4HLYA

The complex crystal structure of the dna binding domain of virf-1 from the oncogenic kshv with dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
KASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the DNA-binding domain of vIRF-1 from the oncogenic KSHV reveals a conserved fold for DNA binding and reinforces its role as a transcription factor.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Dna binding protein/dna
molecule keywords K9
total genus 30
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hlyA00
2DW4A 4WXHA 2XASA 4L9JA 1AWCA 1TBXA 2XRNA 1FY7A 2P4WA 1P6RA 3BJOA 3HHGA 2DU9A 4UV9A 5H20A 2P6SA 3HTSB 3P7NA 1K78A 4U0YA 3VEPA 2OQGA 1J75A 5JVTA 4AD9A 1HBXG 2J5OA 1W5SA 1XSVA 3ERED 3LA3A 1CGPA 2ISZA 1XCBA 5JHUA 4EV0A 1JE8A 1ZGAA 3KP3A 4Q5SF 2E1NA 2PG4A 3KEOA 3P9KA 1JGSA 3K0LA 1BN5A 5K5RA 3F6OA 3QU6A 4MQ9F 4PGHA 1Z9CA 4LK1F 1DUXC 1OKRA 2L4AA 2VONA 5LHGA 4U0WA 5HS7A 4M6XA 3CUQA 1ZH5A 3HIFA 5D4SA 1SD6A 1FC3A 3RKYA 3DEUA 1XGOA 1S6LA 2IT0A 4HQEA 4Z2YA 3M8FA 2Q0OA 2E1CA 1ZARA 2YSRA 5LGNA 2H94A 3GFJA 4KN4X 1T38A 3F8MA 2F5CA 4MGRA 4KIFA 5D5WB 2DBBA 3C7JA 1GXPA 3E3VA 1YYVA 4WCGA 3I53A 2IRFG 2H09A 4LLLA 4Y15A 1KU7A 4KN7X 5J6XA 2VBYA 3ECOA 3SZPA 4AIKA 2DT5A 4IXAA 4EMSA 4DQ2A 3TOAA 2CFXA 4EJOA 6PAXA 1RUOA 4FT8A 1J0RA 4CZZA 4S05A 1F1ZA 1I1SA 5FD6A 2QENA 3HSRA 1K7AA 4L18B 1R7JA 2V9VA 1ZLKA 1PDNC 1WI9A 2HQRA 3L09A 2CW0F 4LG0A 2GAUA 2W24A 4XRFA 4XLPF 2Z99A 4R79A 2D1VA 2HEOA 2XAQA 2HS5A 1R1VA 4MNUA 2X0LA 2ESHA 3GXOA 3RKWA 1SFXA 1LJ9A 2VN2A 2K27A 5FLXZ 1G3WA 1JHFA 1U5TA 3ZN0A 2MBFA 5D8KB 3J80K 4OU0A 1EH7A 3U9GA 2K4BA 2EA2A 1O7LA 1SD4A 1FZPB 4DNCA 4LK0F 1B9MA 2L3DA 2XROA 4A5NA 2L4MA 2FXAA 2MLGA 1C0WA 3KLOA 2GIVA 5HDGA 1BIAA 4PGGA 2PQ8A 2H6BA 1S29A 3BPVA 4LFUA 5DD4A 2ZCWA 3RJPA 4UNOA 3V7RA 1CF7A 1RNLA 3KP6A 2VBZA 3F8FA 4OIOF 3DPLC 5LEKA 2HTSA 1ONVA 4ESBA 5E1WA 1R00A 3LQRA 4U7BA 1BI0A 4R1HA 5HLGA 3H3ZA 2HKXA 2O6GE 2XIGA 3I54A 5AONA 4UV8A 4HAMA 3ZQ7A 4I7HA 1F5TA 1Y0UA 3TO7A 5F64A 3C1DA 3JTHA 2D2WA 3V8LA 2VE9A 4HX7A 3LA2A 1P4XA 5L3EA 1W7PB 4MTEA 4MEYF 3Q9SA 4M9SA 2QM3A 5BQTA 4L0YB 4WWCA 1MJ9A 3I0TA 4ZYHA 2DLLA 4G7HF 4ZYGA 4I02A 4RB1A 1IF1A 1TLHB 1O3RA 1DPUA 3IHUA 4LGWA 2OQRA 3T5XA 1XD7A 4P9UA 1YO5C 1R1UA 5CJ9A 3M8EA 4UXNA 2PBIA 4F7ZA 2FBHA 1ZRDA 1B1BA 1BC7C 3LWFA 2RGVA 2BEOA 3GUDA 2HDCA 1ZN2A 1WWXA 3KZZA 2M5WA 2HKOA 5L3DA 5ICEA 3P9IA 4EM2A 5TRDA 5CVIA 2Z9OA 4ETSA 2WV0A 2VE8A 1ZG1A 2EFWA 4HDUA 1ZGJA 3EQLF 4N0BA 5F6FA 1K78B 2ZMEB 4AWXB 1OPCA 5L3FA 3WODF 3BPXA 1KQ8A 3IRQA 4WF2A 3RKXA 5EEGA 3KCCA 3GW2A 2IA2A 3GF2A 2M45A 4O5VA 3FMRA 3IKTA 1HXDA 1FP1D 1IRFA 3DXJF 4HQMA 4IPAA 3VFZA 1TQIA 5CVRA 1QPMA 1Z1DA 2CWEA 3F6VA 5LLQA 4YIIA 4NQWA 4BH9A 3OV8A 5DCMA 2XAJA 3GLXA 3IL2A 4IRHA 2DAOA 5HDNA 1W7PD 3REOA 1IW7F 4WXDA 1QBJA 2A6HF 2BBYA 2FF4A 3TQNA 2ETHA 1FT9A 3BJAA 3R0JA 2IJLA 2OA4A 1PUEE 1QNTA 3ZMDA 1UB9A 1Z05A 2NRAC 1IXSB 2FMLA 4CHUA 3N97A 3CO6C 1R22A 2V79A 1IAWA 3NRVA 1U5TC 2P8TA 4YFXF 3PFIA 3JW4A 3WE2A 4RAZA 1KQ9A 1XMKA 4Y13A 3FM3A 3IRRA 5A2QZ 4LD5A 3E5QA 1FNNA 4I09A 5ICGA 4RB0A 3L7WA 3MCZA 4IRGA 1MZBA 5AIPA 1F9NA 1YQAA 3CUOA 4O6JA 2FMYA 2JRTA 3GWZA 4QLCU 3DV8A 2DTRA 1D8KA 4P5OA 2PJPA 1ZG3A 3R60A 1FSHA 3K1NA 3BWGA 2IVMA 2LF7A 3CUQB 1YTYA 1G3YA 5DUIA 4KDPA 2Z3YA 5L3BA 2IA1A 4L0ZB 3TDZC 3HTUA 3LA7A 2CGPA 2JZYA 4LJZF 2C6YA 1HW5A 5DV5A 1PP7U 1ZREA 3E6CC 3HSEA 4M72A 3DFGA 5FB2A 3IC7A 1UHMA 4KICA 2QZ8A 1GXQA 1MDMB 3GFMA 3SXYA 3SFZA 4IHTA 2PMUA 2FNPA 2IPQX 3KFWX 3W6JB 5DYMA 3I71A 2QQAA 3KP2A 5HDKA 1HW1A 4P9FA 1OYIA 2FRHA 2UZKA 5FGMA 1H9TA 4AVPA 2RKHA 5HVQC 5L3GA 1MDMA 4EM1A 1QZZA 4ENJA 5E8GA 1G3TA 4GYIA 4G94A 3F23A 4M71A 5JR3A 3E6BA 4CICA 2PEXA 3WTZA 5DCFA 3FXUA 2E7WA 1XMAA 2EWNA 4RS8A 2COMA 2A69F 1FBSA 4HF0A 2KJBA 5H6QA 4EJVA 4KMFA 