4HLYA

The complex crystal structure of the dna binding domain of virf-1 from the oncogenic kshv with dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
KASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K9
publication title The crystal structure of the DNA-binding domain of vIRF-1 from the oncogenic KSHV reveals a conserved fold for DNA binding and reinforces its role as a transcription factor.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Dna binding protein/dna
total genus 30
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hlyA00
2IP2A 4ETSA 2QM3A 2EFQA 4UXNA 2L3DA 4G9YA 1RZ4A 2LNBA 1USSA 4XLNF 3FMSA 3F8MA 1YQAA 2Q0OA 3ZMSA 1IN8A 5D6EA 4AD9A 2IA0A 3TOAA 4EM1A 3F3XA 3KCCA 2KRFA 1AOYA 2HR3A 1IW7F 2R7FA 2ESHA 1HKSA 3HRSA 4UVCA 1BOAA 4CYDA 5IT9K 2A61A 3E97A 1ZLJA 1FBUA 1ZN2A 1Q1HA 2D45A 2LKPA 3QPTA 3V7RA 2IT0A 4EV0A 4YIFA 5F1RA 1QZZA 1UHWA 3KP6A 2KJBA 3T5XA 1ULYA 4ESBA 4L0ZB 2D2WA 2F5DA 1B59A 4BQAA 4LB5A 2MLGA 1XMKA 1K6OA 1CF7B 4IVNA 1BI0A 1U5TA 4BHPA 2KKOA 4I2OA 4Q5SF 4IF4A 4HW0A 3FZVA 4OIPF 5L3EA 3GFMA 3C1DA 1KU3A 3DQVC 3OOPA 2K7LA 5K5QA 3WTVC 1HSTA 1I6XA 5H6RA 3H3UA 4P96A 1FOKA 2V79A 2GXGA 2EV0A 1C0WA 2M45A 1S7AA 2W84A 3ZMVA 3KLOA 1R58A 3T1BA 2ISYA 1ZRCA 3Q9SA 3F8FA 1LDJA 2V6CA 4M9SA 4KIFA 4ASNA 5D5XB 1J75A 1USTA 3TDZC 3ZMDA 4YIIA 5LLQA 3MFKA 1ZG5A 3KP4A 3JTHA 1FT9A 4G6QA 1STZA 5KK1A 3HSRA 2MLKA 1L3LA 4ZYGA 3IKVA 2P7CB 1HW5A 1R36A 1XSXA 5CVJA 5ILUA 2V1UA 2EFWA 4P9FA 4WK8F 1QO0D 3L09A 2ZNYA 3RKXA 1YLFA 3U2RA 4UHTA 3VEPA 4EJUA 4BNCA 2GAUA 5F6FA 5LGUA 3ZQ7A 4R1HA 2FOKA 4OOIA 4HQMA 3WU1B 2V1DA 1PP8F 3CO7C 4P9UA 4FHTA 2VBWA 2DU9A 4A2UA 3V7CA 4CO8A 2ZMEB 2K4JA 2XKPA 4I09A 2STTA 5DD4A 2ADUA 3WTTC 3CLOA 1K7AA 4Q4ZF 4M9ZA 1W7PB 4QWQA 2XV4S 2W24A 3I0TA 1ZYRF 1XD7A 4GO1A 3DXJF 1PP7U 4L0YB 2QWWA 2M5WA 2RVCA 3K1PA 4KUMA 4GCVA 4JK1X 1FYKA 2OZUA 2MH9A 2O0YA 5E8GA 3KP2A 4KNYA 2DFIA 3GXOA 3Q5FA 3CTAA 3I58A 3LWFA 3I59B 1TLHB 2X0LA 3V8JA 3ECOA 3G3ZA 4KIGA 2J5OA 2LF7A 2EV6A 3BJ6A 2PFBA 1HSJA 2WTEA 5A2QZ 4O3MA 1O3TA 2K86A 3V8LA 2E1NA 1XDUA 1JHHA 2XASA 1WRJA 5FO5A 1EH7A 2QYOA 2CYYA 2DLLA 5J8FA 4HF2A 4AVPA 4HYEA 3V7SA 2QZ8A 3I5UA 4O5VA 5FFZA 4EGZA 1XGSA 3COAC 1JGSA 1IXRC 2EB7A 2VBXA 1YG2A 1OR7A 2PJPA 1TW3A 3E3VA 4OIOF 5TRDA 2LDUA 3BP8A 1BI3A 1KU7A 2OBPA 3BOQA 1XN7A 2ZBKA 2BEOA 4FX4A 1GVJA 1D8JA 1J9IA 1MKMA 1R22A 5HLIA 3PFIA 5HVQC 3MAJA 3GUDA 3L7WA 3F22A 3JAMK 2VC0A 1XCVA 4I0AA 4KA4A 3GYHX 1XCBA 1YTYA 5AIQA 2VE8A 1H0MA 1BIAA 2XAGA 4LG0A 4GYGA 4Q48A 4M74A 3BWGA 1U6GA 3FWEA 1UCRA 1PDNC 1XB4A 2VE9A 5JHUA 2EJRA 1YFHA 4IHTA 1P6RA 1MJBA 4LK1F 4ZZDA 4M72A 2DW4A 1EH6A 1WI9A 1MJAA 1U5TB 5AONA 4BH9A 1XGNA 4DQ2A 1BC7C 1UHMA 5BPIA 1OMIA 4IHSA 5CVVA 2STWA 3WU0A 1Z91A 3T8RA 1XSVA 4N0BA 2RC4A 1FSEA 2QQBA 4M71A 1ZLKA 3P9CA 2R3SA 5HDKA 1SFUA 1KQ0A 3I64A 4AIHA 3DV8A 3DEUA 1O57A 2XAHA 4FX0A 5TJJA 1LNWA 2EA2A 4LLLA 4U0VA 2DO7A 3WTSC 2JRTA 2YX7A 2M1BA 5AIPA 1RNLA 2B0LA 4XRFA 2DAOA 2GA2A 4BHBA 1SD4A 4BYYA 2MBFA 4UUVA 2COMA 3E6CC 1IN5A 4G6DA 1YYVA 2DQLA 2GQQA 3RJPA 2FMYA 3F21A 4ENKA 3WG9A 5JI6A 5IT3A 4Y15A 4L5JA 4OINF 1HBXG 4OU0A 4IXAA 4LB6B 3RI4A 3WGHA 1G6NA 4P55A 1ZG1A 1RUNA 4RS8A 3ZN1A 3KEOA 3SXYA 4P5OA 4U7DA 1HQCA 5HS8A 1L0OC 1P4AA 4CZZA 4IPAA 3I4PA 2OD5A 2CFXA 3T8TA 5E8IA 5JFRA 1TQIA 2RQPA 3RKWA 1P4XA 1QQIA 2QBYA 3E5QA 2VONA 1S6LA 3U1DA 1CGPA 1NHAA 1GHCA 3TOBA 2IJLA 1UFMA 1U8RA 1TQPA 2FBKA 2DBBA 4A6DA 2ACJA 1Z9CA 3HRMA 3KLNA 1I27A 1D8KA 3C18A 4BHCA 2A69F 1FC3A 2W57A 1RUOA 2ISZA 1I5ZA 3MZYA 3OV8A 1LQ1A 3BDDA 4HA8A 2EFPA 2DQRA 4CHUA 4HX4A 1MD0A 1TNTA 4KIBA 2JT1A 2RN7A 4MTEA 4ON0A 1R00A 1HW1A 3FF5A 4HF0A 2FQ3A 2GA1A 3GFIA 4M9XA 1H9GA 2G7HA 3B02A 2HS5A 5LGNA 2P7VB 1IN4A 5K5RA 1R1VA 1SMYF 5CYVA 3KE2A 3AAFA 1BI1A 2P5KA 1IXCA 4L18B 4L9VA 2PQ8A 2VXZA 2F5EA 5FB2A 1FLIA 4AWXB 4RGRA 1F5TA 2O8XA 1FNNA 1ZGAA 1HKTA 1QPMA 3BROA 1V4RA 5D8KB 2Q8KA 2YX4A 4DNCA 5CVRA 3CJNA 1KYWA 1D3YA 3KETA 2IVMA 4EMSA 2HEOA 1KU2A 3JSOA 4ENJA 3JW4A 1BJAA 1J0RA 3LQQA 1FX7A 2HQNA 4NHJA 2RDPA 2A3SA 2ESNA 3F8CA 4L9NA 2IRFG 1KA8A 3M9AA 3FM5A 2FSWA 4LG0B 3R4KA 5E1WA 5LHIA 4ZYEA 3WTWC 1IUYA 2WC2A 5HLGA 5K1YA 3R61A 5CLSA 4A0XA 5HS9A 3ROUA 4IRGA 3C3WA 3GO5A 1MDMA 5LRRA 1DPUA 2ZNZA 1LJ9A 1MJ9A 5LEJA 3CUQA 1OYIA 4ZH4F 2P5LC 1R5GA 4B09A 4HAMA 2GXBA 4HF1A 3L2CA 3QRFF 2HYFA 3HSFA 2NRAC 2ZFWA 4WWCA 3WE3A 2MA3A 1S8NA 3F23A 5L3BA 4CXFA 4PCQA 1ZARA 3RTRA 3SZPA 2FMLA 2JPCA 2IA2A 2HTSA 3G73A 1BN5A 3ZN0A 3KP3A 2Z99A 4GGGA 3ZMTA 4XLPF 1YW7A 4RGXA 1DPRA 2TDXA 2QLZA 4LGWA 4EM0B 3W6KB 4G8XA 4ZZLA 3F72A 2RNJA 4A6EA 3GW2A 2VOOA 2QQ9A 4LMYA 1DDNA 4HV5A 2KIUA 3WTXC 2DPDA 3R60A 3EUHA 4ENMA 5LEKA 1T6SA 2R7DA 2IA1A 2HKXA 3KZZA 1U2WA 2MD5A 1FP1D 3BJAA 2EA4A 4MHGA 1VTNC 2Z3YA 3DF8A 2HQRA 4UVAA 1U3EM 2FU4A 4IRHA 2EWNA 4HDVA 2DPUA 2UXXA 3QP5A 1OYWA 3DP7A 3WTZA 4A5NA 2D1VA 1T2KA 4WXDA 1LEAA 4G7OF 2XGXA 4EVIA 4KMUX 4Y13A 3BPXA 1G3WA 2CQKA 1OKRA 4KFCA 3JTGA 2K4BA 2CG4A 1SFXA 3DPLC 3MCZA 4G7HF 2DT5A 2WWYA 2NS0A 1W5TA 3VODA 4RGSA 5E18F 1XMAA 2PMHA 5DCFA 1O3RA 4N9HA 1B1BA 2ZXJA 3ML6A 1Z6TA 2QBYB 4CDGA 5JVTA 5D5UB 4NB5A 2DK5A 4M6XA 3LA3A 4UVBA 3E5UA 5HDGA 1J7KA 2VODA 2PEXA 5HS7A 2CWEA 5DCMA 1O3SA 4HX7A 2HWVA 2HFHA 2XAFA 3W6JB 1G3SA 4CICA 3J80Z 2BGCA 4MQVA 2CW0F 1SAXA 3Q9VA 3BZ6A 2C6YA 3NQOA 2XAQA 1U5TC 5D5WB 1BC8C 4HZFA 4JBAA 1S3JA 1DP7P 3GVAA 5A2QK 2H6CA 4UV9A 2DI3A 1Z05A 2NAZA 2XIGA 3F6OA 2HYGD 1K78A 2VBZA 4U0YA 3MZHA 3HRTA 1BBYA 2HDCA 2IPQX 3FM3A 4KYWA 3J80K 3D5LA 4L5IA 1V3FA 5EEHA 4KICA 3QU3A 4EQQA 3ZMUA 1F9NA 2O61A 3TDUC 2AXLA 4ESFA 3HTSB 1TW2A 2ZCWA 3FMRA 3WODF 2A68F 2WV0A 1DUXC 3TO9A 2BV6A 3K0LA 1LB2A 1TQMA 5E20A 3QOPA 3VFZA 1REPC 2OZ6A 4MNUA 2HKOA 4ENNA 1R5HA 3FXQA 3N97A 1IF1A 1LVAA 2Y0MA 5L3GA 4Z2YA 3GF2A 4R79A 5HOOA 2W85A 2W25A 3QU6A 3K1MA 3FX3A 3P7NA 2UWMA 1G4DA 3BY6A 4MQ9F 3FXUA 3V8KA 1G3YA 5DEQA 4L9JA 3WGGA 5F64A 5LRSA 2O03A 3I54A 3DFGA 1W4MA 3O6BB 3RPQA 1YW9A 2Y75A 4U0WA 5DYMA 3ERED 4A0YA 4RAZA 5JR3A 3HSEA 1MDMB 3HUGA 3CUQB 3GLXA 5ICFA 3ABTA 1IZ1A 1P92A 2P5VA 2HZTA 5E1ZB 3P9IA 2Z5UA 1R1TA 1YIOA 3ISPA 4ZYDA 2F2EA 1D5VA 3K69A 3GX4X 3REOA 3HIFA 3ECHA 3H92A 2LF8A 3CO6C 2Z33A 3D0SA 2FNPA 4S05A 2UXNA 2VC1A 5LHHA 5ICEA 1IXSB 3LSTA 3MQ0A 5J6XA 4HBLA 4S04A 1KQ8A 2UZKA 2KIFA 3QP6A 3RDIA 4LLGF 1A04A 4KN7X 3I71A 3R0AA 2X4HA 1G3TA 5ED4A 4XSXF 4ZYHA 1TBXA 5BOXA 3IC7A 2LSOA 3IHUA 5D4RA 2EFOA 4ESJA 1KGSA 2PMUA 1ZH5A 3HHGA 4WF2A 4L9TA 3CUOA 2ZJ2A 3JSPA 1JXSA 1FSHA 3GZ5A 1ZREA 1MZBA 1I1GA 2QQAA 4Y17A 1SD6A 2MH2A 1KU9A 3K2ZA 1X3UA 3M7GA 1BM9A 1I1SA 4EJOA 3SHFA 1OYYA 4WX9A 3KP5A 4PGGA 1PUEE 3E6DA 3ZP5A 2PLYA 3LAPA 1T38A 1B9MA 2XROA 1YO5C 2XVCA 3ZPLA 1ON1A 4KT5C 2FE3A 3EETA 2P8TA 4I0BA 3BPVA 3TKYA 1P4WA 3LFKA 4HX8A 3SZTA 1Z7UA 2P4WA 4HLXA 1FY7A 1JE8A 1HKQA 4QLCU 1QZYA 5HLHA 2GIVA 3V4GA 2XKOA 1J2XA 3C7JA 3TO7A 1LEBA 3HRUA 4HQEA 2KIMA 4U88A 4YFKF 1IN7A 4YFNF 3O3KA 2M87A 5DCMB 5FD6A 1ZGJA 1T39A 4RB3C 2OA4A 3FMQA 1XSDA 4EJVA 1IN6A 4E70A 5ICGA 3IWZA 4M6YA 3RYPA 4LK0F 1T0FA 1U78A 1R23A 4EJTA 2K02A 4R8HA 3LA2A 4TV7A 4XBFA 2D1HA 1W7PD 5DDGA 2HGCA 4D0PA 2VT3A 4LLNA 5CVIA 1K78B 1R7JA 2L02A 2OU2A 3I53A 3GZ6A 5BQTA 2RGVA 1T98A 3IRQA 4YG2F 4B8XA 2G7UA 3DKWA 1E2XA 3WGIA 1SD5A 2CGPA 3WE2A 1ODDA 2YSRA 5L3CA 1FWZA 1S7OA 1Y0UA 3J7AO 4K2EA 1FZPB 2H6BA 3M8EA 4FT8A 1B6AA 1R1UA 2KJCA 3M8FA 1Z1DA 3F6VA 1B9NA 4UV8A 2FF4A 4I98B 3SQNA 4WXHA 2MC3A 1E17A 5ILSA 4HOBA 4XSZF 1BIBA 1HXDA 4O6JA 2DTRA 2V9VA 2PN6A 4PGHA 5FGMA 5CJ9A 4OMYA 4OMZA 1UB9A 2H27A 3EYYA 2L4MA 4BXUA 2J5PA 3WTUC 2L4AA 3O2PE 2FBIA 3FXRA 1IRGA 2VBYA 1LDDA 1P2FA 3H3ZA 3PQKA 4KN4X 1FYMA 1SMTA 2E1CA 5CVUA 2QVOA 1F1ZA 2E7XA 2HOEA 1WSUA 2K27A 4GXOA 2VOPA 2G9WA 2NNNA 4G94A 4A0ZA 3QPHA 5LHGA 2JZYA 2P6SA 5LBQA 1F4KA 4OIRF 1JHFA 5E1XA 2XRNA 3NEUA 3MEXA 4RGUA 1O3QA 1WWXA 1W5SA 4LJZF 3VB2A 1ZG3A 4WCGA 5H20A 4HDUA 4IRIA 4NQWA 2QENA 1XGOA 3EDPA 3GEZA 2YR2A 3HHHA 2IW5A 2YPRA 3L00A 2PI0A 4A12A 3F8NA 2FA5A 1KYZA 2A5YB 4RB0A 3RYRA 2BYVE 1GXPA 3TQNA 2O6GE 2F5CA 3DPTA 2FBHA 2FRHA 4MEYF 3FHZA 2DK8A 4IJAA 4EJWA 1TNSA 3LQRA 5H6QA 5D8LB 4WXCA 1OPCA 1FP2A 5BMZA 2VT2A 1WKMA 2CO5A 3TO6A 5FLXZ 2PBIA 3P9KA 3ULQB 3HOTA 1YS7A 3EQLF 3R0JA 1QBJA 5L3FA 4Q47A 2JSCA 3LAJA 5DD8A 2A6EF 4KMFA 1HW2A 3HTUA 1ZRFA 3HOSA 3ELKA 3ZMZA 3PQJA 5ERIA 2Q2EA 5ICCA 4RB1A 2OQGA 4G7ZF 3E5XA 3CDHA 5FLXK 1IAWA 3JAMZ 3GWZA 3U9GA 3EYIA 4I7HA 4JQFA 1EH8A 2ELHA 5KVRA 5J8CA 2JPBA 1ON2A 4GYIA 5L3DA 2M30A 1TTYA 1IRFA 2XUBA 2P6TA 4CGZA 3S2WA 1BI2A 4YFXF 1CF7A 2RV8A 2OQRA 1FPQA 4LFUA 3CUQC 3RPUA 2O3FA 3SFZA 2L01A 4HV6A 2FEZA 3BJOA 1B4AA 3K1NA 1RI7A 3KFWX 5D4SA 1Z6RA 4EGYA 1YS6A 3NRVA 1MGTA 1SD7A 3VOEA 5D5VB 4LD5A 2A6HF 3E6BA 2OAZA 3J81Z 1J5YA 5FD5A 4EM2A 3RIRA 1FBQA 1SFEA 3N4MA 4BAYA 4PZJA 2ZKZA 2V1XA 1RIOH 2PG4A 2XHKA 2GZWA 4RAYA 2EV5A 5DUIA 3B73A 3IWFA 4KDPA 4MEXF 1S29A 1ONVA 1XDSA 1ZHFA 5FFXA 2BE5F 3T0YA 2A07F 3HYIA 5HDNA 3J81K 3IKTA 1FBSA 4MTDA 1KQ9A 2ETHA 4PDKA 2FNAA 2AS5F 2EK5A 2M8EA 5DUKA 1GXQA 5DV5A 3ABUA 2Z9OA 2L54A 4UNOA 3GFJA 4I02A 3L9FA 2H09A 4I01A 3M1EA 1WQ2A 3MWMA 4MGRA 1YW8A 5D6FA 2ZMEA 2E7WA 3QAHA 3R6SA 4AIJA 2FXAA 5EEGA 2GWRA 1EV7A 4H0EA 4U7BA 5BS6A 1QNTA 1ZAOA 1W7PA 2Y48A 2YU3A 4M73A 1FYLA 5E17F 1QGPA 5ILVA 3RKYA 1K79A 4OIQF 3KZYA 5K5OA 3LA7A 3K9TA 2JTVA 6PAXA 2VN2A 4HLYA 3IRRA 3F8BA 1O7FA 3WTYC 2BBYA 2NNYA 3TGNA 1LDKB 1H9TA 4AIKA 2RKHA 2F5FA 2CSOA 3I59A 1J59A 3KEQA 2ZO4A 4A5MA 2NYXA 2HTJA 3E6MA 3GFLA 1AWCA 1O7LA 1ZRDA 2H94A 3IL2A 2XAJA 4N9IA 2EFNA 3KP7A 5BPDA 5LGTA 1XGMA 2QUFA 4RB2C 5IT9Z 4F7ZA
chains in the Genus database with same CATH superfamily
1I3AA 2IP2A 2UUZA 5IOYA 3K2AA 3HGGA 4ETSA 2IS2A 2ZSIB 3DBRB 2DFHA 2QM3A 2EFQA 4NNJA 4D7NA 4UXNA 2JQ7A 1D0XA 3JREA 2L3DA 4G9YA 1Y6IA 1RZ4A 2LNBA 1USSA 4XLNF 3ZQIA 3AKZA 3FMSA 3ERMA 2LP0A 3F8MA 1ETYA 1YQAA 2Q0OA 3ZMSA 3KPHA 1YJWI 1IN8A 5D6EA 4AD9A 2IA0A 4M3EA 3TOAA 4EM1A 2W00A 3F3XA 3ZGKA 3KCCA 3S1QJ 2RNGA 3RQ4A 2KRFA 1AOYA 1GT0C 2HR3A 1IW7F 2R7FA 5FLVA 3H5RA 1MBHA 1HKSA 2ESHA 3HRSA 4UVCA 2M4KA 2DOAA 4HEA2 1MSFC 2ECCA 3M07A 1BOAA 4CYDA 4XICA 5IT9K 1NTCA 2HQAA 4EATA 3S16J 4XLEA 2A61A 5E3MA 1AU7A 2LLKA 2OCEA 2JUGA 3E97A 1JUSA 1ZLJA 1VI0A 3LSMA 2HVSA 1FBUA 1ZN2A 1Q1HA 2D45A 2LKPA 3QPTA 3V7RA 3ZOBA 2AXTC 2IT0A 3FISA 2Q2EB 4EV0A 3C2GA 4YIFA 2VXDA 5F1RA 3IAS2 1QZZA 1UHWA 4HSTA 5IYBJ 1YOVB 3KP6A 4PUSA 2LBFB 3FBIB 3CDLA 2KJBA 3T5XA 1GVDA 1ULYA 3FIWA 3OR2C 4PFPA 4KISA 3BG5A 5GTIC 2EILH 4ESBA 2VASA 4L0ZB 3K4MA 1GLNA 2IGKA 2D2WA 2LKXA 5FRMA 1MMDA 2K9NA 3ZQCA 2F5DA 2JMWA 1B59A 4BQAA 4LB5A 2MLGA 2KDZA 2ELJA 1XMKA 3GBGA 1K6OA 2AQEA 1PUFA 1CF7B 4IVNA 3TW6A 1BI0A 1G59A 5KNLA 1U5TA 4BHPA 2IGNA 2KKOA 3WHCA 4I2OA 4Q5SF 4IF4A 3GTKJ 1VQ4I 4HW0A 3FZVA 4OIPF 5L3EA 3GFMA 3C1DA 3DU6A 1H8AC 1KU3A 3DQVC 1SFKA 3OOPA 3G71I 2K7LA 4QSHA 2WA0A 5K5QA 3WTVC 1HSTA 1I6XA 2NVTJ 5H6RA 1FTZA 3H3UA 4P96A 1FOKA 2V79A 1ETOA 2GXGA 2EV0A 1C0WA 1PJRA 2M45A 4Y33A 4XR6A 2HOAA 1S7AA 2W84A 4NC8A 2ELKA 3ZMVA 3KLOA 2W7NA 1R58A 2M34A 2JRMA 4QPOA 3T1BA 2ISYA 4E7SA 1ZRCA 1X1PA 1DGRM 3K70C 3Q9SA 1GV5A 2ZB9A 3F8FA 1LDJA 3G1LA 2E1MB 2V6CA 4ITVA 4KIFA 4M9SA 4PJMA 2E71A 4ASNA 3H9JA 1MNEA 3VYRB 4D1QA 5D5XB 5B1AH 2IGOA 3L2QA 1J75A 1USTA 2KDOA 3CDIA 3TDZC 3A01B 3CLQA 3H5NA 1FJLA 3ZMDA 4UB6C 4YIIA 5LLQA 3C2HA 1J09A 2MYSA 3MFKA 1ZG5A 1IJWC 3KP4A 4B43A 3V42A 3Q0WA 3JTHA 3ZQLA 1X1CA 1FT9A 1ETQA 3LNQA 4G6QA 1RRJA 1STZA 4C3HJ 5KK1A 1H88C 3VWBA 2XF7A 3HSRA 2MW8A 3OY9A 4A3CJ 2MLKA 3S3OA 2JWTA 1IO2A 4ZYGA 1L3LA 3HUGB 3IKVA 2JA8J 2P7CB 1HW5A 1R36A 1XSXA 2OV7A 3DLAA 5CVJA 5ILUA 4AVZA 2V1UA 3ASNH 2EFWA 2MFZA 4P9FA 4IQJA 1BJZA 1VFCA 4WK8F 1QO0D 3L09A 3DU5A 1A6QA 2ZNYA 1I50J 3RKXA 3PNVA 1YLFA 5BNGA 3HDDA 2PX9A 3U2RA 4UHTA 3VEPA 