4MGRA 4II3A 4A3LJ 2XAJA 3KYCB 1USTA 2M8EA 2VJ4A 5L3BA 5CVIA 2W4SA 2M3AA 3E5UA 3E5QA 1XSDA 5LBQA 2NXNB 3DKYA 1MD0A 5HS7A 1W0UA 2K86A 1SAUA 3U1DA 1OYYA 1ZARA 2FEZA 2KT0A 1E3PA 2XF5A 4A6EA 3GFMA 4A3FJ 4H4KC 1ETXA 4IRGA 4CCMA 2I10A 1ZRDA 1E3OC 2BZTA 1K6OA 3QOEA 5F0FA 3TEDA 2K02A 3KCCA 3BT9A 2VKHA 1QQIA 2ZC2A 2E7WA 3A4CA 3CMAI 1O3SA 4X6AJ 4G9YA 4I0AA 4BL0B 2QWWA 2CWEA 4FHTA 4UV9A 4LK1F 3EPZA 2VXZA 3F3XA 3ABMH 4A69C 2OA4A 2DFIA 1Z67A 1B9NA 1TTYA 4PJLA 2MSYA 4CO8A 1QBJA 3KIOA 3I54A 3K1NA 4Y7NJ 3MVPA 4AVPA 5J8CA 5L3FA 3MAJA 2HVRA 3SYTA 2M9HA 3WTYC 2CFXA 3J7AY 2ECBA 2QLZA 2LKXA 3PIPF 1DP7P 3J80K 4YEJA 2XF7A 4ZZDA 5F08A 2W00A 4MQ9F 3CJTB 5CJ9A 5FLMJ 1TWGJ 4XLHA 2A6TA 2ZJQF 2IS6A 5IT9Z 3L2VA 2VIXA 1IW7F 3NWSA 3QU3A 3GEZA 3LSJA 3GTQJ 3M3YJ 3CZ6A 1ERDA 1SFEA 1F1ZA 1EH8A 2OZUA 1WJEA 5EDNA 1W7PB 1T0FA 2QCOA 1QU3A 3F8MA 2Z33A 2XAHA 2AHQA 3HB9A 4B44A 1EJ9A 3BJ6A 2DA3A 2Y75A 2KIMA 1ACIA 1JGSA 4IOAF 3GFIA 2Z5UA 2BW3B 1L3LA 1J09A 3OYDA 1UG0A 3TBIA 3S93A 3S2HJ 4G7HF 5ILUA 1K4TA 2JSPA 1GVJA 3A1YA 2LBFA 5DM7F 1P7IA 2DTRA 3CC4I 1Y8QB 3L2RA 1YX3A 3H35A 3BTIA 2HTJA 4L5JA 4BHPA 4BE0A 4NDLA 2P6SA 2PI0A 3RI4A 4W97A 1UHMA 2VT2A 3BZCA 2LH9A 2R7DA 4RA2A 1SMTA 2KP6A 2XPVA 2HNHA 5EJCA 3ASOH 2P4WA 3B73A 2Q2EB 4BU2A 5ICEA 5IOYA 2K7LA 1KYWA 4UUTA 2IA1A 5TISC 2KQRA 3KLNA 2NRAC 2EH3A 2HKOA 3GXOA 1UAAA 3LFKA 1BI2A 4M3BA 1FZPB 1XB4A 4YFNF 2L54A 1XDUA 1JT0A 4Q4ZF 4WK8F 4IRIA 4P9UA 1MJAA 5HNFA 4OWRB 2AQFA 5FKOA 2PMZN 2EFWA 1S6LA 5HS9A 3CCJI 2E2JJ 1R1VA 2B0LA 3IUOA 1FIAA 4PCQA 2BY0A 2K27A 4QWQA 3BPXA 3F6VA 2IGMA 4A3MJ 4LG3A 2FU4A 6PAXA 1V4RA 2WADA 3CO7C 2JA7J 5LFAA 2FE3A 3WTVC 5GPCA 3WHBA 4M73A 3TKYA 1QHGA 2CUJA 3JTHA 3JRHA 1O4XA 3D5LA 1ETKA 1FY7A 3M4OJ 4MIMA 3RQ4A 3BR0A 5FLVA 3NRVA 3ZR8X 4MLOA 3LSPA 1FWZA 1ZK8A 5E1ZB 4XN0A 2KKOA 3K0LA 2KRFA 2DXIA 4GFBA 3KZZA 3CCVI 2H6BA 2Y0SA 4RS8A 2Z2SB 5D5XB 5KHDA 4IHWA 3CO6C 5TRDA 3SJMA 2P5VA 1JKRC 1XCVA 2XPWA 2M4KA 2EA2A 4MNUA 4XLFA 3VEPA 5HOOA 4CDGA 3JCUC 2RKHA 3ZOBA 2FBIA 1SANA 3GWZA 5BQTA 2FMYA 1BJZA 3H0GJ 3Q9SA 3LQQA 5EG0B 2EZHA 1B6AA 4WXDA 2DJIA 1Z6TA 2O61A 1JKQC 2NS0A 4KIBA 4IVNA 1Y6IA 1VF9A 2KZVA 4L9NA 3W2VA 2W84A 5GTIC 5HODA 4KJZA 2YU3A 3CP8A 3I3LA 3HOYJ 3TQNA 3HOVJ 2ZNYA 4ZYGA 1VQLI 2DJNA 2WY8Q 1WJ5A 3MWMA 2HGCA 4G6DA 5KCMA 1UMQA 2CQXA 2M30A 5LEJA 1MH4A 4IHTA 4CCLA 5LHIA 3HOSA 1Z1DA 1PJRA 2W24A 4RBOA 4IRHA 1PP7U 4NC7A 3U1KA 2NNNA 2R4GA 3K1MA 3ZQCA 2PMZA 4GXOA 2VQGA 3GX4X 2EBIA 3MKLA 4FX0A 4P96A 1T56A 2GXBA 2BY2A 3Q3SA 3RIRA 1HKQA 1BN5A 1GLNA 2LDUA 1Z77A 4BJ5C 2DDBA 3RKYA 4ENNA 1TWFJ 2VBXA 2ESHA 1Y0NA 2QSFX 4V2GA 5FRNA 2EFOA 2O7OA 5B5EC 4RGRA 1A31A 3M8FA 2JPBA 4LD5A 2LP0A 2FXAA 2VC0A 3WTXC 3ULQB 4UB6C 1DPRA 1IAWA 2K9NA 5GAEJ 1OR7A 1FBSA 4RDUA 4L18B 4V19K 3K9TA 1ETQA 2QQBA 3S3OA 1VQ6I 3U21A 4QTRA 2Y9ZA 2DLLA 2L7ZA 2XDVA 4U0YA 1H88C 3REOA 2MYSA 2NVXJ 2R92J 4G6TB 4A3EJ 3FBIB 1WGXA 2ZB9A 3HSRA 2CSOA 1FOWA 1D1BA 1IXRC 2L4MA 2YPRA 3UNGC 4X0GA 2V7FA 1WRJA 1I6HJ 1MMGA 4FASD 1YS6A 3AG4H 1Y8RB 1WWXA 2JWTA 2HDWA 4F52A 1J7KA 2HXOA 4U87A 2IS4A 5HNHA 2RN7A 3K4LA 3WU0A 3BCBA 3MZ8A 3JRIA 5DTDA 2ZJRF 3KLOA 1O7LA 2L02A 1IRXA 4LLNA 5FGMA 1JXSA 3HSFA 3RZDJ 1QNTA 1TBXA 3PM1A 1LVAA 2VQLA 5DCFA 2GIZA 3ZPLA 3E0JB 1U9OA 3DWLE 1RETA 1G3TA 2ADUA 2O03A 1QPMA 1R1TA 4ZYAA 4DOZA 3KP2A 1OCPA 2XASA 3E3VA 3CC7I 3FF5A 3I4MJ 1KQ9A 2KMUA 2VJ5A 3GTLJ 3IH3A 5B1AH 2LTPA 1RIOH 3K6GA 4JBAA 1AU7A 1RZ4A 3M7GA 3CJNA 4P1WA 1J2XA 1ETOA 1K61A 3Q9VA 1QZZA 1SFXA 2OQRA 3F72A 2ELHA 2WAEA 4Y52J 5CKTA 2R7TA 5GAHJ 4L5IA 1STZA 4UY8I 3SDGA 1WQ2A 2DMQA 1QGPA 4J19A 4M3DA 2HVQA 1HCRA 2QVOA 3RYRA 5BOXA 2LY1A 4RAGA 2XRLA 2VE8A 5DV5A 1WSUA 3QYBA 1SFUA 3ZMTA 3ONQA 3VOEA 1OQYA 2F5EA 2VODA 3RTRA 1CGPA 4AIHA 2A07F 1HQCA 3DBHB 1ETYA 3BG7A 2CFOA 3S1MJ 1X58A 3VFZA 4B43A 1TWAJ 1YOVB 4M3FA 2X0LA 3IKTA 2M8GX 3KP7A 1W4MA 3LA7A 3PQKA 4LOCA 1SVMA 2KJCA 5M3MJ 2FQ4A 2Y48A 3LWFA 2A6HF 3ZGKA 2DT6A 2ELJA 4LB5A 1DGWY 2LR8A 1P9QC 1R7JA 3NARA 1FT9A 3BDDA 3T5XA 4YFXF 3BR3A 3BCAA 3VPRA 1GXPA 2YX7A 3TOBA 1F43A 4HYEA 2JUCA 4HEA2 1ORKA 1UG2A 2ZSIB 4XLPF 1SFOJ 4HF0A 3KX2A 4BUPA 1R5HA 4XK4A 4ETSA 1I39A 4IOCF 1VQPI 4Q47A 2LF7A 2YUSA 3FWEA 4S05A 3E6CC 3HRSA 3CUQC 3FXUA 3P9CA 4OU0A 2MH2A 4XICA 1HXDA 1U6GA 3R4KA 5HLIA 2ZMEA 4XLCA 1G3WA 3BZ6A 2CYYA 5CLSA 5HLTA 1A6IA 2QKMB 1L0OC 3S1NJ 2TRTA 5FD6A 1Q1VA 4HV6A 4UUSA 2OD5A 3IV5A 5DM6F 1UHSA 4XN3A 1OJLA 4S04A 2HPMA 2O8KA 1OR7C 3DBLB 3CDHA 1T08B 3OS0A 3GUDA 2HQAA 2PG4A 4II2A 1U0JA 5H20A 3DP7A 4DYCA 1AA7A 4HDUA 2VPLA 2V1NA 2RVCA 2DT7B 1X1PA 3F0CA 2ESNA 1JTYA 2R7OA 1YJWI 4V2FA 2P5LC 1TC3C 2PJRA 3AG3H 3H5NA 4BACA 4QPQA 5JR3A 2ECCA 3PSFA 1U5TB 3LOCA 1Z7UA 2BGCA 5FLXZ 5FFZA 1M1EB 2G0EA 1GV2A 4OIOF 1TLHB 1ITYA 1V5GA 1R36A 2H6CA 2L7KA 2OUMA 2QF7A 4DBRA 2X48A 1HKSA 2PLYA 1D8JA 3MD2A 4UXNA 1DQUA 3KE2A 3H5RA 2KJBA 5JI6A 4NUBA 3S32A 1S9HA 2WC2A 4Z6YA 2F2EA 3V7CA 2H1KA 3FXMA 2V79A 4F7ZA 2K9MA 2XGEA 1C0WA 3TO7A 1XSXA 4HX7A 3HPHA 4PFPA 2XGXA 3KEQA 1JKOC 4ZC3A 5E3MA 3J81Z 1YTYA 1ZG5A 4RGXA 1ON2A 3ZQLA 2WB1N 2JRMA 5DUIA 4F3QA 3F8BA 3PFYA 1H9GA 3TO6A 4ZYDA 3FMRA 4EVIA 2DA2A 4UNOA 2L01A 4A5MA 4JQFA 2FNPA 1F9NA 5KVRA 4BQOA 5C3EJ 1POGA 3F9KA 3SHFA 3COAC 3BR2A 1LEBA 1I6XA 4EGYA 3CF2A 1A6QA 2OTLI 2CRGA 2W85A 2DU9A 2MGQA 2QA4I 4IJAA 4PFOA 4HLYA 1R1UA 1K78B 2W1OA 4HV5A 2P6TA 5J8FA 2JN6A 1S29A 4I7HA 4A3CJ 1PVEA 2BY1A 3KEOA 3M8EA 1X3ZB 2KL4A 3G4SI 5IYDJ 1D1CA 5F0HA 5ICGA 2ZO4A 2O8XA 2EK5A 3G2BA 2JJ7A 4ZJZA 3H92A 5AIPA 4L5EA 1GUUA 2LSOA 3OOPA 1WFXA 1LKXA 3LSRA 4BJTA 1GVDA 4NHJA 2KDOA 2DA4A 5C4XJ 4G12A 4QIWN 5AONA 1LB2A 5D4SA 2EV0A 1BR2A 2LVSA 1IDYA 3TP3A 1MNMC 4MFDA 4XL9A 3QRFF 2CQNA 3RDIA 1MJ9A 2BXZA 3PNYA 4MTDA 3N97A 2GOMA 2XGDA 3HBLA 3CMYA 1BC7C 2VL8A 3KPHA 5FO5A 2GIVA 3DBRB 5ICFA 1JT6A 2BVLA 4R8HA 4RB1A 2ZNZA 4Y13A 1U8RA 1PUFA 4RM2A 2OQGA 2CS3A 3IL2A 3DLLF 4A0YA 2DCEA 4HOBA 1ZR2A 3C1DA 1OPCA 2J5OA 1YI2I 2GZWA 4ESFA 4E7ZA 1UB9A 1GXQA 3T8TA 4NQWB 4HBLA 2DODA 2JVHA 2KZGA 5EEGA 2R5YB 3I56I 2X6OA 3DPLC 4U7DA 2ZXHA 3OYFA 3H0DA 3KEYA 1SVOA 2VKVA 3BJAA 3TP0A 5KNLA 4WX9A 5E1XA 3DPUA 4JX6A 5DCMB 1VQNI 2VN2A 1IRZA 4XSZF 1FTZA 3G1LA 3CCYA 1SD6A 2WB1A 3KFWX 3GW2A 4Y17A 5D6FA 2QBYA 1Z3YA 3K7AJ 2QENA 3E1SA 3FX3A 3U9GA 4XRSG 3MKYB 1IDZA 2DTZA 2BXYA 3S14J 4BE1A 1OCCH 1ZYRF 4KIFA 2LG4A 3CTAA 3F23A 2E1MC 3M1CA 1BW5A 1LE8B 2Y2ZA 4X1EA 3OYCA 2RQPA 1IUYA 2WV1A 3SEZA 4ZTFA 2PX9A 2R0QC 3OYEA 2IGKA 1S7EA 2A5WA 4ZDLA 3RPUD 3WODF 2IRFG 3HOWJ 2QQ9A 3AG2H 3FXJA 3ZQIA 2A68F 5DS9A 1ZTRA 1ZGJA 2LY2A 2RREA 5C44J 3OYMA 1S3JA 1ZN2A 3FDYA 4DYQA 4EJUA 2QBYB 2LF8A 2QEXI 1MSFC 2MH9A 3RKXA 4GYGA 2AQEA 3KETA 1LFPA 4BXUA 4K2EA 3OR2C 2KLOA 4G7OF 1V55H 3HC7A 3CCSI 1TT0A 2DOFA 4ENJA 2DYSH 1B1BA 2RC4A 2Q1ZB 2XVCA 4CUGA 1EA3A 2EWNA 3S3MA 5IP9J 3BOQA 3ERED 1JKPC 2V4JC 5IP7J 3N4MA 3OL4A 3OIPA 2HQRA 1W7PA 2QM3A 3P7NA 1TQMA 3KZIC 1RPWA 1B8IB 1VQOI 3FXOA 3U2RA 1HF0A 1BA5A 1CQTA 3SXYA 4HQMA 1MGTA 4A5NA 4C30A 3VODA 2KFDA 2BW3A 2D45A 2HXIA 3OYHA 2ME6A 2BVMA 5L3EA 1KA8A 2R7UA 2WY7Q 2QSHX 3GTMJ 4HX8A 4CSWA 2WAQN 2D1VA 3H1CA 3C3WA 4O6JA 3EUHC 1MNEA 4YIIA 3HYIA 3IH4A 3D1NI 2Z1DA 4OIPF 3RYPA 4IHXA 4OOIA 1W5TA 5DD8A 5EF6A 2IT0A 3IHUA 2OJED 3C2GA 3CJRB 1T98A 3K70C 4MEYF 2Q2EA 5CVUA 5J1YA 4CYDA 2LD5A 4MEXF 3RZOJ 1BJAA 4MFEA 3M07A 2F5CA 3E5XA 3WU1B 3FZVA 2RNGA 2DA6A 4XLNF 1LQ1A 4L9TA 2ICWG 2K5CA 1YQAA 1RI7A 2R93J 4NNJA 4PJMA 1FTTA 3ABLH 3B02A 3UKGA 3V7RA 1T95A 5FKKA 1UFMA 4PGGA 1Z6RA 2JPCA 1R6RA 1IGNA 2EV6A 2IGNA 3P5JA 1D0ZA 1K83J
chains in the Genus database with same CATH topology
2YX4A 3RPUA 1XD7A 1XGSA 3C18A 1BC8C 1KYZA 5CVVA 4EGZA 2EV5A 2IP2A 2C6YA 2IPQX 2ZFWA 4R1HA 2ETHA 4UV8A 3LQRA 3E6MA 3DF8A 4ENKA 5L3CA 1BIBA 3SFZA 1ZGAA 1YO5C 5D5UB 4KUMA 3ZMSA 1P4XA 1IN4A 5LGTA 4WXHA 1TQIA 2VT3A 4D0PA 5HDGA 1R22A 2XHKA 4OMZA 2M87A 3L7WA 2VOOA 1KU2A 4ZYEA 2F5DA 2STTA 4M9XA 2PMHA 4EM1A 3WGIA 3I59B 4ENMA 3F21A 4B8XA 4TV7A 1KQ8A 3EYYA 2PJPA 1REPC 1J75A 3Q5FA 5F6FA 3WTTC 2P7VB 3P9KA 5LGUA 4M6XA 2ISYA 3GVAA 4OIRF 2XKPA 1J5YA 1JHHA 4QLCU 4OMYA 5E1WA 1XSVA 1IZ1A 1JHFA 2AXLA 2CG4A 1ON1A 3FM5A 4BYYA 2V1UA 3J7AO 1FP2A 2A5YB 3QPTA 2HS5A 4PGHA 4EV0A 2LKPA 3GF2A 5HLGA 1G3YA 1ZG1A 1K7AA 3BROA 1I1SA 4CHUA 4EQQA 1I5ZA 1ZRFA 4L9JA 4LMYA 2X4HA 2IW5A 1LJ9A 2G9WA 1BOAA 3R0AA 3QP5A 2DK8A 5FB2A 4HQEA 1Z91A 2XKOA 1IN5A 4LG0B 3F8NA 2E1CA 4NB5A 1FBQA 1PP8F 4R79A 1FYLA 1J59A 3CUQB 1CF7B 4GYIA 4KN7X 3J81K 4P55A 1YIOA 4IXAA 2EJRA 3TO9A 2QZ8A 2DPDA 2BEOA 1Q1HA 3RJPA 1T38A 3T0YA 1G3SA 2VBZA 4OIQF 1V3FA 5D5VB 1E2XA 3FHZA 5DUKA 5BMZA 2Z99A 3WGHA 1DUXC 1OYWA 3V8KA 1P4AA 5F1RA 1RUNA 1HW2A 1T2KA 4MQVA 1HW1A 1BI3A 4AIJA 3EQLF 5ILSA 3PQJA 4UVCA 4G6QA 2XRNA 1J9IA 3EYIA 5K5RA 3T8RA 4A2UA 4KDPA 3WG9A 2UXXA 3ZMDA 2W57A 4LK0F 1D8KA 2DK5A 1OMIA 4I0BA 3ZN1A 1IN8A 3P9IA 5J6XA 3O6BB 1DPUA 2ZJ2A 3KP5A 4BHCA 2G7UA 4ON0A 4WWCA 3MZHA 3S2WA 3ABTA 1ZRCA 3ZMZA 5ICCA 1IN7A 2PBIA 2DAOA 1O3QA 3QOPA 3BY6A 3FXQA 2BV6A 1O57A 1U5TA 3HTUA 1U3EM 1ZH5A 4BH9A 5JHUA 1YW9A 2EFQA 3E6DA 1P6RA 3V7SA 1HSJA 2XV4S 2Q0OA 3LAPA 4KIGA 5F64A 3TOAA 