4U7DA 4CYDA 2EFOA 4LLGF 4YG2F 4IVNA 2W84A 3F21A 1JXSA 4R8HA 1D3YA 2CQKA 1MGTA 2YR2A 2TDXA 4BHBA 1T98A 1FYMA 2OAZA 3JAMZ 2YPRA 3I5UA 1YLFA 3DP7A 2Z5UA 4XLNF 4HLYA 3L00A 3BY6A 3TGNA 2ZNZA 4ENKA 1D5VA 1BM9A 2RDPA 3OOPA 4XBFA 1T2KA 2EFNA 1STZA 2KIMA 2V1UA 2LNBA 3HSFA 1H9GA 1O7FA 3L9FA 1W7PA 3GFLA 5E1ZB 3BDDA 3G3ZA 4LB6B 1P2FA 4MQVA 2XKOA 4M9XA 1IRGA 4PCQA 2STTA 3M7GA 4UVAA 4UUVA 2NAZA 4A0XA 4ESFA 1KU9A 3FXRA 3CJNA 2M87A 5D6FA 4OIRF 3EDPA 4RB3C 4EGZA 4G7ZF 1LQ1A 3E5UA 2HOEA 4A2UA 5L3CA 3T1BA 2FBKA 2P5KA 1ZG5A 3G73A 3KP4A 2O0YA 5FD5A 3ROUA 3FF5A 3RDIA 1FPQA 3FX3A 3ZP5A 5IT9Z 4HOBA 2K02A 1LVAA 2V6CA 2VC0A 2VBXA 3ISPA 1RIOH 2H6CA 2NS0A 3IWFA 2F2EA 2QBYA 3F3XA 1SAXA 1T0FA 3CDHA 3CLOA 1ON1A 3L2CA 3B02A 3MQ0A 1K79A 4KUMA 1USTA 4HDVA 4IRIA 2O03A 4GO1A 3WG9A 3ZPLA 1FP2A 3VOEA 2JT1A 5D6EA 3E6DA 4EM0B 2VT2A 2HFHA 4UVCA 4Q48A 4ASNA 3WE3A 5ERIA 2Z33A 2XGXA 5IT3A 2PN6A 1I6XA 1HW2A 1PP8F 4LG0B 4XSZF 2G7UA 3O3KA 2FQ3A 3BROA 5CLSA 2V1DA 3I59B 1J59A 3J81K 3ZMSA 1GHCA 2HTJA 4ENMA 4YIFA 2VC1A 1IN5A 1FSEA 2EV0A 4UHTA 3ZMUA 2DQRA 3CO7C 3V8JA 1MD0A 4KNYA 2AXLA 4GGGA 1R5HA 3R4KA 3DF8A 4N9HA 1ZYRF 4HF2A 3ELKA 1QQIA 2KRFA 1D8JA 3WTUC 2L02A 2XAHA 3QRFF 1MJBA 4L9TA 5LGTA 5EEHA 1Z7UA 1XDSA 5DCMB 1G6NA 3FXQA 2CYYA 4A6DA 4G6QA 2MA3A 2IW5A 3JSPA 4WK8F 5HOOA 1Z6RA 5LRSA 4XSXF 3E5XA 3H92A 1SFEA 1YW8A 2GXBA 4M73A 3QU3A 5ILSA 1U2WA 1O3SA 1XGSA 4JQFA 1BBYA 2GWRA 3PQKA 4UVBA 3TDUC 3HOSA 2OZ6A 5D5XB 2RNJA 4IHSA 2P5VA 2A07F 5BMZA 5HS8A 3WTSC 5E20A 1KA8A 4OMYA 3C3WA 1RI7A 2ESNA 2DQLA 1OMIA 4CDGA 3E6MA 3N4MA 2FBIA 5BS6A 1FX7A 2PI0A 1REPC 2HZTA 3SZTA 5E17F 5D8LB 5KVRA 1IZ1A 5LHIA 5E1XA 2O8XA 4I0BA 4LB5A 2BE5F 3SQNA 2LDUA 2VOPA 3FMSA 2J5PA 1DP7P 4KFCA 2EFPA 5CVUA 4B09A 4A6EA 4FX0A 4A0YA 4BAYA 1MJAA 3HRSA 3F8BA 5ILVA 4EJWA 2MH9A 3W6KB 3FM5A 1FBQA 2UXXA 2KJCA 3ZMTA 2MD5A 1ODDA 1XN7A 1UHWA 4I2OA 1SMYF 2OBPA 3T8TA 2ZJ2A 1Z91A 1ZRFA 3WU1B 2IA0A 1KYWA 5LEJA 3EETA 5H6RA 2EJRA 1XDUA 1BI1A 3GVAA 2EA4A 4M6YA 4GXOA 4ZH4F 2EK5A 3VB2A 4BQAA 4I0AA 1FBUA 3CUQC 4A0ZA 2GA2A 5LHHA 1BC8C 3R6SA 2FU4A 4NHJA 1YS6A 2Q2EA 1G4DA 4ON0A 1SMTA 2DPUA 1FYLA 3K9TA 3MZYA 4CO8A 3C18A 2NNYA 1I27A 2XV4S 4CGZA 1S7AA 4A5MA 5DUKA 3TOBA 3PQJA 4S04A 2QWWA 2AS5F 1UCRA 2P6TA 3AAFA 4Q4ZF 2DPDA 2CSOA 4BYYA 2FEZA 2HR3A 5E8IA 1BI2A 2Y48A 3M9AA 2A68F 4CXFA 1QZYA 1ON2A 1LB2A 4D0PA 4L5IA 1FWZA 4K2EA 5J8FA 5FFZA 4GYGA 2FOKA 1DDNA 3LFKA 4HX8A 5ILUA 1TNTA 4JK1X 2F5FA 4Y17A 4EVIA 1R23A 4Q47A 2RVCA 4KYWA 2L54A 5K5OA 3TKYA 3J81Z 5JI6A 2NYXA 3IKVA 1B9NA 3RYPA 3GFIA 1A04A 3ABTA 3BP8A 3WTVC 4HYEA 1J2XA 4O3MA 5BOXA 3I4PA 2V1XA 3GYHX 1J9IA 4U88A 2R3SA 4KA4A 1LDDA 2M1BA 4OIQF 2WC2A 2KIFA 5BPDA 4AIHA 2OZUA 4L9VA 1W5TA 2FSWA 2R7DA 3SHFA 4OIPF 4JBAA 2WWYA 3KLNA 4YFKF 3LAJA 4OINF 3ULQB 3WTYC 3T0YA 2NNNA 3MAJA 1J7KA 2VOOA 1XSXA 3QPHA 2XUBA 4KMUX 1TQPA 3NEUA 4RGRA 3BOQA 2JPCA 1B6AA 5FFXA 5D4RA 1BI3A 3KETA 2LSOA 2L01A 2PFBA 4HV6A 3RIRA 4NB5A 5ED4A 2RC4A 1IUYA 5CVVA 5IT9K 1LEAA 4HA8A 3HRMA 1U3EM 3WGGA 2QQ9A 3DQVC 1XGNA 3KEQA 1E17A 3V8KA 2MC3A 1EH8A 1L3LA 1SD7A 1B59A 1KQ0A 1HKTA 4PZJA 4RGXA 1ZAOA 3KP7A 1YFHA 2FNAA 2HYGD 5ICCA 1P92A 4MEXF 2X4HA 3LAPA 2XKPA 4RGUA 5F1RA 5AIQA 1V4RA 3WTXC 3FHZA 4EGYA 1HSJA 1T39A 3ZN1A 4ZYEA 3I58A 1ZRCA 2D45A 2P7VB 1TW3A 2EV5A 3RI4A 1RZ4A 4G9YA 3GZ5A 3EUHA 2O3FA 3WGHA 2GXGA 4M74A 5CVJA 1TTYA 4PDKA 2F5EA 2MLKA 4MTDA 4KIGA 1ZHFA 3F22A 2DK5A 3ECHA 2XAFA 2VODA 3K1MA 3ML6A 5FO5A 2K7LA 3TO6A 4ZZLA 3K2ZA 1HKSA 1YG2A 1I5ZA 2QYOA 5K1YA 1LNWA 3O2PE 2ZFWA 3K69A 1EV7A 1LDKB 2ADUA 2RV8A 4L5JA 1TQMA 5D5UB 1NHAA 2BYVE 2CG4A 2R7FA 4KT5C 1FOKA 4IF4A 3T8RA 1K6OA 1R5GA 2F5DA 3V7CA 2P5LC 3BJ6A 4HV5A 4EJUA 3QP5A 4G8XA 3I59A 2HQNA 2WTEA 1ZLJA 4I01A 4HX4A 4WXCA 3VODA 1JHHA 3D0SA 1HQCA 2JTVA 1UFMA 2W85A 2DO7A 4HZFA 1TW2A 5D5VB 3KE2A 