3S1NJ 4RAGA 1W36C 4EJUA 4BNCA 2GAUA 3K4KA 5F6FA 5J4YA 5LGUA 3ZQ7A 1M1EB 4R1HA 3IAM2 4CCKA 1VZ0A 4QIWN 2FOKA 4OOIA 3FXJA 4JYKA 4HQMA 3WU1B 5DTDA 3RCOA 2V1DA 1PP8F 3CO7C 4JX6A 4ZDPA 1R49A 4P9UA 2EIKH 4FHTA 2LMDA 2VBWA 4JOMA 5FROA 2DU9A 1APLC 2X85A 3KYLA 4A2UA 3V7CA 2LK2A 3OL4A 4CO8A 2ZMEB 4YRVA 5IOZA 1BW6A 2K4JA 3PSFA 1OCZH 2XKPA 5HNFA 4I09A 3FXLA 3Q3SA 2LTPA 2STTA 5DD4A 2ADUA 3WTTC 3OYAA 2HXIA 3W3CA 2GBYA 2BXYA 4CCOA 3CLOA 1K7AA 2DOEA 2FJ1A 1R4MB 4XLAA 3A1YA 4Q4ZF 4M9ZA 1W7PB 1BW5A 4QWQA 1EJ9A 4A3KJ 2XV4S 2W24A 2XGDA 3I0TA 1U9OA 2W48A 1ZYRF 1XD7A 1S9HA 1NK2P 4GO1A 3DXJF 1PP7U 4L0YB 1LFBA 5JLWA 2QWWA 2BY1A 5F04A 4UUTA 3S8PA 2M5WA 4AM3A 2RVCA 3AG4H 3K1PA 4KUMA 4Y3OA 4GCVA 3CESA 4JK1X 1FYKA 2OZUA 2L7KA 1DQUA 4PFOA 2R7QA 2MH9A 4IHYA 5E3LA 2O0YA 5E8GA 3KP2A 1WJAA 3CF5F 4XKCA 4KNYA 3M1CA 2DFIA 3D5RC 3GXOA 4HSRA 4NDLA 3Q5FA 1NK3P 2ZSHB 4QPQA 3CTAA 3OR1C 5GPAA 3I58A 3LWFA 2R7WA 3I59B 1TLHB 1T56A 2X0LA 3V8JA 4C3JJ 2EIJH 3HPGA 3ECOA 4A3IJ 4BUPA 3G3ZA 4C2MJ 3H0GJ 4KIGA 1YRNB 3EUKL 3OOUA 2H8RA 2J5OA 1HC8A 2DT6A 2LF7A 2EV6A 1T0FC 3BJ6A 3BG7A 2PFBA 3HL2A 1HSJA 2WTEA 5A2QZ 4O3MA 1O3TA 1MMAA 2M7AA 2K86A 3V8LA 2LVSA 1K83J 2R5YA 4HRIA 4CZCA 2V9PA 1XDUA 2E1NA 2ZFUA 2QSFX 2V1NA 1JHHA 5J1RA 3HOVJ 1PYVA 2CW8A 2XASA 1WRJA 3JCUC 5FO5A 1EH7A 2QYOA 2CYYA 2DLLA 2OJED 5J8FA 4HF2A 4F91B 4BE0A 2I10A 4AVPA 4HYEA 2DODA 3V7SA 2QZ8A 5F1JA 2K40A 3I5UA 4O5VA 5FFZA 3LSGA 2VJIA 1FTTA 2AHQA 4XLFA 4EGZA 1XGSA 1MW7A 3COAC 1MBJA 1JGSA 2G0EA 1IXRC 2EB7A 2VBXA 3IH3A 2LOOA 1YG2A 4KJZA 5CKTA 2VJJA 1OR7A 2WBMA 2PJPA 1TW3A 3E3VA 3QYEA 2HXOA 4OIOF 2H1KA 5TRDA 2LDUA 3BP8A 2R0QC 2QKMB 1BI3A 4A3LJ 2M3AA 1KU7A 2M4GA 1F43A 2OBPA 2HOSA 1YJNI 3BOQA 1XN7A 2ZBKA 1XMXA 2BEOA 4FX4A 1GVJA 2YUSA 3A0BC 1D8JA 1J9IA 1ETKA 3BTLA 1MKMA 1R22A 5HLIA 3PFIA 3SDBA 3OS2A 1YJ9I 5HVQC 3MAJA 3GUDA 3VYTB 3L7WA 3F22A 4M3FA 3JAMK 4KT6A 2VC0A 1XCVA 4I0AA 3GYHX 4KA4A 1XCBA 1E3OC 1K61A 1YTYA 5AIQA 2VE8A 1H0MA 1BIAA 4X1EA 2XAGA 4LG0A 1I6HJ 4GYGA 4Q48A 4M74A 3BWGA 1MNDA 2DMQA 4JX5A 1IDZA 1U6GA 3FWEA 1QZEA 2JVGA 5CQEA 4RBOA 2Y30A 1SEUA 1UCRA 1PDNC 4OAZA 1XB4A 2E5NA 2VE9A 5TISC 5JHUA 2EJRA 1YFHA 4IHTA 3ABLH 1P6RA 3PNTA 4XORA 1MJBA 4D7MA 4LIVA 4LK1F 3LSPA 3ABKH 4ZZDA 5F08A 3CC4I 4M72A 2DW4A 1ZQ3P 1QRYA 2DMPA 1PUFB 2FUG2 1K6YA 2ME0A 2LH9A 1EH6A 1WI9A 4DZJA 3ZRGA 2DMUA 1MJAA 3M3YJ 1WH7A 1U5TB 1JUMA 5AONA 3FHNA 4BH9A 3H36A 4ZTJA 1XGNA 1IGNA 4DQ2A 1X1BA 4JX4A 1BC7C 4F3QA 1UHMA 5KAIC 5BPIA 2MC4A 1OMIA 2HVRA 4IHSA 5CVVA 2STWA 3WU0A 2O8KA 2WY8Q 1Z91A 3T8RA 2AQFA 1XSVA 3FXOA 3TL4X 4N0BA 1QPIA 2R7XA 2RC4A 3JRDA 2BHZA 1FSEA 4CCLA 3OS1A 5EGOB 2QQBA 4M71A 1ZLKA 3P9CA 1X4PA 2NVYJ 2R3SA 2E35A 3AG3H 3IUOA 1WFXA 5HDKA 3DWLE 1SFUA 1KQ0A 3I64A 3BR0A 4IO9F 1X1AA 4AIHA 3DV8A 3DEUA 1O57A 2LY9A 2LC2A 2HVQA 2XAHA 4FX0A 5TJJA 1LNWA 2EA2A 2BY3A 4LLLA 2EINH 2D5VA 4C2UA 5IYDJ 4U0VA 2DO7A 3WTSC 2JRTA 4HNUA 1X2MA 3MKWB 2YX7A 1XC5A 2M1BA 5AIPA 2NOGA 4IHXA 3E0JB 2ZXWH 3SFIA 1RNLA 2B0LA 2XSDC 3I55I 3OYCA 4ZDOA 4XRFA 2DAOA 3HXLA 2GA2A 4BHBA 1HDPA 1SD4A 4BYYA 2MBFA 3BTJA 5J40A 1WGXA 5H2FC 4UUVA 4IZZA 2COMA 3OYFA 2XDVA 1IN5A 3E6CC 2JJ7A 5GTHC 4XKBA 4G6DA 2EQRA 3L2WA 1YYVA 2DQLA 2GQQA 1X4OA 3K4JA 2FMYA 3RJPA 3BR6A 2M0CA 4CCJA 5J47A 1JKOC 2HU9A 3F21A 4ENKA 3WG9A 5JI6A 5IT3A 3CD6I 3JRFA 4Y15A 4L5JA 4A3FJ 4OINF 1X19A 1HBXG 3U1KA 2JN6A 1TZLA 4OU0A 3QQAA 2TCTA 4IXAA 2KRHA 1U9NA 2MGQA 3EUAA 4LB6B 3RI4A 3HOZJ 2NVXJ 3WGHA 1G6NA 4P55A 1ZG1A 1JT0A 1RUNA 4GRIA 2WY7Q 1X3WB 4RS8A 2A05A 3ZN1A 3KEOA 1O4XA 1QA6A 3SXYA 4P5OA 4U7DA 2L2OA 3PUBA 2FQ4A 2MG4A 4XK4A 1HQCA 2QEXI 2E19A 3G2BA 2QA4I 5HS8A 1L0OC 1P4AA 4CZZA 2E34A 2OC6A 2DJIA 4IPAA 3I4PA 3DEEA 3MD2A 2OD5A 5FKMA 1TC3C 2CFXA 2WAEA 4XL9A 3T8TA 5E8IA 4J19A 5JFRA 1TQIA 3ZQQA 2RQPA 1ETWA 4NQWB 4E7LA 3RKWA 2K9LA 1P4XA 1QQIA 2QBYA 5F27A 5IYCJ 3E5QA 2VONA 1S6LA 3U1DA 1MH4A 2VL8A 1CGPA 1NHAA 1GHCA 3TOBA 4AIDA 2IJLA 5IP6A 1UFMA 1U8RA 1TQPA 1DU6A 2FBKA 2DBBA 3BR5A 2XRLA 2KISA 3AL0B 1D0YA 2DYRH 4A6DA 3FXKA 1VQLI 3H9GA 4XLHA 2ACJA 3QYBA 4B4CA 1YI2I 1Z9CA 2RQQA 4BS9A 3HRMA 3KLNA 3WG7H 1IUFA 1I27A 1BA5A 1D8KA 3C18A 4BHCA 2X6OA 4BACA 2A69F 1FC3A 2W57A 1RUOA 1X1DA 2ISZA 1YITI 1I5ZA 2KT0A 1ENHA 2WAQN 2NOJB 2IEKA 3MZYA 3OV8A 1LQ1A 2CFOA 3BDDA 5EJCA 1TP4A 4HA8A 2EFPA 2DQRA 1RESA 3VSKA 4CHUA 4HX4A 1MD0A 2OUMA 4L5EA 1TNTA 4KIBA 2JT1A 5GPCA 4V2FA 2RN7A 4MTEA 4ON0A 2CQNA 1R00A 2CUEA 4NC6A 1HCRA 1N75A 2PMZA 4FCYA 1HW1A 3FF5A 4IQ4A 1MNMC 2DCEA 4HF0A 1Z3XA 2FQ3A 2VQHA 3DTKA 2GA1A 2R5YB 1JKPC 2VQLA 3CMEI 4B1RA 1S7EA 4P1WA 3GFIA 4M9XA 2VPLA 1H9GA 2G7HA 2E1OA 2EZHA 4RLFA 2BY2A 3B02A 2JA6J 1OFCX 2HS5A 3HZJA 5LGNA 2ZJRF 1UJ8A 3CCLI 2E1MC 2P7VB 1IN4A 2DMTA 3CZ6A 5K5RA 1R1VA 3B6AA 2OPTA 3H3VK 1SMYF 5CYVA 3KE2A 3K6GA 3AAFA 2W4SA 3K70D 1BI1A 5DS9A 2P5KA 5FJ8J 1VF9A 3F0CA 1IXCA 4L18B 3QPSA 4L9VA 4ANJA 2R7ZJ 2PQ8A 2HNHA 2VXZA 4DOZA 2F5EA 2K85A 5FB2A 3OIOA 3I3LA 2L7FP 1T08B 1FLIA 4AWXB 4RGRA 1F5TA 3TEDA 3OYLA 2O8XA 1A6IA 2CQQA 3SZGA 1FNNA 1ZGAA 1HKTA 1QPMA 1Z21A 3BROA 2DXIA 4ZDLA 3FKJA 1V4RA 5D8KB 2Q8KA 3BCAA 2YX4A 2DT7B 1WJEA 4DNCA 5CVRA 3CJNA 1KYWA 1D3YA 3PNYA 3KETA 1MBGA 4MIMA 4CYCA 2IVMA 3CC7I 4EMSA 2HEOA 1KU2A 3JSOA 3D1NI 4ENJA 3JW4A 1BJAA 1J0RA 1WJCA 3A4CA 1FX7A 3LQQA 2HQNA 2L0KA 3L2RA 2M8GX 4N4NB 4NHJA 2E2IJ 2Z1DA 3TP0A 2RDPA 2A3SA 3CCQI 1XX5A 2ESNA 3F8CA 4L9NA 1BR4A 1KA8A 2AO9A 3BG6A 3LSHA 3M9AA 3FM5A 2IRFG 2KP6A 3FXMA 2FSWA 4LG0B 2R7UA 3R4KA 3GTPJ 5E1WA 4M3DA 5LHIA 3S3NA 3PO3J 1T33A 4ZYEA 3WTWC 1IUYA 2WC2A 5HLGA 1W36D 5K1YA 3R61A 5CLSA 1E3HA 5HS9A 3ROUA 4A0XA 4E7ZA 4A3JJ 4XONA 2X6YA 3W2WA 2IAIA 4LOCA 4XN3A 5FKOA 2ZMEC 4IRGA 1B8IA 3C3WA 3GO5A 5F0CA 1MDMA 3O8GA 5LRRA 1DPUA 2ZNZA 1LJ9A 1MJ9A 5LEJA 3CUQA 3HOUJ 4XRMA 1JJ6C 1WCMJ 1OYIA 4ZH4F 2P5LC 2QKLB 1HLVA 2V26A 1YE9A 1R5GA 3H9QA 4B09A 1DU0A 1E0EA 4HAMA 1Y1WJ 2GXBA 4H4KC 4M3GA 4HF1A 2CUZA 1TWHJ 3L2CA 3BC8A 4LIUA 3QRFF 3OMYA 1ZKGA 2HYFA 3HSFA 4EEFG 2NRAC 2ZFWA 4WWCA 3WE3A 2MA3A 2K9QA 1S8NA 2DOFA 1K4SA 4B47A 2Y0SA 3F23A 3BZCA 5L3BA 1Z3YA 4CXFA 4PCQA 2XAUA 1ZARA 2JA5J 3SEZA 2DFEA 3RTRA 1MBFA 3SZPA 4DJAA 2I5UA 2FMLA 2JPCA 2IA2A 2HTSA 3G73A 1ZTRA 1V55H 2EIMH 4XN0A 1BN5A 3ZN0A 4X0GA 2CV0A 3KP3A 2Z99A 4Y52J 1SFOJ 4GGGA 3ZMTA 4XLPF 1YW7A 3CJQB 4RGXA 2Y9YA 1DPRA 2TDXA 1MBKA 2QLZA 3OYBA 4LGWA 4F93B 4EM0B 1SVLA 3W6KB 1TWCJ 4AYBA 4C30A 4BDZA 4BQOA 3HOWJ 4G8XA 4ZZLA 3N05A 2LR8A 3JR9A 3F72A 2RNJA 3K10A 1VQMI 4A6EA 1LPQA 3GW2A 2O9LA 2VOOA 4IOCF 4AUXA 2F4MB 2QQ9A 3H35A 3S32A 3JRGA 2Y2ZA 2WAFA 4MLOA 4LMYA 5E3NA 3HJEA 4V2GA 1DDNA 4HV5A 2KIUA 3WTXC 4BL0B 2DPDA 2V7FA 3R60A 3EUHA 2KMUA 4ENMA 5LEKA 1T6SA 2IXSA 2R7DA 2IA1A 4FISA 2HKXA 5JVGF 2XB5A 3H5AA 4N4OB 1CQTA 3KZZA 1U2WA 2CV1A 1ETXA 4YEJA 1S72I 2MD5A 1FP1D 3BJAA 1Z67A 2EA4A 4MHGA 4E6KG 1VTNC 4ZTFA 3G1MA 1TT0A 1DGWY 2Z3YA 4IX7A 3DF8A 2HQRA 4UVAA 3KX2A 1U3EM 5EZGA 2FU4A 4IRHA 4NBQA 2E5ZA 2EWNA 3A03A 4HDVA 2DPUA 2UXXA 3QP5A 1OYWA 3DP7A 3WTZA 4A5NA 2D1VA 2QGUA 1T2KA 1XG1A 4WXDA 1LEAA 2KPMA 2BZTA 3FK7A 4G7OF 3BG3A 2XGXA 3LSIA 4EVIA 4KMUX 4Y13A 3BPXA 1UZCA 1G3WA 2CQKA 3PUFA 1OKRA 4KFCA 3JTGA 2HDWA 2K4BA 2CG4A 1G8XA 2B9SA 1SFXA 2RREA 3RZOJ 3DPLC 3MCZA 5EEAA 1VQ8I 4G7HF 3OYJA 2DT5A 2WWYA 2NS0A 1W5TA 3VODA 4RGSA 5E18F 1XMAA 2PMHA 2N8GA 5DCFA 3SDGA 1O3RA 1VNDA 4XRSG 3W2VA 4N9HA 3CJTB 1B1BA 2ZXJA 3ML6A 1Z6TA 2LY2A 4G6TB 3FDYA 3FBNB 2QBYB 1ZELA 1VQ7I 2LD5A 4CDGA 5JVTA 1D1AA 5D5UB 3BG9A 4NB5A 3E7LA 2DK5A 3IP4B 4M6XA 4XMYA 1N77A 3BQZA 3LA3A 4UVBA 3E5UA 4DBQA 2B7EA 5M5XJ 5HDGA 4Y7NJ 1J7KA 2B63J 1QHHD 2PEXA 2VODA 1WVRA 2CWEA 3ABMH 3K4CA 5DCMA 4ZC3A 5HS7A 1O3SA 2KIQA 1WJDA 1OCPA 4HX7A 2HWVA 1AKHA 2L7MP 2HFHA 2DTZA 2XAFA 5FKLA 3W6JB 1G3SA 4PSWA 1HOMA 2E60A 4FQGA 4CICA 2WB1N 3J80Z 4RLQA 2BGCA 2XF5A 4RA2A 1WH5A 2EZLA 2CV2A 2BHYA 1SC7A 4MQVA 2VKDA 4PK4A 5E79C 2CW0F 1SAXA 2L7ZA 3Q9VA 3BZ6A 1WPKA 2C6YA 3NQOA 4A3DJ 4BKXA 2RAEA 2XAQA 1U5TC 2DDAA 3MKYB 5D5WB 3QOEA 1OQYA 4FASD 1BC8C 4QTRA 3DKXA 4HZFA 4JBAA 1S3JA 1DP7P 3GVAA 5A2QK 4E4HA 2BOLA 2H6CA 4UV9A 2Q1ZB 2DI3A 2LBFA 4XOPA 1Z05A 2NAZA 2XIGA 3NAUA 2HOTA 1MIJA 3F6OA 2HYGD 2M7BA 3J7AY 1K78A 4BE1A 2VBZA 2LFBA 1WJFA 3IH2A 4U0YA 4J01A 3MZHA 4V19K 3HRTA 1BBYA 1A35A 2HDCA 5K7FA 2IPQX 3FM3A 5K7HA 2R7VA 4KYWA 3J80K 3HKZA 5C3EJ 5IPAA 3D5LA 3PL8A 4L5IA 3S93A 2ID6A 1W5CC 2F6CA 1V3FA 3DPUA 3PSIA 1ZR2A 1MH3A 4I99C 5EEHA 4KICA 4BXFA 3QU3A 3RSNA 3LMMA 3ZMUA 1F9NA 4EQQA 3RQIA 2O61A 2V6EA 3TDUC 2AXLA 4ESFA 2YU9J 3HTSB 2Z16A 1TW2A 2QQ8A 3SJMA 1K4TA 2ZCWA 3FMRA 3L1PA 5FRNA 1ERDA 3WODF 1IV8A 4C2TA 1ZGWA 2NVUB 3S1MJ 2A68F 1TWAJ 2KL4A 2WV0A 1B72A 5IP7J 1DUXC 3TW7A 1YX3A 3TO9A 2BV6A 3K0LA 3L2UA 1LB2A 1LE8A 4W1UA 1A31A 1TQMA 5E20A 2ZJQF 1Y8QB 3K4LA 3FKIJ 3WU2C 3QOPA 4F52A 3W6VA 3VFZA 1REPC 9ANTA 2OZ6A 1OJLA 2KRCA 4MNUA 2HKOA 4KITB 2KHMA 4ENNA 1R5HA 3FXQA 3N97A 1LFUP 1IF1A 1LVAA 2Y0MA 4CYCB 5L3GA 4Z2YA 2YS9A 1IC8A 5JHFA 1VQ6I 3GF2A 4R79A 2NVQJ 3S14J 5HOOA 2W85A 2W25A 2DA7A 3OYDA 1JTXA 1GV2A 2TRTA 2VPRA 3QU6A 2M9HA 2X51A 3K1MA 3FX3A 3P7NA 2UWMA 1G4DA 2QSGX 3BY6A 4MQ9F 3FXUA 3V8KA 3CJRB 3L2VA 1G3YA 5DEQA 4L9JA 4D5CA 3WGGA 5F64A 5GADJ 5LRSA 5IP9J 3BR2A 2O03A 2DA1A 3I54A 3DFGA 1W4MA 3GMEA 3O6BB 3RPQA 3UKGA 1YW9A 4A3MJ 2KZGA 2Y75A 4U0WA 5DYMA 3ERED 4A0YA 2LRDA 5FKKA 3UNGC 4BQNA 4CA0A 4RAZA 1OCCH 4IL6C 5JR3A 3GCMA 3CCEI 1IV6A 1YIJI 4YELA 3ZQFA 2EPFA 3HSEA 2ZC2A 1B8IB 1MDMB 3HUGA 3DLLF 3CUQB 3W2AA 3GLXA 5ICFA 1V5GA 3ABTA 1IZ1A 1HF0A 5KHDA 1TL8A 1P92A 2P5VA 5B5EC 2HZTA 5E1ZB 5HLTA 3P9IA 2BY0A 2Z5UA 1R1TA 1YIOA 3IH4A 3VDXA 4BEHA 3A0HC 3ISPA 1FMVA 4ZYDA 2F2EA 3AL0C 1Y39A 2VI6A 5TGTA 1D5VA 1DP3A 3K69A 3GX4X 2E36A 2WADA 3REOA 2H1LA 1JKRC 3H0DA 3TP3A 3HIFA 3ECHA 3H92A 3LL7A 3ZQGA 4HPQA 1XPXA 2LF8A 3CO6C 2Y69H 2Z33A 4LG3A 3D0SA 2FNPA 2KLOA 4S05A 2UXNA 3LFUA 2VC1A 5LHHA 3HG9A 5GP9A 1IXSB 3LSTA 5ICEA 3MQ0A 5J6XA 5LD2C 4HBLA 5HODA 1H89C 1JJ8C 3G6EI 2X1DA 2IBDA 2BW3A 1LFPA 4S04A 2E2JJ 1ACIA 1KQ8A 2UZKA 2KIFA 1AA7A 2X1CA 2X9DA 3QP6A 3RDIA 3DCFA 3OIQA 4LLGF 1A04A 4RM2A 5EF6A 4KN7X 3JRAA 2LYCA 3I71A 3O8HA 3C2BA 3R0AA 5F0HA 1R6RA 3GTGJ 2X4HA 1G3TA 5ED4A 4G12A 5F0FA 4XSXF 2JUCA 3RZDJ 3CCJI 1XS9A 4ZYHA 1TBXA 2CW7A 1PVEA 3IC7A 5BOXA 1P7IA 2LSOA 3IHUA 2EFOA 5D4RA 3G4SI 3MVPA 4ESJA 1MMSA 4X6AJ 1KGSA 2BXZA 2Y31A 2PMUA 4ZJZA 3GLLA 1ZH5A 3HHGA 1ZR4A 4WF2A 4L9TA 5CPRB 1D1BA 1FOYA 4PSXA 3CUOA 2ZJ2A 1R4NB 3JSPA 1VQ5I 1JXSA 2VJ4A 2R7OA 1SAUA 3GZ5A 1SVOA 1FSHA 3GTQJ 4F55A 3B6CA 1ZREA 2OCCH 2PJRA 1MZBA 1YHQI 1I1GA 3U21A 3DBHB 4JP0A 1SANA 1X58A 1S5LC 2XB0X 2ECBA 2QQAA 4Y17A 4GDFA 1FIPA 1SD6A 2MH2A 3I4MJ 1KU9A 3K4NA 3K2ZA 5GAGJ 1OR7C 1X3UA 3M7GA 1BM9A 3GTOJ 3OS0A 1I1SA 5EYRA 2VIXA 4EJOA 3SHFA 1OYYA 4WX9A 3KP5A 3K7AJ 2L5QA 5M3MJ 2R92J 4PGGA 1NH3A 5DM7F 1PUEE 3E6DA 3ZP5A 2PLYA 2IS4A 3LAPA 1T38A 1B9MA 2XROA 1YO5C 2XVCA 3ZPLA 1ON1A 3BT9A 2FE3A 4KT5C 3EETA 1POGA 2P8TA 4I0BA 3BPVA 3TKYA 1W0UA 3HBLA 2IS1A 3ONQA 1IRZA 2XSJC 2LG4A 1P4WA 3LSJA 3LFKA 1A36A 4UUSA 1RETA 4HX8A 3SZTA 1EA3A 2FOWA 3HB9A 1Z7UA 2QF7A 2P4WA 1V54H 1FY7A 4HLXA 1JE8A 2M2EA 1HKQA 4QLCU 1QZYA 5HLHA 2GIVA 4FE4A 3V4GA 2XKOA 1J2XA 4DZPA 4DGWB 1FIAA 2EZIA 3C7JA 3TO7A 1LEBA 3HRUA 4HQEA 2KIMA 4U88A 1OISA 4DYQA 1X3ZB 3BCBA 4YFKF 1IN7A 2VQCA 4YFNF 4MO7A 3O3KA 2M87A 2HYJA 5DCMB 1N78A 3PJRA 1EKEA 5FD6A 1AKHB 1ZGJA 2A6TA 2CS3A 2JK3A 1T39A 4BQQA 4RB3C 2ME6A 2WAQA 2OA4A 3FMQA 1XSDA 3HOXJ 3J7ZI 4BE2A 2H8WA 2L9SA 2CUFA 4RMNA 4EJVA 3EPZA 1U8BA 1IN6A 1VQ9I 1Z0XA 4E70A 4XRSA 3VYSB 5ICGA 1YX5A 3IWZA 2R4GA 1E3PA 4XKWA 4M6YA 3CC2I 1RR8C 3RYPA 2QCOA 5EG0A 4LK0F 1T0FA 1U78A 2X6WA 1R23A 4EJTA 3HGYA 3NARA 3AG2H 2K02A 4R8HA 3AFHA 3LA2A 4TV7A 4XBFA 2D1HA 1W7PD 2KFDA 5DDGA 3CCRI 2HGCA 2GOXB 4D0PA 2VT3A 1MBEA 4LLNA 2LY1A 5CVIA 