2UXNA 1BM9A 1HBXG 5CYVA 3ML6A 1O7FA 1VTNC 3QP6A 1R23A 4YG2F 3VB2A 4LLGF 1PDNC 2F5FA 3HRMA 5E20A 3ZMUA 2ISZA 2M5WA 2EFNA 2Z9OA 1YG2A 1KU7A 2RV8A 5LGNA 1IXSB 2FOKA 5HLHA 2STWA 4HA8A 3CUOA 3ECHA 3ISPA 4B09A 2HWVA 4WF2A 4KMUX 5HVQC 5ILVA 1S7OA 2XAGA 1K78A 3ZMVA 4HX4A 2E7XA 5IT9K 4N0BA 2GXGA 3PFIA 3NEUA 4Z2YA 3WTWC 3F6OA 5JFRA 2GQQA 3M9AA 4OINF 1SD4A 5DYMA 2A3SA 1KU3A 4M6YA 2NNYA 2CW0F 3IRRA 1O3TA 1YFHA 1ZLKA 1FC3A 3W6JB 5E8GA 1QZYA 1SD5A 1G4DA 1KU9A 3I53A 2EFPA 3HHGA 1E17A 1FX7A 4U7BA 3I0TA 2VONA 4NQWA 1FNNA 2WV0A 4Q48A 5CVJA 2GA2A 3H3ZA 2ZCWA 4O3MA 4I2OA 1XMKA 1UHWA 2P8TA 5DCMA 4RAZA 3K69A 4ASNA 3ECOA 1DDNA 1RNLA 1SD7A 3JSOA 2O3FA 1FOKA 2JTVA 2JT1A 1UCRA 1I27A 2RGVA 4XSXF 2EA4A 4WCGA 2W25A 3L2CA 4A0ZA 4PZJA 3L09A 4G8XA 1P2FA 2DPUA 2P5KA 4BAYA 2HOEA 1Z05A 1R5GA 2GAUA 3KP4A 5TJJA 3HIFA 1ZLJA 4HW0A 4FX4A 1P4WA 1BI0A 1XDSA 1AWCA 3K1PA 3KP3A 1WKMA 1TQPA 2ZBKA 4HF1A 2DT5A 4IHSA 4KMFA 4FT8A 4PDKA 1B9MA 1MKMA 3F22A 5FD5A 2COMA 4I98B 1HW5A 2FQ3A 1YS7A 1PUEE 4EMSA 4ZYHA 3IRQA 2L4AA 1YW7A 4GO1A 1XGMA 1FYMA 1FP1D 2DQRA 2DI3A 2VOPA 3KZYA 2PMUA 2DO7A 1IF1A 2D2WA 2MBFA 5HDNA 1H0MA 3DXJF 3BJOA 4M72A 3QU6A 2V1DA 1ZREA 2DW4A 4AWXB 4AD9A 5A2QZ 2K4BA 3DV8A 3L9FA 4ZH4F 2OBPA 1X3UA 4WXCA 4HF2A 4BQAA 4HAMA 1B4AA 2IJLA 3LAJA 2FSWA 4P5OA 5KK1A 4Y15A 4CZZA 2IA0A 2HFHA 4H0EA 3ZQ7A 2XAFA 3DQVC 2FNAA 1ZAOA 4YIFA 4E70A 3DKWA 1BIAA 2R7FA 2VBYA 4G94A 2ZXJA 3HRTA 4XRFA 3GFLA 2PN6A 2M1BA 1D3YA 3WTZA 1JE8A 3MFKA 4LB6B 1IN6A 1H9TA 1BI1A 3D0SA 3HUGA 3WE2A 5BPDA 1MZBA 2JRTA 2R3SA 3E97A 4U88A 3GFJA 1FSHA 2XAQA 2BBYA 2V9VA 3R6SA 2MLKA 2PEXA 5IT3A 1FSEA 4N9HA 3T1BA 2QUFA 2J5PA 1YW8A 1HSTA 3I59A 1XMAA 3FMQA 5K5OA 3JAMZ 5LHHA 3BPVA 1XN7A 3QAHA 3OV8A 5LHGA 2HQNA 5DEQA 1LNWA 2LNBA 2QQAA 3TDZC 4MTEA 3ELKA 1G6NA 4EJTA 3GZ5A 3F8CA 3EDPA 5EEHA 2HEOA 4L0ZB 1ONVA 2XUBA 3ROUA 1F5TA 2HTSA 1O3RA 2A61A 2FA5A 4RGSA 1ODDA 2OAZA 5H6QA 3LA3A 5E17F 3MZYA 3EETA 1R00A 3MQ0A 4RB0A 1EH7A 4EM2A 1ZHFA 3WGGA 2K4JA 3R61A 1MJBA 4LGWA 3BP8A 1J0RA 2KIUA 1IRFA 1LDDA 1NHAA 4HDVA 2Z3YA 4CGZA 3C7JA 4IPAA 1QO0D 3V4GA 4EJVA 4LG0A 4HZFA 3SZPA 1IRGA 4U0VA 2XIGA 2PQ8A 3CUQA 3I71A 1CF7A 5FLXK 4M9ZA 1BBYA 3O3KA 4MHGA 3J80Z 2V1XA 2MLGA 3R60A 2FF4A 2BE5F 2KIFA 3MCZA 3M1EA 1SAXA 4ESBA 4RB2C 2UWMA 5K1YA 2IVMA 3SQNA 2G7HA 4M9SA 4HLXA 5L3DA 4G7ZF 2BYVE 3LSTA 2D1HA 4KNYA 4KFCA 4KT5C 3JW4A 4GGGA 2MC3A 2OZ6A 2FMLA 2HZTA 2HDCA 3I4PA 5K5QA 3HHHA 5E8IA 2VC1A 1HKTA 2EB7A 3V8JA 2ACJA 3TGNA 3G3ZA 3I58A 2GWRA 4I02A 3WTUC 3O2PE 4LJZF 4YFKF 4O5VA 2NYXA 3JSPA 1K79A 5H6RA 5D8KB 2WWYA 2M45A 3MEXA 1GHCA 3BWGA 5HS8A 3SZTA 3GO5A 1EV7A 1Y0UA 2A69F 3L00A 1LEAA 2OU2A 3E6BA 3JTGA 5D5WB 3DFGA 2AS5F 4EJWA 1Z9CA 5LEKA 2NAZA 2Y0MA 3I64A 3WTSC 1XGOA 3H3UA 5D6EA 3FMSA 1OYIA 3RPQA 2GA1A 1T39A 1ZG3A 1ULYA 4I09A 1U2WA 1FPQA 4CICA 5LRSA 5D4RA 4KYWA 1FLIA 1B59A 3LA2A 4UHTA 2TDXA 1LDKB 4XBFA 2O0YA 1YLFA 4U0WA 5FFXA 3K2ZA 2JSCA 1AOYA 1OKRA 4AIKA 1FYKA 2JZYA 3ABUA 1D5VA 1T6SA 2UZKA 1TW3A 4BNCA 1P92A 1USSA 5LLQA 4DNCA 4P9FA 3AAFA 4RAYA 1TW2A 1S7AA 5ERIA 4KA4A 1EH6A 3DPTA 2FRHA 4M74A 5JVTA 2E1NA 3IWFA 3GYHX 2P7CB 4N9IA 5D8LB 2PFBA 2MA3A 5A2QK 2ZMEB 4I01A 2WTEA 2RNJA 2Q8KA 5HDKA 5L3GA 2HYGD 2O6GE 2DQLA 2HKXA 4M71A 1A04A 2RDPA 1F4KA 1R58A 1IXCA 2QYOA 5ED4A 5E18F 4EM0B 5DD4A 4IF4A 4A6DA 3R0JA 1MDMA 3HSEA 3ZN0A 4BHBA 3FXRA 2YSRA 4LLLA 5LRRA 1W5SA 3ZP5A 3GLXA 4UVBA 4DQ2A 3RKWA 1LDJA 2XROA 3IC7A 1KQ0A 2A6EF 3F8FA 4JK1X 1MDMB 1XGNA 1RUOA 2H09A 3DEUA 3HRUA 3I5UA 3EUHA 5DDGA 3GZ6A 3TDUC 5AIQA 1FBUA 4A12A 2VBWA 4LFUA 2DBBA 1KGSA 2VE9A 4ZZLA 3QPHA 4UUVA 3NQOA 2FBKA 4A0XA 1W7PD 4KICA 2CGPA 4L0YB 1TNSA 4CXFA 1U5TC 3JAMK 3HTSB 2L3DA 4ESJA 1WI9A 3IWZA 5BS6A 3CLOA 5CVRA 2CQKA 3FM3A 1TNTA 3G73A 2V6CA 3KP6A 1U78A 3HOTA 4Q5SF 3W6KB 2HYFA 2FBHA 1YYVA 3V8LA 1SMYF 3WE3A 4GCVA 1XCBA 4L9VA 2H94A 2YR2A 3IKVA 2H27A 2MD5A 4EJOA 1I1GA 2CO5A 2IA2A 4RB3C 4RGUA 4KN4X 2HR3A 4UVAA 2ZKZA 1S8NA 5BPIA 4MGRA 2XAJA 1USTA 2M8EA 5L3BA 5CVIA 3E5UA 3E5QA 1XSDA 5LBQA 1MD0A 5HS7A 2K86A 3U1DA 1OYYA 1ZARA 2FEZA 4A6EA 3GFMA 4IRGA 1ZRDA 1K6OA 2K02A 3KCCA 1QQIA 1O3SA 2E7WA 4G9YA 4I0AA 2QWWA 2CWEA 4FHTA 4UV9A 4LK1F 2VXZA 3F3XA 2OA4A 2DFIA 1B9NA 1TTYA 4CO8A 1QBJA 3I54A 3K1NA 4AVPA 5J8CA 5L3FA 3MAJA 3WTYC 2CFXA 2QLZA 1DP7P 3J80K 4ZZDA 4MQ9F 5CJ9A 5IT9Z 1IW7F 3QU3A 3GEZA 1SFEA 1F1ZA 1EH8A 2OZUA 1W7PB 1T0FA 3F8MA 2Z33A 2XAHA 3BJ6A 2Y75A 2KIMA 1JGSA 3GFIA 2Z5UA 1L3LA 4G7HF 5ILUA 1GVJA 2DTRA 2HTJA 4L5JA 4BHPA 2P6SA 2PI0A 3RI4A 1UHMA 2VT2A 2R7DA 1SMTA 2P4WA 3B73A 5ICEA 2K7LA 1KYWA 2IA1A 3KLNA 2NRAC 3GXOA 2HKOA 3LFKA 1BI2A 1FZPB 1XB4A 4YFNF 2L54A 1XDUA 4Q4ZF 4WK8F 4IRIA 4P9UA 1MJAA 2EFWA 1S6LA 5HS9A 1R1VA 2B0LA 4PCQA 2K27A 4QWQA 3BPXA 3F6VA 2FU4A 6PAXA 1V4RA 3CO7C 3WTVC 2FE3A 4M73A 3TKYA 3JTHA 3D5LA 1FY7A 3NRVA 1FWZA 5E1ZB 2KKOA 3K0LA 2KRFA 3KZZA 2H6BA 4RS8A 5D5XB 3CO6C 5TRDA 2P5VA 1XCVA 2EA2A 4MNUA 3VEPA 5HOOA 4CDGA 2RKHA 2FBIA 3GWZA 5BQTA 2FMYA 3Q9SA 3LQQA 1B6AA 4WXDA 1Z6TA 2O61A 2NS0A 4KIBA 4IVNA 4L9NA 2W84A 2YU3A 3TQNA 2ZNYA 4ZYGA 3MWMA 2HGCA 4G6DA 2M30A 5LEJA 4IHTA 5LHIA 3HOSA 1Z1DA 2W24A 4IRHA 1PP7U 2NNNA 3K1MA 4GXOA 3GX4X 4FX0A 4P96A 2GXBA 3RIRA 1HKQA 1BN5A 2LDUA 3RKYA 4ENNA 2VBXA 2ESHA 2EFOA 4RGRA 3M8FA 2JPBA 4LD5A 2FXAA 2VC0A 3WTXC 3ULQB 1DPRA 1IAWA 1OR7A 1FBSA 4L18B 3K9TA 2QQBA 2DLLA 4U0YA 3REOA 3HSRA 2CSOA 1IXRC 2L4MA 2YPRA 1WRJA 1YS6A 1WWXA 1J7KA 2RN7A 3WU0A 3KLOA 1O7LA 2L02A 4LLNA 5FGMA 1JXSA 3HSFA 1QNTA 1TBXA 5DCFA 1LVAA 3ZPLA 1G3TA 2ADUA 2O03A 1QPMA 1R1TA 3KP2A 3E3VA 2XASA 3FF5A 1KQ9A 1RIOH 4JBAA 1RZ4A 3M7GA 3CJNA 1J2XA 3Q9VA 1QZZA 1SFXA 2OQRA 3F72A 2ELHA 4L5IA 1STZA 1WQ2A 1QGPA 2QVOA 3RYRA 5BOXA 2VE8A 5DV5A 1WSUA 1SFUA 3ZMTA 3VOEA 2F5EA 2VODA 3RTRA 1CGPA 4AIHA 2A07F 1HQCA 3VFZA 2X0LA 3IKTA 3KP7A 1W4MA 3LA7A 3PQKA 2KJCA 2Y48A 3LWFA 2A6HF 4LB5A 1R7JA 1FT9A 3BDDA 3T5XA 4YFXF 1GXPA 2YX7A 3TOBA 4HYEA 4XLPF 4HF0A 1R5HA 4ETSA 4Q47A 2LF7A 4S05A 3FWEA 3E6CC 3HRSA 3CUQC 3FXUA 3P9CA 4OU0A 2MH2A 1HXDA 1U6GA 3R4KA 5HLIA 2ZMEA 1G3WA 3BZ6A 2CYYA 5CLSA 1L0OC 5FD6A 4HV6A 2OD5A 4S04A 3CDHA 3GUDA 2PG4A 5H20A 3DP7A 4HDUA 2RVCA 2ESNA 2P5LC 5JR3A 1U5TB 1Z7UA 2BGCA 5FLXZ 5FFZA 4OIOF 1TLHB 1R36A 2H6CA 1HKSA 2PLYA 1D8JA 4UXNA 3KE2A 2KJBA 5JI6A 2WC2A 2F2EA 3V7CA 2V79A 4F7ZA 1C0WA 3TO7A 1XSXA 4HX7A 2XGXA 3KEQA 1YTYA 3J81Z 1ZG5A 4RGXA 1ON2A 5DUIA 3F8BA 1H9GA 3TO6A 4ZYDA 3FMRA 4EVIA 4UNOA 2L01A 4A5MA 4JQFA 2FNPA 1F9NA 5KVRA 3SHFA 3COAC 1LEBA 1I6XA 4EGYA 2W85A 2DU9A 4IJAA 4HLYA 1R1UA 1K78B 4HV5A 2P6TA 5J8FA 4I7HA 1S29A 3KEOA 3M8EA 5ICGA 2ZO4A 2O8XA 2EK5A 3H92A 5AIPA 2LSOA 3OOPA 4NHJA 5AONA 1LB2A 5D4SA 2EV0A 3QRFF 3RDIA 1MJ9A 4MTDA 3N97A 1BC7C 5FO5A 2GIVA 5ICFA 4R8HA 4RB1A 2ZNZA 4Y13A 1U8RA 2OQGA 3IL2A 4A0YA 4HOBA 3C1DA 1OPCA 2J5OA 2GZWA 4ESFA 1UB9A 1GXQA 3T8TA 4HBLA 5EEGA 3DPLC 4U7DA 3BJAA 4WX9A 5E1XA 5DCMB 2VN2A 4XSZF 1SD6A 3KFWX 4Y17A 3GW2A 5D6FA 2QBYA 2QENA 3FX3A 3U9GA 1ZYRF 4KIFA 3CTAA 3F23A 2RQPA 1IUYA 3WODF 2IRFG 2QQ9A 2A68F 1ZGJA 1S3JA 1ZN2A 4EJUA 2QBYB 2LF8A 2MH9A 3RKXA 4GYGA 3KETA 4BXUA 4K2EA 4G7OF 4ENJA 1B1BA 2RC4A 2XVCA 2EWNA 3BOQA 3ERED 3N4MA 2HQRA 1W7PA 2QM3A 3P7NA 1TQMA 3U2RA 3SXYA 4HQMA 1MGTA 4A5NA 3VODA 2D45A 5L3EA 1KA8A 4HX8A 2D1VA 3C3WA 4O6JA 4YIIA 3HYIA 4OIPF 3RYPA 4OOIA 1W5TA 5DD8A 2IT0A 3IHUA 1T98A 4MEYF 2Q2EA 5CVUA 4MEXF 4CYDA 1BJAA 2F5CA 3E5XA 3WU1B 3FZVA 4XLNF 1LQ1A 4L9TA 1YQAA 1RI7A 3B02A 3V7RA 1UFMA 4PGGA 1Z6RA 2JPCA 2EV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX4 A;  3RPU A;  1XD7 A;  1XGS A;  3C18 A;  1BC8 C;  1KYZ A;  5CVV A;  4EGZ A;  2EV5 A;  2IP2 A;  2C6Y A;  2IPQ X;  2ZFW A;  4R1H A;  2ETH A;  4UV8 A;  3LQR A;  3E6M A;  3DF8 A;  4ENK A;  5L3C A;  1BIB A;  3SFZ A;  1ZGA A;  1YO5 C;  5D5U B;  4KUM A;  3ZMS A;  1P4X A;  1IN4 A;  5LGT A;  4WXH A;  1TQI A;  2VT3 A;  4D0P A;  5HDG A;  1R22 A;  2XHK A;  4OMZ A;  2M87 A;  3L7W A;  2VOO A;  1KU2 A;  4ZYE A;  2F5D A;  2STT A;  4M9X A;  2PMH A;  4EM1 A;  3WGI A;  3I59 B;  4ENM A;  3F21 A;  4B8X A;  4TV7 A;  1KQ8 A;  3EYY A;  2PJP A;  1REP C;  1J75 A;  3Q5F A;  5F6F A;  3WTT C;  2P7V B;  3P9K A;  5LGU A;  4M6X A;  2ISY A;  3GVA A;  4OIR F;  2XKP A;  1J5Y A;  1JHH A;  4QLC U;  4OMY A;  5E1W A;  1XSV A;  1IZ1 A;  1JHF A;  2AXL A;  2CG4 A;  1ON1 A;  3FM5 A;  4BYY A;  2V1U A;  3J7A O;  1FP2 A;  2A5Y B;  3QPT A;  2HS5 A;  4PGH A;  4EV0 A;  2LKP A;  3GF2 A;  5HLG A;  1G3Y A;  1ZG1 A;  1K7A A;  3BRO A;  1I1S A;  4CHU A;  4EQQ A;  1I5Z A;  1ZRF A;  4L9J A;  4LMY A;  2X4H A;  2IW5 A;  1LJ9 A;  2G9W A;  1BOA A;  3R0A A;  3QP5 A;  2DK8 A;  5FB2 A;  4HQE A;  1Z91 A;  2XKO A;  1IN5 A;  4LG0 B;  3F8N A;  2E1C A;  4NB5 A;  1FBQ A;  1PP8 F;  4R79 A;  1FYL A;  1J59 A;  3CUQ B;  1CF7 B;  4GYI A;  4KN7 X;  3J81 K;  4P55 A;  1YIO A;  4IXA A;  2EJR A;  3TO9 A;  2QZ8 A;  2DPD A;  2BEO A;  1Q1H A;  3RJP A;  1T38 A;  3T0Y A;  1G3S A;  2VBZ A;  4OIQ F;  1V3F A;  5D5V B;  1E2X A;  3FHZ A;  5DUK A;  5BMZ A;  2Z99 A;  3WGH A;  1DUX C;  1OYW A;  3V8K A;  1P4A A;  5F1R A;  