3FZVA 2M8EA 1CF7B 2EFQA 4LMYA 4RGSA 3M1EA 4P96A 1SD5A 2FE3A 4BNCA 2A5YB 4HF1A 2P7CB 2QUFA 5LGUA 4HW0A 3TO9A 2H27A 5HS9A 2XVCA 3GEZA 3FWEA 3WTWC 2KKOA 4RAYA 1QO0D 3U1DA 3RYRA 3JSOA 3COAC 3HRTA 1RUNA 1J5YA 4H0EA 1W4MA 5BPIA 4BHPA 1YS7A 3DPTA 2BGCA 2XHKA 2ZO4A 1XSDA 5K5QA 1KYZA 3D5LA 3O6BB 1HKQA 1Z6TA 2A6EF 3BZ6A 1YIOA 5J8CA 1USSA 2GQQA 2B0LA 2O61A 3Q5FA 3QAHA 5ICFA 1WQ2A 3MEXA 3QPTA 1LEBA 1EH6A 3LQQA 1IN8A 3GZ6A 1O3TA 3V4GA 2ELHA 2ISYA 4MHGA 4G6DA 5KK1A 1FYKA 1R58A 1HSTA 5HLHA 1GVJA 1YW9A 4KIBA 2VXZA 3QOPA 2QQBA 2UXNA 4BHCA 3S2WA 5LRRA 4WX9A 2ZXJA 1I1GA 1B4AA 4YFNF 3RTRA 2M30A 1KU2A 2ZBKA 4G7OF 1F4KA 3E97A 1S7OA 3RPQA 4L9NA 3R61A 5CYVA 1SFUA 3K1PA 4BXUA 2ZKZA 2CO5A 3P9CA 4IJAA 1TNSA 3H3UA 1U78A 4QWQA 1OR7A 5E18F 2Y75A 2FA5A 3Q9VA 5JFRA 2DI3A 2MH2A 3U2RA 2UWMA 1BJAA 4TV7A 3FMQA 3F8NA 2K4JA 3R0AA 3F8CA 2GA1A 3JAMK 1XB4A 1U8RA 1KU3A 4FHTA 1XCVA 5TJJA 2QBYB 1AOYA 2PLYA 1MKMA 3EYIA 4ENNA 3GO5A 1IN6A 2JPBA 1IXCA 1S3JA 1WRJA 1XGMA 3DKWA 1QGPA 4M9ZA 1BIBA 1ULYA 2IP2A 5DDGA 4A12A 3QP6A 2RN7A 3HHHA 1IN4A 3HYIA 5DD8A 1H0MA 4ZYDA 2ACJA 1OYWA 3HRUA 2G7HA 4B8XA 3MZHA 1U5TB 2STWA 1G3SA 2YU3A 2W57A 3WGIA 3B73A 2ZMEA 3ZMVA 3KZYA 1U6GA 2D1HA 5DEQA 2KIUA 2Q8KA 4I98B 1X3UA 1VTNC 4ESJA 3WTTC 1E2XA 4E70A 3GX4X 3F72A 3IWZA 5HLIA 2HYFA 2K86A 5LBQA 1IXRC 2A61A 1FLIA 3HOTA 2DK8A 2OD5A 1P4WA 2W25A 4OMZA 2GZWA 3WU0A 2EV6A 3ZMZA 2G9WA 4EJTA 2ZNYA 1LDJA 3EYYA 4ZZDA 2HGCA 2YX4A 1S8NA 1R1TA 2DFIA 2RQPA 1R36A 4N9IA 4HLXA 3J7AO 1O57A 1IN7A 3RPUA 2Y0MA 1DPRA 1WSUA 3CTAA 2QLZA 2XAGA 3V7SA 1KGSA 3KP5A 2LKPA 1P4AA 3NQOA 1O3QA 4HBLA 4GCVA 2JSCA 4FX4A 3HUGA 4U0VA 2HWVA 4OOIA 2BV6A 2VBWA 3MWMA 1Q1HA 1BOAA 2E7XA 1OYYA 4RB2C 1YW7A 1L0OC 2OU2A 2QVOA 1T6SA 3MFKA 2PMHA 2EB7A 4P55A 2VT3A 3ABUA 3LSTA 1V3FA 3J80Z 4EQQA 2LF8A 5FLXK 2YX7A 4LLNA 4AIJA 1WKMA 5A2QK 3I64A 3JTGA 2A3SA
chains in the Genus database with same CATH superfamily
2W1OA 4E7JA 2DW4A 4Y52J 2HI3A 3CCEI 5B1BH 4WXHA 2XASA 4L9JA 3CCVI 1JTXA 3E0JB 1AWCA 1TBXA 2UUZA 2XRNA 4XKVA 1XS9A 2O8KA 3CMYA 1FY7A 4JP0A 2P4WA 3EUHC 1P6RA 2M9HA 4GFBA 3BJOA 3HHGA 2DU9A 4UV9A 5H20A 2P6SA 4H4KC 3HTSB 1ZR2A 3OIOA 3P7NA 1K78A 4U0YA 3OYLA 3VEPA 4V2FA 3GTKJ 4PK4A 2OQGA 3TBIA 3AL0C 1M1EB 2R5YB 1J75A 5JVTA 3OYGA 4AD9A 2LLKA 4ZC3A 1HBXG 2J5OA 1W5SA 1XSVA 3ERED 3LA3A 1CGPA 5CPRB 2ISZA 1XCBA 5JHUA 4EV0A 1MMAA 1JE8A 1ZGAA 2OCCH 3KP3A 4Q5SF 2E1NA 5GTIC 2PG4A 1B8IB 5EF6A 3KEOA 3P9KA 1JGSA 3K0LA 2WV1A 1H88C 1VQ9I 2EZHA 1BN5A 5K5RA 3F6OA 3QU6A 4MQ9F 2JA6J 4B48A 4PGHA 1VQ6I 1Z9CA 3DEWA 4LK1F 4Z6YA 1DUXC 3I4MJ 3HGYA 3SEZA 4B43A 1OKRA 2L4AA 3HC7A 5CQEA 2VONA 1GV2A 2V9KA 1X4OA 5LHGA 3JRCA 4U0WA 5HS7A 1OCCH 4ITVA 3A2KA 4M6XA 2IGOA 3CUQA 2Y2ZA 4PSXA 3DLAA 3ZQHA 1ZH5A 3HIFA 2E2IJ 4PFOA 2DOAA 4QSHA 5D4SA 1SD6A 1FC3A 3ZRGA 4Y3OA 1UAAA 3RKYA 3DEUA 3CMMA 1BW5A 1XGOA 1S6LA 2IT0A 4HQEA 4Z2YA 3DKYA 3M8FA 2Q0OA 2DT7B 2E1CA 1ZARA 2YSRA 5LGNA 2H94A 3GFJA 4KN4X 1T38A 3F8MA 4PFPA 3CCRI 4IZZA 2F5CA 4XNFA 4MGRA 4KIFA 5D5WB 5KAIC 2DBBA 3C7JA 1GXPA 3E3VA 1YYVA 4WCGA 1QHHD 3I53A 1POGA 3DU6A 2HXIA 2VB6A 2IRFG 2H09A 2JRMA 4LLLA 3FXOA 4Y15A 1KU7A 1WCMJ 4KN7X 5J6XA 3BT9A 2M7BA 5JLXA 3BG6A 1G2HA 2ID6A 3H3VK 2VBYA 3ECOA 3NWTA 3SZPA 4AIKA 1IV8A 5DM6F 4IOAF 2DT5A 1WJCA 1Y6IA 1Z0XA 4IXAA 4EMSA 4DQ2A 3TOAA 2DJNA 2OPTA 3ZCOA 2CFXA 2LC2A 4EJOA 5IYCJ 2ECCA 3BG9A 6PAXA 1TWAJ 4FT8A 3K70D 4LOCA 1J0RA 3W2WA 4CZZA 4S05A 1RUOA 3EUKL 1F1ZA 1I1SA 1MSEC 2QEXI 5FD6A 1DU0A 2QENA 2HOTA 3HSRA 1K7AA 4L18B 3S17J 2CH0A 1R7JA 2V9VA 3GTJJ 1ZLKA 2MFZA 1KZHA 2XF6A 3IAS2 1PDNC 2DOFA 1WI9A 4A3LJ 2HQRA 1VNDA 3SYTA 1LFUP 4BBRJ 3L09A 2CW0F 4LG0A 2GAUA 2W24A 4XRFA 2MW8A 4XLPF 3CZ6A 2Z99A 4R79A 2D1VA 2HEOA 2XAQA 2HS5A 4A3FJ 1R1VA 1OCZH 4MNUA 2JA2A 3K4LA 4I76A 1RETA 2X0LA 4RLQA 2E1MB 2ESHA 2R4GA 2QSFX 