1K78B 1R7JA 2L02A 2OU2A 5FKNA 3I53A 4NC7A 3GZ6A 5BQTA 2RGVA 3J7YJ 1UAAA 1WZ2A 1T98A 2K3FA 4Y4RA 3IRQA 4YG2F 4B8XA 5CQGA 2G7UA 2FX0A 3DKWA 3LSRA 3Q0UA 5FLMJ 1E2XA 1WJBA 3DEWA 3WGIA 2R7SA 3A02A 1SD5A 2CGPA 3WE2A 1ODDA 2YSRA 3MZ8A 2DN0A 3BTCA 1BR1A 1FWZA 1S7OA 2DA2A 1Y0UA 4ABZA 5L3CA 3J7AO 1ETVA 2XGCA 4K2EA 4C3IJ 1FZPB 2H6BA 4E7JA 4IKFA 4CUGA 3M8EA 4FT8A 3CCMI 1B6AA 1B72B 4FE7A 2CJJA 3BZKA 3QODA 4M3BA 4AC0A 1R1UA 4E7HA 5M5WJ 2R7RA 2R93J 2XPVA 2KJCA 3KYDB 1UHSA 3M8FA 4II3A 2Y0SN 3Q0VA 1Z1DA 3F6VA 1B9NA 4UV8A 5K7ZA 2FF4A 1BOBA 3BQYA 4I98B 3SQNA 5EGOA 4WXHA 2MC3A 1E17A 3M4OJ 4HOBA 5ILSA 1NG6A 3OYNA 5KAFC 1LKXA 3PIPF 3A2KA 4XSZF 3GTMJ 3BTIA 4W97A 1BIBA 4B44A 1HXDA 4O6JA 1IRXA 2DTRA 2V9VA 3HC7A 3AG1H 2PN6A 2EH3A 2DYSH 3KYCB 1QU3A 4OAYA 4PGHA 5FGMA 4GFBA 3S15J 5CJ9A 3VYUB 2EBIA 4OMYA 4OMZA 1UB9A 2H27A 2NXNB 4AYBN 3EYYA 2L4MA 2MABA 4C9YA 4BXUA 3TMOA 3S2DJ 2J5PA 3WTUC 2L4AA 1FOXA 3D5SC 3O2PE 1JT6A 3OL3A 3I9V2 2O7OA 2FBIA 3HEFA 2KQRA 3FXRA 4A3GJ 2X1EA 1IRGA 2BVMA 2VBYA 1LDDA 3JRHA 3RKQA 1P2FA 2OF7A 3H3ZA 3UR3C 3PQKA 4KN4X 4A3EJ 1LE8B 2VKEA 1SMTA 1FYMA 2E1CA 5DM6F 5CVUA 2QVOA 3SEQA 3OYIA 1FOWA 2K5CA 3MKLA 2GOMA 1F1ZA 2E7XA 2HOEA 2GIZA 1SVMA 2K27A 4GXOA 5KCMA 1WSUA 2VOPA 2G9WA 3CP8A 2NNNA 2XPUA 4G94A 4A0ZA 3NWTA 1JTYA 3QPHA 5LHGA 2JZYA 2P6SA 5LBQA 1F4KA 4OIRF 3OYKA 1JHFA 1G2HA 2GLOA 5E1XA 2LREA 1QVUA 4BEHB 1HDDC 4E7IA 2XRNA 5J1YA 2IS6A 2NS7A 3MMYB 1ITYA 3NEUA 4FETA 3MEXA 2VKHA 3F9KA 3PO2J 4UY8I 3LSKA 1V5FA 4RGUA 4BY1J 1O3QA 1WWXA 4IHWA 2EZKA 1W5SA 2DA5A 4S0HB 3MN2A 4LJZF 3VB2A 1ZG3A 4WCGA 3BR1A 4RDUA 5H20A 2Z2SB 4J00A 4HDUA 2QSHX 4IRIA 4NQWA 2QENA 2MD0A 1XGOA 3EDPA 1HA8A 1VQKI 3GEZA 2YR2A 4A93J 3HHHA 2IW5A 1Y1VJ 2YPRA 2BW3B 3CQZJ 3L00A 2IGMA 2PI0A 4CCNA 2DA4A 5M3FJ 4A12A 3F8NA 3KIOA 2FA5A 1KYZA 4HNTA 2DFFA 2DA3A 1I39A 2A5YB 1UELB 4XLCA 2V4JC 2R5ZA 4RB0A 3RYRA 2VKVA 2BYVE 1Z77A 1VQPI 4PJNA 4BXXJ 1GXPA 3TQNA 2O6GE 2F5CA 2CH0A 4B3AA 3DPTA 1A5JA 2FBHA 1WI3A 2FRHA 4MEYF 4AU7A 5GAHJ 3FHZA 2DK8A 4IJAA 1BL0A 3KEYA 4EJWA 2XC7A 1TNSA 3LQRA 5H6QA 1IDYA 2X6XA 4DBRA 3I4NJ 2F5VA 3DTIA 3E1SA 1Y8RB 5D8LB 1JKQC 1RKTA 1Y0NA 4MFDA 4WXCA 1OPCA 3P5JA 2DA6A 1FP2A 2VJ5A 4B48A 3CCSI 2VT2A 5BMZA 1WKMA 1RC9A 4IHVA 2PJRB 2CO5A 3HM5A 3TO6A 1QVTA 5FLXZ 2PBIA 2X48A 3P9KA 3ULQB 4BBRJ 3OYGA 3CP2A 3QYFA 4XKVA 1YS7A 2F4OB 3HOTA 2UV1A 3EQLF 2HZDA 3R0JA 3GTJJ 4A3BJ 3PM1A 1QBJA 1FEXA 1AHDP 5L3FA 4F92B 3CMMA 4Q47A 5LFAA 4II2A 2JSCA 3LAJA 2CUJA 1P9QC 1ORKA 1W1WE 1LVKA 4IOAF 3JRIA 1NG7A 5DD8A 1WHUA 4XNFA 2A6EF 4KMFA 1OCRH 1HW2A 2E2HJ 4DW6A 3HTUA 2ZXIA 4MFEA 1ZRFA 4UB8C 3OYMA 3HOSA 2MSYA 3ELKA 4BBSJ 3ZMZA 1BR2A 1FMWA 3PQJA 5ERIA 2Q2EA 3HKZN 5ICCA 4RB1A 5HNHA 2OQGA 4G7ZF 4RM3A 4UUSB 3E5XA 5IY5H 3ZCOA 2KZVA 3CDHA 5FLXK 1TWGJ 1VQNI 2GXAA 1IAWA 3JAMZ 3GWZA 3U9GA 5GAEJ 2JSPA 3EYIA 2VB6A 2HDDA 1D0ZA 2OTJI 4I7HA 4JQFA 1EH8A 2ELHA 4OWRB 3CMAI 5KVRA 2L9VA 5J8CA 2JPBA 1ON2A 4GYIA 3OWTA 2Y9ZA 2ID3A 5L3DA 4NUBA 1JGGA 1D1CA 5E3OA 4CSWA 2M30A 2WB1A 1GUUA 1TTYA 4XQFA 1IRFA 2XUBA 1P7JA 2P6TA 5C44J 3JRCA 4CGZA 3IV5A 3S2WA 1BI2A 4YFXF 3CCYA 1CF7A 4BJ6C 2RV8A 2OQRA 2ZXHA 1FPQA 1Y56A 3DKYA 3CUQC 4LFUA 3RPUA 4BGDA 3PIOF 3CF2A 2O3FA 1UMQA 3OYHA 3SFZA 2L01A 4HV6A 1OCTC 4YIRX 3CCUI 4PJJA 2A5WA 2FEZA 2HPIA 3BJOA 1B4AA 2HQ5A 3K1NA 1RI7A 1QHGA 3KFWX 5EG0B 3OIPA 2DDBA 5D4SA 1Z6RA 3SYTA 4EGYA 2DMNA 3GZNB 1ZK8A 2HPMA 2XGEA 1YS6A 3ASOH 3NRVA 3JRBA 1MGTA 1SD7A 2O5RA 2COBA 3VOEA 4XM3A 2JVHA 5D5VB 4LD5A 2L9NA 2A6HF 3E6BA 2OAZA 1IG7A 4DIQA 1J5YA 5FD5A 3J81Z 4EM2A 4PJLA 3RIRA 3S17J 4XIDA 2K9MA 4Z6YA 3BR3A 1FBQA 3OSGA 1SFEA 3N4MA 4BAYA 4PZJA 4CH7A 2ZKZA 1JI8A 2V1XA 1RIOH 2PG4A 2XHKA 4BJTA 2OTLI 3A01A 2VLAA 1OCOH 4LITA 3WHBA 2GZWA 4CCMA 3OSFA 4B3XA 3ESWB 4RAYA 2EV5A 4D5FA 1RKWA 5B1BH 5DUIA 2DJNA 3B73A 3IWFA 4KDPA 2CMPA 2ICWG 3I56I 4MEXF 1S29A 4DYCA 1ONVA 4E7KA 1I3QJ 1XDSA 5B66C 3VPRA 1ZHFA 2F4IA 5FFXA 3ZXSA 2BE5F 3EUHC 5C4XJ 3T0YA 2A07F 3QPLA 4BDYA 3HYIA 3QWLA 5M5YJ 3BLYA 5HDNA 4FTHA 1KZHA 3DBLB 3J81K 3IKTA 5J1UA 3PFYA 1FBSA 4RAFA 3S2HJ 1T95A 1WJ5A 4MTDA 3MKZA 1KQ9A 3ZQHA 2ETHA 2ZJPF 4PDKA 2CRGA 2FNAA 2AS5F 3HOYJ 2EK5A 2XPWA 2M8EA 4PJ0C 3GTLJ 1TWFJ 5DUKA 4ZYAA 4D9JA 4XOTA 3S1RJ 1Q1VA 1XTAA 5C4JJ 1GXQA 4HG2A 5DV5A 3ABUA 1F36A 2Z9OA 1TT5B 2W82A 1R71A 2L54A 4UNOA 1VQOI 2L9RA 3GFJA 2K9SA 1X2NA 4I02A 3M8JA 3L9FA 2H09A 4I01A 3M1EA 5J4VA 2VUMJ 1WQ2A 3MWMA 1UG2A 2XF6A 4MGRA 1RR7A 3S3MA 2V9KA 3TBIA 1YW8A 5EDNA 5D6FA 2ZMEA 3HPHA 2E7WA 2P81A 3H1CA 3QAHA 3R6SA 1KONA 4AIJA 2FXAA 5EEGA 2GWRA 1EV7A 4H0EA 3KZIC 4U7BA 5BS6A 3ZR8X 1OLTA 2NS8A 1N25A 1QNTA 2JA7J 3NWSA 1RPWA 1UG0A 1ZAOA 1W7PA 2BVLA 3CCVI 3RPUD 1R9TJ 2JA2A 5J3LA 4DYRA 2Y48A 1D5YA 1JUPA 2YU3A 3OYEA 4IEJA 2GM4A 3CMYA 2LKSA 4M73A 5JLXA 1FYLA 1GDTA 5E17F 1QGPA 3VSLA 3FK6A 1LUJB 5ILVA 3RKYA 1K79A 4OIQF 3KZYA 1W0TA 2K3PA 5K5OA 3LA7A 2FD5A 2CU7A 4A69C 4HNVA 2CQ7A 3K9TA 2JTVA 6PAXA 2VN2A 4BJ5C 3LOCA 4BU2A 2P0WA 4HLYA 5B3SH 3IRRA 2M0MA 4I6ZA 2I8DA 3F8BA 1O7FA 4BY7J 2VQGA 3WTYC 1MMNA 2BBYA 2NNYA 3TGNA 1R5ID 1LDKB 3G1OA 1H9TA 4AIKA 2RKHA 2F5FA 2CSOA 3I59A 1J59A 1EF4A 3K4BA 3KEQA 2ZO4A 5EZHA 4A5MA 2NYXA 1MMGA 1U0JA 4I76A 3DTEA 2HTJA 3E6MA 1YRNA 3GFLA 2WV1A 1AWCA 1O7LA 2W1OA 1ZRDA 2R7TA 2H94A 3IL2A 1T8IA 3X2QH 2XAJA 4N9IA 2CQXA 2EFNA 2R5ZB 3KP7A 4U87A 1V5EA 5BPDA 2PMZN 1MSEC 5LGTA 4M6VA 1XGMA 2QUFA 2HI3A 2F48A 1Z7LA 4RB2C 5IT9Z 4F7ZA
chains in the Genus database with same CATH topology
2IP2A 4ETSA 2QM3A 2EFQA 4UXNA 2L3DA 4G9YA 1RZ4A 2LNBA 1USSA 4XLNF 3FMSA 3F8MA 1YQAA 2Q0OA 3ZMSA 1IN8A 5D6EA 4AD9A 2IA0A 3TOAA 4EM1A 3F3XA 3KCCA 2KRFA 1AOYA 2HR3A 1IW7F 2R7FA 2ESHA 1HKSA 3HRSA 4UVCA 1BOAA 4CYDA 5IT9K 2A61A 3E97A 1ZLJA 1FBUA 1ZN2A 1Q1HA 2D45A 2LKPA 3QPTA 3V7RA 2IT0A 4EV0A 4YIFA 5F1RA 1QZZA 1UHWA 3KP6A 2KJBA 3T5XA 1ULYA 4ESBA 4L0ZB 2D2WA 2F5DA 1B59A 4BQAA 4LB5A 2MLGA 1XMKA 1K6OA 1CF7B 4IVNA 1BI0A 1U5TA 4BHPA 2KKOA 4I2OA 4Q5SF 4IF4A 4HW0A 3FZVA 4OIPF 5L3EA 3GFMA 3C1DA 1KU3A 3DQVC 3OOPA 2K7LA 5K5QA 3WTVC 1HSTA 1I6XA 5H6RA 3H3UA 4P96A 1FOKA 2V79A 2GXGA 2EV0A 1C0WA 2M45A 1S7AA 2W84A 3ZMVA 3KLOA 1R58A 3T1BA 2ISYA 1ZRCA 3Q9SA 3F8FA 1LDJA 2V6CA 4M9SA 4KIFA 4ASNA 5D5XB 1J75A 1USTA 3TDZC 3ZMDA 4YIIA 5LLQA 3MFKA 1ZG5A 3KP4A 3JTHA 1FT9A 4G6QA 1STZA 5KK1A 3HSRA 2MLKA 1L3LA 4ZYGA 3IKVA 2P7CB 1HW5A 1R36A 1XSXA 5CVJA 5ILUA 2V1UA 2EFWA 4P9FA 4WK8F 1QO0D 3L09A 2ZNYA 3RKXA 1YLFA 3U2RA 4UHTA 3VEPA 4EJUA 4BNCA 2GAUA 5F6FA 5LGUA 3ZQ7A 4R1HA 2FOKA 4OOIA 4HQMA 3WU1B 2V1DA 1PP8F 3CO7C 4P9UA 4FHTA 2VBWA 2DU9A 4A2UA 3V7CA 4CO8A 2ZMEB 2K4JA 2XKPA 4I09A 2STTA 5DD4A 2ADUA 3WTTC 3CLOA 1K7AA 4Q4ZF 4M9ZA 1W7PB 4QWQA 2XV4S 2W24A 3I0TA 1ZYRF 1XD7A 4GO1A 3DXJF 1PP7U 4L0YB 2QWWA 2M5WA 2RVCA 3K1PA 4KUMA 4GCVA 4JK1X 1FYKA 2OZUA 2MH9A 2O0YA 5E8GA 3KP2A 4KNYA 2DFIA 3GXOA 3Q5FA 3CTAA 3I58A 3LWFA 3I59B 1TLHB 2X0LA 3V8JA 3ECOA 3G3ZA 4KIGA 2J5OA 2LF7A 2EV6A 3BJ6A 2PFBA 1HSJA 2WTEA 5A2QZ 4O3MA 1O3TA 2K86A 3V8LA 2E1NA 1XDUA 1JHHA 2XASA 1WRJA 5FO5A 1EH7A 2QYOA 2CYYA 2DLLA 5J8FA 4HF2A 4AVPA 4HYEA 3V7SA 2QZ8A 3I5UA 4O5VA 5FFZA 4EGZA 1XGSA 3COAC 1JGSA 1IXRC 2EB7A 2VBXA 1YG2A 1OR7A 2PJPA 1TW3A 3E3VA 4OIOF 5TRDA 2LDUA 3BP8A 1BI3A 1KU7A 2OBPA 3BOQA 1XN7A 2ZBKA 2BEOA 4FX4A 1GVJA 1D8JA 1J9IA 1MKMA 1R22A 5HLIA 3PFIA 5HVQC 3MAJA 3GUDA 3L7WA 3F22A 3JAMK 2VC0A 1XCVA 4I0AA 4KA4A 3GYHX 1XCBA 1YTYA 5AIQA 2VE8A 1H0MA 1BIAA 2XAGA 4LG0A 4GYGA 4Q48A 4M74A 3BWGA 1U6GA 3FWEA 1UCRA 1PDNC 1XB4A 2VE9A 5JHUA 2EJRA 1YFHA 4IHTA 1P6RA 1MJBA 4LK1F 4ZZDA 4M72A 2DW4A 1EH6A 1WI9A 1MJAA 1U5TB 5AONA 4BH9A 1XGNA 4DQ2A 1BC7C 1UHMA 5BPIA 1OMIA 4IHSA 5CVVA 2STWA 3WU0A 1Z91A 3T8RA 1XSVA 4N0BA 2RC4A 1FSEA 2QQBA 4M71A 1ZLKA 3P9CA 2R3SA 5HDKA 1SFUA 1KQ0A 3I64A 4AIHA 3DV8A 3DEUA 1O57A 2XAHA 4FX0A 5TJJA 1LNWA 2EA2A 4LLLA 4U0VA 2DO7A 3WTSC 2JRTA 2YX7A 2M1BA 5AIPA 1RNLA 2B0LA 4XRFA 2DAOA 2GA2A 4BHBA 1SD4A 4BYYA 2MBFA 4UUVA 2COMA 3E6CC 1IN5A 4G6DA 1YYVA 2DQLA 2GQQA 3RJPA 2FMYA 3F21A 4ENKA 3WG9A 5JI6A 5IT3A 4Y15A 4L5JA 4OINF 1HBXG 4OU0A 4IXAA 4LB6B 3RI4A 3WGHA 1G6NA 4P55A 1ZG1A 1RUNA 4RS8A 3ZN1A 3KEOA 3SXYA 4P5OA 4U7DA 1HQCA 5HS8A 1L0OC 1P4AA 4CZZA 4IPAA 3I4PA 2OD5A 2CFXA 3T8TA 5E8IA 5JFRA 1TQIA 2RQPA 3RKWA 1P4XA 1QQIA 2QBYA 3E5QA 2VONA 1S6LA 3U1DA 1CGPA 1NHAA 1GHCA 3TOBA 2IJLA 1UFMA 1U8RA 1TQPA 2FBKA 2DBBA 4A6DA 2ACJA 1Z9CA 3HRMA 3KLNA 1I27A 1D8KA 3C18A 4BHCA 2A69F 1FC3A 2W57A 1RUOA 2ISZA 1I5ZA 3MZYA 3OV8A 1LQ1A 3BDDA 4HA8A 2EFPA 2DQRA 4CHUA 4HX4A 1MD0A 1TNTA 4KIBA 2JT1A 2RN7A 4MTEA 4ON0A 1R00A 1HW1A 3FF5A 4HF0A 2FQ3A 2GA1A 3GFIA 4M9XA 1H9GA 2G7HA 3B02A 2HS5A 5LGNA 2P7VB 1IN4A 5K5RA 1R1VA 1SMYF 5CYVA 3KE2A 3AAFA 1BI1A 2P5KA 1IXCA 4L18B 4L9VA 2PQ8A 2VXZA 2F5EA 5FB2A 1FLIA 4AWXB 4RGRA 1F5TA 2O8XA 1FNNA 1ZGAA 1HKTA 1QPMA 3BROA 1V4RA 5D8KB 2Q8KA 2YX4A 4DNCA 5CVRA 3CJNA 1KYWA 1D3YA 3KETA 2IVMA 4EMSA 2HEOA 1KU2A 3JSOA 4ENJA 3JW4A 1BJAA 1J0RA 3LQQA 1FX7A 2HQNA 4NHJA 2RDPA 2A3SA 2ESNA 3F8CA 4L9NA 2IRFG 1KA8A 3M9AA 3FM5A 2FSWA 4LG0B 3R4KA 5E1WA 5LHIA 4ZYEA 3WTWC 1IUYA 2WC2A 5HLGA 5K1YA 3R61A 5CLSA 4A0XA 5HS9A 3ROUA 4IRGA 3C3WA 3GO5A 1MDMA 5LRRA 1DPUA 2ZNZA 1LJ9A 1MJ9A 5LEJA 3CUQA 1OYIA 4ZH4F 2P5LC 1R5GA 4B09A 4HAMA 2GXBA 4HF1A 3L2CA 3QRFF 2HYFA 3HSFA 2NRAC 2ZFWA 4WWCA 3WE3A 2MA3A 1S8NA 3F23A 5L3BA 4CXFA 4PCQA 1ZARA 3RTRA 3SZPA 2FMLA 2JPCA 2IA2A 2HTSA 3G73A 1BN5A 3ZN0A 3KP3A 2Z99A 4GGGA 3ZMTA 4XLPF 1YW7A 4RGXA 1DPRA 2TDXA 2QLZA 4LGWA 4EM0B 3W6KB 4G8XA 4ZZLA 3F72A 2RNJA 4A6EA 3GW2A 2VOOA 2QQ9A 4LMYA 1DDNA 4HV5A 2KIUA 3WTXC 2DPDA 3R60A 3EUHA 4ENMA 5LEKA 1T6SA 2R7DA 2IA1A 2HKXA 3KZZA 1U2WA 2MD5A 1FP1D 3BJAA 2EA4A 4MHGA 1VTNC 2Z3YA 3DF8A 2HQRA 4UVAA 1U3EM 2FU4A 4IRHA 2EWNA 4HDVA 2DPUA 2UXXA 3QP5A 1OYWA 3DP7A 3WTZA 4A5NA 2D1VA 1T2KA 4WXDA 1LEAA 4G7OF 2XGXA 4EVIA 4KMUX 4Y13A 3BPXA 1G3WA 2CQKA 1OKRA 4KFCA 3JTGA 2K4BA 2CG4A 1SFXA 3DPLC 3MCZA 4G7HF 2DT5A 2WWYA 2NS0A 1W5TA 3VODA 4RGSA 5E18F 1XMAA 2PMHA 5DCFA 1O3RA 4N9HA 1B1BA 2ZXJA 3ML6A 1Z6TA 2QBYB 4CDGA 5JVTA 5D5UB 4NB5A 2DK5A 4M6XA 3LA3A 4UVBA 3E5UA 5HDGA 1J7KA 2VODA 2PEXA 5HS7A 2CWEA 5DCMA 1O3SA 4HX7A 2HWVA 2HFHA 2XAFA 3W6JB 1G3SA 4CICA 3J80Z 2BGCA 4MQVA 2CW0F 1SAXA 3Q9VA 3BZ6A 2C6YA 3NQOA 2XAQA 1U5TC 5D5WB 1BC8C 4HZFA 4JBAA 1S3JA 1DP7P 3GVAA 5A2QK 2H6CA 4UV9A 2DI3A 1Z05A 2NAZA 2XIGA 3F6OA 2HYGD 1K78A 2VBZA 4U0YA 3MZHA 3HRTA 1BBYA 2HDCA 2IPQX 3FM3A 4KYWA 3J80K 3D5LA 4L5IA 1V3FA 5EEHA 4KICA 3QU3A 4EQQA 3ZMUA 1F9NA 2O61A 3TDUC 2AXLA 4ESFA 3HTSB 1TW2A 2ZCWA 3FMRA 3WODF 2A68F 2WV0A 1DUXC 3TO9A 2BV6A 3K0LA 1LB2A 1TQMA 5E20A 3QOPA 3VFZA 1REPC 2OZ6A 4MNUA 2HKOA 4ENNA 1R5HA 3FXQA 3N97A 1IF1A 1LVAA 2Y0MA 5L3GA 4Z2YA 3GF2A 4R79A 5HOOA 2W85A 2W25A 3QU6A 3K1MA 3FX3A 3P7NA 2UWMA 1G4DA 3BY6A 4MQ9F 3FXUA 3V8KA 1G3YA 5DEQA 4L9JA 3WGGA 5F64A 5LRSA 2O03A 3I54A 3DFGA 1W4MA 3O6BB 3RPQA 1YW9A 2Y75A 4U0WA 5DYMA 3ERED 4A0YA 4RAZA 5JR3A 3HSEA 1MDMB 3HUGA 3CUQB 3GLXA 5ICFA 3ABTA 1IZ1A 1P92A 2P5VA 2HZTA 5E1ZB 3P9IA 2Z5UA 1R1TA 1YIOA 3ISPA 4ZYDA 2F2EA 1D5VA 3K69A 3GX4X 3REOA 3HIFA 3ECHA 3H92A 2LF8A 3CO6C 2Z33A 3D0SA 2FNPA 4S05A 2UXNA 2VC1A 5LHHA 5ICEA 1IXSB 3LSTA 3MQ0A 5J6XA 4HBLA 4S04A 1KQ8A 2UZKA 2KIFA 3QP6A 3RDIA 4LLGF 1A04A 4KN7X 3I71A 3R0AA 2X4HA 1G3TA 5ED4A 4XSXF 4ZYHA 1TBXA 5BOXA 3IC7A 2LSOA 3IHUA 5D4RA 2EFOA 4ESJA 1KGSA 2PMUA 1ZH5A 3HHGA 4WF2A 4L9TA 3CUOA 2ZJ2A 3JSPA 1JXSA 1FSHA 3GZ5A 1ZREA 1MZBA 1I1GA 2QQAA 4Y17A 1SD6A 2MH2A 1KU9A 3K2ZA 1X3UA 3M7GA 1BM9A 1I1SA 4EJOA 3SHFA 1OYYA 4WX9A 3KP5A 4PGGA 1PUEE 3E6DA 3ZP5A 2PLYA 3LAPA 1T38A 1B9MA 2XROA 1YO5C 2XVCA 3ZPLA 1ON1A 4KT5C 2FE3A 3EETA 2P8TA 4I0BA 3BPVA 3TKYA 1P4WA 3LFKA 4HX8A 3SZTA 1Z7UA 2P4WA 4HLXA 1FY7A 1JE8A 1HKQA 4QLCU 1QZYA 5HLHA 2GIVA 3V4GA 2XKOA 1J2XA 3C7JA 3TO7A 1LEBA 3HRUA 