1RUN A;  1HW2 A;  1T2K A;  4MQV A;  1HW1 A;  1BI3 A;  4AIJ A;  3EQL F;  5ILS A;  3PQJ A;  4UVC A;  4G6Q A;  2XRN A;  1J9I A;  3EYI A;  5K5R A;  3T8R A;  4A2U A;  4KDP A;  3WG9 A;  2UXX A;  3ZMD A;  2W57 A;  4LK0 F;  1D8K A;  2DK5 A;  1OMI A;  4I0B A;  3ZN1 A;  1IN8 A;  3P9I A;  5J6X A;  3O6B B;  1DPU A;  2ZJ2 A;  3KP5 A;  4BHC A;  2G7U A;  4ON0 A;  4WWC A;  3MZH A;  3S2W A;  3ABT A;  1ZRC A;  3ZMZ A;  5ICC A;  1IN7 A;  2PBI A;  2DAO A;  1O3Q A;  3QOP A;  3BY6 A;  3FXQ A;  2BV6 A;  1O57 A;  1U5T A;  3HTU A;  1U3E M;  1ZH5 A;  4BH9 A;  5JHU A;  1YW9 A;  2EFQ A;  3E6D A;  1P6R A;  3V7S A;  1HSJ A;  2XV4 S;  2Q0O A;  3LAP A;  4KIG A;  5F64 A;  3TOA A;  2UXN A;  1BM9 A;  1HBX G;  5CYV A;  3ML6 A;  1O7F A;  1VTN C;  3QP6 A;  1R23 A;  4YG2 F;  3VB2 A;  4LLG F;  1PDN C;  2F5F A;  3HRM A;  5E20 A;  3ZMU A;  2ISZ A;  2M5W A;  2EFN A;  2Z9O A;  1YG2 A;  1KU7 A;  2RV8 A;  5LGN A;  1IXS B;  2FOK A;  5HLH A;  2STW A;  4HA8 A;  3CUO A;  3ECH A;  3ISP A;  4B09 A;  2HWV A;  4WF2 A;  4KMU X;  5HVQ C;  5ILV A;  1S7O A;  2XAG A;  1K78 A;  3ZMV A;  4HX4 A;  2E7X A;  5IT9 K;  4N0B A;  2GXG A;  3PFI A;  3NEU A;  4Z2Y A;  3WTW C;  3F6O A;  5JFR A;  2GQQ A;  3M9A A;  4OIN F;  1SD4 A;  5DYM A;  2A3S A;  1KU3 A;  4M6Y A;  2NNY A;  2CW0 F;  3IRR A;  1O3T A;  1YFH A;  1ZLK A;  1FC3 A;  3W6J B;  5E8G A;  1QZY A;  1SD5 A;  1G4D A;  1KU9 A;  3I53 A;  2EFP A;  3HHG A;  1E17 A;  1FX7 A;  4U7B A;  3I0T A;  2VON A;  4NQW A;  1FNN A;  2WV0 A;  4Q48 A;  5CVJ A;  2GA2 A;  3H3Z A;  2ZCW A;  4O3M A;  4I2O A;  1XMK A;  1UHW A;  2P8T A;  5DCM A;  4RAZ A;  3K69 A;  4ASN A;  3ECO A;  1DDN A;  1RNL A;  1SD7 A;  3JSO A;  2O3F A;  1FOK A;  2JTV A;  2JT1 A;  1UCR A;  1I27 A;  2RGV A;  4XSX F;  2EA4 A;  4WCG A;  2W25 A;  3L2C A;  4A0Z A;  4PZJ A;  3L09 A;  4G8X A;  1P2F A;  2DPU A;  2P5K A;  4BAY A;  2HOE A;  1Z05 A;  1R5G A;  2GAU A;  3KP4 A;  5TJJ A;  3HIF A;  1ZLJ A;  4HW0 A;  4FX4 A;  1P4W A;  1BI0 A;  1XDS A;  1AWC A;  3K1P A;  3KP3 A;  1WKM A;  1TQP A;  2ZBK A;  4HF1 A;  2DT5 A;  4IHS A;  4KMF A;  4FT8 A;  4PDK A;  1B9M A;  1MKM A;  3F22 A;  5FD5 A;  2COM A;  4I98 B;  1HW5 A;  2FQ3 A;  1YS7 A;  1PUE E;  4EMS A;  4ZYH A;  3IRQ A;  2L4A A;  1YW7 A;  4GO1 A;  1XGM A;  1FYM A;  1FP1 D;  2DQR A;  2DI3 A;  2VOP A;  3KZY A;  2PMU A;  2DO7 A;  1IF1 A;  2D2W A;  2MBF A;  5HDN A;  1H0M A;  3DXJ F;  3BJO A;  4M72 A;  3QU6 A;  2V1D A;  1ZRE A;  2DW4 A;  4AWX B;  4AD9 A;  5A2Q Z;  2K4B A;  3DV8 A;  3L9F A;  4ZH4 F;  2OBP A;  1X3U A;  4WXC A;  4HF2 A;  4BQA A;  4HAM A;  1B4A A;  2IJL A;  3LAJ A;  2FSW A;  4P5O A;  5KK1 A;  4Y15 A;  4CZZ A;  2IA0 A;  2HFH A;  4H0E A;  3ZQ7 A;  2XAF A;  3DQV C;  2FNA A;  1ZAO A;  4YIF A;  4E70 A;  3DKW A;  1BIA A;  2R7F A;  2VBY A;  4G94 A;  2ZXJ A;  3HRT A;  4XRF A;  3GFL A;  2PN6 A;  2M1B A;  1D3Y A;  3WTZ A;  1JE8 A;  3MFK A;  4LB6 B;  1IN6 A;  1H9T A;  1BI1 A;  3D0S A;  3HUG A;  3WE2 A;  5BPD A;  1MZB A;  2JRT A;  2R3S A;  3E97 A;  4U88 A;  3GFJ A;  1FSH A;  2XAQ A;  2BBY A;  2V9V A;  3R6S A;  2MLK A;  2PEX A;  5IT3 A;  1FSE A;  4N9H A;  3T1B A;  2QUF A;  2J5P A;  1YW8 A;  1HST A;  3I59 A;  1XMA A;  3FMQ A;  5K5O A;  3JAM Z;  5LHH A;  3BPV A;  1XN7 A;  3QAH A;  3OV8 A;  5LHG A;  2HQN A;  5DEQ A;  1LNW A;  2LNB A;  2QQA A;  3TDZ C;  4MTE A;  3ELK A;  1G6N A;  4EJT A;  3GZ5 A;  3F8C A;  3EDP A;  5EEH A;  2HEO A;  4L0Z B;  1ONV A;  2XUB A;  3ROU A;  1F5T A;  2HTS A;  1O3R A;  2A61 A;  2FA5 A;  4RGS A;  1ODD A;  2OAZ A;  5H6Q A;  3LA3 A;  5E17 F;  3MZY A;  3EET A;  1R00 A;  3MQ0 A;  4RB0 A;  1EH7 A;  4EM2 A;  1ZHF A;  3WGG A;  2K4J A;  3R61 A;  1MJB A;  4LGW A;  3BP8 A;  1J0R A;  2KIU A;  1IRF A;  1LDD A;  1NHA A;  4HDV A;  2Z3Y A;  4CGZ A;  3C7J A;  4IPA A;  1QO0 D;  3V4G A;  4EJV A;  4LG0 A;  4HZF A;  3SZP A;  1IRG A;  4U0V A;  2XIG A;  2PQ8 A;  3CUQ A;  3I71 A;  1CF7 A;  5FLX K;  4M9Z A;  1BBY A;  3O3K A;  4MHG A;  3J80 Z;  2V1X A;  2MLG A;  3R60 A;  2FF4 A;  2BE5 F;  2KIF A;  3MCZ A;  3M1E A;  1SAX A;  4ESB A;  4RB2 C;  2UWM A;  5K1Y A;  2IVM A;  3SQN A;  2G7H A;  4M9S A;  4HLX A;  5L3D A;  4G7Z F;  2BYV E;  3LST A;  2D1H A;  4KNY A;  4KFC A;  4KT5 C;  3JW4 A;  4GGG A;  2MC3 A;  2OZ6 A;  2FML A;  2HZT A;  2HDC A;  3I4P A;  5K5Q A;  3HHH A;  5E8I A;  2VC1 A;  1HKT A;  2EB7 A;  3V8J A;  2ACJ A;  3TGN A;  3G3Z A;  3I58 A;  2GWR A;  4I02 A;  3WTU C;  3O2P E;  4LJZ F;  4YFK F;  4O5V A;  2NYX A;  3JSP A;  1K79 A;  5H6R A;  5D8K B;  2WWY A;  2M45 A;  3MEX A;  1GHC A;  3BWG A;  5HS8 A;  3SZT A;  3GO5 A;  1EV7 A;  1Y0U A;  2A69 F;  3L00 A;  1LEA A;  2OU2 A;  3E6B A;  3JTG A;  5D5W B;  3DFG A;  2AS5 F;  4EJW A;  1Z9C A;  5LEK A;  2NAZ A;  2Y0M A;  3I64 A;  3WTS C;  1XGO A;  3H3U A;  5D6E A;  3FMS A;  1OYI A;  3RPQ A;  2GA1 A;  1T39 A;  1ZG3 A;  1ULY A;  4I09 A;  1U2W A;  1FPQ A;  4CIC A;  5LRS A;  5D4R A;  4KYW A;  1FLI A;  1B59 A;  3LA2 A;  4UHT A;  2TDX A;  1LDK B;  4XBF A;  2O0Y A;  1YLF A;  4U0W A;  5FFX A;  3K2Z A;  2JSC A;  1AOY A;  1OKR A;  4AIK A;  1FYK A;  2JZY A;  3ABU A;  1D5V A;  1T6S A;  2UZK A;  1TW3 A;  4BNC A;  1P92 A;  1USS A;  5LLQ A;  4DNC A;  4P9F A;  3AAF A;  4RAY A;  1TW2 A;  1S7A A;  5ERI A;  4KA4 A;  1EH6 A;  3DPT A;  2FRH A;  4M74 A;  5JVT A;  2E1N A;  3IWF A;  3GYH X;  2P7C B;  4N9I A;  5D8L B;  2PFB A;  2MA3 A;  5A2Q K;  2ZME B;  4I01 A;  2WTE A;  2RNJ A;  2Q8K A;  5HDK A;  5L3G A;  2HYG D;  2O6G E;  2DQL A;  2HKX A;  4M71 A;  1A04 A;  2RDP A;  1F4K A;  1R58 A;  1IXC A;  2QYO A;  5ED4 A;  5E18 F;  4EM0 B;  5DD4 A;  4IF4 A;  4A6D A;  3R0J A;  1MDM A;  3HSE A;  3ZN0 A;  4BHB A;  3FXR A;  2YSR A;  4LLL A;  5LRR A;  1W5S A;  3ZP5 A;  3GLX A;  4UVB A;  4DQ2 A;  3RKW A;  1LDJ A;  2XRO A;  3IC7 A;  1KQ0 A;  2A6E F;  3F8F A;  4JK1 X;  1MDM B;  1XGN A;  1RUO A;  2H09 A;  3DEU A;  3HRU A;  3I5U A;  3EUH A;  5DDG A;  3GZ6 A;  3TDU C;  5AIQ A;  1FBU A;  4A12 A;  2VBW A;  4LFU A;  2DBB A;  1KGS A;  2VE9 A;  4ZZL A;  3QPH A;  4UUV A;  3NQO A;  2FBK A;  4A0X A;  1W7P D;  4KIC A;  2CGP A;  4L0Y B;  1TNS A;  4CXF A;  1U5T C;  3JAM K;  3HTS B;  2L3D A;  4ESJ A;  1WI9 A;  3IWZ A;  5BS6 A;  3CLO A;  5CVR A;  2CQK A;  3FM3 A;  1TNT A;  3G73 A;  2V6C A;  3KP6 A;  1U78 A;  3HOT A;  4Q5S F;  3W6K B;  2HYF A;  2FBH A;  1YYV A;  3V8L A;  1SMY F;  3WE3 A;  4GCV A;  1XCB A;  4L9V A;  2H94 A;  2YR2 A;  3IKV A;  2H27 A;  2MD5 A;  4EJO A;  1I1G A;  2CO5 A;  2IA2 A;  4RB3 C;  4RGU A;  4KN4 X;  2HR3 A;  4UVA A;  2ZKZ A;  1S8N A;  5BPI A;  4MGR A;  2XAJ A;  1UST A;  2M8E A;  5L3B A;  5CVI A;  3E5U A;  3E5Q A;  1XSD A;  5LBQ A;  1MD0 A;  5HS7 A;  2K86 A;  3U1D A;  1OYY A;  1ZAR A;  2FEZ A;  4A6E A;  3GFM A;  4IRG A;  1ZRD A;  1K6O A;  2K02 A;  3KCC A;  1QQI A;  1O3S A;  2E7W A;  4G9Y A;  4I0A A;  2QWW A;  2CWE A;  4FHT A;  4UV9 A;  4LK1 F;  2VXZ A;  3F3X A;  2OA4 A;  2DFI A;  1B9N A;  1TTY A;  4CO8 A;  1QBJ A;  3I54 A;  3K1N A;  4AVP A;  5J8C A;  5L3F A;  3MAJ A;  3WTY C;  2CFX A;  2QLZ A;  1DP7 P;  3J80 K;  4ZZD A;  4MQ9 F;  5CJ9 A;  5IT9 Z;  1IW7 F;  3QU3 A;  3GEZ A;  1SFE A;  1F1Z A;  1EH8 A;  2OZU A;  1W7P B;  1T0F A;  3F8M A;  2Z33 A;  2XAH A;  3BJ6 A;  2Y75 A;  2KIM A;  1JGS A;  3GFI A;  2Z5U A;  1L3L A;  4G7H F;  5ILU A;  1GVJ A;  2DTR A;  2HTJ A;  4L5J A;  4BHP A;  2P6S A;  2PI0 A;  3RI4 A;  1UHM A;  2VT2 A;  2R7D A;  1SMT A;  2P4W A;  3B73 A;  5ICE A;  2K7L A;  1KYW A;  2IA1 A;  3KLN A;  2NRA C;  3GXO A;  2HKO A;  3LFK A;  1BI2 A;  1FZP B;  1XB4 A;  4YFN F;  2L54 A;  1XDU A;  4Q4Z F;  4WK8 F;  4IRI A;  4P9U A;  1MJA A;  2EFW A;  1S6L A;  5HS9 A;  1R1V A;  2B0L A;  4PCQ A;  2K27 A;  4QWQ A;  3BPX A;  3F6V A;  2FU4 A;  6PAX A;  1V4R A;  3CO7 C;  3WTV C;  2FE3 A;  4M73 A;  3TKY A;  3JTH A;  3D5L A;  1FY7 A;  3NRV A;  1FWZ A;  5E1Z B;  2KKO A;  3K0L A;  2KRF A;  3KZZ A;  2H6B A;  4RS8 A;  5D5X B;  3CO6 C;  5TRD A;  2P5V A;  1XCV A;  2EA2 A;  4MNU A;  3VEP A;  5HOO A;  4CDG A;  2RKH A;  2FBI A;  3GWZ A;  5BQT A;  2FMY A;  3Q9S A;  3LQQ A;  1B6A A;  4WXD A;  1Z6T A;  2O61 A;  2NS0 A;  4KIB A;  4IVN A;  4L9N A;  2W84 A;  2YU3 A;  3TQN A;  2ZNY A;  4ZYG A;  3MWM A;  2HGC A;  4G6D A;  2M30 A;  5LEJ A;  4IHT A;  5LHI A;  3HOS A;  1Z1D A;  2W24 A;  4IRH A;  1PP7 U;  2NNN A;  3K1M A;  4GXO A;  3GX4 X;  4FX0 A;  4P96 A;  2GXB A;  3RIR A;  1HKQ A;  1BN5 A;  2LDU A;  3RKY A;  4ENN A;  2VBX A;  2ESH A;  2EFO A;  4RGR A;  3M8F A;  2JPB A;  4LD5 A;  2FXA A;  2VC0 A;  3WTX C;  3ULQ B;  1DPR A;  1IAW A;  1OR7 A;  1FBS A;  4L18 B;  3K9T A;  2QQB A;  2DLL A;  4U0Y A;  3REO A;  3HSR A;  2CSO A;  1IXR C;  2L4M A;  2YPR A;  1WRJ A;  1YS6 A;  1WWX A;  1J7K A;  2RN7 A;  3WU0 A;  3KLO A;  1O7L A;  2L02 A;  4LLN A;  5FGM A;  1JXS A;  3HSF A;  1QNT A;  1TBX A;  5DCF A;  1LVA A;  3ZPL A;  1G3T A;  2ADU A;  2O03 A;  1QPM A;  1R1T A;  3KP2 A;  3E3V A;  2XAS A;  3FF5 A;  1KQ9 A;  1RIO H;  4JBA A;  