3GXOA 1G8XA 4QPQA 2WAEA 3RKWA 1SFXA 4XKCA 1LJ9A 3OYAA 2VN2A 1Y1VJ 1U9NA 2K27A 5FLXZ 1G3WA 2MD0A 1JHFA 1U5TA 3ZN0A 2MBFA 3GZNB 3ESWB 5D8KB 2MABA 4OU0A 3J80K 3E1SA 1EH7A 3U9GA 1MBKA 2K4BA 2EA2A 1O7LA 1SD4A 3GLLA 3S16J 3DKXA 4C30A 4LK0F 4DNCA 4AVZA 1B9MA 2L3DA 5J1UA 2XROA 1FZPB 4A3GJ 3ASNH 4A5NA 2L4MA 2FXAA 1MNMC 2L7MP 5E3MA 2MLGA 3OYJA 1C0WA 4XOTA 2ZSIB 2RQQA 3KLOA 2GIVA 5HODA 5GPCA 5HDGA 1DU6A 1FJLA 1BIAA 4PGGA 3HOYJ 2E5ZA 2PQ8A 2H6BA 3PNYA 3ZXSA 1S29A 3BPVA 1TWFJ 4LFUA 1TT5B 2MG4A 5DD4A 2ZCWA 3RJPA 4UNOA 3V7RA 1QPIA 3FKJA 5KCMA 4CA0A 2JA8J 1CF7A 1RNLA 3KP6A 2VBZA 4D5FA 2CU7A 3KYCB 5E3LA 1JUMA 2XDVA 3F8FA 4OIOF 2HVQA 3DPLC 5LEKA 2DA2A 2HTSA 1ZK8A 2HPMA 1ONVA 4ESBA 5E1WA 3BTLA 1R00A 3LQRA 4YELA 5FKKA 1S5LC 1W0UA 3OYBA 3RCOA 3MKYB 2O7OA 4U7BA 1BI0A 1UMQA 4R1HA 2W7NA 2F4OB 4XLHA 2QF7A 5HLGA 3H3ZA 5JLWA 2G0EA 2HKXA 2O6GE 2XIGA 3I54A 1MMDA 2VASA 5AONA 4X0GA 1IC8A 4IHVA 4UV8A 2EZIA 4HAMA 2R7UA 3ZQ7A 5FLVA 4I7HA 1F5TA 1Y0NA 1Y0UA 3TO7A 5F64A 3I4NJ 3C1DA 1R9TJ 3G71I 3JTHA 3LNQA 2E1OA 2D2WA 2ZJQF 3V8LA 4ZDPA 2M3AA 2BXZA 2VE9A 2NVQJ 4HX7A 3LA2A 1P4XA 5L3EA 1Z77A 2IEKA 1P7JA 1A35A 1W7PB 4FASD 4MTEA 5F1JA 4MEYF 3HKZN 2XB0X 2FJ1A 3Q9SA 4M9SA 2QM3A 3H1CA 5DTDA 5BQTA 4L0YB 2IXSA 4AU7A 1MJ9A 4WWCA 3H0DA 3I0TA 4ZYHA 3J7ZI 3GTLJ 2DA6A 3FK6A 2DLLA 2CQ7A 3I3LA 2NOGA 4G7HF 4ZYGA 3HPHA 1D0XA 4I02A 4RB1A 1IF1A 1TLHB 1R4NB 1YRNA 1BL0A 3K4KA 1O3RA 2IGMA 2OCEA 1DPUA 3IHUA 3BR2A 4LGWA 2OQRA 2R7QA 2DFFA 3T5XA 1XD7A 3HGGA 4P9UA 1YO5C 4A3BJ 1R1UA 3OL3A 5CJ9A 2XPWA 1A31A 1T08B 3M8EA 4C3JJ 4UXNA 2PBIA 4F7ZA 5FKMA 1UG0A 2M8GX 2FBHA 3VWBA 2CFOA 1ZRDA 4LIVA 1B1BA 2LYCA 1BC7C 3LWFA 4HG2A 1ETOA 2RGVA 3MKLA 2BEOA 3GUDA 2HDCA 1ZN2A 1WWXA 2VKDA 3KZZA 4BEHA 2M5WA 2HKOA 2VQHA 4PJJA 5L3DA 5ICEA 1UJ8A 3P9IA 4EM2A 2W82A 5K7ZA 2CUJA 5KNLA 3BCAA 3LOCA 1V5GA 5TRDA 5CVIA 2R7ZJ 2Z9OA 1X1BA 5E79C 2WV0A 4ETSA 3S3NA 2CV0A 4II2A 1X1CA 2K5CA 1TP4A 2VE8A 1ZG1A 2EFWA 4HDUA 5CQGA 1YE9A 1ZGJA 3B6AA 3EQLF 4N0BA 1UHSA 2ME6A 3HOVJ 2HNHA 3CCJI 2OUMA 3BR1A 1J09A 4A3EJ 4Y33A 5F6FA 1K78B 2ZMEB 4AWXB 1OPCA 2XF5A 5L3FA 3WODF 4CYCA 2NVTJ 3BPXA 2BOLA 1KQ8A 1OR7C 3IRQA 4WF2A 3RKXA 2LTPA 5EEGA 3KCCA 3GW2A 4E4HA 1R4MB 2IA2A 3GF2A 2M45A 3OWTA 4RBOA 2K9NA 3FMRA 4O5VA 2DCEA 3H9QA 4QPOA 3IKTA 1HXDA 1FP1D 4E7KA 3D5RC 1IRFA 1ETYA 3DXJF 3LSIA 4HQMA 4IPAA 3VFZA 1TQIA 2F4MB 4BJ6C 4CUGA 5CVRA 2KPMA 9ANTA 1QPMA 1Z1DA 3OMYA 3F6VA 2CWEA 1TWGJ 2EIMH 1XG1A 2DFHA 4YIIA 4NQWA 4BH9A 5LLQA 3OV8A 5DCMA 1ZR4A 2XAJA 3CMEI 2LY1A 3GLXA 1DP3A 3IL2A 4IRHA 2DAOA 5HDNA 4IX7A 1W7PD 3REOA 1WGXA 1IW7F 4WXDA 4QIWN 2A6HF 1QBJA 2BBYA 5F27A 3X2QH 2MSYA 1X3WB 2FF4A 2V7FA 3TQNA 4XRSG 2ETHA 3HBLA 3QYEA 1FT9A 3BJAA 3IV5A 1FOYA 3R0JA 2IJLA 2OA4A 5HNFA 4BU2A 4XIDA 1PUEE 1V5FA 1QNTA 2MYSA 3HM5A 2R7SA 3ZMDA 1UB9A 2EIKH 1Z05A 1IRZA 3UKGA 3OIQA 3VPRA 2NRAC 2V1NA 3WHBA 3HOWJ 3LL7A 1IXSB 1SFKA 2FMLA 4CHUA 3N97A 2DT6A 3CO6C 1R22A 2HDDA 2X1CA 2V79A 1IAWA 4D7MA 3NRVA 1U5TC 2CW7A 2P8TA 3SFIA 4YFXF 1AKHB 3OS1A 3PFIA 4F92B 3JW4A 3WE2A 2MGQA 2E36A 1BR4A 4RAZA 2X85A 1KQ9A 1LFBA 1XMKA 3MVPA 4Y13A 3FM3A 3IRRA 2VJIA 1W36C 2OTJI 2EIJH 4PJ0C 5A2QZ 4LD5A 2W48A 3E5QA 1FNNA 2WADA 3Q0VA 4B1RA 2XSDC 4I09A 4NC7A 5ICGA 4RB0A 1APLC 3GCMA 3L7WA 3OS0A 2K40A 4B3AA 4LIUA 1V54H 2DXIA 3MCZA 2LK2A 4IRGA 2DA3A 3CCQI 1MZBA 1Z3YA 2CS3A 3MMYB 5AIPA 1F9NA 1YQAA 2AO9A 3CUOA 4DBQA 2R7OA 4O6JA 2HQ5A 2FMYA 2JRTA 3GWZA 1AHDP 4QLCU 1P9QC 3DV8A 1JI8A 5TGTA 3A03A 1U9OA 2DTRA 3GTQJ 4XRMA 2E60A 5EGOA 2DA1A 2K3PA 1D8KA 4RDUA 1WZ2A 4P5OA 1T95A 2PJPA 1ZG3A 2NS8A 3R60A 4CCJA 3I9V2 4XK4A 1H8AC 5M5WJ 1FSHA 5J1YA 3K1NA 3BWGA 1W5CC 1R5ID 2IVMA 3PL8A 1GT0C 4HRIA 3RPUD 2LF7A 3CUQB 3HXLA 3AG2H 4J19A 3DBLB 3K2AA 3F9KA 4D5CA 2LD5A 2WAFA 2FX0A 1W0TA 3QPSA 1VQ7I 1YTYA 3GTMJ 1G3YA 3A02A 5DUIA 