4HQEA 2KIMA 4U88A 4YFKF 1IN7A 4YFNF 3O3KA 2M87A 5DCMB 5FD6A 1ZGJA 1T39A 4RB3C 2OA4A 3FMQA 1XSDA 4EJVA 1IN6A 4E70A 5ICGA 3IWZA 4M6YA 3RYPA 4LK0F 1T0FA 1U78A 1R23A 4EJTA 2K02A 4R8HA 3LA2A 4TV7A 4XBFA 2D1HA 1W7PD 5DDGA 2HGCA 4D0PA 2VT3A 4LLNA 5CVIA 1K78B 1R7JA 2L02A 2OU2A 3I53A 3GZ6A 5BQTA 2RGVA 1T98A 3IRQA 4YG2F 4B8XA 2G7UA 3DKWA 1E2XA 3WGIA 1SD5A 2CGPA 3WE2A 1ODDA 2YSRA 5L3CA 1FWZA 1S7OA 1Y0UA 3J7AO 4K2EA 1FZPB 2H6BA 3M8EA 4FT8A 1B6AA 1R1UA 2KJCA 3M8FA 1Z1DA 3F6VA 1B9NA 4UV8A 2FF4A 4I98B 3SQNA 4WXHA 2MC3A 1E17A 5ILSA 4HOBA 4XSZF 1BIBA 1HXDA 4O6JA 2DTRA 2V9VA 2PN6A 4PGHA 5FGMA 5CJ9A 4OMYA 4OMZA 1UB9A 2H27A 3EYYA 2L4MA 4BXUA 2J5PA 3WTUC 2L4AA 3O2PE 2FBIA 3FXRA 1IRGA 2VBYA 1LDDA 1P2FA 3H3ZA 3PQKA 4KN4X 1FYMA 1SMTA 2E1CA 5CVUA 2QVOA 1F1ZA 2E7XA 2HOEA 1WSUA 2K27A 4GXOA 2VOPA 2G9WA 2NNNA 4G94A 4A0ZA 3QPHA 5LHGA 2JZYA 2P6SA 5LBQA 1F4KA 4OIRF 1JHFA 5E1XA 2XRNA 3NEUA 3MEXA 4RGUA 1O3QA 1WWXA 1W5SA 4LJZF 3VB2A 1ZG3A 4WCGA 5H20A 4HDUA 4IRIA 4NQWA 2QENA 1XGOA 3EDPA 3GEZA 2YR2A 3HHHA 2IW5A 2YPRA 3L00A 2PI0A 4A12A 3F8NA 2FA5A 1KYZA 2A5YB 4RB0A 3RYRA 2BYVE 1GXPA 3TQNA 2O6GE 2F5CA 3DPTA 2FBHA 2FRHA 4MEYF 3FHZA 2DK8A 4IJAA 4EJWA 1TNSA 3LQRA 5H6QA 5D8LB 4WXCA 1OPCA 1FP2A 5BMZA 2VT2A 1WKMA 2CO5A 3TO6A 5FLXZ 2PBIA 3P9KA 3ULQB 3HOTA 1YS7A 3EQLF 3R0JA 1QBJA 5L3FA 4Q47A 2JSCA 3LAJA 5DD8A 2A6EF 4KMFA 1HW2A 3HTUA 1ZRFA 3HOSA 3ELKA 3ZMZA 3PQJA 5ERIA 2Q2EA 5ICCA 4RB1A 2OQGA 4G7ZF 3E5XA 3CDHA 5FLXK 1IAWA 3JAMZ 3GWZA 3U9GA 3EYIA 4I7HA 4JQFA 1EH8A 2ELHA 5KVRA 5J8CA 2JPBA 1ON2A 4GYIA 5L3DA 2M30A 1TTYA 1IRFA 2XUBA 2P6TA 4CGZA 3S2WA 1BI2A 4YFXF 1CF7A 2RV8A 2OQRA 1FPQA 4LFUA 3CUQC 3RPUA 2O3FA 3SFZA 2L01A 4HV6A 2FEZA 3BJOA 1B4AA 3K1NA 1RI7A 3KFWX 5D4SA 1Z6RA 4EGYA 1YS6A 3NRVA 1MGTA 1SD7A 3VOEA 5D5VB 4LD5A 2A6HF 3E6BA 2OAZA 3J81Z 1J5YA 5FD5A 4EM2A 3RIRA 1FBQA 1SFEA 3N4MA 4BAYA 4PZJA 2ZKZA 2V1XA 1RIOH 2PG4A 2XHKA 2GZWA 4RAYA 2EV5A 5DUIA 3B73A 3IWFA 4KDPA 4MEXF 1S29A 1ONVA 1XDSA 1ZHFA 5FFXA 2BE5F 3T0YA 2A07F 3HYIA 5HDNA 3J81K 3IKTA 1FBSA 4MTDA 1KQ9A 2ETHA 4PDKA 2FNAA 2AS5F 2EK5A 2M8EA 5DUKA 1GXQA 5DV5A 3ABUA 2Z9OA 2L54A 4UNOA 3GFJA 4I02A 3L9FA 2H09A 4I01A 3M1EA 1WQ2A 3MWMA 4MGRA 1YW8A 5D6FA 2ZMEA 2E7WA 3QAHA 3R6SA 4AIJA 2FXAA 5EEGA 2GWRA 1EV7A 4H0EA 4U7BA 5BS6A 1QNTA 1ZAOA 1W7PA 2Y48A 2YU3A 4M73A 1FYLA 5E17F 1QGPA 5ILVA 3RKYA 1K79A 4OIQF 3KZYA 5K5OA 3LA7A 3K9TA 2JTVA 6PAXA 2VN2A 4HLYA 3IRRA 3F8BA 1O7FA 3WTYC 2BBYA 2NNYA 3TGNA 1LDKB 1H9TA 4AIKA 2RKHA 2F5FA 2CSOA 3I59A 1J59A 3KEQA 2ZO4A 4A5MA 2NYXA 2HTJA 3E6MA 3GFLA 1AWCA 1O7LA 1ZRDA 2H94A 3IL2A 2XAJA 4N9IA 2EFNA 3KP7A 5BPDA 5LGTA 1XGMA 2QUFA 4RB2C 5IT9Z 4F7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IP2 A;  4ETS A;  2QM3 A;  2EFQ A;  4UXN A;  2L3D A;  4G9Y A;  1RZ4 A;  2LNB A;  1USS A;  4XLN F;  3FMS A;  3F8M A;  1YQA A;  2Q0O A;  3ZMS A;  1IN8 A;  5D6E A;  4AD9 A;  2IA0 A;  3TOA A;  4EM1 A;  3F3X A;  3KCC A;  2KRF A;  1AOY A;  2HR3 A;  1IW7 F;  2R7F A;  2ESH A;  1HKS A;  3HRS A;  4UVC A;  1BOA A;  4CYD A;  5IT9 K;  2A61 A;  3E97 A;  1ZLJ A;  1FBU A;  1ZN2 A;  1Q1H A;  2D45 A;  2LKP A;  3QPT A;  3V7R A;  2IT0 A;  4EV0 A;  4YIF A;  5F1R A;  1QZZ A;  1UHW A;  3KP6 A;  2KJB A;  3T5X A;  1ULY A;  4ESB A;  4L0Z B;  2D2W A;  2F5D A;  1B59 A;  4BQA A;  4LB5 A;  2MLG A;  1XMK A;  1K6O A;  1CF7 B;  4IVN A;  1BI0 A;  1U5T A;  4BHP A;  2KKO A;  4I2O A;  4Q5S F;  4IF4 A;  4HW0 A;  3FZV A;  4OIP F;  5L3E A;  3GFM A;  3C1D A;  1KU3 A;  3DQV C;  3OOP A;  2K7L A;  5K5Q A;  3WTV C;  1HST A;  1I6X A;  5H6R A;  3H3U A;  4P96 A;  1FOK A;  2V79 A;  2GXG A;  2EV0 A;  1C0W A;  2M45 A;  1S7A A;  2W84 A;  3ZMV A;  3KLO A;  1R58 A;  3T1B A;  2ISY A;  1ZRC A;  3Q9S A;  3F8F A;  1LDJ A;  2V6C A;  4M9S A;  4KIF A;  4ASN A;  5D5X B;  1J75 A;  1UST A;  3TDZ C;  3ZMD A;  4YII A;  5LLQ A;  3MFK A;  1ZG5 A;  3KP4 A;  3JTH A;  1FT9 A;  4G6Q A;  1STZ A;  5KK1 A;  3HSR A;  2MLK A;  1L3L A;  4ZYG A;  3IKV A;  2P7C B;  1HW5 A;  1R36 A;  1XSX A;  5CVJ A;  5ILU A;  2V1U A;  2EFW A;  4P9F A;  4WK8 F;  1QO0 D;  3L09 A;  2ZNY A;  3RKX A;  1YLF A;  3U2R A;  4UHT A;  3VEP A;  4EJU A;  4BNC A;  2GAU A;  5F6F A;  5LGU A;  3ZQ7 A;  4R1H A;  2FOK A;  4OOI A;  4HQM A;  3WU1 B;  2V1D A;  1PP8 F;  3CO7 C;  4P9U A;  4FHT A;  2VBW A;  2DU9 A;  4A2U A;  3V7C A;  4CO8 A;  2ZME B;  2K4J A;  2XKP A;  4I09 A;  2STT A;  5DD4 A;  2ADU A;  3WTT C;  3CLO A;  1K7A A;  4Q4Z F;  4M9Z A;  1W7P B;  4QWQ A;  2XV4 S;  2W24 A;  3I0T A;  1ZYR F;  1XD7 A;  4GO1 A;  3DXJ F;  1PP7 U;  4L0Y B;  2QWW A;  2M5W A;  2RVC A;  3K1P A;  4KUM A;  4GCV A;  4JK1 X;  1FYK A;  2OZU A;  2MH9 A;  2O0Y A;  5E8G A;  3KP2 A;  4KNY A;  2DFI A;  3GXO A;  3Q5F A;  3CTA A;  3I58 A;  3LWF A;  3I59 B;  1TLH B;  2X0L A;  3V8J A;  3ECO A;  3G3Z A;  4KIG A;  2J5O A;  2LF7 A;  2EV6 A;  3BJ6 A;  2PFB A;  1HSJ A;  2WTE A;  5A2Q Z;  4O3M A;  1O3T A;  2K86 A;  3V8L A;  2E1N A;  1XDU A;  1JHH A;  2XAS A;  1WRJ A;  5FO5 A;  1EH7 A;  2QYO A;  2CYY A;  2DLL A;  5J8F A;  4HF2 A;  4AVP A;  4HYE A;  3V7S A;  2QZ8 A;  3I5U A;  4O5V A;  5FFZ A;  4EGZ A;  1XGS A;  3COA C;  1JGS A;  1IXR C;  2EB7 A;  2VBX A;  1YG2 A;  1OR7 A;  2PJP A;  1TW3 A;  3E3V A;  4OIO F;  5TRD A;  2LDU A;  3BP8 A;  1BI3 A;  1KU7 A;  2OBP A;  3BOQ A;  1XN7 A;  2ZBK A;  2BEO A;  4FX4 A;  1GVJ A;  1D8J A;  1J9I A;  1MKM A;  1R22 A;  5HLI A;  3PFI A;  5HVQ C;  3MAJ A;  3GUD A;  3L7W A;  3F22 A;  3JAM K;  2VC0 A;  1XCV A;  4I0A A;  4KA4 A;  3GYH X;  1XCB A;  1YTY A;  5AIQ A;  2VE8 A;  1H0M A;  1BIA A;  2XAG A;  4LG0 A;  4GYG A;  4Q48 A;  4M74 A;  3BWG A;  1U6G A;  3FWE A;  1UCR A;  1PDN C;  1XB4 A;  2VE9 A;  5JHU A;  2EJR A;  1YFH A;  4IHT A;  1P6R A;  1MJB A;  4LK1 F;  4ZZD A;  4M72 A;  2DW4 A;  1EH6 A;  1WI9 A;  1MJA A;  1U5T B;  5AON A;  4BH9 A;  1XGN A;  4DQ2 A;  1BC7 C;  1UHM A;  5BPI A;  1OMI A;  4IHS A;  5CVV A;  2STW A;  3WU0 A;  1Z91 A;  3T8R A;  1XSV A;  4N0B A;  2RC4 A;  1FSE A;  2QQB A;  4M71 A;  1ZLK A;  3P9C A;  2R3S A;  5HDK A;  1SFU A;  1KQ0 A;  3I64 A;  4AIH A;  3DV8 A;  3DEU A;  1O57 A;  2XAH A;  4FX0 A;  5TJJ A;  1LNW A;  2EA2 A;  4LLL A;  4U0V A;  2DO7 A;  3WTS C;  2JRT A;  2YX7 A;  2M1B A;  5AIP A;  1RNL A;  2B0L A;  4XRF A;  2DAO A;  2GA2 A;  4BHB A;  1SD4 A;  4BYY A;  2MBF A;  4UUV A;  2COM A;  3E6C C;  1IN5 A;  4G6D A;  1YYV A;  2DQL A;  2GQQ A;  3RJP A;  2FMY A;  3F21 A;  4ENK A;  3WG9 A;  5JI6 A;  5IT3 A;  4Y15 A;  4L5J A;  4OIN F;  1HBX G;  4OU0 A;  4IXA A;  4LB6 B;  3RI4 A;  3WGH A;  1G6N A;  4P55 A;  1ZG1 A;  1RUN A;  4RS8 A;  3ZN1 A;  3KEO A;  3SXY A;  4P5O A;  4U7D A;  1HQC A;  5HS8 A;  1L0O C;  1P4A A;  4CZZ A;  4IPA A;  3I4P A;  2OD5 A;  2CFX A;  3T8T A;  5E8I A;  5JFR A;  1TQI A;  2RQP A;  3RKW A;  1P4X A;  1QQI A;  2QBY A;  3E5Q A;  2VON A;  1S6L A;  3U1D A;  1CGP A;  1NHA A;  1GHC A;  3TOB A;  2IJL A;  1UFM A;  1U8R A;  1TQP A;  2FBK A;  2DBB A;  4A6D A;  2ACJ A;  1Z9C A;  3HRM A;  3KLN A;  1I27 A;  1D8K A;  3C18 A;  4BHC A;  2A69 F;  1FC3 A;  2W57 A;  1RUO A;  2ISZ A;  1I5Z A;  3MZY A;  3OV8 A;  1LQ1 A;  3BDD A;  4HA8 A;  2EFP A;  2DQR A;  4CHU A;  4HX4 A;  1MD0 A;  1TNT A;  4KIB A;  2JT1 A;  2RN7 A;  4MTE A;  4ON0 A;  1R00 A;  1HW1 A;  3FF5 A;  4HF0 A;  2FQ3 A;  2GA1 A;  3GFI A;  4M9X A;  1H9G A;  2G7H A;  3B02 A;  2HS5 A;  5LGN A;  2P7V B;  1IN4 A;  5K5R A;  1R1V A;  1SMY F;  5CYV A;  3KE2 A;  3AAF A;  1BI1 A;  2P5K A;  1IXC A;  4L18 B;  4L9V A;  2PQ8 A;  2VXZ A;  2F5E A;  5FB2 A;  1FLI A;  4AWX B;  4RGR A;  1F5T A;  2O8X A;  1FNN A;  1ZGA A;  1HKT A;  1QPM A;  3BRO A;  1V4R A;  5D8K B;  2Q8K A;  2YX4 A;  4DNC A;  5CVR A;  3CJN A;  1KYW A;  1D3Y A;  3KET A;  2IVM A;  4EMS A;  2HEO A;  1KU2 A;  3JSO A;  4ENJ A;  3JW4 A;  1BJA A;  1J0R A;  3LQQ A;  1FX7 A;  2HQN A;  4NHJ A;  2RDP A;  2A3S A;  2ESN A;  3F8C A;  4L9N A;  2IRF G;  1KA8 A;  3M9A A;  3FM5 A;  2FSW A;  4LG0 B;  3R4K A;  5E1W A;  5LHI A;  4ZYE A;  3WTW C;  1IUY A;  2WC2 A;  5HLG A;  5K1Y A;  3R61 A;  5CLS A;  4A0X A;  5HS9 A;  3ROU A;  4IRG A;  3C3W A;  3GO5 A;  1MDM A;  5LRR A;  1DPU A;  2ZNZ A;  1LJ9 A;  1MJ9 A;  5LEJ A;  3CUQ A;  1OYI A;  4ZH4 F;  2P5L C;  1R5G A;  4B09 A;  4HAM A;  2GXB A;  4HF1 A;  3L2C A;  3QRF F;  2HYF A;  3HSF A;  2NRA C;  2ZFW A;  4WWC A;  3WE3 A;  2MA3 A;  1S8N A;  3F23 A;  5L3B A;  4CXF A;  4PCQ A;  1ZAR A;  3RTR A;  3SZP A;  2FML A;  2JPC A;  2IA2 A;  2HTS A;  3G73 A;  1BN5 A;  3ZN0 A;  3KP3 A;  2Z99 A;  4GGG A;  3ZMT A;  4XLP F;  1YW7 A;  4RGX A;  1DPR A;  2TDX A;  2QLZ A;  4LGW A;  4EM0 B;  3W6K B;  4G8X A;  4ZZL A;  3F72 A;  2RNJ A;  4A6E A;  3GW2 A;  2VOO A;  2QQ9 A;  4LMY A;  1DDN A;  4HV5 A;  2KIU A;  3WTX C;  2DPD A;  3R60 A;  3EUH A;  4ENM A;  5LEK A;  1T6S A;  2R7D A;  2IA1 A;  2HKX A;  3KZZ A;  1U2W A;  2MD5 A;  1FP1 D;  3BJA A;  2EA4 A;  4MHG A;  1VTN C;  2Z3Y A;  3DF8 A;  2HQR A;  4UVA A;  1U3E M;  2FU4 A;  4IRH A;  2EWN A;  4HDV A;  2DPU A;  2UXX A;  3QP5 A;  1OYW A;  3DP7 A;  3WTZ A;  4A5N A;  2D1V A;  1T2K A;  4WXD A;  1LEA A;  4G7O F;  2XGX A;  4EVI A;  4KMU X;  4Y13 A;  3BPX A;  1G3W A;  2CQK A;  1OKR A;  4KFC A;  3JTG A;  2K4B A;  2CG4 A;  1SFX A;  3DPL C;  3MCZ A;  4G7H F;  2DT5 A;  2WWY A;  2NS0 A;  1W5T A;  3VOD A;  4RGS A;  5E18 F;  1XMA A;  2PMH A;  5DCF A;  1O3R A;  4N9H A;  1B1B A;  2ZXJ A;  3ML6 A;  1Z6T A;  2QBY B;  4CDG A;  5JVT A;  5D5U B;  4NB5 A;  2DK5 A;  4M6X A;  3LA3 A;  4UVB A;  3E5U A;  5HDG A;  1J7K A;  2VOD A;  2PEX A;  5HS7 A;  2CWE A;  5DCM A;  1O3S A;  4HX7 A;  2HWV A;  2HFH A;  2XAF A;  3W6J B;  1G3S A;  4CIC A;  3J80 Z;  2BGC A;  4MQV A;  2CW0 F;  1SAX A;  3Q9V A;  3BZ6 A;  2C6Y A;  3NQO A;  2XAQ A;  1U5T C;  5D5W B;  1BC8 C;  4HZF A;  4JBA A;  1S3J A;  1DP7 P;  3GVA A;  5A2Q K;  2H6C A;  4UV9 A;  2DI3 A;  1Z05 A;  2NAZ A;  2XIG A;  3F6O A;  2HYG D;  1K78 A;  2VBZ A;  4U0Y A;  3MZH A;  3HRT A;  1BBY A;  2HDC A;  2IPQ X;  3FM3 A;  4KYW A;  3J80 K;  3D5L A;  4L5I A;  1V3F A;  5EEH A;  4KIC A;  3QU3 A;  4EQQ A;  3ZMU A;  1F9N A;  2O61 A;  3TDU C;  2AXL A;  4ESF A;  3HTS B;  1TW2 A;  2ZCW A;  3FMR A;  3WOD F;  2A68 F;  2WV0 A;  1DUX C;  3TO9 A;  2BV6 A;  3K0L A;  1LB2 A;  1TQM A;  5E20 A;  3QOP A;  3VFZ A;  1REP C;  2OZ6 A;  4MNU A;  2HKO A;  4ENN A;  1R5H A;  3FXQ A;  3N97 A;  1IF1 A;  1LVA A;  2Y0M A;  5L3G A;  4Z2Y A;  3GF2 A;  4R79 A;  5HOO A;  2W85 A;  2W25 A;  3QU6 A;  3K1M A;  3FX3 A;  3P7N A;  2UWM A;  1G4D A;  3BY6 A;  4MQ9 F;  3FXU A;  3V8K A;  1G3Y A;  5DEQ A;  4L9J A;  3WGG A;  5F64 A;  5LRS A;  2O03 A;  3I54 A;  3DFG A;  1W4M A;  3O6B B;  3RPQ A;  1YW9 A;  2Y75 A;  4U0W A;  5DYM A;  3ERE D;  4A0Y A;  4RAZ A;  5JR3 A;  3HSE A;  1MDM B;  3HUG A;  3CUQ B;  3GLX A;  5ICF A;  3ABT A;  1IZ1 A;  1P92 A;  2P5V A;  2HZT A;  5E1Z B;  3P9I A;  2Z5U A;  1R1T A;  1YIO A;  3ISP A;  4ZYD A;  2F2E A;  1D5V A;  3K69 A;  3GX4 X;  3REO A;  3HIF A;  3ECH A;  3H92 A;  2LF8 A;  3CO6 C;  2Z33 A;  3D0S A;  2FNP A;  4S05 A;  2UXN A;  2VC1 A;  5LHH A;  5ICE A;  1IXS B;  3LST A;  3MQ0 A;  5J6X A;  4HBL A;  4S04 A;  1KQ8 A;  2UZK A;  2KIF A;  3QP6 A;  3RDI A;  4LLG F;  1A04 A;  4KN7 X;  3I71 A;  3R0A A;  2X4H A;  1G3T A;  5ED4 A;  4XSX F;  4ZYH A;  1TBX A;  5BOX A;  3IC7 A;  2LSO A;  3IHU A;  5D4R A;  2EFO A;  4ESJ A;  1KGS A;  2PMU A;  1ZH5 A;  3HHG A;  4WF2 A;  4L9T A;  3CUO A;  2ZJ2 A;  3JSP A;  1JXS A;  1FSH A;  3GZ5 A;  1ZRE A;  1MZB A;  1I1G A;  2QQA A;  4Y17 A;  1SD6 A;  2MH2 A;  1KU9 A;  3K2Z A;  1X3U A;  3M7G A;  1BM9 A;  1I1S A;  4EJO A;  3SHF A;  1OYY A;  