1RZ4 A;  3M7G A;  3CJN A;  1J2X A;  3Q9V A;  1QZZ A;  1SFX A;  2OQR A;  3F72 A;  2ELH A;  4L5I A;  1STZ A;  1WQ2 A;  1QGP A;  2QVO A;  3RYR A;  5BOX A;  2VE8 A;  5DV5 A;  1WSU A;  1SFU A;  3ZMT A;  3VOE A;  2F5E A;  2VOD A;  3RTR A;  1CGP A;  4AIH A;  2A07 F;  1HQC A;  3VFZ A;  2X0L A;  3IKT A;  3KP7 A;  1W4M A;  3LA7 A;  3PQK A;  2KJC A;  2Y48 A;  3LWF A;  2A6H F;  4LB5 A;  1R7J A;  1FT9 A;  3BDD A;  3T5X A;  4YFX F;  1GXP A;  2YX7 A;  3TOB A;  4HYE A;  4XLP F;  4HF0 A;  1R5H A;  4ETS A;  4Q47 A;  2LF7 A;  4S05 A;  3FWE A;  3E6C C;  3HRS A;  3CUQ C;  3FXU A;  3P9C A;  4OU0 A;  2MH2 A;  1HXD A;  1U6G A;  3R4K A;  5HLI A;  2ZME A;  1G3W A;  3BZ6 A;  2CYY A;  5CLS A;  1L0O C;  5FD6 A;  4HV6 A;  2OD5 A;  4S04 A;  3CDH A;  3GUD A;  2PG4 A;  5H20 A;  3DP7 A;  4HDU A;  2RVC A;  2ESN A;  2P5L C;  5JR3 A;  1U5T B;  1Z7U A;  2BGC A;  5FLX Z;  5FFZ A;  4OIO F;  1TLH B;  1R36 A;  2H6C A;  1HKS A;  2PLY A;  1D8J A;  4UXN A;  3KE2 A;  2KJB A;  5JI6 A;  2WC2 A;  2F2E A;  3V7C A;  2V79 A;  4F7Z A;  1C0W A;  3TO7 A;  1XSX A;  4HX7 A;  2XGX A;  3KEQ A;  1YTY A;  3J81 Z;  1ZG5 A;  4RGX A;  1ON2 A;  5DUI A;  3F8B A;  1H9G A;  3TO6 A;  4ZYD A;  3FMR A;  4EVI A;  4UNO A;  2L01 A;  4A5M A;  4JQF A;  2FNP A;  1F9N A;  5KVR A;  3SHF A;  3COA C;  1LEB A;  1I6X A;  4EGY A;  2W85 A;  2DU9 A;  4IJA A;  4HLY A;  1R1U A;  1K78 B;  4HV5 A;  2P6T A;  5J8F A;  4I7H A;  1S29 A;  3KEO A;  3M8E A;  5ICG A;  2ZO4 A;  2O8X A;  2EK5 A;  3H92 A;  5AIP A;  2LSO A;  3OOP A;  4NHJ A;  5AON A;  1LB2 A;  5D4S A;  2EV0 A;  3QRF F;  3RDI A;  1MJ9 A;  4MTD A;  3N97 A;  1BC7 C;  5FO5 A;  2GIV A;  5ICF A;  4R8H A;  4RB1 A;  2ZNZ A;  4Y13 A;  1U8R A;  2OQG A;  3IL2 A;  4A0Y A;  4HOB A;  3C1D A;  1OPC A;  2J5O A;  2GZW A;  4ESF A;  1UB9 A;  1GXQ A;  3T8T A;  4HBL A;  5EEG A;  3DPL C;  4U7D A;  3BJA A;  4WX9 A;  5E1X A;  5DCM B;  2VN2 A;  4XSZ F;  1SD6 A;  3KFW X;  4Y17 A;  3GW2 A;  5D6F A;  2QBY A;  2QEN A;  3FX3 A;  3U9G A;  1ZYR F;  4KIF A;  3CTA A;  3F23 A;  2RQP A;  1IUY A;  3WOD F;  2IRF G;  2QQ9 A;  2A68 F;  1ZGJ A;  1S3J A;  1ZN2 A;  4EJU A;  2QBY B;  2LF8 A;  2MH9 A;  3RKX A;  4GYG A;  3KET A;  4BXU A;  4K2E A;  4G7O F;  4ENJ A;  1B1B A;  2RC4 A;  2XVC A;  2EWN A;  3BOQ A;  3ERE D;  3N4M A;  2HQR A;  1W7P A;  2QM3 A;  3P7N A;  1TQM A;  3U2R A;  3SXY A;  4HQM A;  1MGT A;  4A5N A;  3VOD A;  2D45 A;  5L3E A;  1KA8 A;  4HX8 A;  2D1V A;  3C3W A;  4O6J A;  4YII A;  3HYI A;  4OIP F;  3RYP A;  4OOI A;  1W5T A;  5DD8 A;  2IT0 A;  3IHU A;  1T98 A;  4MEY F;  2Q2E A;  5CVU A;  4MEX F;  4CYD A;  1BJA A;  2F5C A;  3E5X A;  3WU1 B;  3FZV A;  4XLN F;  1LQ1 A;  4L9T A;  1YQA A;  1RI7 A;  3B02 A;  3V7R A;  1UFM A;  4PGG A;  1Z6R A;  2JPC A;  2EV6 A; 
#chains in the Genus database with same CATH topology
 2YX4 A;  4C3I J;  3RPU A;  3OS1 A;  1W36 C;  2F5V A;  1WI3 A;  2Y31 A;  4HRI A;  3C2B A;  1XD7 A;  4BXF A;  1XGS A;  1N25 A;  3C18 A;  1SVL A;  1G2H A;  1BC8 C;  1KYZ A;  3FK6 A;  1BOB A;  2ZXW H;  3VYS B;  5J1R A;  5CVV A;  5CPR B;  4HSR A;  4J01 A;  3C2H A;  2E2I J;  1VQK I;  1VND A;  4EGZ A;  2M7B A;  2EV5 A;  2IP2 A;  2C6Y A;  2IPQ X;  3MN2 A;  1RKW A;  2ZFW A;  4R1H A;  2L9V A;  2ETH A;  4XKC A;  4UV8 A;  3LQR A;  2LRE A;  3MKW B;  2CMP A;  2JA5 J;  3E6M A;  3DF8 A;  2E5N A;  3HUG B;  4ENK A;  5L3C A;  1BIB A;  3SFZ A;  2Z16 A;  1BR1 A;  1ZGA A;  1YO5 C;  5D5U B;  5EG0 A;  4KUM A;  3OMY A;  3ZMS A;  3BR1 A;  1P4X A;  2B9S A;  3S15 J;  1FIP A;  1IN4 A;  1MMN A;  2WAQ A;  5LGT A;  4WXH A;  1JI8 A;  3DTI A;  1WH5 A;  5FRM A;  1TQI A;  2VT3 A;  4DIQ A;  3K4N A;  5HDG A;  4D0P A;  1R22 A;  2XHK A;  3K4C A;  4OMZ A;  1X1C A;  3ABK H;  3LSK A;  3AL0 C;  2M87 A;  2L7F P;  3L7W A;  3ZQQ A;  2VOO A;  1ZQ3 P;  2N8G A;  1KU2 A;  1DGR M;  3K4K A;  4ZYE A;  4BJ6 C;  2F5D A;  5J4V A;  2STT A;  4M9X A;  2PMH A;  4EM1 A;  3WGI A;  3SZG A;  3I59 B;  3WG7 H;  4E6K G;  3V42 A;  4ENM A;  3F21 A;  4B8X A;  4TV7 A;  5B3S H;  1KQ8 A;  1ZGW A;  4ANJ A;  3EYY A;  2PJP A;  1W1W E;  2V9P A;  1YJN I;  2L0K A;  3Q5F A;  1J75 A;  1REP C;  1MBH A;  1G8X A;  4XM3 A;  5F6F A;  3WTT C;  2P7V B;  3P9K A;  3A01 A;  5LGU A;  4M6X A;  1WJB A;  2ISY A;  2UV1 A;  3GVA A;  4OIR F;  5M5Y J;  4A3D J;  2XKP A;  3HL2 A;  2R7R A;  1J5Y A;  1JHH A;  2KIQ A;  4S0H B;  4J00 A;  4QLC U;  4F93 B;  5B1B H;  4XRS A;  3OL3 A;  4OMY A;  1V5E A;  3BC8 A;  5E1W A;  4B47 A;  1XSV A;  1IZ1 A;  1JHF A;  2EIN H;  4D7N A;  2AXL A;  4E7S A;  2CG4 A;  1ON1 A;  3OYI A;  1QPI A;  3FM5 A;  4BYY A;  1Z0X A;  4NC8 A;  3UR3 C;  2V1U A;  3J7A O;  1FP2 A;  2A5Y B;  3I55 I;  3QPT A;  2HS5 A;  5F0C A;  2R7Q A;  4PGH A;  4EV0 A;  3ESW B;  2K9S A;  3S17 J;  3A01 B;  2OV7 A;  4QPO A;  2LKP A;  3GF2 A;  5HLG A;  2DMN A;  4ITV A;  1G3Y A;  3JRA A;  1ZG1 A;  1K7A A;  3BRO A;  1X1A A;  1XC5 A;  4HNU A;  1LPQ A;  1I1S A;  1T0F C;  2VPR A;  4CHU A;  3L2U A;  4EQQ A;  1I5Z A;  3NAU A;  2ID6 A;  1ZRF A;  3I9V 2;  5IY5 H;  1Z21 A;  4L9J A;  4PJ0 C;  4LMY A;  2X4H A;  2IW5 A;  3MKZ A;  3GCM A;  2E71 A;  3HM5 A;  3J7Z I;  4A3G J;  1IV6 A;  3BQY A;  1LJ9 A;  2G9W A;  3NWT A;  1BOA A;  3R0A A;  1P7J A;  2X85 A;  3S3N A;  3PUB A;  2E34 A;  3QP5 A;  2DK8 A;  2KDZ A;  5J3L A;  3Q0U A;  5FB2 A;  2OCC H;  4XKV A;  1Z91 A;  2XKO A;  4HQE A;  1IN5 A;  4LG0 B;  3F8N A;  4FIS A;  4NB5 A;  1FBQ A;  1H8A C;  2E1C A;  3A2K A;  1PP8 F;  5JLX A;  3VSL A;  4R79 A;  2RQQ A;  2R7V A;  1N75 A;  1FYL A;  1J59 A;  3CUQ B;  3VYR B;  1CF7 B;  2Y69 H;  4GYI A;  4KN7 X;  3J81 K;  4P55 A;  1YIO A;  4IXA A;  1D0Y A;  4IQ4 A;  2EJR A;  3TO9 A;  3CCL I;  1MBG A;  2QZ8 A;  3CJQ B;  2NS8 A;  4E7J A;  2UUZ A;  2DPD A;  1X4P A;  2BEO A;  1Q1H A;  3RJP A;  4EEF G;  1T38 A;  1WJF A;  3T0Y A;  1G3S A;  2VBZ A;  4OIQ F;  1V3F A;  5KAI C;  2R5Z A;  4CYC B;  5D5V B;  1E2X A;  4DW6 A;  1ZR4 A;  2K40 A;  3FHZ A;  5DUK A;  2OF7 A;  4AID A;  4C3H J;  4C2M J;  5BMZ A;  2Z99 A;  3G6E I;  3WGH A;  3CCM I;  1LVK A;  5K7H A;  3HOZ J;  2HOA A;  3ZCO A;  2OCE A;  1DUX C;  1OYW A;  3BTJ A;  1P4A A;  2EPF A;  3FXL A;  3V8K A;  3GTG J;  5F1R A;  5C4J J;  1RUN A;  5M3F J;  1HW2 A;  1D1A A;  1T2K A;  4MQV A;  2DFF A;  1HW1 A;  2HDD A;  1BI3 A;  4AIJ A;  2K85 A;  3TL4 X;  3EQL F;  1NK3 P;  5ILS A;  3PQJ A;  4UVC A;  4G6Q A;  4ZDP A;  1VQ7 I;  2R5Z B;  4BDZ A;  2XRN A;  2FOW A;  2NVU B;  1J9I A;  2HU9 A;  2WA0 A;  3EYI A;  5K5R A;  4D1Q A;  3T8R A;  4B1R A;  4A2U A;  4KDP A;  3AG1 H;  3HXL A;  4KIT B;  2NS7 A;  3QYF A;  3ZQF A;  3WG9 A;  2CV1 A;  2UXX A;  2FD5 A;  3ZMD A;  2M0M A;  2L9N A;  2W57 A;  3OYK A;  2V9K A;  4B48 A;  4LK0 F;  2E1O A;  2VXD A;  1D8K A;  3A0B C;  2DK5 A;  4CZC A;  4A3I J;  2IGO A;  5M5X J;  3K4J A;  5JVG F;  2IBD A;  1SFK A;  2EIK H;  3SDB A;  1OMI A;  4I0B A;  3ZN1 A;  1IN8 A;  3H9Q A;  3P9I A;  5J6X A;  3O6B B;  4XOR A;  4GRI A;  4HNT A;  1DPU A;  2ZJ2 A;  1UZC A;  2HZD A;  3OYN A;  5EGO B;  3KP5 A;  2X9D A;  4BHC A;  2G7U A;  4ON0 A;  4WWC A;  3MZH A;  3OR1 C;  3S2W A;  3ABT A;  2B7E A;  1ZRC A;  1LFB A;  3ZMZ A;  2M0C A;  4XMY A;  2ID3 A;  4AC0 A;  1R71 A;  2E2H J;  1IC8 A;  1LFU P;  2R7S A;  5ICC A;  1IN7 A;  2PBI A;  4OAY A;  4RAF A;  2DAO A;  1E0E A;  3BQZ A;  1O3Q A;  3QOP A;  3BY6 A;  1ENH A;  3QQA A;  3FXQ A;  2BV6 A;  1O57 A;  1U5T A;  2IAI A;  3HTU A;  4XKW A;  3W3C A;  5K7F A;  4BH9 A;  1U3E M;  1ZH5 A;  4BQQ A;  4XID A;  5EZG A;  1RKT A;  1YW9 A;  5JHU A;  1W0T A;  2EFQ A;  3E6D A;  3HGY A;  3QPS A;  1P6R A;  1WHU A;  3V7S A;  4CCO A;  1HSJ A;  2XV4 S;  4LIV A;  4Y3O A;  2Q0O A;  3LAP A;  4KIG A;  5F64 A;  4KIS A;  3TOA A;  2UXN A;  1B72 A;  2CV2 A;  1S72 I;  2BHY A;  3H5A A;  1BM9 A;  1HBX G;  2COB A;  5CYV A;  3ML6 A;  4IL6 C;  1O7F A;  1LUJ B;  2JK3 A;  1VTN C;  3QP6 A;  2LKS A;  3Q0V A;  2LC2 A;  1MW7 A;  2XC7 A;  2XSD C;  1R23 A;  3D5S C;  2L9S A;  2JUG A;  4YG2 F;  3H3V K;  1XTA A;  3VB2 A;  1JUP A;  4ZTJ A;  2O9L A;  4LLG F;  1PDN C;  4YIR X;  1YX5 A;  2F5F A;  3A03 A;  4BBR J;  2MW8 A;  3HRM A;  5E20 A;  4BKX A;  3ZMU A;  4BEH A;  3MMY B;  3OYL A;  2M5W A;  2EFN A;  2ISZ A;  2Z9O A;  3OWT A;  1YG2 A;  1Z3X A;  1KU7 A;  2RV8 A;  5LGN A;  1IXS B;  2FOK A;  5HLH A;  3SEQ A;  1RES A;  1B72 B;  2STW A;  4HA8 A;  3CUO A;  3ECH A;  1YRN A;  2GOX B;  1YJ9 I;  3W6V A;  3ISP A;  2JQ7 A;  4B09 A;  2HWV A;  4WF2 A;  4IQJ A;  1TWH J;  2IXS A;  4PUS A;  4KMU X;  3B6A A;  3DU5 A;  5HVQ C;  1X1B A;  1MBF A;  5ILV A;  3FXK A;  1S7O A;  2XAG A;  4B3A A;  1K78 A;  3ZMV A;  4HX4 A;  5GTH C;  3FIW A;  1DU0 A;  4XON A;  2E7X A;  2E1M B;  4N0B A;  5IT9 K;  2GXG A;  4EAT A;  3PFI A;  4BEH B;  3NEU A;  4Z2Y A;  3WTW C;  1U9N A;  3QWL A;  1MMA A;  1G59 A;  3F6O A;  5JFR A;  2GQQ A;  1YRN B;  2JVG A;  3M9A A;  4OIN F;  2NOJ B;  1SD4 A;  3BLY A;  5DYM A;  2A3S A;  2P81 A;  1VI0 A;  1KU3 A;  4M6Y A;  1FMV A;  2CW0 