4KDPA 2OJED 2ZXWH 2Z3YA 5L3BA 2IA1A 1G59A 3TDZC 4L0ZB 3HTUA 1S72I 3LA7A 2CGPA 2Y0SA 2JZYA 3BLYA 3LFUA 4LJZF 3S32A 2C6YA 2WA0A 1HW5A 2E34A 1WH5A 1I3AA 4NBQA 5DV5A 1PP7U 3GTGJ 1ZREA 1WJDA 3ZQFA 4X6AJ 3E6CC 2I8DA 3JRIA 3CJRB 2VKEA 3HSEA 4M72A 3DFGA 1JKRC 5FB2A 1A5JA 3IC7A 1UHMA 4KICA 2QZ8A 4CCOA 1GXQA 1MDMB 3GFMA 1A6IA 3ONQA 2DYSH 1JUPA 2LFBA 2Y31A 1MNEA 3CF2A 3SXYA 4AYBN 3H0GJ 1LVKA 2KIQA 3SFZA 4DBRA 2CW8A 2PMUA 3D5SC 4IHTA 1OCOH 2FNPA 3BTIA 4BJ5C 2IPQX 2GOMA 2LOOA 2M4KA 3KFWX 3W6JB 5DYMA 5C4JJ 1HF0A 1MMSA 2YU9J 2IS2A 3I71A 4BUPA 2QQAA 1MNDA 3KP2A 4XKWA 4IEJA 1Z3XA 4ZTJA 1JKPC 5IYDJ 3L2QA 3WHCA 5HDKA 1VQMI 1HW1A 4P9FA 2B63J 1OYIA 4B44A 2FRHA 2UZKA 5FGMA 3TW7A 1H9TA 4AVPA 2ZSHB 2RKHA 5HVQC 2Q1ZB 2COBA 5L3GA 1MDMA 3BCBA 1Y8QB 4EM1A 3CLQA 1QZZA 4S0HB 4ENJA 2VI6A 2M2EA 5E8GA 1G3TA 4GYIA 4G94A 3F23A 4M71A 5JR3A 3E6BA 2ICWG 5FKOA 4CICA 2PEXA 1HA8A 3WTZA 5K7FA 4XLCA 2VPRA 5DCFA 3FXUA 1FTZA 2E7WA 4RA2A 1XMAA 2VPLA 3QWLA 2EWNA 2KMUA 4RS8A 2COMA 4NUBA 1R49A 2A69F 1FBSA 1YJ9I 4HF0A 4HSRA 1ETXA 3A01B 2KJBA 5H6QA 2A05A 4EJVA 4KMFA 4U7DA 4CYDA 3PIPF 2EFOA 4LLGF 4E7LA 4YG2F 1ETVA 4IVNA 2W84A 3F21A 1JXSA 2HU9A 4R8HA 1IG7A 1D3YA 4ZTFA 3K4BA 2DJIA 4JYKA 2CQKA 1MGTA 4RLFA 4V19K 2YR2A 2TDXA 4BHBA 4ZYAA 4RAGA 1K4SA 1T98A 2OAZA 3JAMZ 1R71A 1FYMA 2YPRA 2CQQA 1YLFA 3I5UA 3VYTB 3DP7A 2Z5UA 4XLNF 1T33A 1MW7A 4U87A 3ZGKA 4HLYA 4IHXA 3L00A 1XPXA 1N78A 3OYHA 3CJTB 3SDBA 4MIMA 3BY6A 3HUGB 2EPFA 3TGNA 2ZNZA 3I55I 4I99C 4ENKA 2WB1A 1D5VA 1WJEA 1BM9A 1BR2A 5GAGJ 2RDPA 3M07A 5EZHA 2HOSA 1DGWY 3OOPA 2X51A 4XBFA 2OTLI 1YX5A 1T2KA 1D5YA 2R7TA 2EFNA 4HNUA 1STZA 2KIMA 2V1UA 2LNBA 1LE8A 3HSFA 2V6EA 1H9GA 1O7FA 1WJBA 2L7FP 2XAUA 3L9FA 3M1CA 2TRTA 1DGRM 1W7PA 1VZ0A 2DA7A 2W4SA 3WG7H 3GFLA 5E1ZB 3WU2C 4FE7A 3RQ4A 5GAHJ 3BDDA 3G3ZA 3NWSA 4LB6B 1P2FA 3KEYA 4MQVA 2XKOA 4M9XA 4RAFA 1IRGA 4PCQA 2STTA 3CESA 3M7GA 4B3XA 2E1MC 2A5WA 4UVAA 4UUVA 2NAZA 3AL0B 4A0XA 4ESFA 1KU9A 1TL8A 4UUTA 4BDZA 3DTIA 3FXRA 5GADJ 2IS4A 2X1DA 3CJNA 2OC6A 2M87A 1GV5A 4V2GA 2M34A 5D6FA 1WJFA 2WAQN 3DTKA 1HDPA 3N05A 4OIRF 3EDPA 4L5EA 1V55H 4RB3C 3JREA 4EGZA 4A3IJ 3ASOH 2JK3A 4G7ZF 4XQFA 1LQ1A 2X1EA 5EEAA 3FISA 3PNTA 3E5UA 1VQOI 2LY2A 2R7VA 2HOEA 4A2UA 5L3CA 3T1BA 2FBKA 5FROA 3JRBA 1P7IA 4JX6A 2P5KA 1ZG5A 5GTHC 3G73A 4IQJA 3KP4A 3OYIA 1MIJA 2O0YA 5FD5A 3QQAA 3ROUA 3H9GA 2ZXIA 3FF5A 2JUGA 1FPQA 2Q2EB 3RDIA 1JUSA 4CH7A 3FX3A 5J1RA 1D0YA 3ZP5A 5IT9Z 4HOBA 3ZQGA 3CMAI 3CCYA 2K02A 1LVAA 2V6CA 1D1BA 2VBXA 2VC0A 1MBHA 3ISPA 1RIOH 1RKTA 2H6CA 5C44J 2NS0A 3IWFA 2F2EA 2QBYA 3F3XA 2IAIA 1SAXA 1LUJB 2HQAA 1GVDA 2LRDA 1RESA 3PFYA 1T0FA 1OLTA 2KLOA 3CDHA 3FXLA 5FJ8J 3CLOA 5FLMJ 1ON1A 3J7YJ 3L2CA 3B02A 3MQ0A 1K79A 4KUMA 4NQWB 1USTA 4HDVA 4CSWA 2R7XA 4IRIA 2Z1DA 2O03A 4GO1A 1RKWA 3CD6I 3WG9A 3ZPLA 5CKTA 1FP2A 2JA7J 1T8IA 3VOEA 2JT1A 5D6EA 2XGEA 3E6DA 4EM0B 2VT2A 5M5XJ 4FETA 4C2TA 2HFHA 4UVCA 4Q48A 4ASNA 3WE3A 3F0CA 2XGXA 4XN3A 5ERIA 5IT3A 2Z33A 2PN6A 2XGCA 4XICA 1I6XA 1HW2A 2CV1A 5F04A 1PP8F 4NC6A 1PUFB 4LG0B 2K85A 4XSZF 5EG0A 2G7UA 3CDIA 2Y9ZA 4CYCB 3O3KA 4ZJZA 4F55A 1U8BA 4X1EA 2FQ3A 3BROA 5CLSA 5B5EC 2KQRA 2V1DA 1ACIA 2OF7A 3I59B 3FK7A 4XONA 1TT0A 4YRVA 1W36D 1J59A 2BVMA 3OSGA 3J81K 1ZELA 3ZMSA 1GHCA 4FQGA 3FKIJ 4BY1J 5J4VA 4J01A 1PUFA 3NARA 2HTJA 4ENMA 2E35A 2HYJA 4YIFA 3L2WA 2PMZN 3SDGA 3HKZA 2VC1A 1ZKGA 2AQEA 3BTJA 4II3A 1IN5A 1FSEA 1OCRH 2EV0A 4UHTA 1K6YA 3G1OA 3ZMUA 2DQRA 1FIAA 3CO7C 2BY1A 4I6ZA 5J40A 3RKQA 3V8JA 1MD0A 4KNYA 2AXLA 1HCRA 3A01A 4GGGA 4DOZA 3BC8A 1R5HA 1DQUA 3EPZA 2QCOA 3R4KA 1OJLA 1EKEA 3S15J 3DF8A 4UB6C 2GOXB 4N9HA 1U0JA 2K9QA 1ZYRF 4HF2A 5J4YA 3SZGA 1HDDC 3ELKA 4A69C 2DOEA 1QQIA 2KRFA 3QPLA 4UUSA 3U21A 1D8JA 4RMNA 2R0QC 1E0EA 5DM7F 5GAEJ 2HDWA 3WTUC 2L02A 2XAHA 1LFPA 3QRFF 1MJBA 5HNHA 