4WX9 A;  3KP5 A;  4PGG A;  1PUE E;  3E6D A;  3ZP5 A;  2PLY A;  3LAP A;  1T38 A;  1B9M A;  2XRO A;  1YO5 C;  2XVC A;  3ZPL A;  1ON1 A;  4KT5 C;  2FE3 A;  3EET A;  2P8T A;  4I0B A;  3BPV A;  3TKY A;  1P4W A;  3LFK A;  4HX8 A;  3SZT A;  1Z7U A;  2P4W A;  4HLX A;  1FY7 A;  1JE8 A;  1HKQ A;  4QLC U;  1QZY A;  5HLH A;  2GIV A;  3V4G A;  2XKO A;  1J2X A;  3C7J A;  3TO7 A;  1LEB A;  3HRU A;  4HQE A;  2KIM A;  4U88 A;  4YFK F;  1IN7 A;  4YFN F;  3O3K A;  2M87 A;  5DCM B;  5FD6 A;  1ZGJ A;  1T39 A;  4RB3 C;  2OA4 A;  3FMQ A;  1XSD A;  4EJV A;  1IN6 A;  4E70 A;  5ICG A;  3IWZ A;  4M6Y A;  3RYP A;  4LK0 F;  1T0F A;  1U78 A;  1R23 A;  4EJT A;  2K02 A;  4R8H A;  3LA2 A;  4TV7 A;  4XBF A;  2D1H A;  1W7P D;  5DDG A;  2HGC A;  4D0P A;  2VT3 A;  4LLN A;  5CVI A;  1K78 B;  1R7J A;  2L02 A;  2OU2 A;  3I53 A;  3GZ6 A;  5BQT A;  2RGV A;  1T98 A;  3IRQ A;  4YG2 F;  4B8X A;  2G7U A;  3DKW A;  1E2X A;  3WGI A;  1SD5 A;  2CGP A;  3WE2 A;  1ODD A;  2YSR A;  5L3C A;  1FWZ A;  1S7O A;  1Y0U A;  3J7A O;  4K2E A;  1FZP B;  2H6B A;  3M8E A;  4FT8 A;  1B6A A;  1R1U A;  2KJC A;  3M8F A;  1Z1D A;  3F6V A;  1B9N A;  4UV8 A;  2FF4 A;  4I98 B;  3SQN A;  4WXH A;  2MC3 A;  1E17 A;  5ILS A;  4HOB A;  4XSZ F;  1BIB A;  1HXD A;  4O6J A;  2DTR A;  2V9V A;  2PN6 A;  4PGH A;  5FGM A;  5CJ9 A;  4OMY A;  4OMZ A;  1UB9 A;  2H27 A;  3EYY A;  2L4M A;  4BXU A;  2J5P A;  3WTU C;  2L4A A;  3O2P E;  2FBI A;  3FXR A;  1IRG A;  2VBY A;  1LDD A;  1P2F A;  3H3Z A;  3PQK A;  4KN4 X;  1FYM A;  1SMT A;  2E1C A;  5CVU A;  2QVO A;  1F1Z A;  2E7X A;  2HOE A;  1WSU A;  2K27 A;  4GXO A;  2VOP A;  2G9W A;  2NNN A;  4G94 A;  4A0Z A;  3QPH A;  5LHG A;  2JZY A;  2P6S A;  5LBQ A;  1F4K A;  4OIR F;  1JHF A;  5E1X A;  2XRN A;  3NEU A;  3MEX A;  4RGU A;  1O3Q A;  1WWX A;  1W5S A;  4LJZ F;  3VB2 A;  1ZG3 A;  4WCG A;  5H20 A;  4HDU A;  4IRI A;  4NQW A;  2QEN A;  1XGO A;  3EDP A;  3GEZ A;  2YR2 A;  3HHH A;  2IW5 A;  2YPR A;  3L00 A;  2PI0 A;  4A12 A;  3F8N A;  2FA5 A;  1KYZ A;  2A5Y B;  4RB0 A;  3RYR A;  2BYV E;  1GXP A;  3TQN A;  2O6G E;  2F5C A;  3DPT A;  2FBH A;  2FRH A;  4MEY F;  3FHZ A;  2DK8 A;  4IJA A;  4EJW A;  1TNS A;  3LQR A;  5H6Q A;  5D8L B;  4WXC A;  1OPC A;  1FP2 A;  5BMZ A;  2VT2 A;  1WKM A;  2CO5 A;  3TO6 A;  5FLX Z;  2PBI A;  3P9K A;  3ULQ B;  3HOT A;  1YS7 A;  3EQL F;  3R0J A;  1QBJ A;  5L3F A;  4Q47 A;  2JSC A;  3LAJ A;  5DD8 A;  2A6E F;  4KMF A;  1HW2 A;  3HTU A;  1ZRF A;  3HOS A;  3ELK A;  3ZMZ A;  3PQJ A;  5ERI A;  2Q2E A;  5ICC A;  4RB1 A;  2OQG A;  4G7Z F;  3E5X A;  3CDH A;  5FLX K;  1IAW A;  3JAM Z;  3GWZ A;  3U9G A;  3EYI A;  4I7H A;  4JQF A;  1EH8 A;  2ELH A;  5KVR A;  5J8C A;  2JPB A;  1ON2 A;  4GYI A;  5L3D A;  2M30 A;  1TTY A;  1IRF A;  2XUB A;  2P6T A;  4CGZ A;  3S2W A;  1BI2 A;  4YFX F;  1CF7 A;  2RV8 A;  2OQR A;  1FPQ A;  4LFU A;  3CUQ C;  3RPU A;  2O3F A;  3SFZ A;  2L01 A;  4HV6 A;  2FEZ A;  3BJO A;  1B4A A;  3K1N A;  1RI7 A;  3KFW X;  5D4S A;  1Z6R A;  4EGY A;  1YS6 A;  3NRV A;  1MGT A;  1SD7 A;  3VOE A;  5D5V B;  4LD5 A;  2A6H F;  3E6B A;  2OAZ A;  3J81 Z;  1J5Y A;  5FD5 A;  4EM2 A;  3RIR A;  1FBQ A;  1SFE A;  3N4M A;  4BAY A;  4PZJ A;  2ZKZ A;  2V1X A;  1RIO H;  2PG4 A;  2XHK A;  2GZW A;  4RAY A;  2EV5 A;  5DUI A;  3B73 A;  3IWF A;  4KDP A;  4MEX F;  1S29 A;  1ONV A;  1XDS A;  1ZHF A;  5FFX A;  2BE5 F;  3T0Y A;  2A07 F;  3HYI A;  5HDN A;  3J81 K;  3IKT A;  1FBS A;  4MTD A;  1KQ9 A;  2ETH A;  4PDK A;  2FNA A;  2AS5 F;  2EK5 A;  2M8E A;  5DUK A;  1GXQ A;  5DV5 A;  3ABU A;  2Z9O A;  2L54 A;  4UNO A;  3GFJ A;  4I02 A;  3L9F A;  2H09 A;  4I01 A;  3M1E A;  1WQ2 A;  3MWM A;  4MGR A;  1YW8 A;  5D6F A;  2ZME A;  2E7W A;  3QAH A;  3R6S A;  4AIJ A;  2FXA A;  5EEG A;  2GWR A;  1EV7 A;  4H0E A;  4U7B A;  5BS6 A;  1QNT A;  1ZAO A;  1W7P A;  2Y48 A;  2YU3 A;  4M73 A;  1FYL A;  5E17 F;  1QGP A;  5ILV A;  3RKY A;  1K79 A;  4OIQ F;  3KZY A;  5K5O A;  3LA7 A;  3K9T A;  2JTV A;  6PAX A;  2VN2 A;  4HLY A;  3IRR A;  3F8B A;  1O7F A;  3WTY C;  2BBY A;  2NNY A;  3TGN A;  1LDK B;  1H9T A;  4AIK A;  2RKH A;  2F5F A;  2CSO A;  3I59 A;  1J59 A;  3KEQ A;  2ZO4 A;  4A5M A;  2NYX A;  2HTJ A;  3E6M A;  3GFL A;  1AWC A;  1O7L A;  1ZRD A;  2H94 A;  3IL2 A;  2XAJ A;  4N9I A;  2EFN A;  3KP7 A;  5BPD A;  5LGT A;  1XGM A;  2QUF A;  4RB2 C;  5IT9 Z;  4F7Z A; 
#chains in the Genus database with same CATH topology
 1I3A A;  2IP2 A;  2UUZ A;  5IOY A;  3K2A A;  3HGG A;  4ETS A;  2IS2 A;  2ZSI B;  3DBR B;  2DFH A;  2QM3 A;  2EFQ A;  4NNJ A;  4D7N A;  4UXN A;  2JQ7 A;  1D0X A;  3JRE A;  2L3D A;  4G9Y A;  1Y6I A;  1RZ4 A;  2LNB A;  1USS A;  4XLN F;  3ZQI A;  3AKZ A;  3FMS A;  3ERM A;  2LP0 A;  3F8M A;  1ETY A;  1YQA A;  2Q0O A;  3ZMS A;  3KPH A;  1YJW I;  1IN8 A;  5D6E A;  4AD9 A;  2IA0 A;  4M3E A;  3TOA A;  4EM1 A;  2W00 A;  3F3X A;  3ZGK A;  3KCC A;  3S1Q J;  2RNG A;  3RQ4 A;  2KRF A;  1AOY A;  1GT0 C;  2HR3 A;  1IW7 F;  2R7F A;  5FLV A;  3H5R A;  1MBH A;  1HKS A;  2ESH A;  3HRS A;  4UVC A;  2M4K A;  2DOA A;  4HEA 2;  1MSF C;  2ECC A;  3M07 A;  1BOA A;  4CYD A;  4XIC A;  5IT9 K;  1NTC A;  2HQA A;  4EAT A;  3S16 J;  4XLE A;  2A61 A;  5E3M A;  1AU7 A;  2LLK A;  2OCE A;  2JUG A;  3E97 A;  1JUS A;  1ZLJ A;  1VI0 A;  3LSM A;  2HVS A;  1FBU A;  1ZN2 A;  1Q1H A;  2D45 A;  2LKP A;  3QPT A;  3V7R A;  3ZOB A;  2AXT C;  2IT0 A;  3FIS A;  2Q2E B;  4EV0 A;  3C2G A;  4YIF A;  2VXD A;  5F1R A;  3IAS 2;  1QZZ A;  1UHW A;  4HST A;  5IYB J;  1YOV B;  3KP6 A;  4PUS A;  2LBF B;  3FBI B;  3CDL A;  2KJB A;  3T5X A;  1GVD A;  1ULY A;  3FIW A;  3OR2 C;  4PFP A;  4KIS A;  3BG5 A;  5GTI C;  2EIL H;  4ESB A;  2VAS A;  4L0Z B;  3K4M A;  1GLN A;  2IGK A;  2D2W A;  2LKX A;  5FRM A;  1MMD A;  2K9N A;  3ZQC A;  2F5D A;  2JMW A;  1B59 A;  4BQA A;  4LB5 A;  2MLG A;  2KDZ A;  2ELJ A;  1XMK A;  3GBG A;  1K6O A;  2AQE A;  1PUF A;  1CF7 B;  4IVN A;  3TW6 A;  1BI0 A;  1G59 A;  5KNL A;  1U5T A;  4BHP A;  2IGN A;  2KKO A;  3WHC A;  4I2O A;  4Q5S F;  4IF4 A;  3GTK J;  1VQ4 I;  4HW0 A;  3FZV A;  4OIP F;  5L3E A;  3GFM A;  3C1D A;  3DU6 A;  1H8A C;  1KU3 A;  3DQV C;  1SFK A;  3OOP A;  3G71 I;  2K7L A;  4QSH A;  2WA0 A;  5K5Q A;  3WTV C;  1HST A;  1I6X A;  2NVT J;  5H6R A;  1FTZ A;  3H3U A;  4P96 A;  1FOK A;  2V79 A;  1ETO A;  2GXG A;  2EV0 A;  1C0W A;  1PJR A;  2M45 A;  4Y33 A;  4XR6 A;  2HOA A;  1S7A A;  2W84 A;  4NC8 A;  2ELK A;  3ZMV A;  3KLO A;  2W7N A;  1R58 A;  2M34 A;  2JRM A;  4QPO A;  3T1B A;  2ISY A;  4E7S A;  1ZRC A;  1X1P A;  1DGR M;  3K70 C;  3Q9S A;  1GV5 A;  2ZB9 A;  3F8F A;  1LDJ A;  3G1L A;  2E1M B;  2V6C A;  4ITV A;  4KIF A;  4M9S A;  4PJM A;  2E71 A;  4ASN A;  3H9J A;  1MNE A;  3VYR B;  4D1Q A;  5D5X B;  5B1A H;  2IGO A;  3L2Q A;  1J75 A;  1UST A;  2KDO A;  3CDI A;  3TDZ C;  3A01 B;  3CLQ A;  3H5N A;  1FJL A;  3ZMD A;  4UB6 C;  4YII A;  5LLQ A;  3C2H A;  1J09 A;  2MYS A;  3MFK A;  1ZG5 A;  1IJW C;  3KP4 A;  4B43 A;  3V42 A;  3Q0W A;  3JTH A;  3ZQL A;  1X1C A;  1FT9 A;  1ETQ A;  3LNQ A;  4G6Q A;  1RRJ A;  1STZ A;  4C3H J;  5KK1 A;  1H88 C;  3VWB A;  2XF7 A;  3HSR A;  2MW8 A;  3OY9 A;  4A3C J;  2MLK A;  3S3O A;  2JWT A;  1IO2 A;  4ZYG A;  1L3L A;  3HUG B;  3IKV A;  2JA8 J;  2P7C B;  1HW5 A;  1R36 A;  1XSX A;  2OV7 A;  3DLA A;  5CVJ A;  5ILU A;  4AVZ A;  2V1U A;  3ASN H;  2EFW A;  2MFZ A;  4P9F A;  4IQJ A;  1BJZ A;  1VFC A;  4WK8 F;  1QO0 D;  3L09 A;  3DU5 A;  1A6Q A;  2ZNY A;  1I50 J;  3RKX A;  3PNV A;  1YLF A;  5BNG A;  3HDD A;  2PX9 A;  3U2R A;  4UHT A;  3VEP A;  3S1N J;  4RAG A;  1W36 C;  4EJU A;  4BNC A;  2GAU A;  3K4K A;  5F6F A;  5J4Y A;  5LGU A;  3ZQ7 A;  1M1E B;  4R1H A;  3IAM 2;  4CCK A;  1VZ0 A;  4QIW N;  2FOK A;  4OOI A;  3FXJ A;  4JYK A;  4HQM A;  3WU1 B;  5DTD A;  3RCO A;  2V1D A;  1PP8 F;  3CO7 C;  4JX6 A;  4ZDP A;  1R49 A;  4P9U A;  2EIK H;  4FHT A;  2LMD A;  2VBW A;  4JOM A;  5FRO A;  2DU9 A;  1APL C;  2X85 A;  3KYL A;  4A2U A;  3V7C A;  2LK2 A;  3OL4 A;  4CO8 A;  2ZME B;  4YRV A;  5IOZ A;  1BW6 A;  2K4J A;  3PSF A;  1OCZ H;  2XKP A;  5HNF A;  4I09 A;  3FXL A;  3Q3S A;  2LTP A;  2STT A;  5DD4 A;  2ADU A;  3WTT C;  3OYA A;  2HXI A;  3W3C A;  2GBY A;  2BXY A;  4CCO A;  3CLO A;  1K7A A;  2DOE A;  2FJ1 A;  1R4M B;  4XLA A;  3A1Y A;  4Q4Z F;  4M9Z A;  1W7P B;  1BW5 A;  4QWQ A;  1EJ9 A;  4A3K J;  2XV4 S;  2W24 A;  2XGD A;  3I0T A;  1U9O A;  2W48 A;  1ZYR F;  1XD7 A;  1S9H A;  1NK2 P;  4GO1 A;  3DXJ F;  1PP7 U;  4L0Y B;  1LFB A;  5JLW A;  2QWW A;  2BY1 A;  5F04 A;  4UUT A;  3S8P A;  2M5W A;  4AM3 A;  2RVC A;  3AG4 H;  3K1P A;  4KUM A;  4Y3O A;  4GCV A;  3CES A;  4JK1 X;  1FYK A;  2OZU A;  2L7K A;  1DQU A;  4PFO A;  2R7Q A;  2MH9 A;  4IHY A;  5E3L A;  2O0Y A;  5E8G A;  3KP2 A;  1WJA A;  3CF5 F;  4XKC A;  4KNY A;  3M1C A;  2DFI A;  3D5R C;  3GXO A;  4HSR A;  4NDL A;  3Q5F A;  1NK3 P;  2ZSH B;  4QPQ A;  3CTA A;  3OR1 C;  5GPA A;  3I58 A;  3LWF A;  2R7W A;  3I59 B;  1TLH B;  1T56 A;  2X0L A;  3V8J A;  4C3J J;  2EIJ H;  3HPG A;  3ECO A;  4A3I J;  4BUP A;  3G3Z A;  4C2M J;  3H0G J;  4KIG A;  1YRN B;  3EUK L;  3OOU A;  2H8R A;  2J5O A;  1HC8 A;  2DT6 A;  2LF7 A;  2EV6 A;  1T0F C;  3BJ6 A;  3BG7 A;  2PFB A;  3HL2 A;  1HSJ A;  2WTE A;  5A2Q Z;  4O3M A;  1O3T A;  1MMA A;  2M7A A;  2K86 A;  3V8L A;  2LVS A;  1K83 J;  2R5Y A;  4HRI A;  4CZC A;  2V9P A;  1XDU A;  2E1N A;  2ZFU A;  2QSF X;  2V1N A;  1JHH A;  5J1R A;  3HOV J;  1PYV A;  2CW8 A;  2XAS A;  1WRJ A;  3JCU C;  5FO5 A;  1EH7 A;  2QYO A;  2CYY A;  2DLL A;  2OJE D;  5J8F A;  4HF2 A;  4F91 B;  4BE0 A;  2I10 A;  4AVP A;  4HYE A;  2DOD A;  3V7S A;  2QZ8 A;  5F1J A;  2K40 A;  3I5U A;  4O5V A;  5FFZ A;  3LSG A;  2VJI A;  1FTT A;  2AHQ A;  4XLF A;  4EGZ A;  1XGS A;  1MW7 A;  3COA C;  1MBJ A;  1JGS A;  2G0E A;  1IXR C;  2EB7 A;  2VBX A;  3IH3 A;  2LOO A;  1YG2 A;  4KJZ A;  5CKT A;  2VJJ A;  1OR7 A;  2WBM A;  2PJP A;  1TW3 A;  3E3V A;  3QYE A;  2HXO A;  4OIO F;  2H1K A;  5TRD A;  2LDU A;  3BP8 A;  2R0Q C;  2QKM B;  1BI3 A;  4A3L J;  2M3A A;  1KU7 A;  2M4G A;  1F43 A;  2OBP A;  2HOS A;  1YJN I;  3BOQ A;  1XN7 A;  2ZBK A;  1XMX A;  2BEO A;  4FX4 A;  1GVJ A;  2YUS A;  3A0B C;  1D8J A;  1J9I A;  1ETK A;  3BTL A;  1MKM A;  1R22 A;  5HLI A;  3PFI A;  3SDB A;  3OS2 A;  1YJ9 I;  5HVQ C;  3MAJ A;  3GUD A;  3VYT B;  3L7W A;  3F22 A;  4M3F A;  3JAM K;  4KT6 A;  2VC0 A;  1XCV A;  4I0A A;  3GYH X;  4KA4 A;  1XCB A;  1E3O C;  1K61 A;  1YTY A;  5AIQ A;  2VE8 A;  1H0M A;  1BIA A;  4X1E A;  2XAG A;  4LG0 A;  1I6H J;  4GYG A;  4Q48 A;  4M74 A;  3BWG A;  1MND A;  2DMQ A;  4JX5 A;  1IDZ A;  1U6G A;  3FWE A;  1QZE A;  2JVG A;  5CQE A;  4RBO A;  2Y30 A;  1SEU A;  1UCR A;  1PDN C;  4OAZ A;  1XB4 A;  2E5N A;  2VE9 A;  5TIS C;  5JHU A;  2EJR A;  1YFH A;  4IHT A;  3ABL H;  1P6R A;  3PNT A;  4XOR A;  1MJB A;  4D7M A;  4LIV A;  4LK1 F;  3LSP A;  3ABK H;  4ZZD A;  5F08 A;  3CC4 I;  4M72 A;  2DW4 A;  1ZQ3 P;  1QRY A;  2DMP A;  1PUF B;  2FUG 2;  1K6Y A;  2ME0 A;  2LH9 A;  1EH6 A;  1WI9 A;  4DZJ A;  3ZRG A;  2DMU A;  1MJA A;  3M3Y J;  1WH7 A;  1U5T B;  1JUM A;  5AON A;  3FHN A;  4BH9 A;  3H36 A;  4ZTJ A;  1XGN A;  1IGN A;  4DQ2 A;  1X1B A;  4JX4 A;  1BC7 C;  4F3Q A;  1UHM A;  5KAI C;  5BPI A;  2MC4 A;  1OMI A;  2HVR A;  4IHS A;  5CVV A;  2STW A;  3WU0 A;  2O8K A;  2WY8 Q;  1Z91 A;  3T8R A;  2AQF A;  1XSV A;  3FXO A;  3TL4 X;  4N0B A;  1QPI A;  2R7X A;  2RC4 A;  3JRD A;  2BHZ A;  1FSE A;  4CCL A;  3OS1 A;  5EGO B;  2QQB A;  4M71 A;  1ZLK A;  3P9C A;  1X4P A;  2NVY J;  2R3S A;  2E35 