F;  2NNY A;  3IRR A;  2X1D A;  1O3T A;  3OYJ A;  4PK4 A;  1YFH A;  4Y4R A;  3ZRG A;  1ZLK A;  3OIO A;  1FC3 A;  3W6J B;  3BTC A;  1QZY A;  1SD5 A;  5E8G A;  1G4D A;  3JRE A;  1KU9 A;  3I53 A;  2EFP A;  3W2A A;  3FKJ A;  3HHG A;  1E17 A;  1FX7 A;  1RR7 A;  4U7B A;  3I0T A;  2GM4 A;  2VON A;  4NQW A;  2DA5 A;  2R5Y A;  2HOS A;  3IAS 2;  1FNN A;  2WV0 A;  4Q48 A;  5CVJ A;  2GA2 A;  3H3Z A;  3HG9 A;  3PO2 J;  2ZCW A;  4O3M A;  2FUG 2;  5E3N A;  4I2O A;  1QA6 A;  1XMK A;  2CUE A;  1UHW A;  2P8T A;  5DCM A;  5GAG J;  2R7X A;  4RAZ A;  1WH7 A;  3K69 A;  2L9R A;  2ZXI A;  4ASN A;  2FX0 A;  3ECO A;  4FE4 A;  4W1U A;  3BG3 A;  2CH0 A;  1DDN A;  1RNL A;  4BDY A;  4FET A;  1SD7 A;  3JSO A;  2O3F A;  2HVS A;  2VQC A;  2OC6 A;  1FOK A;  2JTV A;  2JT1 A;  1UCR A;  1LE8 A;  1I27 A;  1JTX A;  2RGV A;  4XSX F;  3A0H C;  3RCO A;  2EA4 A;  4WCG A;  2YU9 J;  3DEW A;  2W25 A;  4A0Z A;  3L2C A;  4PZJ A;  3L09 A;  3OY9 A;  4G8X A;  2ME0 A;  1P2F A;  2DPU A;  2XF6 A;  2ZME C;  2P5K A;  1A35 A;  4BAY A;  2LY9 A;  4DZJ A;  3CD6 I;  2IS1 A;  2HOE A;  1Z05 A;  1R5G A;  1VQM I;  1V5F A;  5GAD J;  2GAU A;  3KP4 A;  5TJJ A;  3HIF A;  1ZLJ A;  4ZDO A;  3X2Q H;  4HW0 A;  4FX4 A;  1P4W A;  4N4O B;  1BI0 A;  2HQ5 A;  2FJ1 A;  1JJ8 C;  1XDS A;  1AWC A;  3K1P A;  2LRD A;  3KP3 A;  1WKM A;  1TQP A;  2ZBK A;  1XS9 A;  4HF1 A;  2DT5 A;  1AKH B;  2EZI A;  2NVQ J;  4IHS A;  4KMF A;  4FT8 A;  4PDK A;  1B9M A;  1HDD C;  1MKM A;  4M6V A;  3F22 A;  3OIQ A;  1WCM J;  1W5C C;  5FD5 A;  2COM A;  4I98 B;  2DMU A;  1HW5 A;  2FQ3 A;  1YS7 A;  1FOY A;  1PUE E;  1IJW C;  4EMS A;  2BOL A;  3IP4 B;  4PJN A;  2DN0 A;  4ZYH A;  1OFC X;  3IRQ A;  2L4A A;  4HG2 A;  1YW7 A;  4GO1 A;  1QVU A;  1XGM A;  1B8I A;  1WPK A;  1T33 A;  4E7K A;  1FYM A;  1FP1 D;  2DQR A;  4M3G A;  5KAF C;  2DI3 A;  2ZJP F;  2VOP A;  3EUK L;  3KZY A;  2PMU A;  2DO7 A;  1RRJ A;  3ASN H;  4Y33 A;  1IF1 A;  2D2W A;  2MBF A;  5HDN A;  1H0M A;  2LFB A;  3DXJ F;  3BJO A;  4M72 A;  2CW7 A;  2VJI A;  3QU6 A;  2V1D A;  1ZRE A;  2DW4 A;  4AWX B;  4XR6 A;  4AD9 A;  5A2Q Z;  1WZ2 A;  2K4B A;  3DV8 A;  1MSE C;  2DA1 A;  3L9F A;  4ZH4 F;  2OBP A;  4AM3 A;  2CJJ A;  1X3U A;  3BTL A;  4WXC A;  3OSF A;  5IYB J;  1MND A;  4HF2 A;  2MD0 A;  4XLA A;  5IP6 A;  4BQA A;  4HAM A;  3WU2 C;  1B4A A;  1SEU A;  3AL0 B;  2IJL A;  4A3J J;  2P0W A;  2ELK A;  2F4O B;  2FSW A;  3LAJ A;  4P5O A;  5B66 C;  1MBE A;  3CDI A;  1JGG A;  5KK1 A;  3DEE A;  4Y15 A;  4CZZ A;  1QRY A;  2IA0 A;  2HFH A;  4H0E A;  1ETV A;  3ZQ7 A;  1DU6 A;  2XAF A;  1R5I D;  2FNA A;  3DQV C;  2TCT A;  5BNG A;  1ZAO A;  4YIF A;  1X2N A;  4E70 A;  1IG7 A;  3CCU I;  2I5U A;  3DKW A;  4M3E A;  1BIA A;  2R7F A;  3CF5 F;  2VBY A;  1EKE A;  4G94 A;  3CP2 A;  1NG7 A;  2ZXJ A;  3LFU A;  2AO9 A;  4QSH A;  2VI6 A;  3HRT A;  3PO3 J;  4XRF A;  4N4N B;  3TMO A;  3GFL A;  2PN6 A;  2Y0S N;  2X6Y A;  2M1B A;  1D3Y A;  3JRF A;  3WTZ A;  4E7H A;  1JE8 A;  3MFK A;  3CLQ A;  4LB6 B;  2VKD A;  1IN6 A;  4FQG A;  1VFC A;  1H9T A;  1BI1 A;  3D0S A;  3HUG A;  5EZH A;  1Z7L A;  2GXA A;  3GTJ J;  3WE2 A;  1WVR A;  2LLK A;  3H36 A;  5BPD A;  1MZB A;  2F4M B;  1BW6 A;  2JRT A;  2R3S A;  3E97 A;  3PJR A;  3DLA A;  3HZJ A;  4U88 A;  3CQZ J;  5LD2 C;  2K9L A;  3QOD A;  4B4C A;  3BG6 A;  3GFJ A;  3DTE A;  1HLV A;  4D7M A;  1FSH A;  3GLL A;  5J4Y A;  3S1R J;  2XAQ A;  1I50 J;  2BBY A;  4D5C A;  2XSJ C;  2V9V A;  3E7L A;  3R6S A;  2DYR H;  2MLK A;  2BHZ A;  3PUF A;  4D5F A;  2PEX A;  3CES A;  3BR5 A;  5CQG A;  5IT3 A;  2CUF A;  2ZSH B;  1FSE A;  4N9H A;  3T1B A;  2QUF A;  2J5P A;  1YW8 A;  1HST A;  3I59 A;  1UEL B;  1XMA A;  3FMQ A;  4YRV A;  5K5O A;  3JAM Z;  2LBF B;  5LHH A;  3BPV A;  2JA6 J;  1OCR H;  1A5J A;  4GDF A;  4DZP A;  4A3B J;  1UJ8 A;  2VKE A;  1XN7 A;  3S8P A;  3N05 A;  1YE9 A;  3RQI A;  1X3W B;  3QAH A;  3OV8 A;  2CUZ A;  2KIS A;  2JA8 J;  5LHG A;  2HQN A;  3JRG A;  3SFI A;  3CDL A;  3BZK A;  1QVT A;  5DEQ A;  1A36 A;  2I8D A;  1LNW A;  2LNB A;  2QQA A;  3TDZ C;  1ETW A;  5FKN A;  1R4N B;  4MTE A;  3VDX A;  2W7N A;  3ELK A;  1G6N A;  4EJT A;  3GZ5 A;  3HKZ N;  2JMW A;  3F8C A;  3OYA A;  3PNV A;  4F92 B;  3EDP A;  5CQE A;  4C2U A;  1V54 H;  2KPM A;  5EEH A;  3GME A;  2HEO A;  4IKF A;  4L0Z B;  1AHD P;  1ONV A;  2XUB A;  3A02 A;  3HOU J;  3ROU A;  1MBK A;  4JX5 A;  2CV0 A;  1I3A A;  1F5T A;  1IO2 A;  2E36 A;  2HTS A;  1O3R A;  4CH7 A;  2A61 A;  3LNQ A;  4RM3 A;  2X6X A;  2FA5 A;  3FHN A;  4RGS A;  1ODD A;  2OAZ A;  2IEK A;  2HYJ A;  4MO7 A;  3GBG A;  4XKB A;  5H6Q A;  2KHM A;  1JJ6 C;  2B63 J;  3LA3 A;  1Y1V J;  3S16 J;  2Y30 A;  5TGT A;  5E17 F;  2LMD A;  3MZY A;  2KRH A;  3EET A;  3PNT A;  1R00 A;  4RLF A;  3MQ0 A;  4RB0 A;  4BQN A;  5F27 A;  1EH7 A;  3FK7 A;  4EM2 A;  1ZHF A;  4ABZ A;  3WGG A;  4XQF A;  2K4J A;  4FCY A;  3R61 A;  1MJB A;  1KON A;  3AFH A;  2QQ8 A;  4LGW A;  2R7Z J;  2DOA A;  1XMX A;  2EIJ H;  1FEX A;  3BP8 A;  3OSG A;  1J0R A;  2F48 A;  4AU7 A;  3CMM A;  2KIU A;  1IRF A;  4FTH A;  2O5R A;  1LDD A;  1TWC J;  5JHF A;  1NHA A;  4HDV A;  2Z3Y A;  4CGZ A;  3C7J A;  4IPA A;  4IEJ A;  3S2D J;  1QO0 D;  3IAM 2;  4HPQ A;  3V4G A;  4EJV A;  4LG0 A;  5E3L A;  4HZF A;  3SZP A;  1IRG A;  3FKI J;  4BBS J;  4U0V A;  2XIG A;  1YHQ I;  3G1O A;  3DCF A;  2PQ8 A;  4UB8 C;  2D5V A;  2F4I A;  1OLT A;  2V26 A;  3CUQ A;  1PYV A;  2LOO A;  3I71 A;  1CF7 A;  5FLX K;  2R7W A;  1D0X A;  1VQ9 I;  3CC2 I;  2K9Q A;  1WJC A;  4M9Z A;  1WJA A;  3JRD A;  3QYE A;  1BBY A;  3O3K A;  4MHG A;  3J80 Z;  3EUA A;  2V1X A;  2E35 A;  2MLG A;  3R60 A;  2FF4 A;  4CYC A;  2L2O A;  2BE5 F;  3LMM A;  2KIF A;  3HKZ A;  3CME I;  3MCZ A;  1MIJ A;  4BS9 A;  1MMS A;  4JX4 A;  3M1E A;  1SAX A;  4ESB A;  1NTC A;  4RB2 C;  1OCZ H;  4NC6 A;  2UWM A;  4JP0 A;  5K1Y A;  3DU6 A;  1GV5 A;  5IOZ A;  3ZXS A;  2A05 A;  2IVM A;  4AUX A;  3SQN A;  1TT5 B;  2G7H A;  4M9S A;  4HLX A;  3LSH A;  1X4O A;  5L3D A;  4G7Z F;  2E60 A;  2BYV E;  3LST A;  4BY7 J;  2D1H A;  2L7M P;  1GDT A;  4KNY A;  4BXX J;  2W82 A;  2VB6 A;  1HDP A;  2CW8 A;  1N78 A;  1VQ8 I;  2W48 A;  4KFC A;  4KT5 C;  2X1E A;  3JW4 A;  1FJL A;  4GGG A;  2MC3 A;  4C9Y A;  4A3K J;  2OZ6 A;  1MMD A;  2FML A;  4PSW A;  2V6E A;  2HZT A;  3ZQH A;  2HDC A;  1TL8 A;  1TZL A;  4BE2 A;  2QGU A;  3I4P A;  5K5Q A;  4DGW B;  3HHH A;  4PSX A;  5E8I A;  2K3P A;  2VC1 A;  1HKT A;  3LL7 A;  3H9J A;  2EB7 A;  3L2Q A;  3V8J A;  2ACJ A;  3TGN A;  2NVY J;  3G3Z A;  3I58 A;  2GWR A;  2WBM A;  4I02 A;  3ZQG A;  3WTU C;  2CU7 A;  3O2P E;  2VLA A;  1X19 A;  4LJZ F;  4YFK F;  1VQ4 I;  1F36 A;  4O5V A;  1KZH A;  3O8H A;  2NYX A;  3JSP A;  2X6W A;  1K79 A;  4LIT A;  5H6R A;  5D8K B;  2M45 A;  3MEX A;  2WWY A;  2EIL H;  4DJA A;  1GHC A;  3BWG A;  5HS8 A;  3SZT A;  1X2M A;  2NVT J;  3GO5 A;  1EV7 A;  4RLQ A;  1Y0U A;  2A69 F;  4E7I A;  3VYU B;  5EGO A;  3L00 A;  1LEA A;  2OU2 A;  3E6B A;  3JTG A;  5D5W B;  5FJ8 J;  3DFG A;  2AS5 F;  1IUF A;  4EJW A;  2XAU A;  1JUS A;  1NH3 A;  3PSI A;  4LIU A;  1Z9C A;  5LEK A;  2NAZ A;  2Y0M A;  3I64 A;  3WTS C;  3L1P A;  2AXT C;  1XGO A;  4YEL A;  3H3U A;  4IX7 A;  5D6E A;  1MH3 A;  4CCK A;  3O8G A;  4CCN A;  3FMS A;  1OYI A;  1RC9 A;  1OIS A;  3RPQ A;  2XGC A;  4FE7 A;  4I76 A;  2GA1 A;  5EEA A;  1T39 A;  3OS2 A;  1ZG3 A;  3OOU A;  1ULY A;  4I09 A;  1U2W A;  1FPQ A;  1RR8 C;  4C3J J;  3DKX A;  4HST A;  4CIC A;  1DP3 A;  5LRS A;  4XLE A;  1R4M B;  5D4R A;  4KYW A;  5FKM A;  1FLI A;  3HEF A;  1B59 A;  3K2A A;  3LA2 A;  4UHT A;  2TDX A;  2Y9Y A;  1LDK B;  5F1J A;  3I4N J;  2VAS A;  4XBF A;  2O0Y A;  4AYB N;  1YLF A;  4U0W A;  1QHH D;  5FFX A;  2X51 A;  4XOT A;  1YIJ I;  3K2Z A;  3GZN B;  3K10 A;  2JSC A;  1AOY A;  3GTK J;  1X1D A;  1OKR A;  4AIK A;  1FYK A;  2JZY A;  2BY3 A;  3G1M A;  3ABU A;  1D5V A;  2GBY A;  3ERM A;  3HGG A;  1K6Y A;  4OAZ A;  4I6Z A;  3J7Y J;  1U8B A;  1D5Y A;  3KYD B;  3BG9 A;  1T6S A;  2XB0 X;  2UZK A;  2JA2 A;  5E3O A;  2M2E A;  3TW7 A;  4NBQ A;  3W2W A;  5IPA A;  1TW3 A;  4BNC A;  1WJD A;  1P92 A;  2EZK A;  3LSI A;  3K70 D;  1USS A;  5LLQ A;  4DNC A;  2X1C A;  3QPL A;  4P9F A;  3AAF A;  4RAY A;  1TW2 A;  1QZE A;  1S7A A;  5ERI A;  4JYK A;  5J47 A;  1SC7 A;  4KA4 A;  2DMT A;  3RSN A;  2H1L A;  1EH6 A;  4CA0 A;  1H89 C;  3DPT A;  2FRH A;  4M74 A;  5JVT A;  2E1N A;  3IWF A;  3RKQ A;  4C2T A;  3GYH X;  3KYL A;  2P7C B;  3OYG A;  1R9T J;  2CQQ A;  4N9I A;  3WHC A;  5D8L B;  2PFB A;  2MA3 A;  2ZFU A;  5A2Q K;  1EF4 A;  2QSG X;  1ZKG A;  2LYC A;  2MAB A;  2ZME B;  5FKL A;  4AVZ A;  1W36 D;  4I01 A;  2WTE A;  2RNJ A;  2Q8K A;  5HDK A;  5L3G A;  2YS9 A;  3GTO J;  2HYG D;  1BR4 A;  2MFZ A;  4UUS B;  3VWB A;  4BY1 J;  5J40 A;  2DQL A;  2HKX A;  1Y1W J;  2O6G E;  4M71 A;  5F04 A;  4KT6 A;  1A04 A;  2RDP A;  2DDA A;  2DFH A;  1S5L C;  1F4K A;  3PIO F;  3CCE I;  1R58 A;  4JOM