4L9TA 5LGTA 4BXXJ 5EEHA 3K4CA 2W00A 1Z7UA 1XDSA 5DCMB 1G6NA 2K9MA 2K9LA 4XM3A 3FXQA 2CYYA 4A6DA 4G6QA 3KPHA 2MA3A 2P0WA 2IW5A 3JSPA 4XOPA 2X48A 4WK8F 5IPAA 2ZC2A 2HZDA 5HOOA 1Z6RA 3KZIC 1GUUA 3QODA 4XSXF 5LRSA 2HVRA 3E5XA 3H92A 1K4TA 5TISC 2JN6A 1SFEA 1YW8A 2GXBA 4M73A 2F4IA 3QU3A 5ILSA 1PJRA 1U2WA 1O3SA 1XGSA 2ZB9A 1ZGWA 2VXDA 3AG1H 4JQFA 1VQ8I 1BBYA 2GWRA 5GPAA 3PQKA 2DMTA 4UVBA 3TDUC 4E6KG 1JKOC 2R5YA 4F93B 3BG7A 3W2VA 3HOSA 1TZLA 2FOWA 2OZ6A 4DYQA 5D5XB 4KISA 4F52A 2PJRA 2ZMEC 2RNJA 1RR7A 4IHSA 2H1LA 2P5VA 2ME0A 2A07F 5M5YJ 2R92J 2VL8A 5BMZA 3HB9A 5H2FC 5M3MJ 3BR0A 5HS8A 1K61A 4E7SA 3WTSC 2GBYA 4PJMA 3JRHA 1VQLI 5E20A 1KA8A 3CCLI 4OMYA 2BY0A 3RZOJ 1X1AA 3VSKA 4OAYA 2EQRA 3UNGC 3C3WA 1RI7A 2ESNA 3H5RA 2DQLA 1NTCA 1OMIA 3E6MA 4CDGA 3N4MA 3K4JA 1CQTA 2FBIA 4BEHB 5BS6A 1FX7A 2PI0A 1REPC 2HZTA 3SZTA 2M7AA 2DMPA 2XF7A 3PNVA 1SAUA 3ZR8X 4A3KJ 5E17F 2L2OA 5D8LB 2V26A 2JUCA 2X6WA 4BKXA 5KVRA 3GMEA 2EZKA 3GTPJ 2KL4A 3FDYA 1IZ1A 5LHIA 1MBGA 2DA5A 2QQ8A 2O8XA 4I0BA 5E1XA 4LB5A 2BE5F 3SQNA 2LDUA 3DBHB 3CC2I 4GDFA 1S7EA 2VOPA 3L1PA 3FMSA 2J5PA 1DP7P 1IJWC 4KFCA 4RM2A 5IOZA 2EFPA 2LREA 3LSHA 4MO7A 5CVUA 4B09A 4A6EA 1N75A 4FX0A 4XL9A 1YJNI 4A0YA 1X1PA 4BAYA 1MJAA 3HRSA 2XPVA 3TW6A 4IOCF 1TWHJ 3F8BA 5ILVA 4EJWA 2MH9A 2ID3A 3W6KB 1UELB 4BGDA 1FMWA 2CJJA 1HLVA 3FM5A 2ELKA 1FBQA 2UXXA 2KJCA 4MLOA 2KT0A 3ZMTA 1YX3A 2MD5A 3A4CA 3S3MA 1ODDA 1XN7A 4PSWA 2LKXA 1UHWA 4I2OA 1SMYF 2OBPA 2B7EA 2AXTC 3FIWA 2E2JJ 3T8TA 3ZQQA 4ANJA 1QVUA 2ZJ2A 3HEFA 1IDZA 1Z91A 2DODA 3VDXA 1ZRFA 2FQ4A 3WU1B 2IA0A 2KHMA 1BA5A 1KYWA 5LEJA 3EETA 5H6RA 3K70C 2EJRA 3HJEA 1XDUA 1BI1A 3GVAA 2L9NA 2LVSA 3TEDA 2EA4A 3AG3H 4M6YA 4GXOA 4ZH4F 2EK5A 2XGDA 2LR8A 3QOEA 2KRCA 3DWLE 3VB2A 4BQAA 1AKHA 3OL4A 4I0AA 1FBUA 1YOVB 2DYRH 3CUQC 4A0ZA 2GA2A 2NOJB 5LHHA 3A0HC 1Z7LA 3G6EI 1YI2I 3OYCA 1JJ8C 2L5QA 4MFEA 1BC8C 4CCMA 4XLEA 5M3FJ 3R6SA 2FU4A 2HOAA 4NHJA 2CRGA 1YS6A 4OAZA 3L2VA 2Q2EA 5FKLA 4Y7NJ 1G4DA 4ON0A 3JCUC 4BJTA 1SMTA 2DPUA 4XRSA 1FYLA 2Y0SN 3K9TA 1FOWA 3MZYA 4CO8A 4M3DA 3C18A 2BHYA 2NNYA 5E3NA 1ERDA 2DDAA 2R93J 1I27A 1QZEA 2XV4S 4AUXA 4CGZA 1S7AA 3UR3C 4D7NA 4A5MA 3SJMA 2GXAA 5DUKA 3TOBA 3PQJA 2F48A 2QWWA 4DGWB 1UCRA 4S04A 2AS5F 3B6CA 2P6TA 2BXYA 3BZCA 3IP4B 3AAFA 3VYSB 3HDDA 4Q4ZF 4BDYA 2CSOA 3PM1A 2DPDA 3CP8A 4BYYA 1BOBA 2FEZA 3K6GA 5IP9J 1WJ5A 1D0ZA 2HR3A 5E8IA 1BI2A 2Y48A 3HOUJ 3BG5A 1IUFA 3VSLA 3M9AA 3G2BA 2A68F 3W2AA 4CXFA 1QZYA 1ON2A 5F0HA 1NH3A 4D0PA 4L5IA 3KIOA 1LB2A 1VQ4I 1FWZA 4K2EA 1ETQA 1VF9A 1X1DA 4BBSJ 5J8FA 1Y39A 4G12A 5FFZA 4GYGA 2PJRB 2K9SA 1AU7A 2FOKA 4B47A 2NXNB 3LSPA 2KP6A 1E3OC 1DDNA 3LFKA 3CC7I 2O9LA 3C2GA 4HX8A 5ILUA 2LP0A 2Z16A 4HPQA 2FD5A 1TNTA 4JK1X 5B1AH 5HLTA 3QYFA 3W6VA 2F5FA 4Y17A 4PJLA 2NS7A 4EVIA 1R23A 2H8WA 4BY7J 3DCFA 4Q47A 1RC9A 2RVCA 4HNTA 4KYWA 2L54A 5K5OA 1XMXA 2VUMJ 4EATA 2JVHA 3TKYA 3S93A 5JI6A 3J81Z 1NK2P 2NYXA 3IKVA 1B9NA 2LH9A 3RYPA 3GFIA 1A04A 1YHQI 2L7ZA 3ABTA 3HL2A 2DN0A 1OQYA 3BP8A 3WTVC 4E7HA 4HYEA 2L9SA 1QRYA 4A3DJ 1J2XA 4O3MA 5BOXA 3I4PA 2V1XA 2DTZA 3GYHX 1J9IA 4U88A 2VJJA 2R3SA 4KJZA 2GLOA 4KA4A 1LDDA 2M1BA 4OIQF 5FRMA 3FHNA 2WC2A 4NDLA 2KIFA 5BPDA 4AIHA 1ENHA 2OZUA 2CQNA 3PUBA 2JJ7A 2V4JC 3BQYA 4L9VA 2ZJRF 2NVXJ 1RPWA 1W5TA 2FSWA 2R7DA 3SHFA 4DZPA 4OIPF 4JBAA 2WWYA 3KLNA 4RM3A 2JA5J 4YFKF 3PO2J 3LAJA 4OINF 3ULQB 1I3QJ 4UUSB 2VQGA 3WTYC 3T0YA 3S2HJ 2BW3B 2XPUA 2NNNA 2BY3A 4DW6A 3MAJA 1J7KA 2VOOA 1BW6A 2DMUA 1XSXA 3QPHA 2XUBA 1Z21A 4KMUX 4IO9F 1TQPA 3NEUA 3JRFA 4RGRA 3BOQA 4BQOA 2JPCA 4HEA2 1B6AA 5FFXA 5D4RA 3MKZA 1BI3A 3OOUA 3KETA 2LSOA 5IOYA 2L01A 2PFBA 3ABKH 4HV6A 3RIRA 1MMGA 1B72B 1GDTA 4AM3A 4A3JJ 4NB5A 5ED4A 1QHGA 2RC4A 1IUYA 5CVVA 5IT9K 1LEAA 4HA8A 1ETKA 3HRMA 4OWRB 1U3EM 3WGGA 4CCKA 2QQ9A 3DQVC 1XGNA 2F6CA 3KEQA 1E17A 