A;  3AG3 H;  3IUO A;  1WFX A;  5HDK A;  3DWL E;  1SFU A;  1KQ0 A;  3I64 A;  3BR0 A;  4IO9 F;  1X1A A;  4AIH A;  3DV8 A;  3DEU A;  1O57 A;  2LY9 A;  2LC2 A;  2HVQ A;  2XAH A;  4FX0 A;  5TJJ A;  1LNW A;  2EA2 A;  2BY3 A;  4LLL A;  2EIN H;  2D5V A;  4C2U A;  5IYD J;  4U0V A;  2DO7 A;  3WTS C;  2JRT A;  4HNU A;  1X2M A;  3MKW B;  2YX7 A;  1XC5 A;  2M1B A;  5AIP A;  2NOG A;  4IHX A;  3E0J B;  2ZXW H;  3SFI A;  1RNL A;  2B0L A;  2XSD C;  3I55 I;  3OYC A;  4ZDO A;  4XRF A;  2DAO A;  3HXL A;  2GA2 A;  4BHB A;  1HDP A;  1SD4 A;  4BYY A;  2MBF A;  3BTJ A;  5J40 A;  1WGX A;  5H2F C;  4UUV A;  4IZZ A;  2COM A;  3OYF A;  2XDV A;  1IN5 A;  3E6C C;  2JJ7 A;  5GTH C;  4XKB A;  4G6D A;  2EQR A;  3L2W A;  1YYV A;  2DQL A;  2GQQ A;  1X4O A;  3K4J A;  2FMY A;  3RJP A;  3BR6 A;  2M0C A;  4CCJ A;  5J47 A;  1JKO C;  2HU9 A;  3F21 A;  4ENK A;  3WG9 A;  5JI6 A;  5IT3 A;  3CD6 I;  3JRF A;  4Y15 A;  4L5J A;  4A3F J;  4OIN F;  1X19 A;  1HBX G;  3U1K A;  2JN6 A;  1TZL A;  4OU0 A;  3QQA A;  2TCT A;  4IXA A;  2KRH A;  1U9N A;  2MGQ A;  3EUA A;  4LB6 B;  3RI4 A;  3HOZ J;  2NVX J;  3WGH A;  1G6N A;  4P55 A;  1ZG1 A;  1JT0 A;  1RUN A;  4GRI A;  2WY7 Q;  1X3W B;  4RS8 A;  2A05 A;  3ZN1 A;  3KEO A;  1O4X A;  1QA6 A;  3SXY A;  4P5O A;  4U7D A;  2L2O A;  3PUB A;  2FQ4 A;  2MG4 A;  4XK4 A;  1HQC A;  2QEX I;  2E19 A;  3G2B A;  2QA4 I;  5HS8 A;  1L0O C;  1P4A A;  4CZZ A;  2E34 A;  2OC6 A;  2DJI A;  4IPA A;  3I4P A;  3DEE A;  3MD2 A;  2OD5 A;  5FKM A;  1TC3 C;  2CFX A;  2WAE A;  4XL9 A;  3T8T A;  5E8I A;  4J19 A;  5JFR A;  1TQI A;  3ZQQ A;  2RQP A;  1ETW A;  4NQW B;  4E7L A;  3RKW A;  2K9L A;  1P4X A;  1QQI A;  2QBY A;  5F27 A;  5IYC J;  3E5Q A;  2VON A;  1S6L A;  3U1D A;  1MH4 A;  2VL8 A;  1CGP A;  1NHA A;  1GHC A;  3TOB A;  4AID A;  2IJL A;  5IP6 A;  1UFM A;  1U8R A;  1TQP A;  1DU6 A;  2FBK A;  2DBB A;  3BR5 A;  2XRL A;  2KIS A;  3AL0 B;  1D0Y A;  2DYR H;  4A6D A;  3FXK A;  1VQL I;  3H9G A;  4XLH A;  2ACJ A;  3QYB A;  4B4C A;  1YI2 I;  1Z9C A;  2RQQ A;  4BS9 A;  3HRM A;  3KLN A;  3WG7 H;  1IUF A;  1I27 A;  1BA5 A;  1D8K A;  3C18 A;  4BHC A;  2X6O A;  4BAC A;  2A69 F;  1FC3 A;  2W57 A;  1RUO A;  1X1D A;  2ISZ A;  1YIT I;  1I5Z A;  2KT0 A;  1ENH A;  2WAQ N;  2NOJ B;  2IEK A;  3MZY A;  3OV8 A;  1LQ1 A;  2CFO A;  3BDD A;  5EJC A;  1TP4 A;  4HA8 A;  2EFP A;  2DQR A;  1RES A;  3VSK A;  4CHU A;  4HX4 A;  1MD0 A;  2OUM A;  4L5E A;  1TNT A;  4KIB A;  2JT1 A;  5GPC A;  4V2F A;  2RN7 A;  4MTE A;  4ON0 A;  2CQN A;  1R00 A;  2CUE A;  4NC6 A;  1HCR A;  1N75 A;  2PMZ A;  4FCY A;  1HW1 A;  3FF5 A;  4IQ4 A;  1MNM C;  2DCE A;  4HF0 A;  1Z3X A;  2FQ3 A;  2VQH A;  3DTK A;  2GA1 A;  2R5Y B;  1JKP C;  2VQL A;  3CME I;  4B1R A;  1S7E A;  4P1W A;  3GFI A;  4M9X A;  2VPL A;  1H9G A;  2G7H A;  2E1O A;  2EZH A;  4RLF A;  2BY2 A;  3B02 A;  2JA6 J;  1OFC X;  2HS5 A;  3HZJ A;  5LGN A;  2ZJR F;  1UJ8 A;  3CCL I;  2E1M C;  2P7V B;  1IN4 A;  2DMT A;  3CZ6 A;  5K5R A;  1R1V A;  3B6A A;  2OPT A;  3H3V K;  1SMY F;  5CYV A;  3KE2 A;  3K6G A;  3AAF A;  2W4S A;  3K70 D;  1BI1 A;  5DS9 A;  2P5K A;  5FJ8 J;  1VF9 A;  3F0C A;  1IXC A;  4L18 B;  3QPS A;  4L9V A;  4ANJ A;  2R7Z J;  2PQ8 A;  2HNH A;  2VXZ A;  4DOZ A;  2F5E A;  2K85 A;  5FB2 A;  3OIO A;  3I3L A;  2L7F P;  1T08 B;  1FLI A;  4AWX B;  4RGR A;  1F5T A;  3TED A;  3OYL A;  2O8X A;  1A6I A;  2CQQ A;  3SZG A;  1FNN A;  1ZGA A;  1HKT A;  1QPM A;  1Z21 A;  3BRO A;  2DXI A;  4ZDL A;  3FKJ A;  1V4R A;  5D8K B;  2Q8K A;  3BCA A;  2YX4 A;  2DT7 B;  1WJE A;  4DNC A;  5CVR A;  3CJN A;  1KYW A;  1D3Y A;  3PNY A;  3KET A;  1MBG A;  4MIM A;  4CYC A;  2IVM A;  3CC7 I;  4EMS A;  2HEO A;  1KU2 A;  3JSO A;  3D1N I;  4ENJ A;  3JW4 A;  1BJA A;  1J0R A;  1WJC A;  3A4C A;  1FX7 A;  3LQQ A;  2HQN A;  2L0K A;  3L2R A;  2M8G X;  4N4N B;  4NHJ A;  2E2I J;  2Z1D A;  3TP0 A;  2RDP A;  2A3S A;  3CCQ I;  1XX5 A;  2ESN A;  3F8C A;  4L9N A;  1BR4 A;  1KA8 A;  2AO9 A;  3BG6 A;  3LSH A;  3M9A A;  3FM5 A;  2IRF G;  2KP6 A;  3FXM A;  2FSW A;  4LG0 B;  2R7U A;  3R4K A;  3GTP J;  5E1W A;  4M3D A;  5LHI A;  3S3N A;  3PO3 J;  1T33 A;  4ZYE A;  3WTW C;  1IUY A;  2WC2 A;  5HLG A;  1W36 D;  5K1Y A;  3R61 A;  5CLS A;  1E3H A;  5HS9 A;  3ROU A;  4A0X A;  4E7Z A;  4A3J J;  4XON A;  2X6Y A;  3W2W A;  2IAI A;  4LOC A;  4XN3 A;  5FKO A;  2ZME C;  4IRG A;  1B8I A;  3C3W A;  3GO5 A;  5F0C A;  1MDM A;  3O8G A;  5LRR A;  1DPU A;  2ZNZ A;  1LJ9 A;  1MJ9 A;  5LEJ A;  3CUQ A;  3HOU J;  4XRM A;  1JJ6 C;  1WCM J;  1OYI A;  4ZH4 F;  2P5L C;  2QKL B;  1HLV A;  2V26 A;  1YE9 A;  1R5G A;  3H9Q A;  4B09 A;  1DU0 A;  1E0E A;  4HAM A;  1Y1W J;  2GXB A;  4H4K C;  4M3G A;  4HF1 A;  2CUZ A;  1TWH J;  3L2C A;  3BC8 A;  4LIU A;  3QRF F;  3OMY A;  1ZKG A;  2HYF A;  3HSF A;  4EEF G;  2NRA C;  2ZFW A;  4WWC A;  3WE3 A;  2MA3 A;  2K9Q A;  1S8N A;  2DOF A;  1K4S A;  4B47 A;  2Y0S A;  3F23 A;  3BZC A;  5L3B A;  1Z3Y A;  4CXF A;  4PCQ A;  2XAU A;  1ZAR A;  2JA5 J;  3SEZ A;  2DFE A;  3RTR A;  1MBF A;  3SZP A;  4DJA A;  2I5U A;  2FML A;  2JPC A;  2IA2 A;  2HTS A;  3G73 A;  1ZTR A;  1V55 H;  2EIM H;  4XN0 A;  1BN5 A;  3ZN0 A;  4X0G A;  2CV0 A;  3KP3 A;  2Z99 A;  4Y52 J;  1SFO J;  4GGG A;  3ZMT A;  4XLP F;  1YW7 A;  3CJQ B;  4RGX A;  2Y9Y A;  1DPR A;  2TDX A;  1MBK A;  2QLZ A;  3OYB A;  4LGW A;  4F93 B;  4EM0 B;  1SVL A;  3W6K B;  1TWC J;  4AYB A;  4C30 A;  4BDZ A;  4BQO A;  3HOW J;  4G8X A;  4ZZL A;  3N05 A;  2LR8 A;  3JR9 A;  3F72 A;  2RNJ A;  3K10 A;  1VQM I;  4A6E A;  1LPQ A;  3GW2 A;  2O9L A;  2VOO A;  4IOC F;  4AUX A;  2F4M B;  2QQ9 A;  3H35 A;  3S32 A;  3JRG A;  2Y2Z A;  2WAF A;  4MLO A;  4LMY A;  5E3N A;  3HJE A;  4V2G A;  1DDN A;  4HV5 A;  2KIU A;  3WTX C;  4BL0 B;  2DPD A;  2V7F A;  3R60 A;  3EUH A;  2KMU A;  4ENM A;  5LEK A;  1T6S A;  2IXS A;  2R7D A;  2IA1 A;  4FIS A;  2HKX A;  5JVG F;  2XB5 A;  3H5A A;  4N4O B;  1CQT A;  3KZZ A;  1U2W A;  2CV1 A;  1ETX A;  4YEJ A;  1S72 I;  2MD5 A;  1FP1 D;  3BJA A;  1Z67 A;  2EA4 A;  4MHG A;  4E6K G;  1VTN C;  4ZTF A;  3G1M A;  1TT0 A;  1DGW Y;  2Z3Y A;  4IX7 A;  3DF8 A;  2HQR A;  4UVA A;  3KX2 A;  1U3E M;  5EZG A;  2FU4 A;  4IRH A;  4NBQ A;  2E5Z A;  2EWN A;  3A03 A;  4HDV A;  2DPU A;  2UXX A;  3QP5 A;  1OYW A;  3DP7 A;  3WTZ A;  4A5N A;  2D1V A;  2QGU A;  1T2K A;  1XG1 A;  4WXD A;  1LEA A;  2KPM A;  2BZT A;  3FK7 A;  4G7O F;  3BG3 A;  2XGX A;  3LSI A;  4EVI A;  4KMU X;  4Y13 A;  3BPX A;  1UZC A;  1G3W A;  2CQK A;  3PUF A;  1OKR A;  4KFC A;  3JTG A;  2HDW A;  2K4B A;  2CG4 A;  1G8X A;  2B9S A;  1SFX A;  2RRE A;  3RZO J;  3DPL C;  3MCZ A;  5EEA A;  1VQ8 I;  4G7H F;  3OYJ A;  2DT5 A;  2WWY A;  2NS0 A;  1W5T A;  3VOD A;  4RGS A;  5E18 F;  1XMA A;  2PMH A;  2N8G A;  5DCF A;  3SDG A;  1O3R A;  1VND A;  4XRS G;  3W2V A;  4N9H A;  3CJT B;  1B1B A;  2ZXJ A;  3ML6 A;  1Z6T A;  2LY2 A;  4G6T B;  3FDY A;  3FBN B;  2QBY B;  1ZEL A;  1VQ7 I;  2LD5 A;  4CDG A;  5JVT A;  1D1A A;  5D5U B;  3BG9 A;  4NB5 A;  3E7L A;  2DK5 A;  3IP4 B;  4M6X A;  4XMY A;  1N77 A;  3BQZ A;  3LA3 A;  4UVB A;  3E5U A;  4DBQ A;  2B7E A;  5M5X J;  5HDG A;  4Y7N J;  1J7K A;  2B63 J;  1QHH D;  2PEX A;  2VOD A;  1WVR A;  2CWE A;  3ABM H;  3K4C A;  5DCM A;  4ZC3 A;  5HS7 A;  1O3S A;  2KIQ A;  1WJD A;  1OCP A;  4HX7 A;  2HWV A;  1AKH A;  2L7M P;  2HFH A;  2DTZ A;  2XAF A;  5FKL A;  3W6J B;  1G3S A;  4PSW A;  1HOM A;  2E60 A;  4FQG A;  4CIC A;  2WB1 N;  3J80 Z;  4RLQ A;  2BGC A;  2XF5 A;  4RA2 A;  1WH5 A;  2EZL A;  2CV2 A;  2BHY A;  1SC7 A;  4MQV A;  2VKD A;  4PK4 A;  5E79 C;  2CW0 F;  1SAX A;  2L7Z A;  3Q9V A;  3BZ6 A;  1WPK A;  2C6Y A;  3NQO A;  4A3D J;  4BKX A;  2RAE A;  2XAQ A;  1U5T C;  2DDA A;  3MKY B;  5D5W B;  3QOE A;  1OQY A;  4FAS D;  1BC8 C;  4QTR A;  3DKX A;  4HZF A;  4JBA A;  1S3J A;  1DP7 P;  3GVA A;  5A2Q K;  4E4H A;  2BOL A;  2H6C A;  4UV9 A;  2Q1Z B;  2DI3 A;  2LBF A;  4XOP A;  1Z05 A;  2NAZ A;  2XIG A;  3NAU A;  2HOT A;  1MIJ A;  3F6O A;  2HYG D;  2M7B A;  3J7A Y;  1K78 A;  4BE1 A;  2VBZ A;  2LFB A;  1WJF A;  3IH2 A;  4U0Y A;  4J01 A;  3MZH A;  4V19 K;  3HRT A;  1BBY A;  1A35 A;  2HDC A;  5K7F A;  2IPQ X;  3FM3 A;  5K7H A;  2R7V A;  4KYW A;  3J80 K;  3HKZ A;  5C3E J;  5IPA A;  3D5L A;  3PL8 A;  4L5I A;  3S93 A;  2ID6 A;  1W5C C;  2F6C A;  1V3F A;  3DPU A;  3PSI A;  1ZR2 A;  1MH3 A;  4I99 C;  5EEH A;  4KIC A;  4BXF A;  3QU3 A;  3RSN A;  3LMM A;  3ZMU A;  1F9N A;  4EQQ A;  3RQI A;  2O61 A;  2V6E A;  3TDU C;  2AXL A;  4ESF A;  2YU9 J;  3HTS B;  2Z16 A;  1TW2 A;  2QQ8 A;  3SJM A;  1K4T A;  2ZCW A;  3FMR A;  3L1P A;  5FRN A;  1ERD A;  3WOD F;  1IV8 A;  4C2T A;  1ZGW A;  2NVU B;  3S1M J;  2A68 F;  1TWA J;  2KL4 A;  2WV0 A;  1B72 A;  5IP7 J;  1DUX C;  3TW7 A;  1YX3 A;  3TO9 A;  2BV6 A;  3K0L A;  3L2U A;  1LB2 A;  1LE8 A;  4W1U A;  1A31 A;  1TQM A;  5E20 A;  2ZJQ F;  1Y8Q B;  3K4L A;  3FKI J;  3WU2 C;  3QOP A;  4F52 A;  3W6V A;  3VFZ A;  1REP C;  9ANT A;  2OZ6 A;  1OJL A;  2KRC A;  4MNU A;  2HKO A;  4KIT B;  2KHM A;  4ENN A;  1R5H A;  3FXQ A;  3N97 A;  1LFU P;  1IF1 A;  1LVA A;  2Y0M A;  4CYC B;  5L3G A;  4Z2Y A;  2YS9 A;  1IC8 A;  5JHF A;  1VQ6 I;  3GF2 A;  4R79 A;  2NVQ J;  3S14 J;  5HOO A;  2W85 A;  2W25 A;  2DA7 A;  3OYD A;  1JTX A;  1GV2 A;  2TRT A;  2VPR A;  3QU6 A;  2M9H A;  2X51 A;  3K1M A;  3FX3 A;  3P7N A;  2UWM A;  1G4D A;  2QSG X;  3BY6 A;  4MQ9 F;  3FXU A;  3V8K A;  3CJR B;  3L2V A;  1G3Y A;  5DEQ A;  4L9J A;  4D5C A;  3WGG A;  5F64 A;  5GAD J;  5LRS A;  5IP9 J;  3BR2 A;  2O03 A;  2DA1 A;  3I54 A;  3DFG A;  1W4M A;  3GME A;  3O6B B;  3RPQ A;  3UKG A;  1YW9 A;  4A3M J;  2KZG A;  2Y75 A;  4U0W A;  5DYM A;  3ERE D;  4A0Y A;  2LRD A;  5FKK A;  3UNG C;  4BQN A;  4CA0 A;  4RAZ A;  1OCC H;  4IL6 C;  5JR3 A;  3GCM A;  3CCE I;  1IV6 A;  1YIJ I;  4YEL A;  3ZQF A;  2EPF A;  3HSE A;  2ZC2 A;  1B8I B;  1MDM B;  3HUG A;  3DLL F;  3CUQ B;  3W2A A;  3GLX A;  5ICF A;  1V5G A;  3ABT A;  1IZ1 A;  1HF0 A;  5KHD A;  1TL8 A;  1P92 A;  2P5V A;  5B5E C;  2HZT A;  5E1Z B;  5HLT A;  3P9I A;  2BY0 A;  2Z5U A;  1R1T A;  1YIO A;  3IH4 A;  3VDX A;  4BEH A;  3A0H C;  3ISP A;  1FMV A;  4ZYD A;  2F2E A;  3AL0 C;  1Y39 A;  2VI6 A;  5TGT A;  1D5V A;  1DP3 A;  3K69 A;  3GX4 X;  2E36 A;  2WAD A;  3REO A;  2H1L A;  1JKR C;  3H0D A;  3TP3 A;  3HIF A;  3ECH A;  3H92 A;  3LL7 A;  3ZQG A;  4HPQ A;  1XPX A;  2LF8 A;  3CO6 C;  2Y69 H;  2Z33 A;  4LG3 A;  3D0S A;  2FNP A;  2KLO A;  4S05 A;  2UXN A;  3LFU A;  2VC1 A;  5LHH A;  3HG9 A;  5GP9 A;  1IXS B;  3LST A;  5ICE A;  3MQ0 A;  5J6X A;  5LD2 C;  4HBL A;  5HOD A;  1H89 C;  1JJ8 C;  3G6E I;  2X1D A;  2IBD A;  2BW3 A;  1LFP A;  4S04 A;  2E2J J;  1ACI A;  1KQ8 A;  2UZK A;  2KIF A;  1AA7 A;  2X1C A;  2X9D A;  3QP6 A;  3RDI A;  3DCF A;  3OIQ A;  4LLG F;  1A04 A;  4RM2 A;  5EF6 A;  4KN7 X;  3JRA A;  2LYC A;  3I71 A;  3O8H A;  3C2B A;  3R0A A;  5F0H A;  1R6R A;  3GTG J;  2X4H A;  1G3T A;  5ED4 A;  4G12 A;  5F0F A;  4XSX F;  2JUC A;  3RZD J;  3CCJ I;  1XS9 A;  4ZYH A;  1TBX A;  2CW7 A;  1PVE A;  3IC7 A;  5BOX A;  1P7I A;  2LSO A;  3IHU A;  2EFO A;  5D4R A;  3G4S I;  3MVP A;  4ESJ A;  1MMS A;  4X6A J;  1KGS A;  2BXZ A;  2Y31 A;  2PMU A;  4ZJZ A;  3GLL A;  1ZH5 A;  3HHG A;  1ZR4 A;  4WF2 A;  4L9T A;  5CPR B;  1D1B A;  1FOY A;  4PSX A;  3CUO A;  2ZJ2 A;  1R4N B;  3JSP A;  1VQ5 I;  1JXS A;  2VJ4 A;  2R7O A;  1SAU A;  3GZ5 A;  1SVO A;  1FSH A;  3GTQ J;  4F55 A;  3B6C A;  1ZRE A;  2OCC H;  2PJR A;  1MZB A;  1YHQ I;  1I1G A;  3U21 A;  3DBH B;  4JP0 A;  1SAN A;  1X58 A;  1S5L