A;  2KRC A;  2XB5 A;  1IXC A;  2QYO A;  5ED4 A;  2RAE A;  5E18 F;  4AYB A;  4EM0 B;  1VQ5 I;  5DD4 A;  4IF4 A;  4A6D A;  3R0J A;  2LK2 A;  1I3Q J;  1TP4 A;  1MDM A;  3HSE A;  3IH2 A;  4RMN A;  1OCT C;  3ZN0 A;  3D5R C;  4BHB A;  1R49 A;  2PJR B;  1JUM A;  3FXR A;  2DOE A;  2GLO A;  2YSR A;  4IZZ A;  4LLL A;  2QKL B;  3JRC A;  3JR9 A;  3AKZ A;  9ANT A;  1NG6 A;  5LRR A;  1W5S A;  1NK2 P;  3ZP5 A;  3GLX A;  4E7L A;  4UVB A;  2NOG A;  3TW6 A;  2DMP A;  3FIS A;  3G71 I;  3HDD A;  4DQ2 A;  3RKW A;  1LDJ A;  2K3F A;  4HNV A;  1YIT I;  2E19 A;  2XRO A;  1OCO H;  1KQ0 A;  3IC7 A;  2A6E F;  3F8F A;  4JK1 X;  1GT0 C;  3K4B A;  1MDM B;  2DFE A;  1XGN A;  1RUO A;  1FMW A;  2H8W A;  1E3H A;  2H09 A;  4XRM A;  4F91 B;  5M5W J;  3DEU A;  3LSM A;  3HRU A;  3I5U A;  3EUH A;  2HPI A;  5DDG A;  1Y56 A;  4E4H A;  3HPG A;  3GZ6 A;  3TDU C;  5AIQ A;  4DYR A;  2M34 A;  1FBU A;  3FBN B;  4XOP A;  4A12 A;  2VUM J;  2VBW A;  4I99 C;  2DBB A;  4LFU A;  2H8R A;  1KGS A;  2VE9 A;  1N77 A;  3H9G A;  3M8J A;  3K4M A;  3CCR I;  4BGD A;  1BL0 A;  4ZZL A;  1IV8 A;  3QPH A;  4UUV A;  3NQO A;  3L2W A;  2FBK A;  2OTJ I;  2CQ7 A;  3HJE A;  5IYC J;  1VZ0 A;  1AKH A;  4F55 A;  2M4G A;  1APL C;  2L5Q A;  4A0X A;  1W7P D;  2EIM H;  4KIC A;  5H2F C;  3JRB A;  2CGP A;  3VYT B;  5JLW A;  4L0Y B;  1TNS A;  1MBJ A;  2IS2 A;  2XPU A;  4XNF A;  4CXF A;  1FOX A;  1T8I A;  3HOX J;  3Q0W A;  3B6C A;  1U5T C;  5EYR A;  2M7A A;  3JAM K;  3HTS B;  2L3D A;  4ESJ A;  3BR6 A;  1WI9 A;  3IWZ A;  5BS6 A;  3CLO A;  4IHY A;  3PL8 A;  1HA8 A;  2MG4 A;  5CVR A;  2CQK A;  3CCQ I;  3FM3 A;  1XX5 A;  3S1Q J;  2E5Z A;  1TNT A;  3G73 A;  2V6C A;  2HOT A;  3DTK A;  3OYB A;  1Y39 A;  5K7Z A;  3LSG A;  4IO9 F;  2WAF A;  3KP6 A;  1U78 A;  5GPA A;  3HOT A;  4Q5S F;  3W6K B;  4A93 J;  2HYF A;  1XPX A;  2FBH A;  1YYV A;  3V8L A;  4B3X A;  1SMY F;  3BG5 A;  3WE3 A;  4GCV A;  4D9J A;  1K4S A;  5FRO A;  4IHV A;  5E79 C;  1PUF B;  1XCB A;  4L9V A;  2H94 A;  2YR2 A;  5J1U A;  3IKV A;  2H27 A;  1XG1 A;  2MD5 A;  4EJO A;  4CCJ A;  1I1G A;  2CO5 A;  2DA7 A;  2EQR A;  2IA2 A;  4RGU A;  4RB3 C;  1ZEL A;  4PJJ A;  5GP9 A;  4DBQ A;  2OPT A;  4KN4 X;  2HR3 A;  3VSK A;  2F6C A;  2VQH A;  4UVA A;  1HC8 A;  2ZKZ A;  1HOM A;  1S8N A;  2VJJ A;  2MC4 A;  2HI3 A;  5BPI A;  2EZL A;  3GTP J;  4MGR A;  4II3 A;  4A3L J;  2XAJ A;  3KYC B;  1UST A;  2M8E A;  2VJ4 A;  5L3B A;  5CVI A;  2W4S A;  2M3A A;  3E5U A;  3E5Q A;  1XSD A;  5LBQ A;  2NXN B;  3DKY A;  1MD0 A;  5HS7 A;  1W0U A;  2K86 A;  1SAU A;  3U1D A;  1OYY A;  1ZAR A;  2FEZ A;  2KT0 A;  1E3P A;  2XF5 A;  4A6E A;  3GFM A;  4A3F J;  4H4K C;  1ETX A;  4IRG A;  4CCM A;  2I10 A;  1ZRD A;  1E3O C;  2BZT A;  1K6O A;  3QOE A;  5F0F A;  3TED A;  2K02 A;  3KCC A;  3BT9 A;  2VKH A;  1QQI A;  2ZC2 A;  2E7W A;  3A4C A;  3CMA I;  1O3S A;  4X6A J;  4G9Y A;  4I0A A;  4BL0 B;  2QWW A;  2CWE A;  4FHT A;  4UV9 A;  4LK1 F;  3EPZ A;  2VXZ A;  3F3X A;  3ABM H;  4A69 C;  2OA4 A;  2DFI A;  1Z67 A;  1B9N A;  1TTY A;  4PJL A;  2MSY A;  4CO8 A;  1QBJ A;  3KIO A;  3I54 A;  3K1N A;  4Y7N J;  3MVP A;  4AVP A;  5J8C A;  5L3F A;  3MAJ A;  2HVR A;  3SYT A;  2M9H A;  3WTY C;  2CFX A;  3J7A Y;  2ECB A;  2QLZ A;  2LKX A;  3PIP F;  1DP7 P;  3J80 K;  4YEJ A;  2XF7 A;  4ZZD A;  5F08 A;  2W00 A;  4MQ9 F;  3CJT B;  5CJ9 A;  5FLM J;  1TWG J;  4XLH A;  2A6T A;  2ZJQ F;  2IS6 A;  5IT9 Z;  3L2V A;  2VIX A;  1IW7 F;  3NWS A;  3QU3 A;  3GEZ A;  3LSJ A;  3GTQ J;  3M3Y J;  3CZ6 A;  1ERD A;  1SFE A;  1F1Z A;  1EH8 A;  2OZU A;  1WJE A;  5EDN A;  1W7P B;  1T0F A;  2QCO A;  1QU3 A;  3F8M A;  2Z33 A;  2XAH A;  2AHQ A;  3HB9 A;  4B44 A;  1EJ9 A;  3BJ6 A;  2DA3 A;  2Y75 A;  2KIM A;  1ACI A;  1JGS A;  4IOA F;  3GFI A;  2Z5U A;  2BW3 B;  1L3L A;  1J09 A;  3OYD A;  1UG0 A;  3TBI A;  3S93 A;  3S2H J;  4G7H F;  5ILU A;  1K4T A;  2JSP A;  1GVJ A;  3A1Y A;  2LBF A;  5DM7 F;  1P7I A;  2DTR A;  3CC4 I;  1Y8Q B;  3L2R A;  1YX3 A;  3H35 A;  3BTI A;  2HTJ A;  4L5J A;  4BHP A;  4BE0 A;  4NDL A;  2P6S A;  2PI0 A;  3RI4 A;  4W97 A;  1UHM A;  2VT2 A;  3BZC A;  2LH9 A;  2R7D A;  4RA2 A;  1SMT A;  2KP6 A;  2XPV A;  2HNH A;  5EJC A;  3ASO H;  2P4W A;  3B73 A;  2Q2E B;  4BU2 A;  5ICE A;  5IOY A;  2K7L A;  1KYW A;  4UUT A;  2IA1 A;  5TIS C;  2KQR A;  3KLN A;  2NRA C;  2EH3 A;  2HKO A;  3GXO A;  1UAA A;  3LFK A;  1BI2 A;  4M3B A;  1FZP B;  1XB4 A;  4YFN F;  2L54 A;  1XDU A;  1JT0 A;  4Q4Z F;  4WK8 F;  4IRI A;  4P9U A;  1MJA A;  5HNF A;  4OWR B;  2AQF A;  5FKO A;  2PMZ N;  2EFW A;  1S6L A;  5HS9 A;  3CCJ I;  2E2J J;  1R1V A;  2B0L A;  3IUO A;  1FIA A;  4PCQ A;  2BY0 A;  2K27 A;  4QWQ A;  3BPX A;  3F6V A;  2IGM A;  4A3M J;  4LG3 A;  2FU4 A;  6PAX A;  1V4R A;  2WAD A;  3CO7 C;  2JA7 J;  5LFA A;  2FE3 A;  3WTV C;  5GPC A;  3WHB A;  4M73 A;  3TKY A;  1QHG A;  2CUJ A;  3JTH A;  3JRH A;  1O4X A;  3D5L A;  1ETK A;  1FY7 A;  3M4O J;  4MIM A;  3RQ4 A;  3BR0 A;  5FLV A;  3NRV A;  3ZR8 X;  4MLO A;  3LSP A;  1FWZ A;  1ZK8 A;  5E1Z B;  4XN0 A;  2KKO A;  3K0L A;  2KRF A;  2DXI A;  4GFB A;  3KZZ A;  3CCV I;  2H6B A;  2Y0S A;  4RS8 A;  2Z2S B;  5D5X B;  5KHD A;  4IHW A;  3CO6 C;  5TRD A;  3SJM A;  2P5V A;  1JKR C;  1XCV A;  2XPW A;  2M4K A;  2EA2 A;  4MNU A;  4XLF A;  3VEP A;  5HOO A;  4CDG A;  3JCU C;  2RKH A;  3ZOB A;  2FBI A;  1SAN A;  3GWZ A;  5BQT A;  2FMY A;  1BJZ A;  3H0G J;  3Q9S A;  3LQQ A;  5EG0 B;  2EZH A;  1B6A A;  4WXD A;  2DJI A;  1Z6T A;  2O61 A;  1JKQ C;  2NS0 A;  4KIB A;  4IVN A;  1Y6I A;  1VF9 A;  2KZV A;  4L9N A;  3W2V A;  2W84 A;  5GTI C;  5HOD A;  4KJZ A;  2YU3 A;  3CP8 A;  3I3L A;  3HOY J;  3TQN A;  3HOV J;  2ZNY A;  4ZYG A;  1VQL I;  2DJN A;  2WY8 Q;  1WJ5 A;  3MWM A;  2HGC A;  4G6D A;  5KCM A;  1UMQ A;  2CQX A;  2M30 A;  5LEJ A;  1MH4 A;  4IHT A;  4CCL A;  5LHI A;  3HOS A;  1Z1D A;  1PJR A;  2W24 A;  4RBO A;  4IRH A;  1PP7 U;  4NC7 A;  3U1K A;  2NNN A;  2R4G A;  3K1M A;  3ZQC A;  2PMZ A;  4GXO A;  2VQG A;  3GX4 X;  2EBI A;  3MKL A;  4FX0 A;  4P96 A;  1T56 A;  2GXB A;  2BY2 A;  3Q3S A;  3RIR A;  1HKQ A;  1BN5 A;  1GLN A;  2LDU A;  1Z77 A;  4BJ5 C;  2DDB A;  3RKY A;  4ENN A;  1TWF J;  2VBX A;  2ESH A;  1Y0N A;  2QSF X;  4V2G A;  5FRN A;  2EFO A;  2O7O A;  5B5E C;  4RGR A;  1A31 A;  3M8F A;  2JPB A;  4LD5 A;  2LP0 A;  2FXA A;  2VC0 A;  3WTX C;  3ULQ B;  4UB6 C;  1DPR A;  1IAW A;  2K9N A;  5GAE J;  1OR7 A;  1FBS A;  4RDU A;  4L18 B;  4V19 K;  3K9T A;  1ETQ A;  2QQB A;  3S3O A;  1VQ6 I;  3U21 A;  4QTR A;  2Y9Z A;  2DLL A;  2L7Z A;  2XDV A;  4U0Y A;  1H88 C;  3REO A;  2MYS A;  2NVX J;  2R92 J;  4G6T B;  4A3E J;  3FBI B;  1WGX A;  2ZB9 A;  3HSR A;  2CSO A;  1FOW A;  1D1B A;  1IXR C;  2L4M A;  2YPR A;  3UNG C;  4X0G A;  2V7F A;  1WRJ A;  1I6H J;  1MMG A;  4FAS D;  1YS6 A;  3AG4 H;  1Y8R B;  1WWX A;  2JWT A;  2HDW A;  4F52 A;  1J7K A;  2HXO A;  4U87 A;  2IS4 A;  5HNH A;  2RN7 A;  3K4L A;  3WU0 A;  3BCB A;  3MZ8 A;  3JRI A;  5DTD A;  2ZJR F;  3KLO A;  1O7L A;  2L02 A;  1IRX A;  4LLN A;  5FGM A;  1JXS A;  3HSF A;  3RZD J;  1QNT A;  1TBX A;  3PM1 A;  1LVA A;  2VQL A;  5DCF A;  2GIZ A;  3ZPL A;  3E0J B;  1U9O A;  3DWL E;  1RET A;  1G3T A;  2ADU A;  2O03 A;  1QPM A;  1R1T A;  4ZYA A;  4DOZ A;  3KP2 A;  1OCP A;  2XAS A;  3E3V A;  3CC7 I;  3FF5 A;  3I4M J;  1KQ9 A;  2KMU A;  2VJ5 A;  3GTL J;  3IH3 A;  5B1A H;  2LTP A;  1RIO H;  3K6G A;  4JBA A;  1AU7 A;  1RZ4 A;  3M7G A;  3CJN A;  4P1W A;  1J2X A;  1ETO A;  1K61 A;  3Q9V A;  1QZZ A;  1SFX A;  2OQR A;  3F72 A;  2ELH A;  2WAE A;  4Y52 J;  5CKT A;  2R7T A;  5GAH J;  4L5I A;  1STZ A;  4UY8 I;  3SDG A;  1WQ2 A;  2DMQ A;  1QGP A;  4J19 A;  4M3D A;  2HVQ A;  1HCR A;  2QVO A;  3RYR A;  5BOX A;  2LY1 A;  4RAG A;  2XRL A;  2VE8 A;  5DV5 A;  1WSU A;  3QYB A;  1SFU A;  3ZMT A;  3ONQ A;  3VOE A;  1OQY A;  2F5E A;  2VOD A;  3RTR A;  1CGP A;  4AIH A;  2A07 F;  1HQC A;  3DBH B;  1ETY A;  3BG7 A;  2CFO A;  3S1M J;  1X58 A;  3VFZ A;  4B43 A;  1TWA J;  1YOV B;  4M3F A;  2X0L A;  3IKT A;  2M8G X;  3KP7 A;  1W4M A;  3LA7 A;  3PQK A;  4LOC A;  1SVM A;  2KJC A;  5M3M J;  2FQ4 A;  2Y48 A;  3LWF A;  2A6H F;  3ZGK A;  2DT6 A;  2ELJ A;  4LB5 A;  1DGW Y;  2LR8 A;  1P9Q C;  1R7J A;  3NAR A;  1FT9 A;  3BDD A;  3T5X A;  4YFX F;  3BR3 A;  3BCA A;  3VPR A;  1GXP A;  2YX7 A;  3TOB A;  1F43 A;  4HYE A;  2JUC A;  4HEA 2;  1ORK A;  1UG2 A;  2ZSI B;  4XLP F;  1SFO J;  4HF0 A;  3KX2 A;  4BUP A;  1R5H A;  4XK4 A;  4ETS A;  1I39 A;  4IOC F;  1VQP I;  4Q47 A;  2LF7 A;  2YUS A;  3FWE A;  4S05 A;  3E6C C;  3HRS A;  3CUQ C;  3FXU A;  3P9C A;  4OU0 A;  2MH2 A;  4XIC A;  1HXD A;  1U6G A;  3R4K A;  5HLI A;  2ZME A;  4XLC A;  1G3W A;  3BZ6 A;  2CYY A;  5CLS A;  5HLT A;  1A6I A;  2QKM B;  1L0O C;  3S1N J;  2TRT A;  5FD6 A;  1Q1V A;  4HV6 A;  4UUS A;  2OD5 A;  3IV5 A;  5DM6 F;  1UHS A;  4XN3 A;  1OJL A;  4S04 A;  2HPM A;  2O8K A;  1OR7 C;  3DBL B;  3CDH A;  