2CV2A 3V8KA 3ERMA 3OYNA 2X6XA 4M3EA 2MC3A 1EH8A 5IP6A 1L3LA 3M4OJ 1X3ZB 3BG3A 1SD7A 2KZVA 1B59A 1KQ0A 1HKTA 3OIPA 3ZQIA 4PZJA 2NVYJ 4RGXA 1ZAOA 1WPKA 3KP7A 1YFHA 4UB8C 2FNAA 3O8HA 2BZTA 2VQLA 2HYGD 5ICCA 3H9JA 1UZCA 3EUAA 4C3HJ 4C2UA 1P92A 3CF5F 4MEXF 2L9VA 3IH4A 2X4HA 3OYEA 3LAPA 1I6HJ 2AQFA 2WB1N 2JSPA 2XKPA 4RGUA 4DIQA 5F1RA 5AIQA 1V4RA 3WTXC 3FHZA 4EGYA 1HSJA 1T39A 2TCTA 2E2HJ 3ZN1A 4ZYEA 3Q3SA 1VQNI 3HG9A 3I58A 1JKQC 1ZRCA 2D45A 4YIRX 1MMNA 2P7VB 1TW3A 2EV5A 3HOXJ 3RI4A 1JT0A 1RZ4A 2AHQA 2QSGX 2LKSA 4G9YA 3OSFA 3GZ5A 3S1MJ 2P81A 3EUHA 2O3FA 3WGHA 2GXGA 4M74A 5CVJA 1MH4A 3BR3A 1TTYA 4M3BA 3SEQA 4PDKA 2F5EA 2MLKA 4MTDA 2WY8Q 2RNGA 1RRJA 4KIGA 1EF4A 1ZHFA 3JR9A 3F22A 3W3CA 2DK5A 4XKBA 3ECHA 5EDNA 5EYRA 2XRLA 5F0FA 5B66C 2EINH 2XAFA 2VODA 2IGKA 3K1MA 3ML6A 5FO5A 2K7LA 3TO6A 4XMYA 4ZZLA 1YIJI 5EGOB 3K2ZA 3RSNA 1HKSA 1YG2A 4PUSA 1I5ZA 2QYOA 3PSIA 1SVOA 4C3IJ 2ECBA 1E3PA 5K1YA 1LNWA 3IH2A 2X6YA 3O2PE 2DMNA 3G1LA 2ZFWA 3K69A 3S2DJ 1EV7A 2DMQA 1LDKB 1X2MA 2ADUA 2RV8A 4L5JA 1TQMA 5D5UB 3L2RA 3PUFA 4BS9A 4ZDLA 1NHAA 2BYVE 1NK3P 5IY5H 2CG4A 4CCLA 3FBIB 2BY2A 2R7FA 4KT5C 4IF4A 1FOKA 4P1WA 3T8RA 2CMPA 1K6OA 2H1KA 2LMDA 4M3FA 3S8PA 1MBFA 1R5GA 5JVGF 2F5DA 2QKMB 3V7CA 2R5ZA 3CJQB 4Y4RA 2P5LC 1R6RA 3BJ6A 1X4PA 2QA4I 3OR2C 4HV5A 1PYVA 4ABZA 4IQ4A 4EJUA 4HSTA 3H5AA 2QGUA 2GM4A 3LSRA 4IKFA 2IGNA 3CCUI 2EZLA 3QP5A 4G8XA 4BE1A 4FISA 1LPQA 1ORKA 4M6VA 3I59A 3HOZJ 1I50J 2HQNA 4QTRA 2WTEA 3OS2A 4IHWA 1ZLJA 4I01A 2YS9A 3IH3A 4HX4A 2R5ZB 4WXCA 4YEJA 1YRNB 3VODA 3KYLA 3ZQLA 1JHHA 3D0SA 4BACA 1HQCA 2JTVA 1UFMA 2W85A 3CC4I 4FCYA 2LG4A 2DO7A 4HZFA 1TW2A 5D5VB 3S1RJ 1MBJA 3FZVA 3KE2A 2M8EA 1CF7B 2EFQA 4XLAA 1X2NA 4LMYA 1N25A 3OY9A 4RGSA 3M1EA 2V9PA 1IRXA 4P96A 1X19A 3AG4H 1SD5A 2FE3A 3K7AJ 2LBFB 1IV6A 2A6TA 2L7KA 3BR6A 2CUFA 1F36A 3DTEA 4AC0A 4BNCA 2A5YB 4HF1A 3S1QJ 2P7CB 4KT6A 2QUFA 5LGUA 1F43A 1IDYA 3NAUA 4HW0A 3TO9A 2R7RA 2CQXA 2H27A 5HS9A 2XVCA 3GEZA 2XC7A 3G4SI 4DZJA 3FWEA 1SC7A 3U1KA 2E5NA 3WTWC 2KDOA 3AKZA 1WHUA 4BQNA 3L2UA 2KKOA 1ZQ3P 4JX5A 3CP2A 4RAYA 1QO0D 3M8JA 1IO2A 3U1DA 2XB5A 1IGNA 3RYRA 2LY9A 4E7IA 4M3GA 3VYUB 3JSOA 3COAC 1JT6A 3HRTA 1RUNA 2E71A 1S9HA 2DDBA 1J5YA 4H0EA 1W4MA 5BPIA 3ZQCA 4BHPA 5J47A 3FBNB 1OFCX 2EBIA 1SVLA 2VJ4A 1H89C 2ZJPF 4BE2A 1FMVA 2O5RA 3HPGA 2L0KA 4XR6A 4EEFG 1YS7A 3DPTA 5IYBJ 2L9RA 2BGCA 2XHKA 2ZO4A 1XSDA 5K5QA 1KYZA 1B8IA 3S3OA 3D5LA 3FXMA 3O6BB 1HKQA 1Z6TA 2A6EF 2ZXHA 3BZ6A 4JOMA 5JHFA 4LITA 1YIOA 5J8CA 1USSA 5LD2C 1T0FC 3P5JA 2EH3A 2X6OA 4MFDA 2WAQA 4UY8I 3DBRB 2GQQA 2B0LA 2O61A 3Q5FA 3TMOA 1QU3A 1XX5A 3S14J 2CUZA 3QAHA 4A93J 5ICFA 1WQ2A 2ZFUA 1ETWA 1FIPA 3MEXA 3PSFA 3QPTA 1QA6A 1LEBA 4HNVA 1VQ5I 2F5VA 1EH6A 3LQQA 1IN8A 3GZ6A 1FOXA 2PX9A 1SEUA 1O3TA 5FRNA 3CQZJ 2VKVA 3IAM2 4DJAA 3V4GA 4G6TB 2BW3A 2ELHA 2ISYA 4PJNA 2RAEA 2I5UA 4N4OB 4MHGA 3RQIA 3LSMA 4G6DA 5KK1A 1FYKA 1R58A 4BE0A 1HSTA 2KDZA 5HLHA 3GTOJ 1XC5A 2KZGA 1GVJA 1YW9A 2IBDA 1TWCJ 3PIOF 4KIBA 5K7HA 2VXZA 3QOPA 5C4XJ 2QQBA 2DFEA 2UXNA 1Y1WJ 2KISA 4BHCA 2PMZA 3PO3J 3S2WA 5LRRA 4WX9A 5BNGA 2ZXJA 3DPUA 2VJ5A 4AYBA 3PJRA 2HPIA 2YUSA 1I1GA 1B4AA 4YFNF 3RTRA 2M30A 3LSJA 1KU2A 4XN0A 3C2BA 1ZTRA 3DEEA 4ZDOA 2VKHA 2ZBKA 4G7OF 1F4KA 3E97A 1S7OA 5F08A 3RPQA 4L9NA 3A0BC 3R61A 3OYDA 1BR1A 5CYVA 5F0CA 4CCNA 1SFUA 3K1PA 4BXUA 2ZKZA 2MC4A 5C3EJ 2CO5A 2VIXA 3P9CA 1VQKI 4IJAA 4IHYA 3CCSI 1BJZA 1TNSA 3H3UA 3H35A 1U78A 2UV1A 4QWQA 1OR7A 3BR5A 3D1NI 5E18F 2Y75A 2FA5A 5B3SH 1OCTC 3Q9VA 2IS1A 2E19A 3M3YJ 3K4MA 4DYRA 2Y30A 1NG7A 5JFRA 3DLLF 4A3CJ 3LSGA 1HC8A 1QVTA 3KYDB 2DI3A 2MH2A 4AIDA 3H5NA 3U2RA 2UWMA 1HOMA 1BJAA 4TV7A 3I56I 2HXOA 3FMQA 3CDLA 4F3QA 3F8NA 2K4JA 1JJ6C 5EG0B 3R0AA 3MN2A 5LFAA 3F8CA 3VYRB 4XLFA 2GA1A 3JAMK 4C2MJ 4N4NB 2GIZA 1T56A 3ZOBA 1XB4A 3CCMI 2D5VA 