C;  2XB0 X;  2ECB A;  2QQA A;  4Y17 A;  4GDF A;  1FIP A;  1SD6 A;  2MH2 A;  3I4M J;  1KU9 A;  3K4N A;  3K2Z A;  5GAG J;  1OR7 C;  1X3U A;  3M7G A;  1BM9 A;  3GTO J;  3OS0 A;  1I1S A;  5EYR A;  2VIX A;  4EJO A;  3SHF A;  1OYY A;  4WX9 A;  3KP5 A;  3K7A J;  2L5Q A;  5M3M J;  2R92 J;  4PGG A;  1NH3 A;  5DM7 F;  1PUE E;  3E6D A;  3ZP5 A;  2PLY A;  2IS4 A;  3LAP A;  1T38 A;  1B9M A;  2XRO A;  1YO5 C;  2XVC A;  3ZPL A;  1ON1 A;  3BT9 A;  2FE3 A;  4KT5 C;  3EET A;  1POG A;  2P8T A;  4I0B A;  3BPV A;  3TKY A;  1W0U A;  3HBL A;  2IS1 A;  3ONQ A;  1IRZ A;  2XSJ C;  2LG4 A;  1P4W A;  3LSJ A;  3LFK A;  1A36 A;  4UUS A;  1RET A;  4HX8 A;  3SZT A;  1EA3 A;  2FOW A;  3HB9 A;  1Z7U A;  2QF7 A;  2P4W A;  1V54 H;  1FY7 A;  4HLX A;  1JE8 A;  2M2E A;  1HKQ A;  4QLC U;  1QZY A;  5HLH A;  2GIV A;  4FE4 A;  3V4G A;  2XKO A;  1J2X A;  4DZP A;  4DGW B;  1FIA A;  2EZI A;  3C7J A;  3TO7 A;  1LEB A;  3HRU A;  4HQE A;  2KIM A;  4U88 A;  1OIS A;  4DYQ A;  1X3Z B;  3BCB A;  4YFK F;  1IN7 A;  2VQC A;  4YFN F;  4MO7 A;  3O3K A;  2M87 A;  2HYJ A;  5DCM B;  1N78 A;  3PJR A;  1EKE A;  5FD6 A;  1AKH B;  1ZGJ A;  2A6T A;  2CS3 A;  2JK3 A;  1T39 A;  4BQQ A;  4RB3 C;  2ME6 A;  2WAQ A;  2OA4 A;  3FMQ A;  1XSD A;  3HOX J;  3J7Z I;  4BE2 A;  2H8W A;  2L9S A;  2CUF A;  4RMN A;  4EJV A;  3EPZ A;  1U8B A;  1IN6 A;  1VQ9 I;  1Z0X A;  4E70 A;  4XRS A;  3VYS B;  5ICG A;  1YX5 A;  3IWZ A;  2R4G A;  1E3P A;  4XKW A;  4M6Y A;  3CC2 I;  1RR8 C;  3RYP A;  2QCO A;  5EG0 A;  4LK0 F;  1T0F A;  1U78 A;  2X6W A;  1R23 A;  4EJT A;  3HGY A;  3NAR A;  3AG2 H;  2K02 A;  4R8H A;  3AFH A;  3LA2 A;  4TV7 A;  4XBF A;  2D1H A;  1W7P D;  2KFD A;  5DDG A;  3CCR I;  2HGC A;  2GOX B;  4D0P A;  2VT3 A;  1MBE A;  4LLN A;  2LY1 A;  5CVI A;  1K78 B;  1R7J A;  2L02 A;  2OU2 A;  5FKN A;  3I53 A;  4NC7 A;  3GZ6 A;  5BQT A;  2RGV A;  3J7Y J;  1UAA A;  1WZ2 A;  1T98 A;  2K3F A;  4Y4R A;  3IRQ A;  4YG2 F;  4B8X A;  5CQG A;  2G7U A;  2FX0 A;  3DKW A;  3LSR A;  3Q0U A;  5FLM J;  1E2X A;  1WJB A;  3DEW A;  3WGI A;  2R7S A;  3A02 A;  1SD5 A;  2CGP A;  3WE2 A;  1ODD A;  2YSR A;  3MZ8 A;  2DN0 A;  3BTC A;  1BR1 A;  1FWZ A;  1S7O A;  2DA2 A;  1Y0U A;  4ABZ A;  5L3C A;  3J7A O;  1ETV A;  2XGC A;  4K2E A;  4C3I J;  1FZP B;  2H6B A;  4E7J A;  4IKF A;  4CUG A;  3M8E A;  4FT8 A;  3CCM I;  1B6A A;  1B72 B;  4FE7 A;  2CJJ A;  3BZK A;  3QOD A;  4M3B A;  4AC0 A;  1R1U A;  4E7H A;  5M5W J;  2R7R A;  2R93 J;  2XPV A;  2KJC A;  3KYD B;  1UHS A;  3M8F A;  4II3 A;  2Y0S N;  3Q0V A;  1Z1D A;  3F6V A;  1B9N A;  4UV8 A;  5K7Z A;  2FF4 A;  1BOB A;  3BQY A;  4I98 B;  3SQN A;  5EGO A;  4WXH A;  2MC3 A;  1E17 A;  3M4O J;  4HOB A;  5ILS A;  1NG6 A;  3OYN A;  5KAF C;  1LKX A;  3PIP F;  3A2K A;  4XSZ F;  3GTM J;  3BTI A;  4W97 A;  1BIB A;  4B44 A;  1HXD A;  4O6J A;  1IRX A;  2DTR A;  2V9V A;  3HC7 A;  3AG1 H;  2PN6 A;  2EH3 A;  2DYS H;  3KYC B;  1QU3 A;  4OAY A;  4PGH A;  5FGM A;  4GFB A;  3S15 J;  5CJ9 A;  3VYU B;  2EBI A;  4OMY A;  4OMZ A;  1UB9 A;  2H27 A;  2NXN B;  4AYB N;  3EYY A;  2L4M A;  2MAB A;  4C9Y A;  4BXU A;  3TMO A;  3S2D J;  2J5P A;  3WTU C;  2L4A A;  1FOX A;  3D5S C;  3O2P E;  1JT6 A;  3OL3 A;  3I9V 2;  2O7O A;  2FBI A;  3HEF A;  2KQR A;  3FXR A;  4A3G J;  2X1E A;  1IRG A;  2BVM A;  2VBY A;  1LDD A;  3JRH A;  3RKQ A;  1P2F A;  2OF7 A;  3H3Z A;  3UR3 C;  3PQK A;  4KN4 X;  4A3E J;  1LE8 B;  2VKE A;  1SMT A;  1FYM A;  2E1C A;  5DM6 F;  5CVU A;  2QVO A;  3SEQ A;  3OYI A;  1FOW A;  2K5C A;  3MKL A;  2GOM A;  1F1Z A;  2E7X A;  2HOE A;  2GIZ A;  1SVM A;  2K27 A;  4GXO A;  5KCM A;  1WSU A;  2VOP A;  2G9W A;  3CP8 A;  2NNN A;  2XPU A;  4G94 A;  4A0Z A;  3NWT A;  1JTY A;  3QPH A;  5LHG A;  2JZY A;  2P6S A;  5LBQ A;  1F4K A;  4OIR F;  3OYK A;  1JHF A;  1G2H A;  2GLO A;  5E1X A;  2LRE A;  1QVU A;  4BEH B;  1HDD C;  4E7I A;  2XRN A;  5J1Y A;  2IS6 A;  2NS7 A;  3MMY B;  1ITY A;  3NEU A;  4FET A;  3MEX A;  2VKH A;  3F9K A;  3PO2 J;  4UY8 I;  3LSK A;  1V5F A;  4RGU A;  4BY1 J;  1O3Q A;  1WWX A;  4IHW A;  2EZK A;  1W5S A;  2DA5 A;  4S0H B;  3MN2 A;  4LJZ F;  3VB2 A;  1ZG3 A;  4WCG A;  3BR1 A;  4RDU A;  5H20 A;  2Z2S B;  4J00 A;  4HDU A;  2QSH X;  4IRI A;  4NQW A;  2QEN A;  2MD0 A;  1XGO A;  3EDP A;  1HA8 A;  1VQK I;  3GEZ A;  2YR2 A;  4A93 J;  3HHH A;  2IW5 A;  1Y1V J;  2YPR A;  2BW3 B;  3CQZ J;  3L00 A;  2IGM A;  2PI0 A;  4CCN A;  2DA4 A;  5M3F J;  4A12 A;  3F8N A;  3KIO A;  2FA5 A;  1KYZ A;  4HNT A;  2DFF A;  2DA3 A;  1I39 A;  2A5Y B;  1UEL B;  4XLC A;  2V4J C;  2R5Z A;  4RB0 A;  3RYR A;  2VKV A;  2BYV E;  1Z77 A;  1VQP I;  4PJN A;  4BXX J;  1GXP A;  3TQN A;  2O6G E;  2F5C A;  2CH0 A;  4B3A A;  3DPT A;  1A5J A;  2FBH A;  1WI3 A;  2FRH A;  4MEY F;  4AU7 A;  5GAH J;  3FHZ A;  2DK8 A;  4IJA A;  1BL0 A;  3KEY A;  4EJW A;  2XC7 A;  1TNS A;  3LQR A;  5H6Q A;  1IDY A;  2X6X A;  4DBR A;  3I4N J;  2F5V A;  3DTI A;  3E1S A;  1Y8R B;  5D8L B;  1JKQ C;  1RKT A;  1Y0N A;  4MFD A;  4WXC A;  1OPC A;  3P5J A;  2DA6 A;  1FP2 A;  2VJ5 A;  4B48 A;  3CCS I;  2VT2 A;  5BMZ A;  1WKM A;  1RC9 A;  4IHV A;  2PJR B;  2CO5 A;  3HM5 A;  3TO6 A;  1QVT A;  5FLX Z;  2PBI A;  2X48 A;  3P9K A;  3ULQ B;  4BBR J;  3OYG A;  3CP2 A;  3QYF A;  4XKV A;  1YS7 A;  2F4O B;  3HOT A;  2UV1 A;  3EQL F;  2HZD A;  3R0J A;  3GTJ J;  4A3B J;  3PM1 A;  1QBJ A;  1FEX A;  1AHD P;  5L3F A;  4F92 B;  3CMM A;  4Q47 A;  5LFA A;  4II2 A;  2JSC A;  3LAJ A;  2CUJ A;  1P9Q C;  1ORK A;  1W1W E;  1LVK A;  4IOA F;  3JRI A;  1NG7 A;  5DD8 A;  1WHU A;  4XNF A;  2A6E F;  4KMF A;  1OCR H;  1HW2 A;  2E2H J;  4DW6 A;  3HTU A;  2ZXI A;  4MFE A;  1ZRF A;  4UB8 C;  3OYM A;  3HOS A;  2MSY A;  3ELK A;  4BBS J;  3ZMZ A;  1BR2 A;  1FMW A;  3PQJ A;  5ERI A;  2Q2E A;  3HKZ N;  5ICC A;  4RB1 A;  5HNH A;  2OQG A;  4G7Z F;  4RM3 A;  4UUS B;  3E5X A;  5IY5 H;  3ZCO A;  2KZV A;  3CDH A;  5FLX K;  1TWG J;  1VQN I;  2GXA A;  1IAW A;  3JAM Z;  3GWZ A;  3U9G A;  5GAE J;  2JSP A;  3EYI A;  2VB6 A;  2HDD A;  1D0Z A;  2OTJ I;  4I7H A;  4JQF A;  1EH8 A;  2ELH A;  4OWR B;  3CMA I;  5KVR A;  2L9V A;  5J8C A;  2JPB A;  1ON2 A;  4GYI A;  3OWT A;  2Y9Z A;  2ID3 A;  5L3D A;  4NUB A;  1JGG A;  1D1C A;  5E3O A;  4CSW A;  2M30 A;  2WB1 A;  1GUU A;  1TTY A;  4XQF A;  1IRF A;  2XUB A;  1P7J A;  2P6T A;  5C44 J;  3JRC A;  4CGZ A;  3IV5 A;  3S2W A;  1BI2 A;  4YFX F;  3CCY A;  1CF7 A;  4BJ6 C;  2RV8 A;  2OQR A;  2ZXH A;  1FPQ A;  1Y56 A;  3DKY A;  3CUQ C;  4LFU A;  3RPU A;  4BGD A;  3PIO F;  3CF2 A;  2O3F A;  1UMQ A;  3OYH A;  3SFZ A;  2L01 A;  4HV6 A;  1OCT C;  4YIR X;  3CCU I;  4PJJ A;  2A5W A;  2FEZ A;  2HPI A;  3BJO A;  1B4A A;  2HQ5 A;  3K1N A;  1RI7 A;  1QHG A;  3KFW X;  5EG0 B;  3OIP A;  2DDB A;  5D4S A;  1Z6R A;  3SYT A;  4EGY A;  2DMN A;  3GZN B;  1ZK8 A;  2HPM A;  2XGE A;  1YS6 A;  3ASO H;  3NRV A;  3JRB A;  1MGT A;  1SD7 A;  2O5R A;  2COB A;  3VOE A;  4XM3 A;  2JVH A;  5D5V B;  4LD5 A;  2L9N A;  2A6H F;  3E6B A;  2OAZ A;  1IG7 A;  4DIQ A;  1J5Y A;  5FD5 A;  3J81 Z;  4EM2 A;  4PJL A;  3RIR A;  3S17 J;  4XID A;  2K9M A;  4Z6Y A;  3BR3 A;  1FBQ A;  3OSG A;  1SFE A;  3N4M A;  4BAY A;  4PZJ A;  4CH7 A;  2ZKZ A;  1JI8 A;  2V1X A;  1RIO H;  2PG4 A;  2XHK A;  4BJT A;  2OTL I;  3A01 A;  2VLA A;  1OCO H;  4LIT A;  3WHB A;  2GZW A;  4CCM A;  3OSF A;  4B3X A;  3ESW B;  4RAY A;  2EV5 A;  4D5F A;  1RKW A;  5B1B H;  5DUI A;  2DJN A;  3B73 A;  3IWF A;  4KDP A;  2CMP A;  2ICW G;  3I56 I;  4MEX F;  1S29 A;  4DYC A;  1ONV A;  4E7K A;  1I3Q J;  1XDS A;  5B66 C;  3VPR A;  1ZHF A;  2F4I A;  5FFX A;  3ZXS A;  2BE5 F;  3EUH C;  5C4X J;  3T0Y A;  2A07 F;  3QPL A;  4BDY A;  3HYI A;  3QWL A;  5M5Y J;  3BLY A;  5HDN A;  4FTH A;  1KZH A;  3DBL B;  3J81 K;  3IKT A;  5J1U A;  3PFY A;  1FBS A;  4RAF A;  3S2H J;  1T95 A;  1WJ5 A;  4MTD A;  3MKZ A;  1KQ9 A;  3ZQH A;  2ETH A;  2ZJP F;  4PDK A;  2CRG A;  2FNA A;  2AS5 F;  3HOY J;  2EK5 A;  2XPW A;  2M8E A;  4PJ0 C;  3GTL J;  1TWF J;  5DUK A;  4ZYA A;  4D9J A;  4XOT A;  3S1R J;  1Q1V A;  1XTA A;  5C4J J;  1GXQ A;  4HG2 A;  5DV5 A;  3ABU A;  1F36 A;  2Z9O A;  1TT5 B;  2W82 A;  1R71 A;  2L54 A;  4UNO A;  1VQO I;  2L9R A;  3GFJ A;  2K9S A;  1X2N A;  4I02 A;  3M8J A;  3L9F A;  2H09 A;  4I01 A;  3M1E A;  5J4V A;  2VUM J;  1WQ2 A;  3MWM A;  1UG2 A;  2XF6 A;  4MGR A;  1RR7 A;  3S3M A;  2V9K A;  3TBI A;  1YW8 A;  5EDN A;  5D6F A;  2ZME A;  3HPH A;  2E7W A;  2P81 A;  3H1C A;  3QAH A;  3R6S A;  1KON A;  4AIJ A;  2FXA A;  5EEG A;  2GWR A;  1EV7 A;  4H0E A;  3KZI C;  4U7B A;  5BS6 A;  3ZR8 X;  1OLT A;  2NS8 A;  1N25 A;  1QNT A;  2JA7 J;  3NWS A;  1RPW A;  1UG0 A;  1ZAO A;  1W7P A;  2BVL A;  3CCV I;  3RPU D;  1R9T J;  2JA2 A;  5J3L A;  4DYR A;  2Y48 A;  1D5Y A;  1JUP A;  2YU3 A;  3OYE A;  4IEJ A;  2GM4 A;  3CMY A;  2LKS A;  4M73 A;  5JLX A;  1FYL A;  1GDT A;  5E17 F;  1QGP A;  3VSL A;  3FK6 A;  1LUJ B;  5ILV A;  3RKY A;  1K79 A;  4OIQ F;  3KZY A;  1W0T A;  2K3P A;  5K5O A;  3LA7 A;  2FD5 A;  2CU7 A;  4A69 C;  4HNV A;  2CQ7 A;  3K9T A;  2JTV A;  6PAX A;  2VN2 A;  4BJ5 C;  3LOC A;  4BU2 A;  2P0W A;  4HLY A;  5B3S H;  3IRR A;  2M0M A;  4I6Z A;  2I8D A;  3F8B A;  1O7F A;  4BY7 J;  2VQG A;  3WTY C;  1MMN A;  2BBY A;  2NNY A;  3TGN A;  1R5I D;  1LDK B;  3G1O A;  1H9T A;  4AIK A;  2RKH A;  2F5F A;  2CSO A;  3I59 A;  1J59 A;  1EF4 A;  3K4B A;  3KEQ A;  2ZO4 A;  5EZH A;  4A5M A;  2NYX A;  1MMG A;  1U0J A;  4I76 A;  3DTE A;  2HTJ A;  3E6M A;  1YRN A;  3GFL A;  2WV1 A;  1AWC A;  1O7L A;  2W1O A;  1ZRD A;  2R7T A;  2H94 A;  3IL2 A;  1T8I A;  3X2Q H;  2XAJ A;  4N9I A;  2CQX A;  2EFN A;  2R5Z B;  3KP7 A;  4U87 A;  1V5E A;  5BPD A;  2PMZ N;  1MSE C;  5LGT A;  4M6V A;  1XGM A;  2QUF A;  2HI3 A;  2F48 A;  1Z7L A;  4RB2 C;  5IT9 Z;  4F7Z A; 
#chains in the Genus database with same CATH homology