1T08 B;  3OS0 A;  3GUD A;  2HQA A;  2PG4 A;  4II2 A;  1U0J A;  5H20 A;  3DP7 A;  4DYC A;  1AA7 A;  4HDU A;  2VPL A;  2V1N A;  2RVC A;  2DT7 B;  1X1P A;  3F0C A;  2ESN A;  1JTY A;  2R7O A;  1YJW I;  4V2F A;  2P5L C;  1TC3 C;  2PJR A;  3AG3 H;  3H5N A;  4BAC A;  4QPQ A;  5JR3 A;  2ECC A;  3PSF A;  1U5T B;  3LOC A;  1Z7U A;  2BGC A;  5FLX Z;  5FFZ A;  1M1E B;  2G0E A;  1GV2 A;  4OIO F;  1TLH B;  1ITY A;  1V5G A;  1R36 A;  2H6C A;  2L7K A;  2OUM A;  2QF7 A;  4DBR A;  2X48 A;  1HKS A;  2PLY A;  1D8J A;  3MD2 A;  4UXN A;  1DQU A;  3KE2 A;  3H5R A;  2KJB A;  5JI6 A;  4NUB A;  3S32 A;  1S9H A;  2WC2 A;  4Z6Y A;  2F2E A;  3V7C A;  2H1K A;  3FXM A;  2V79 A;  4F7Z A;  2K9M A;  2XGE A;  1C0W A;  3TO7 A;  1XSX A;  4HX7 A;  3HPH A;  4PFP A;  2XGX A;  3KEQ A;  1JKO C;  4ZC3 A;  5E3M A;  3J81 Z;  1YTY A;  1ZG5 A;  4RGX A;  1ON2 A;  3ZQL A;  2WB1 N;  2JRM A;  5DUI A;  4F3Q A;  3F8B A;  3PFY A;  1H9G A;  3TO6 A;  4ZYD A;  3FMR A;  4EVI A;  2DA2 A;  4UNO A;  2L01 A;  4A5M A;  4JQF A;  2FNP A;  1F9N A;  5KVR A;  4BQO A;  5C3E J;  1POG A;  3F9K A;  3SHF A;  3COA C;  3BR2 A;  1LEB A;  1I6X A;  4EGY A;  3CF2 A;  1A6Q A;  2OTL I;  2CRG A;  2W85 A;  2DU9 A;  2MGQ A;  2QA4 I;  4IJA A;  4PFO A;  4HLY A;  1R1U A;  1K78 B;  2W1O A;  4HV5 A;  2P6T A;  5J8F A;  2JN6 A;  1S29 A;  4I7H A;  4A3C J;  1PVE A;  2BY1 A;  3KEO A;  3M8E A;  1X3Z B;  2KL4 A;  3G4S I;  5IYD J;  1D1C A;  5F0H A;  5ICG A;  2ZO4 A;  2O8X A;  2EK5 A;  3G2B A;  2JJ7 A;  4ZJZ A;  3H92 A;  5AIP A;  4L5E A;  1GUU A;  2LSO A;  3OOP A;  1WFX A;  1LKX A;  3LSR A;  4BJT A;  1GVD A;  4NHJ A;  2KDO A;  2DA4 A;  5C4X J;  4G12 A;  4QIW N;  5AON A;  1LB2 A;  5D4S A;  2EV0 A;  1BR2 A;  2LVS A;  1IDY A;  3TP3 A;  1MNM C;  4MFD A;  4XL9 A;  3QRF F;  2CQN A;  3RDI A;  1MJ9 A;  2BXZ A;  3PNY A;  4MTD A;  3N97 A;  2GOM A;  2XGD A;  3HBL A;  3CMY A;  1BC7 C;  2VL8 A;  3KPH A;  5FO5 A;  2GIV A;  3DBR B;  5ICF A;  1JT6 A;  2BVL A;  4R8H A;  4RB1 A;  2ZNZ A;  4Y13 A;  1U8R A;  1PUF A;  4RM2 A;  2OQG A;  2CS3 A;  3IL2 A;  3DLL F;  4A0Y A;  2DCE A;  4HOB A;  1ZR2 A;  3C1D A;  1OPC A;  2J5O A;  1YI2 I;  2GZW A;  4ESF A;  4E7Z A;  1UB9 A;  1GXQ A;  3T8T A;  4NQW B;  4HBL A;  2DOD A;  2JVH A;  2KZG A;  5EEG A;  2R5Y B;  3I56 I;  2X6O A;  3DPL C;  4U7D A;  2ZXH A;  3OYF A;  3H0D A;  3KEY A;  1SVO A;  2VKV A;  3BJA A;  3TP0 A;  5KNL A;  4WX9 A;  5E1X A;  3DPU A;  4JX6 A;  5DCM B;  1VQN I;  2VN2 A;  1IRZ A;  4XSZ F;  1FTZ A;  3G1L A;  3CCY A;  1SD6 A;  2WB1 A;  3KFW X;  3GW2 A;  4Y17 A;  5D6F A;  2QBY A;  1Z3Y A;  3K7A J;  2QEN A;  3E1S A;  3FX3 A;  3U9G A;  4XRS G;  3MKY B;  1IDZ A;  2DTZ A;  2BXY A;  3S14 J;  4BE1 A;  1OCC H;  1ZYR F;  4KIF A;  2LG4 A;  3CTA A;  3F23 A;  2E1M C;  3M1C A;  1BW5 A;  1LE8 B;  2Y2Z A;  4X1E A;  3OYC A;  2RQP A;  1IUY A;  2WV1 A;  3SEZ A;  4ZTF A;  2PX9 A;  2R0Q C;  3OYE A;  2IGK A;  1S7E A;  2A5W A;  4ZDL A;  3RPU D;  3WOD F;  2IRF G;  3HOW J;  2QQ9 A;  3AG2 H;  3FXJ A;  3ZQI A;  2A68 F;  5DS9 A;  1ZTR A;  1ZGJ A;  2LY2 A;  2RRE A;  5C44 J;  3OYM A;  1S3J A;  1ZN2 A;  3FDY A;  4DYQ A;  4EJU A;  2QBY B;  2LF8 A;  2QEX I;  1MSF C;  2MH9 A;  3RKX A;  4GYG A;  2AQE A;  3KET A;  1LFP A;  4BXU A;  4K2E A;  3OR2 C;  2KLO A;  4G7O F;  1V55 H;  3HC7 A;  3CCS I;  1TT0 A;  2DOF A;  4ENJ A;  2DYS H;  1B1B A;  2RC4 A;  2Q1Z B;  2XVC A;  4CUG A;  1EA3 A;  2EWN A;  3S3M A;  5IP9 J;  3BOQ A;  3ERE D;  1JKP C;  2V4J C;  5IP7 J;  3N4M A;  3OL4 A;  3OIP A;  2HQR A;  1W7P A;  2QM3 A;  3P7N A;  1TQM A;  3KZI C;  1RPW A;  1B8I B;  1VQO I;  3FXO A;  3U2R A;  1HF0 A;  1BA5 A;  1CQT A;  3SXY A;  4HQM A;  1MGT A;  4A5N A;  4C30 A;  3VOD A;  2KFD A;  2BW3 A;  2D45 A;  2HXI A;  3OYH A;  2ME6 A;  2BVM A;  5L3E A;  1KA8 A;  2R7U A;  2WY7 Q;  2QSH X;  3GTM J;  4HX8 A;  4CSW A;  2WAQ N;  2D1V A;  3H1C A;  3C3W A;  4O6J A;  3EUH C;  1MNE A;  4YII A;  3HYI A;  3IH4 A;  3D1N I;  2Z1D A;  4OIP F;  3RYP A;  4IHX A;  4OOI A;  1W5T A;  5DD8 A;  5EF6 A;  2IT0 A;  3IHU A;  2OJE D;  3C2G A;  3CJR B;  1T98 A;  3K70 C;  4MEY F;  2Q2E A;  5CVU A;  5J1Y A;  4CYD A;  2LD5 A;  4MEX F;  3RZO J;  1BJA A;  4MFE A;  3M07 A;  2F5C A;  3E5X A;  3WU1 B;  3FZV A;  2RNG A;  2DA6 A;  4XLN F;  1LQ1 A;  4L9T A;  2ICW G;  2K5C A;  1YQA A;  1RI7 A;  2R93 J;  4NNJ A;  4PJM A;  1FTT A;  3ABL H;  3B02 A;  3UKG A;  3V7R A;  1T95 A;  5FKK A;  1UFM A;  4PGG A;  1Z6R A;  2JPC A;  1R6R A;  1IGN A;  2EV6 A;  2IGN A;  3P5J A;  1D0Z A;  1K83 J; 
#chains in the Genus database with same CATH homology
 2YX4 A;  3RPU A;  1XD7 A;  1XGS A;  3C18 A;  1BC8 C;  1KYZ A;  5CVV A;  4EGZ A;  2EV5 A;  2IP2 A;  2C6Y A;  2IPQ X;  2ZFW A;  4R1H A;  2ETH A;  4UV8 A;  3LQR A;  3E6M A;  3DF8 A;  4ENK A;  5L3C A;  1BIB A;  3SFZ A;  1ZGA A;  1YO5 C;  5D5U B;  4KUM A;  3ZMS A;  1P4X A;  1IN4 A;  5LGT A;  4WXH A;  1TQI A;  2VT3 A;  4D0P A;  5HDG A;  1R22 A;  2XHK A;  4OMZ A;  2M87 A;  3L7W A;  2VOO A;  1KU2 A;  4ZYE A;  2F5D A;  2STT A;  4M9X A;  2PMH A;  4EM1 A;  3WGI A;  3I59 B;  4ENM A;  3F21 A;  4B8X A;  4TV7 A;  1KQ8 A;  3EYY A;  2PJP A;  1REP C;  1J75 A;  3Q5F A;  5F6F A;  3WTT C;  2P7V B;  3P9K A;  5LGU A;  4M6X A;  2ISY A;  3GVA A;  4OIR F;  2XKP A;  1J5Y A;  1JHH A;  4QLC U;  4OMY A;  5E1W A;  1XSV A;  1IZ1 A;  1JHF A;  2AXL A;  2CG4 A;  1ON1 A;  3FM5 A;  4BYY A;  2V1U A;  3J7A O;  1FP2 A;  2A5Y B;  3QPT A;  2HS5 A;  4PGH A;  4EV0 A;  2LKP A;  3GF2 A;  5HLG A;  1G3Y A;  1ZG1 A;  1K7A A;  3BRO A;  1I1S A;  4CHU A;  4EQQ A;  1I5Z A;  1ZRF A;  4L9J A;  4LMY A;  2X4H A;  2IW5 A;  1LJ9 A;  2G9W A;  1BOA A;  3R0A A;  3QP5 A;  2DK8 A;  5FB2 A;  4HQE A;  1Z91 A;  2XKO A;  1IN5 A;  4LG0 B;  3F8N A;  2E1C A;  4NB5 A;  1FBQ A;  1PP8 F;  4R79 A;  1FYL A;  1J59 A;  3CUQ B;  1CF7 B;  4GYI A;  4KN7 X;  3J81 K;  4P55 A;  1YIO A;  4IXA A;  2EJR A;  3TO9 A;  2QZ8 A;  2DPD A;  2BEO A;  1Q1H A;  3RJP A;  1T38 A;  3T0Y A;  1G3S A;  2VBZ A;  4OIQ F;  1V3F A;  5D5V B;  1E2X A;  3FHZ A;  5DUK A;  5BMZ A;  2Z99 A;  3WGH A;  1DUX C;  1OYW A;  3V8K A;  1P4A A;  5F1R A;  1RUN A;  1HW2 A;  1T2K A;  4MQV A;  1HW1 A;  1BI3 A;  4AIJ A;  3EQL F;  5ILS A;  3PQJ A;  4UVC A;  4G6Q A;  2XRN A;  1J9I A;  3EYI A;  5K5R A;  3T8R A;  4A2U A;  4KDP A;  3WG9 A;  2UXX A;  3ZMD A;  2W57 A;  4LK0 F;  1D8K A;  2DK5 A;  1OMI A;  4I0B A;  3ZN1 A;  1IN8 A;  3P9I A;  5J6X A;  3O6B B;  1DPU A;  2ZJ2 A;  3KP5 A;  4BHC A;  2G7U A;  4ON0 A;  4WWC A;  3MZH A;  3S2W A;  3ABT A;  1ZRC A;  3ZMZ A;  5ICC A;  1IN7 A;  2PBI A;  2DAO A;  1O3Q A;  3QOP A;  3BY6 A;  3FXQ A;  2BV6 A;  1O57 A;  1U5T A;  3HTU A;  1U3E M;  1ZH5 A;  4BH9 A;  5JHU A;  1YW9 A;  2EFQ A;  3E6D A;  1P6R A;  3V7S A;  1HSJ A;  2XV4 S;  2Q0O A;  3LAP A;  4KIG A;  5F64 A;  3TOA A;  2UXN A;  1BM9 A;  1HBX G;  5CYV A;  3ML6 A;  1O7F A;  1VTN C;  3QP6 A;  1R23 A;  4YG2 F;  3VB2 A;  4LLG F;  1PDN C;  2F5F A;  3HRM A;  5E20 A;  3ZMU A;  2ISZ A;  2M5W A;  2EFN A;  2Z9O A;  1YG2 A;  1KU7 A;  2RV8 A;  5LGN A;  1IXS B;  2FOK A;  5HLH A;  2STW A;  4HA8 A;  3CUO A;  3ECH A;  3ISP A;  4B09 A;  2HWV A;  4WF2 A;  4KMU X;  5HVQ C;  5ILV A;  1S7O A;  2XAG A;  1K78 A;  3ZMV A;  4HX4 A;  2E7X A;  5IT9 K;  4N0B A;  2GXG A;  3PFI A;  3NEU A;  4Z2Y A;  3WTW C;  3F6O A;  5JFR A;  2GQQ A;  3M9A A;  4OIN F;  1SD4 A;  5DYM A;  2A3S A;  1KU3 A;  4M6Y A;  2NNY A;  2CW0 F;  3IRR A;  1O3T A;  1YFH A;  1ZLK A;  1FC3 A;  3W6J B;  5E8G A;  1QZY A;  1SD5 A;  1G4D A;  1KU9 A;  3I53 A;  2EFP A;  3HHG A;  1E17 A;  1FX7 A;  4U7B A;  3I0T A;  2VON A;  4NQW A;  1FNN A;  2WV0 A;  4Q48 A;  5CVJ A;  2GA2 A;  3H3Z A;  2ZCW A;  4O3M A;  4I2O A;  1XMK A;  1UHW A;  2P8T A;  5DCM A;  4RAZ A;  3K69 A;  4ASN A;  3ECO A;  1DDN A;  1RNL A;  1SD7 A;  3JSO A;  2O3F A;  1FOK A;  2JTV A;  2JT1 A;  1UCR A;  1I27 A;  2RGV A;  4XSX F;  2EA4 A;  4WCG A;  2W25 A;  3L2C A;  4A0Z A;  4PZJ A;  3L09 A;  4G8X A;  1P2F A;  2DPU A;  2P5K A;  4BAY A;  2HOE A;  1Z05 A;  1R5G A;  2GAU A;  3KP4 A;  5TJJ A;  3HIF A;  1ZLJ A;  4HW0 A;  4FX4 A;  1P4W A;  1BI0 A;  1XDS A;  1AWC A;  3K1P A;  3KP3 A;  1WKM A;  1TQP A;  2ZBK A;  4HF1 A;  2DT5 A;  4IHS A;  4KMF A;  4FT8 A;  4PDK A;  1B9M A;  1MKM A;  3F22 A;  5FD5 A;  2COM A;  4I98 B;  1HW5 A;  2FQ3 A;  1YS7 A;  1PUE E;  4EMS A;  4ZYH A;  3IRQ A;  2L4A A;  1YW7 A;  4GO1 A;  1XGM A;  1FYM A;  1FP1 D;  2DQR A;  2DI3 A;  2VOP A;  3KZY A;  2PMU A;  2DO7 A;  1IF1 A;  2D2W A;  2MBF A;  5HDN A;  1H0M A;  3DXJ F;  3BJO A;  4M72 A;  3QU6 A;  2V1D A;  1ZRE A;  2DW4 A;  4AWX B;  4AD9 A;  5A2Q Z;  2K4B A;  3DV8 A;  3L9F A;  4ZH4 F;  2OBP A;  1X3U A;  4WXC A;  4HF2 A;  4BQA A;  4HAM A;  1B4A A;  2IJL A;  3LAJ A;  2FSW A;  4P5O A;  5KK1 A;  4Y15 A;  4CZZ A;  2IA0 A;  2HFH A;  4H0E A;  3ZQ7 A;  2XAF A;  3DQV C;  2FNA A;  1ZAO A;  4YIF A;  4E70 A;  3DKW A;  1BIA A;  2R7F A;  2VBY A;  4G94 A;  2ZXJ A;  3HRT A;  4XRF A;  3GFL A;  2PN6 A;  2M1B A;  1D3Y A;  3WTZ A;  1JE8 A;  3MFK A;  4LB6 B;  1IN6 A;  1H9T A;  1BI1 A;  3D0S A;  3HUG A;  3WE2 A;  5BPD A;  1MZB A;  2JRT A;  2R3S A;  3E97 A;  4U88 A;  3GFJ A;  1FSH A;  2XAQ A;  2BBY A;  2V9V A;  3R6S A;  2MLK A;  2PEX A;  5IT3 A;  1FSE A;  4N9H A;  3T1B A;  2QUF A;  2J5P A;  1YW8 A;  1HST A;  3I59 A;  1XMA A;  3FMQ A;  5K5O A;  3JAM Z;  5LHH A;  3BPV A;  1XN7 A;  3QAH A;  3OV8 A;  5LHG A;  2HQN A;  5DEQ A;  1LNW A;  2LNB A;  2QQA A;  3TDZ C;  4MTE A;  3ELK A;  1G6N A;  4EJT A;  3GZ5 A;  3F8C A;  3EDP A;  5EEH A;  2HEO A;  4L0Z B;  1ONV A;  2XUB A;  3ROU A;  1F5T A;  2HTS A;  1O3R A;  2A61 A;  2FA5 A;  4RGS A;  1ODD A;  2OAZ A;  5H6Q A;  3LA3 A;  5E17 F;  3MZY A;  3EET A;  1R00 A;  3MQ0 A;  4RB0 A;  1EH7 A;  4EM2 A;  1ZHF A;  3WGG A;  2K4J A;  3R61 A;  1MJB A;  4LGW A;  3BP8 A;  1J0R A;  2KIU A;  1IRF A;  1LDD A;  1NHA A;  4HDV A;  2Z3Y A;  4CGZ A;  3C7J A;  4IPA A;  1QO0 D;  3V4G A;  4EJV A;  4LG0 A;  4HZF A;  3SZP A;  1IRG A;  4U0V A;  2XIG A;  2PQ8 A;  3CUQ A;  3I71 A;  1CF7 A;  5FLX K;  4M9Z A;  1BBY A;  3O3K A;  4MHG A;  3J80 Z;  2V1X A;  2MLG A;  3R60 A;  2FF4 A;  2BE5 F;  2KIF A;  3MCZ A;  3M1E A;  1SAX A;  4ESB A;  4RB2 C;  2UWM A;  5K1Y A;  2IVM A;  3SQN A;  2G7H A;  4M9S A;  4HLX A;  5L3D A;  4G7Z F;  2BYV E;  3LST A;  2D1H A;  4KNY A;  4KFC A;  4KT5 C;  3JW4 A;  4GGG A;  2MC3 A;  2OZ6 A;  2FML A;  2HZT A;  2HDC A;  3I4P A;  5K5Q A;  3HHH A;  5E8I A;  2VC1 A;  1HKT A;  2EB7 A;  3V8J A;  2ACJ A;  3TGN A;  3G3Z A;  3I58 A;  2GWR A;  4I02 A;  3WTU C;  3O2P E;  4LJZ F;  4YFK F;  4O5V A;  2NYX A;  3JSP A;  1K79 A;  5H6R A;  5D8K B;  2WWY A;  2M45 A;  3MEX A;  1GHC A;  3BWG A;  5HS8 A;  3SZT A;  3GO5 A;  1EV7 A;  1Y0U A;  2A69 F;  3L00 A;  1LEA A;  2OU2 A;  3E6B A;  3JTG A;  5D5W B;  3DFG A;  2AS5 F;  4EJW A;  1Z9C A;  5LEK A;  2NAZ A;  2Y0M A;  3I64 A;  3WTS C;  1XGO A;  3H3U A;  5D6E A;  3FMS A;  1OYI A;  3RPQ A;  2GA1 A;  1T39 A;  1ZG3 A;  1ULY A;  4I09 A;  1U2W A;  1FPQ A;  4CIC A;  5LRS A;  5D4R A;  4KYW A;  1FLI A;  1B59 A;  3LA2 A;  4UHT A;  2TDX A;  1LDK B;  4XBF A;  2O0Y A;  1YLF A;  4U0W A;  5FFX A;  3K2Z A;  2JSC A;  1AOY A;  1OKR A;  4AIK A;  1FYK A;  2JZY A;  3ABU A;  1D5V A;  1T6S A;  2UZK A;  1TW3 A;  4BNC A;  1P92 A;  1USS A;  5LLQ A;  4DNC A;  4P9F A;  3AAF A;  4RAY A;  1TW2 A;  1S7A A;  5ERI A;  4KA4 A;  1EH6 A;  3DPT A;  2FRH A;  4M74 A;  5JVT A;  2E1N A;  3IWF A;  3GYH X;  2P7C B;  4N9I A;  5D8L B;  2PFB A;  2MA3 A;  5A2Q K;  2ZME B;  4I01 A;  2WTE A;  2RNJ A;  2Q8K A;  5HDK A;  5L3G A;  2HYG D;  2O6G E;  2DQL A;  2HKX A;  4M71 A;  1A04 A;  2RDP A;  1F4K A;  1R58 A;  1IXC A;  2QYO A;  5ED4 A;  5E18 F;  4EM0 B;  5DD4 A;  4IF4 A;  4A6D A;  3R0J A;  1MDM A;  3HSE A;  3ZN0 A;  4BHB A;  3FXR A;  2YSR A;  4LLL A;  5LRR A;  1W5S A;  3ZP5 A;  3GLX A;  4UVB A;  4DQ2 A;  3RKW A;  1LDJ A;  2XRO A;  3IC7 A;  1KQ0 A;  2A6E F;  3F8F A;  4JK1 X;  1MDM B;  1XGN A;  1RUO A;  2H09 A;  3DEU A;  3HRU A;  3I5U A;  3EUH A;  5DDG A;  3GZ6 A;  3TDU C;  5AIQ A;  1FBU A;  4A12 A;  2VBW A;  4LFU A;  2DBB A;  1KGS A;  2VE9 A;  4ZZL A;  3QPH A;  4UUV A;  3NQO A;  2FBK A;  4A0X A;  1W7P D;  4KIC A;  2CGP A;  4L0Y B;  1TNS A;  4CXF A;  1U5T C;  3JAM K;  3HTS B;  2L3D A;  4ESJ A;  1WI9 A;  3IWZ A;  5BS6 A;  3CLO A;  5CVR A;  2CQK A;  3FM3 A;  1TNT A;  3G73 A;  2V6C A;  3KP6 A;  1U78 A;  3HOT A;  4Q5S F;  3W6K B;  2HYF A;  2FBH A;  1YYV A;  3V8L A;  1SMY F;  3WE3 A;  4GCV A;  1XCB A;  4L9V A;  2H94 A;  2YR2 A;  3IKV A;  2H27 A;  2MD5 A;  4EJO A;  1I1G A;  2CO5 A;  2IA2 A;  4RB3 C;  4RGU A;  4KN4 X;  2HR3 A;  4UVA A;  2ZKZ A;  1S8N A;  5BPI A;  4MGR A;  2XAJ A;  1UST A;  2M8E A;  5L3B A;  5CVI A;  3E5U A;  3E5Q A;  1XSD A;  5LBQ A;  1MD0 A;  5HS7 A;  2K86 A;  3U1D A;  1OYY A;  1ZAR A;  2FEZ A;  4A6E A;  3GFM A;  4IRG A;  1ZRD A;  1K6O A;  2K02 A;  3KCC A;  1QQI A;  1O3S A;  2E7W A;  4G9Y A;  4I0A A;  2QWW A;  2CWE A;  4FHT A;  4UV9 A;  4LK1 F;  2VXZ A;  3F3X A;  2OA4 A;  2DFI A;  1B9N A;  1TTY A;  4CO8 A;  1QBJ A;  3I54 A;  3K1N A;  4AVP A;  5J8C A;  5L3F A;  3MAJ A;  3WTY C;  2CFX A;  2QLZ A;  1DP7 P;  3J80 K;  4ZZD A;  4MQ9 F;  5CJ9 A;  5IT9 Z;  1IW7 F;  3QU3 A;  3GEZ A;  1SFE A;  1F1Z A;  1EH8 A;  2OZU A;  1W7P B;  1T0F A;  3F8M A;  2Z33 A;  2XAH A;  3BJ6 A;  2Y75 A;  2KIM A;  1JGS A;  3GFI A;  2Z5U A;  1L3L A;  4G7H F;  5ILU A;  1GVJ A;  2DTR A;  2HTJ A;  4L5J A;  4BHP A;  2P6S A;  2PI0 A;  3RI4 A;  1UHM A;  2VT2 A;  2R7D A;  1SMT A;  2P4W A;  3B73 A;  5ICE A;  2K7L A;  1KYW A;  2IA1 A;  3KLN A;  2NRA C;  3GXO A;  2HKO A;  3LFK A;  1BI2 A;  1FZP B;  1XB4 A;  4YFN F;  2L54 A;  1XDU A;  4Q4Z F;  4WK8 F;  4IRI A;  4P9U A;  1MJA A;  2EFW A;  1S6L A;  5HS9 A;  1R1V A;  2B0L A;  4PCQ A;  2K27 A;  4QWQ A;  3BPX A;  3F6V A;  2FU4 A;  6PAX A;  1V4R A;  3CO7 C;  3WTV C;  2FE3 A;  4M73 A;  3TKY A;  3JTH A;  3D5L A;  1FY7 A;  3NRV A;  1FWZ A;  5E1Z B;  2KKO A;  3K0L A;  2KRF A;  3KZZ A;  2H6B A;  4RS8 A;  5D5X B;  3CO6 C;  5TRD A;  2P5V A;  1XCV A;  2EA2 A;  4MNU A;  3VEP A;  5HOO A;  4CDG A;  2RKH A;  2FBI A;  3GWZ A;  5BQT A;  2FMY A;  3Q9S A;  3LQQ A;  1B6A A;  4WXD A;  1Z6T A;  2O61 A;  2NS0 A;  4KIB A;  4IVN A;  4L9N A;  2W84 A;  2YU3 A;  3TQN A;  2ZNY A;  4ZYG A;  3MWM A;  2HGC A;  4G6D A;  2M30 A;  5LEJ A;  4IHT A;  5LHI A;  3HOS A;  1Z1D A;  2W24 A;  4IRH A;  1PP7 U;  2NNN A;  3K1M A;  4GXO A;  3GX4 X;  4FX0 A;  4P96 A;  2GXB A;  3RIR A;  1HKQ A;  1BN5 A;  2LDU A;  3RKY A;  4ENN A;  2VBX A;  2ESH A;  2EFO A;  4RGR A;  3M8F A;  2JPB A;  4LD5 A;  2FXA A;  2VC0 A;  3WTX C;  3ULQ B;  1DPR A;  1IAW A;  1OR7 A;  1FBS A;  4L18 B;  3K9T A;  2QQB A;  2DLL A;  4U0Y A;  3REO A;  3HSR A;  2CSO A;  1IXR C;  2L4M A;  2YPR A;  1WRJ A;  1YS6 A;  1WWX A;  1J7K A;  2RN7 A;  3WU0 A;  3KLO A;  1O7L A;  2L02 A;  4LLN A;  5FGM A;  1JXS A;  3HSF A;  1QNT A;  1TBX A;  5DCF A;  1LVA A;  3ZPL A;  1G3T A;  2ADU A;  2O03 A;  1QPM A;  1R1T A;  3KP2 A;  3E3V A;  2XAS A;  3FF5 A;  1KQ9 A;  1RIO H;  4JBA A;  1RZ4 A;  3M7G A;  3CJN A;  1J2X A;  3Q9V A;  1QZZ A;  1SFX A;  2OQR A;  3F72 A;  2ELH A;  4L5I A;  1STZ A;  1WQ2 A;  1QGP A;  2QVO A;  3RYR A;  5BOX A;  2VE8 A;  5DV5 A;  1WSU A;  1SFU A;  3ZMT A;  3VOE A;  2F5E A;  2VOD A;  3RTR A;  1CGP A;  4AIH A;  2A07 F;  1HQC A;  3VFZ A;  2X0L A;  3IKT A;  3KP7 A;  1W4M A;  3LA7 A;  3PQK A;  2KJC A;  2Y48 A;  3LWF A;  2A6H F;  4LB5 A;  1R7J A;  1FT9 A;  3BDD A;  3T5X A;  4YFX F;  1GXP A;  2YX7 A;  3TOB A;  4HYE A;  4XLP F;  4HF0 A;  1R5H A;  4ETS A;  4Q47 A;  2LF7 A;  4S05 A;  3FWE A;  3E6C C;  3HRS A;  3CUQ C;  3FXU A;  3P9C A;  4OU0 A;  2MH2 A;  1HXD A;  1U6G A;  3R4K A;  5HLI A;  2ZME A;  1G3W A;  3BZ6 A;  2CYY A;  5CLS A;  1L0O C;  5FD6 A;  4HV6 A;  2OD5 A;  4S04 A;  3CDH A;  3GUD A;  2PG4 A;  5H20 A;  3DP7 A;  4HDU A;  2RVC A;  2ESN A;  2P5L C;  5JR3 A;  1U5T B;  1Z7U A;  2BGC A;  5FLX Z;  5FFZ A;  4OIO F;  1TLH B;  1R36 A;  2H6C A;  1HKS A;  2PLY A;  1D8J A;  4UXN A;  3KE2 A;  2KJB A;  5JI6 A;  2WC2 A;  2F2E A;  3V7C A;  2V79 A;  4F7Z A;  1C0W A;  3TO7 A;  1XSX A;  4HX7 A;  2XGX A;  3KEQ A;  1YTY A;  3J81 Z;  1ZG5 A;  4RGX A;  1ON2 A;  5DUI A;  3F8B A;  1H9G A;  3TO6 A;  4ZYD A;  3FMR A;  4EVI A;  4UNO A;  2L01 A;  4A5M A;  4JQF A;  2FNP A;  1F9N A;  5KVR A;  3SHF A;  3COA C;  1LEB A;  1I6X A;  4EGY A;  2W85 A;  2DU9 A;  4IJA A;  4HLY A;  1R1U A;  1K78 B;  4HV5 A;  2P6T A;  5J8F A;  4I7H A;  1S29 A;  3KEO A;  3M8E A;  5ICG A;  2ZO4 A;  2O8X A;  2EK5 A;  3H92 A;  5AIP A;  2LSO A;  3OOP A;  4NHJ A;  5AON A;  1LB2 A;  5D4S A;  2EV0 A;  3QRF F;  3RDI A;  1MJ9 A;  4MTD A;  3N97 A;  1BC7 C;  5FO5 A;  2GIV A;  5ICF A;  4R8H A;  4RB1 A;  2ZNZ A;  4Y13 A;  1U8R A;  2OQG A;  3IL2 A;  4A0Y A;  4HOB A;  3C1D A;  1OPC A;  2J5O A;  2GZW A;  4ESF A;  1UB9 A;  1GXQ A;  3T8T A;  4HBL A;  5EEG A;  3DPL C;  4U7D A;  3BJA A;  4WX9 A;  5E1X A;  5DCM B;  2VN2 A;  4XSZ F;  1SD6 A;  3KFW X;  4Y17 A;  3GW2 A;  5D6F A;  2QBY A;  2QEN A;  3FX3 A;  3U9G A;  1ZYR F;  4KIF A;  3CTA A;  3F23 A;  2RQP A;  1IUY A;  3WOD F;  2IRF G;  2QQ9 A;  2A68 F;  1ZGJ A;  1S3J A;  1ZN2 A;  4EJU A;  2QBY B;  2LF8 A;  2MH9 A;  3RKX A;  4GYG A;  3KET A;  4BXU A;  4K2E A;  4G7O F;  4ENJ A;  1B1B A;  2RC4 A;  2XVC A;  2EWN A;  3BOQ A;  3ERE D;  3N4M A;  2HQR A;  1W7P A;  2QM3 A;  3P7N A;  1TQM A;  3U2R A;  3SXY A;  4HQM A;  1MGT A;  4A5N A;  3VOD A;  2D45 A;  5L3E A;  1KA8 A;  4HX8 A;  2D1V A;  3C3W A;  4O6J A;  4YII A;  3HYI A;  4OIP F;  3RYP A;  4OOI A;  1W5T A;  5DD8 A;  2IT0 A;  3IHU A;  1T98 A;  4MEY F;  2Q2E A;  5CVU A;  4MEX F;  4CYD A;  1BJA A;  2F5C A;  3E5X A;  3WU1 B;  3FZV A;  4XLN F;  1LQ1 A;  4L9T A;  1YQA A;  1RI7 A;  3B02 A;  3V7R A;  1UFM A;  4PGG A;  1Z6R A;  2JPC A;  2EV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...