 2IP2 A;  4ETS A;  2QM3 A;  2EFQ A;  4UXN A;  2L3D A;  4G9Y A;  1RZ4 A;  2LNB A;  1USS A;  4XLN F;  3FMS A;  3F8M A;  1YQA A;  2Q0O A;  3ZMS A;  1IN8 A;  5D6E A;  4AD9 A;  2IA0 A;  3TOA A;  4EM1 A;  3F3X A;  3KCC A;  2KRF A;  1AOY A;  2HR3 A;  1IW7 F;  2R7F A;  2ESH A;  1HKS A;  3HRS A;  4UVC A;  1BOA A;  4CYD A;  5IT9 K;  2A61 A;  3E97 A;  1ZLJ A;  1FBU A;  1ZN2 A;  1Q1H A;  2D45 A;  2LKP A;  3QPT A;  3V7R A;  2IT0 A;  4EV0 A;  4YIF A;  5F1R A;  1QZZ A;  1UHW A;  3KP6 A;  2KJB A;  3T5X A;  1ULY A;  4ESB A;  4L0Z B;  2D2W A;  2F5D A;  1B59 A;  4BQA A;  4LB5 A;  2MLG A;  1XMK A;  1K6O A;  1CF7 B;  4IVN A;  1BI0 A;  1U5T A;  4BHP A;  2KKO A;  4I2O A;  4Q5S F;  4IF4 A;  4HW0 A;  3FZV A;  4OIP F;  5L3E A;  3GFM A;  3C1D A;  1KU3 A;  3DQV C;  3OOP A;  2K7L A;  5K5Q A;  3WTV C;  1HST A;  1I6X A;  5H6R A;  3H3U A;  4P96 A;  1FOK A;  2V79 A;  2GXG A;  2EV0 A;  1C0W A;  2M45 A;  1S7A A;  2W84 A;  3ZMV A;  3KLO A;  1R58 A;  3T1B A;  2ISY A;  1ZRC A;  3Q9S A;  3F8F A;  1LDJ A;  2V6C A;  4M9S A;  4KIF A;  4ASN A;  5D5X B;  1J75 A;  1UST A;  3TDZ C;  3ZMD A;  4YII A;  5LLQ A;  3MFK A;  1ZG5 A;  3KP4 A;  3JTH A;  1FT9 A;  4G6Q A;  1STZ A;  5KK1 A;  3HSR A;  2MLK A;  1L3L A;  4ZYG A;  3IKV A;  2P7C B;  1HW5 A;  1R36 A;  1XSX A;  5CVJ A;  5ILU A;  2V1U A;  2EFW A;  4P9F A;  4WK8 F;  1QO0 D;  3L09 A;  2ZNY A;  3RKX A;  1YLF A;  3U2R A;  4UHT A;  3VEP A;  4EJU A;  4BNC A;  2GAU A;  5F6F A;  5LGU A;  3ZQ7 A;  4R1H A;  2FOK A;  4OOI A;  4HQM A;  3WU1 B;  2V1D A;  1PP8 F;  3CO7 C;  4P9U A;  4FHT A;  2VBW A;  2DU9 A;  4A2U A;  3V7C A;  4CO8 A;  2ZME B;  2K4J A;  2XKP A;  4I09 A;  2STT A;  5DD4 A;  2ADU A;  3WTT C;  3CLO A;  1K7A A;  4Q4Z F;  4M9Z A;  1W7P B;  4QWQ A;  2XV4 S;  2W24 A;  3I0T A;  1ZYR F;  1XD7 A;  4GO1 A;  3DXJ F;  1PP7 U;  4L0Y B;  2QWW A;  2M5W A;  2RVC A;  3K1P A;  4KUM A;  4GCV A;  4JK1 X;  1FYK A;  2OZU A;  2MH9 A;  2O0Y A;  5E8G A;  3KP2 A;  4KNY A;  2DFI A;  3GXO A;  3Q5F A;  3CTA A;  3I58 A;  3LWF A;  3I59 B;  1TLH B;  2X0L A;  3V8J A;  3ECO A;  3G3Z A;  4KIG A;  2J5O A;  2LF7 A;  2EV6 A;  3BJ6 A;  2PFB A;  1HSJ A;  2WTE A;  5A2Q Z;  4O3M A;  1O3T A;  2K86 A;  3V8L A;  2E1N A;  1XDU A;  1JHH A;  2XAS A;  1WRJ A;  5FO5 A;  1EH7 A;  2QYO A;  2CYY A;  2DLL A;  5J8F A;  4HF2 A;  4AVP A;  4HYE A;  3V7S A;  2QZ8 A;  3I5U A;  4O5V A;  5FFZ A;  4EGZ A;  1XGS A;  3COA C;  1JGS A;  1IXR C;  2EB7 A;  2VBX A;  1YG2 A;  1OR7 A;  2PJP A;  1TW3 A;  3E3V A;  4OIO F;  5TRD A;  2LDU A;  3BP8 A;  1BI3 A;  1KU7 A;  2OBP A;  3BOQ A;  1XN7 A;  2ZBK A;  2BEO A;  4FX4 A;  1GVJ A;  1D8J A;  1J9I A;  1MKM A;  1R22 A;  5HLI A;  3PFI A;  5HVQ C;  3MAJ A;  3GUD A;  3L7W A;  3F22 A;  3JAM K;  2VC0 A;  1XCV A;  4I0A A;  4KA4 A;  3GYH X;  1XCB A;  1YTY A;  5AIQ A;  2VE8 A;  1H0M A;  1BIA A;  2XAG A;  4LG0 A;  4GYG A;  4Q48 A;  4M74 A;  3BWG A;  1U6G A;  3FWE A;  1UCR A;  1PDN C;  1XB4 A;  2VE9 A;  5JHU A;  2EJR A;  1YFH A;  4IHT A;  1P6R A;  1MJB A;  4LK1 F;  4ZZD A;  4M72 A;  2DW4 A;  1EH6 A;  1WI9 A;  1MJA A;  1U5T B;  5AON A;  4BH9 A;  1XGN A;  4DQ2 A;  1BC7 C;  1UHM A;  5BPI A;  1OMI A;  4IHS A;  5CVV A;  2STW A;  3WU0 A;  1Z91 A;  3T8R A;  1XSV A;  4N0B A;  2RC4 A;  1FSE A;  2QQB A;  4M71 A;  1ZLK A;  3P9C A;  2R3S A;  5HDK A;  1SFU A;  1KQ0 A;  3I64 A;  4AIH A;  3DV8 A;  3DEU A;  1O57 A;  2XAH A;  4FX0 A;  5TJJ A;  1LNW A;  2EA2 A;  4LLL A;  4U0V A;  2DO7 A;  3WTS C;  2JRT A;  2YX7 A;  2M1B A;  5AIP A;  1RNL A;  2B0L A;  4XRF A;  2DAO A;  2GA2 A;  4BHB A;  1SD4 A;  4BYY A;  2MBF A;  4UUV A;  2COM A;  3E6C C;  1IN5 A;  4G6D A;  1YYV A;  2DQL A;  2GQQ A;  3RJP A;  2FMY A;  3F21 A;  4ENK A;  3WG9 A;  5JI6 A;  5IT3 A;  4Y15 A;  4L5J A;  4OIN F;  1HBX G;  4OU0 A;  4IXA A;  4LB6 B;  3RI4 A;  3WGH A;  1G6N A;  4P55 A;  1ZG1 A;  1RUN A;  4RS8 A;  3ZN1 A;  3KEO A;  3SXY A;  4P5O A;  4U7D A;  1HQC A;  5HS8 A;  1L0O C;  1P4A A;  4CZZ A;  4IPA A;  3I4P A;  2OD5 A;  2CFX A;  3T8T A;  5E8I A;  5JFR A;  1TQI A;  2RQP A;  3RKW A;  1P4X A;  1QQI A;  2QBY A;  3E5Q A;  2VON A;  1S6L A;  3U1D A;  1CGP A;  1NHA A;  1GHC A;  3TOB A;  2IJL A;  1UFM A;  1U8R A;  1TQP A;  2FBK A;  2DBB A;  4A6D A;  2ACJ A;  1Z9C A;  3HRM A;  3KLN A;  1I27 A;  1D8K A;  3C18 A;  4BHC A;  2A69 F;  1FC3 A;  2W57 A;  1RUO A;  2ISZ A;  1I5Z A;  3MZY A;  3OV8 A;  1LQ1 A;  3BDD A;  4HA8 A;  2EFP A;  2DQR A;  4CHU A;  4HX4 A;  1MD0 A;  1TNT A;  4KIB A;  2JT1 A;  2RN7 A;  4MTE A;  4ON0 A;  1R00 A;  1HW1 A;  3FF5 A;  4HF0 A;  2FQ3 A;  2GA1 A;  3GFI A;  4M9X A;  1H9G A;  2G7H A;  3B02 A;  2HS5 A;  5LGN A;  2P7V B;  1IN4 A;  5K5R A;  1R1V A;  1SMY F;  5CYV A;  3KE2 A;  3AAF A;  1BI1 A;  2P5K A;  1IXC A;  4L18 B;  4L9V A;  2PQ8 A;  2VXZ A;  2F5E A;  5FB2 A;  1FLI A;  4AWX B;  4RGR A;  1F5T A;  2O8X A;  1FNN A;  1ZGA A;  1HKT A;  1QPM A;  3BRO A;  1V4R A;  5D8K B;  2Q8K A;  2YX4 A;  4DNC A;  5CVR A;  3CJN A;  1KYW A;  1D3Y A;  3KET A;  2IVM A;  4EMS A;  2HEO A;  1KU2 A;  3JSO A;  4ENJ A;  3JW4 A;  1BJA A;  1J0R A;  3LQQ A;  1FX7 A;  2HQN A;  4NHJ A;  2RDP A;  2A3S A;  2ESN A;  3F8C A;  4L9N A;  2IRF G;  1KA8 A;  3M9A A;  3FM5 A;  2FSW A;  4LG0 B;  3R4K A;  5E1W A;  5LHI A;  4ZYE A;  3WTW C;  1IUY A;  2WC2 A;  5HLG A;  5K1Y A;  3R61 A;  5CLS A;  4A0X A;  5HS9 A;  3ROU A;  4IRG A;  3C3W A;  3GO5 A;  1MDM A;  5LRR A;  1DPU A;  2ZNZ A;  1LJ9 A;  1MJ9 A;  5LEJ A;  3CUQ A;  1OYI A;  4ZH4 F;  2P5L C;  1R5G A;  4B09 A;  4HAM A;  2GXB A;  4HF1 A;  3L2C A;  3QRF F;  2HYF A;  3HSF A;  2NRA C;  2ZFW A;  4WWC A;  3WE3 A;  2MA3 A;  1S8N A;  3F23 A;  5L3B A;  4CXF A;  4PCQ A;  1ZAR A;  3RTR A;  3SZP A;  2FML A;  2JPC A;  2IA2 A;  2HTS A;  3G73 A;  1BN5 A;  3ZN0 A;  3KP3 A;  2Z99 A;  4GGG A;  3ZMT A;  4XLP F;  1YW7 A;  4RGX A;  1DPR A;  2TDX A;  2QLZ A;  4LGW A;  4EM0 B;  3W6K B;  4G8X A;  4ZZL A;  3F72 A;  2RNJ A;  4A6E A;  3GW2 A;  2VOO A;  2QQ9 A;  4LMY A;  1DDN A;  4HV5 A;  2KIU A;  3WTX C;  2DPD A;  3R60 A;  3EUH A;  4ENM A;  5LEK A;  1T6S A;  2R7D A;  2IA1 A;  2HKX A;  3KZZ A;  1U2W A;  2MD5 A;  1FP1 D;  3BJA A;  2EA4 A;  4MHG A;  1VTN C;  2Z3Y A;  3DF8 A;  2HQR A;  4UVA A;  1U3E M;  2FU4 A;  4IRH A;  2EWN A;  4HDV A;  2DPU A;  2UXX A;  3QP5 A;  1OYW A;  3DP7 A;  3WTZ A;  4A5N A;  2D1V A;  1T2K A;  4WXD A;  1LEA A;  4G7O F;  2XGX A;  4EVI A;  4KMU X;  4Y13 A;  3BPX A;  1G3W A;  2CQK A;  1OKR A;  4KFC A;  3JTG A;  2K4B A;  2CG4 A;  1SFX A;  3DPL C;  3MCZ A;  4G7H F;  2DT5 A;  2WWY A;  2NS0 A;  1W5T A;  3VOD A;  4RGS A;  5E18 F;  1XMA A;  2PMH A;  5DCF A;  1O3R A;  4N9H A;  1B1B A;  2ZXJ A;  3ML6 A;  1Z6T A;  2QBY B;  4CDG A;  5JVT A;  5D5U B;  4NB5 A;  2DK5 A;  4M6X A;  3LA3 A;  4UVB A;  3E5U A;  5HDG A;  1J7K A;  2VOD A;  2PEX A;  5HS7 A;  2CWE A;  5DCM A;  1O3S A;  4HX7 A;  2HWV A;  2HFH A;  2XAF A;  3W6J B;  1G3S A;  4CIC A;  3J80 Z;  2BGC A;  4MQV A;  2CW0 F;  1SAX A;  3Q9V A;  3BZ6 A;  2C6Y A;  3NQO A;  2XAQ A;  1U5T C;  5D5W B;  1BC8 C;  4HZF A;  4JBA A;  1S3J A;  1DP7 P;  3GVA A;  5A2Q K;  2H6C A;  4UV9 A;  2DI3 A;  1Z05 A;  2NAZ A;  2XIG A;  3F6O A;  2HYG D;  1K78 A;  2VBZ A;  4U0Y A;  3MZH A;  3HRT A;  1BBY A;  2HDC A;  2IPQ X;  3FM3 A;  4KYW A;  3J80 K;  3D5L A;  4L5I A;  1V3F A;  5EEH A;  4KIC A;  3QU3 A;  4EQQ A;  3ZMU A;  1F9N A;  2O61 A;  3TDU C;  2AXL A;  4ESF A;  3HTS B;  1TW2 A;  2ZCW A;  3FMR A;  3WOD F;  2A68 F;  2WV0 A;  1DUX C;  3TO9 A;  2BV6 A;  3K0L A;  1LB2 A;  1TQM A;  5E20 A;  3QOP A;  3VFZ A;  1REP C;  2OZ6 A;  4MNU A;  2HKO A;  4ENN A;  1R5H A;  3FXQ A;  3N97 A;  1IF1 A;  1LVA A;  2Y0M A;  5L3G A;  4Z2Y A;  3GF2 A;  4R79 A;  5HOO A;  2W85 A;  2W25 A;  3QU6 A;  3K1M A;  3FX3 A;  3P7N A;  2UWM A;  1G4D A;  3BY6 A;  4MQ9 F;  3FXU A;  3V8K A;  1G3Y A;  5DEQ A;  4L9J A;  3WGG A;  5F64 A;  5LRS A;  2O03 A;  3I54 A;  3DFG A;  1W4M A;  3O6B B;  3RPQ A;  1YW9 A;  2Y75 A;  4U0W A;  5DYM A;  3ERE D;  4A0Y A;  4RAZ A;  5JR3 A;  3HSE A;  1MDM B;  3HUG A;  3CUQ B;  3GLX A;  5ICF A;  3ABT A;  1IZ1 A;  1P92 A;  2P5V A;  2HZT A;  5E1Z B;  3P9I A;  2Z5U A;  1R1T A;  1YIO A;  3ISP A;  4ZYD A;  2F2E A;  1D5V A;  3K69 A;  3GX4 X;  3REO A;  3HIF A;  3ECH A;  3H92 A;  2LF8 A;  3CO6 C;  2Z33 A;  3D0S A;  2FNP A;  4S05 A;  2UXN A;  2VC1 A;  5LHH A;  5ICE A;  1IXS B;  3LST A;  3MQ0 A;  5J6X A;  4HBL A;  4S04 A;  1KQ8 A;  2UZK A;  2KIF A;  3QP6 A;  3RDI A;  4LLG F;  1A04 A;  4KN7 X;  3I71 A;  3R0A A;  2X4H A;  1G3T A;  5ED4 A;  4XSX F;  4ZYH A;  1TBX A;  5BOX A;  3IC7 A;  2LSO A;  3IHU A;  5D4R A;  2EFO A;  4ESJ A;  1KGS A;  2PMU A;  1ZH5 A;  3HHG A;  4WF2 A;  4L9T A;  3CUO A;  2ZJ2 A;  3JSP A;  1JXS A;  1FSH A;  3GZ5 A;  1ZRE A;  1MZB A;  1I1G A;  2QQA A;  4Y17 A;  1SD6 A;  2MH2 A;  1KU9 A;  3K2Z A;  1X3U A;  3M7G A;  1BM9 A;  1I1S A;  4EJO A;  3SHF A;  1OYY A;  4WX9 A;  3KP5 A;  4PGG A;  1PUE E;  3E6D A;  3ZP5 A;  2PLY A;  3LAP A;  1T38 A;  1B9M A;  2XRO A;  1YO5 C;  2XVC A;  3ZPL A;  1ON1 A;  4KT5 C;  2FE3 A;  3EET A;  2P8T A;  4I0B A;  3BPV A;  3TKY A;  1P4W A;  3LFK A;  4HX8 A;  3SZT A;  1Z7U A;  2P4W A;  4HLX A;  1FY7 A;  1JE8 A;  1HKQ A;  4QLC U;  1QZY A;  5HLH A;  2GIV A;  3V4G A;  2XKO A;  1J2X A;  3C7J A;  3TO7 A;  1LEB A;  3HRU A;  4HQE A;  2KIM A;  4U88 A;  4YFK F;  1IN7 A;  4YFN F;  3O3K A;  2M87 A;  5DCM B;  5FD6 A;  1ZGJ A;  1T39 A;  4RB3 C;  2OA4 A;  3FMQ A;  1XSD A;  4EJV A;  1IN6 A;  4E70 A;  5ICG A;  3IWZ A;  4M6Y A;  3RYP A;  4LK0 F;  1T0F A;  1U78 A;  1R23 A;  4EJT A;  2K02 A;  4R8H A;  3LA2 A;  4TV7 A;  4XBF A;  2D1H A;  1W7P D;  5DDG A;  2HGC A;  4D0P A;  2VT3 A;  4LLN A;  5CVI A;  1K78 B;  1R7J A;  2L02 A;  2OU2 A;  3I53 A;  3GZ6 A;  5BQT A;  2RGV A;  1T98 A;  3IRQ A;  4YG2 F;  4B8X A;  2G7U A;  3DKW A;  1E2X A;  3WGI A;  1SD5 A;  2CGP A;  3WE2 A;  1ODD A;  2YSR A;  5L3C A;  1FWZ A;  1S7O A;  1Y0U A;  3J7A O;  4K2E A;  1FZP B;  2H6B A;  3M8E A;  4FT8 A;  1B6A A;  1R1U A;  2KJC A;  3M8F A;  1Z1D A;  3F6V A;  1B9N A;  4UV8 A;  2FF4 A;  4I98 B;  3SQN A;  4WXH A;  2MC3 A;  1E17 A;  5ILS A;  4HOB A;  4XSZ F;  1BIB A;  1HXD A;  4O6J A;  2DTR A;  2V9V A;  2PN6 A;  4PGH A;  5FGM A;  5CJ9 A;  4OMY A;  4OMZ A;  1UB9 A;  2H27 A;  3EYY A;  2L4M A;  4BXU A;  2J5P A;  3WTU C;  2L4A A;  3O2P E;  2FBI A;  3FXR A;  1IRG A;  2VBY A;  1LDD A;  1P2F A;  3H3Z A;  3PQK A;  4KN4 X;  1FYM A;  1SMT A;  2E1C A;  5CVU A;  2QVO A;  1F1Z A;  2E7X A;  2HOE A;  1WSU A;  2K27 A;  4GXO A;  2VOP A;  2G9W A;  2NNN A;  4G94 A;  4A0Z A;  3QPH A;  5LHG A;  2JZY A;  2P6S A;  5LBQ A;  1F4K A;  4OIR F;  1JHF A;  5E1X A;  2XRN A;  3NEU A;  3MEX A;  4RGU A;  1O3Q A;  1WWX A;  1W5S A;  4LJZ F;  3VB2 A;  1ZG3 A;  4WCG A;  5H20 A;  4HDU A;  4IRI A;  4NQW A;  2QEN A;  1XGO A;  3EDP A;  3GEZ A;  2YR2 A;  3HHH A;  2IW5 A;  2YPR A;  3L00 A;  2PI0 A;  4A12 A;  3F8N A;  2FA5 A;  1KYZ A;  2A5Y B;  4RB0 A;  3RYR A;  2BYV E;  1GXP A;  3TQN A;  2O6G E;  2F5C A;  3DPT A;  2FBH A;  2FRH A;  4MEY F;  3FHZ A;  2DK8 A;  4IJA A;  4EJW A;  1TNS A;  3LQR A;  5H6Q A;  5D8L B;  4WXC A;  1OPC A;  1FP2 A;  5BMZ A;  2VT2 A;  1WKM A;  2CO5 A;  3TO6 A;  5FLX Z;  2PBI A;  3P9K A;  3ULQ B;  3HOT A;  1YS7 A;  3EQL F;  3R0J A;  1QBJ A;  5L3F A;  4Q47 A;  2JSC A;  3LAJ A;  5DD8 A;  2A6E F;  4KMF A;  1HW2 A;  3HTU A;  1ZRF A;  3HOS A;  3ELK A;  3ZMZ A;  3PQJ A;  5ERI A;  2Q2E A;  5ICC A;  4RB1 A;  2OQG A;  4G7Z F;  3E5X A;  3CDH A;  5FLX K;  1IAW A;  3JAM Z;  3GWZ A;  3U9G A;  3EYI A;  4I7H A;  4JQF A;  1EH8 A;  2ELH A;  5KVR A;  5J8C A;  2JPB A;  1ON2 A;  4GYI A;  5L3D A;  2M30 A;  1TTY A;  1IRF A;  2XUB A;  2P6T A;  4CGZ A;  3S2W A;  1BI2 A;  4YFX F;  1CF7 A;  2RV8 A;  2OQR A;  1FPQ A;  4LFU A;  3CUQ C;  3RPU A;  2O3F A;  3SFZ A;  2L01 A;  4HV6 A;  2FEZ A;  3BJO A;  1B4A A;  3K1N A;  1RI7 A;  3KFW X;  5D4S A;  1Z6R A;  4EGY A;  1YS6 A;  3NRV A;  1MGT A;  1SD7 A;  3VOE A;  5D5V B;  4LD5 A;  2A6H F;  3E6B A;  2OAZ A;  3J81 Z;  1J5Y A;  5FD5 A;  4EM2 A;  3RIR A;  1FBQ A;  1SFE A;  3N4M A;  4BAY A;  4PZJ A;  2ZKZ A;  2V1X A;  1RIO H;  2PG4 A;  2XHK A;  2GZW A;  4RAY A;  2EV5 A;  5DUI A;  3B73 A;  3IWF A;  4KDP A;  4MEX F;  1S29 A;  1ONV A;  1XDS A;  1ZHF A;  5FFX A;  2BE5 F;  3T0Y A;  2A07 F;  3HYI A;  5HDN A;  3J81 K;  3IKT A;  1FBS A;  4MTD A;  1KQ9 A;  2ETH A;  4PDK A;  2FNA A;  2AS5 F;  2EK5 A;  2M8E A;  5DUK A;  1GXQ A;  5DV5 A;  3ABU A;  2Z9O A;  2L54 A;  4UNO A;  3GFJ A;  4I02 A;  3L9F A;  2H09 A;  4I01 A;  3M1E A;  1WQ2 A;  3MWM A;  4MGR A;  1YW8 A;  5D6F A;  2ZME A;  2E7W A;  3QAH A;  3R6S A;  4AIJ A;  2FXA A;  5EEG A;  2GWR A;  1EV7 A;  4H0E A;  4U7B A;  5BS6 A;  1QNT A;  1ZAO A;  1W7P A;  2Y48 A;  2YU3 A;  4M73 A;  1FYL A;  5E17 F;  1QGP A;  5ILV A;  3RKY A;  1K79 A;  4OIQ F;  3KZY A;  5K5O A;  3LA7 A;  3K9T A;  2JTV A;  6PAX A;  2VN2 A;  4HLY A;  3IRR A;  3F8B A;  1O7F A;  3WTY C;  2BBY A;  2NNY A;  3TGN A;  1LDK B;  1H9T A;  4AIK A;  2RKH A;  2F5F A;  2CSO A;  3I59 A;  1J59 A;  3KEQ A;  2ZO4 A;  4A5M A;  2NYX A;  2HTJ A;  3E6M A;  3GFL A;  1AWC A;  1O7L A;  1ZRD A;  2H94 A;  3IL2 A;  2XAJ A;  4N9I A;  2EFN A;  3KP7 A;  5BPD A;  5LGT A;  1XGM A;  2QUF A;  4RB2 C;  5IT9 Z;  4F7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...