1OCPA 3DU5A 4A3MJ 1U8RA 3K4NA 3JRAA 1KU3A 4FHTA 1VQPI 1XCVA 5TJJA 2QBYB 1UG2A 1AOYA 2PLYA 1WH7A 1MKMA 3EYIA 4ENNA 3GO5A 3S1NJ 1IN6A 4NNJA 2JPBA 2Y69H 3TP0A 3C2HA 2KRHA 1VI0A 1IXCA 1S3JA 1WRJA 1V5EA 1XGMA 2LBFA 2JWTA 3DKWA 1QGPA 4M9ZA 1BIBA 4W1UA 1Q1VA 1ULYA 2IP2A 3MZ8A 5DDGA 5GP9A 3J7AY 2H8RA 4A12A 1Z67A 2Z2SB 3LSKA 4LG3A 1LKXA 3QP6A 2M4GA 2RN7A 2X9DA 3OYFA 3HHHA 1IN4A 1NG6A 3HYIA 5DD8A 1H0MA 1FTTA 3ABLH 4BXFA 1MBEA 4ZYDA 2KFDA 1A6QA 1A36A 2ACJA 4F91B 4FE4A 1OYWA 5J3LA 1SVMA 4GRIA 3HRUA 1WVRA 2G7HA 4B8XA 4CZCA 3MZHA 1AA7A 1U5TB 2STWA 1G3SA 3BTCA 3O8GA 2YU3A 2W57A 3WGIA 3TL4X 3B73A 2ZMEA 1OISA 2CUEA 3ZMVA 3BQZA 3KZYA 1WI3A 3Q0UA 1U6GA 2D1HA 2ELJA 1JTYA 2KIUA 5DEQA 4I98B 2Q8KA 1X3UA 2QKLB 3GBGA 2VLAA 1VTNC 1VFCA 5DS9A 4ESJA 3WTTC 1E2XA 1GLNA 2EILH 3H36A 4E70A 3GX4X 3F72A 3IWZA 5HLIA 3MKWB 2HYFA 2K86A 5LBQA 1IXRC 2A61A 3LMMA 2DA4A 1FLIA 1EJ9A 3OYMA 2IS6A 3HOTA 2BHZA 2DK8A 2OD5A 4J00A 1P4WA 2W25A 1Y8RB 4OMZA 1XTAA 4FTHA 2GZWA 3WU0A 1MSFC 2EV6A 3ZMZA 3BZKA 2G9WA 1MH3A 4EJTA 2ZNYA 3JRDA 1K83J 1YITI 1LDJA 2NVUB 2N8GA 3EYYA 3Q0WA 4ZZDA 2JVGA 2K3FA 1B72A 1YJWI 5KAFC 2HGCA 2JMWA 2YX4A 4KITB 5EZGA 1D1CA 1S8NA 2VQCA 1R1TA 3RZDJ 2DFIA 2M0CA 2RQPA 2XSJC 3KX2A 1EA3A 1R36A 4N9IA 5IP7J 2I10A 3QYBA 3OYKA 4HLXA 3FXKA 3MD2A 3J7AO 2BVLA 3AFHA 3E7LA 1O57A 1IN7A 3RPUA 1WJAA 1N77A 2Y0MA 1DPRA 1FEXA 1WSUA 1KONA 3CTAA 2QLZA 1JGGA 5FKNA 2XAGA 1ITYA 3V7SA 4W97A 1SFOJ 1KGSA 2B9SA 1LE8B 3KP5A 2LKPA 1Y56A 2JQ7A 1P4AA 3NQOA 5EJCA 2R7WA 1O3QA 1O4XA 2FUG2 4HBLA 4GCVA 2JSCA 4FX4A 1W1WE 3TP3A 2WY7Q 5KHDA 2HVSA 3HUGA 4U0VA 4E7ZA 3FXJA 2HWVA 4OOIA 2BV6A 2VBWA 2WBMA 2OV7A 3MWMA 1Q1HA 1BOAA 2E7XA 1OYYA 3ABMH 4C9YA 1D1AA 4RB2C 2Y9YA 1YW7A 4JX4A 1L0OC 1RR8C 2OU2A 4BL0B 1X58A 2RREA 2QVOA 4XORA 2M0MA 1T6SA 3MFKA 2PMHA 3A1YA 4B4CA 1WFXA 2EB7A 3G1MA 3HZJA 4P55A 3JRGA 2VT3A 3OR1C 4BQQA 4IL6C 3ABUA 1TC3C 3LSTA 1V3FA 3J80Z 3K10A 3V42A 4D1QA 3IUOA 4EQQA 2LF8A 4NC8A 5FLXK 1I39A 2YX7A 4LLNA 1E3HA 1PVEA 4AIJA 1WKMA 4DYCA 5E3OA 5A2QK 4D9JA 3I64A 2QSHX 3JTGA 1SANA 2A3SA
chains in the Genus database with same CATH topology
2DW4A 4WXHA 2XASA 4L9JA 1AWCA 1TBXA 2XRNA 1FY7A 2P4WA 1P6RA 3BJOA 3HHGA 2DU9A 4UV9A 5H20A 2P6SA 3HTSB 3P7NA 1K78A 4U0YA 3VEPA 2OQGA 1J75A 5JVTA 4AD9A 1HBXG 2J5OA 1W5SA 1XSVA 3ERED 3LA3A 1CGPA 2ISZA 1XCBA 5JHUA 4EV0A 1JE8A 1ZGAA 3KP3A 4Q5SF 2E1NA 2PG4A 3KEOA 3P9KA 1JGSA 3K0LA 1BN5A 5K5RA 3F6OA 3QU6A 4MQ9F 4PGHA 1Z9CA 4LK1F 1DUXC 1OKRA 2L4AA 2VONA 5LHGA 4U0WA 5HS7A 4M6XA 3CUQA 1ZH5A 3HIFA 5D4SA 1SD6A 1FC3A 3RKYA 3DEUA 1XGOA 1S6LA 2IT0A 4HQEA 4Z2YA 3M8FA 2Q0OA 2E1CA 1ZARA 2YSRA 5LGNA 2H94A 3GFJA 4KN4X 1T38A 3F8MA 2F5CA 4MGRA 4KIFA 5D5WB 2DBBA 3C7JA 1GXPA 3E3VA 1YYVA 4WCGA 3I53A 2IRFG 2H09A 4LLLA 4Y15A 1KU7A 4KN7X 5J6XA 2VBYA 3ECOA 3SZPA 4AIKA 2DT5A 4IXAA 4EMSA 4DQ2A 3TOAA 2CFXA 4EJOA 6PAXA 1RUOA 4FT8A 1J0RA 4CZZA 4S05A 1F1ZA 1I1SA 5FD6A 2QENA 3HSRA 1K7AA 4L18B 1R7JA 2V9VA 1ZLKA 1PDNC 1WI9A 2HQRA 3L09A 2CW0F 4LG0A 2GAUA 2W24A 4XRFA 4XLPF 2Z99A 4R79A 2D1VA 2HEOA 2XAQA 2HS5A 1R1VA 4MNUA 2X0LA 2ESHA 3GXOA 3RKWA 1SFXA 1LJ9A 2VN2A 2K27A 5FLXZ 1G3WA 1JHFA 1U5TA 3ZN0A 2MBFA 5D8KB 3J80K 4OU0A 1EH7A 3U9GA 2K4BA 2EA2A 1O7LA 1SD4A 1FZPB 4DNCA 4LK0F 1B9MA 2L3DA 2XROA 4A5NA 2L4MA 2FXAA 2MLGA 1C0WA 3KLOA 2GIVA 5HDGA 1BIAA 4PGGA 2PQ8A 2H6BA 1S29A 3BPVA 4LFUA 5DD4A 2ZCWA 3RJPA 4UNOA 3V7RA 1CF7A 1RNLA 3KP6A 2VBZA 3F8FA 4OIOF 3DPLC 5LEKA 2HTSA 1ONVA 4ESBA 5E1WA 1R00A 3LQRA 4U7BA 1BI0A 4R1HA 5HLGA 3H3ZA 2HKXA 2O6GE 2XIGA 3I54A 5AONA 4UV8A 4HAMA 3ZQ7A 4I7HA 1F5TA 1Y0UA 3TO7A 5F64A 3C1DA 3JTHA 2D2WA 3V8LA 2VE9A 4HX7A 3LA2A 1P4XA 5L3EA 1W7PB 4MTEA 4MEYF 3Q9SA 4M9SA 2QM3A 5BQTA 4L0YB 4WWCA 1MJ9A 3I0TA 4ZYHA 2DLLA 4G7HF 4ZYGA 4I02A 4RB1A 1IF1A 1TLHB 1O3RA 1DPUA 3IHUA 4LGWA 2OQRA 3T5XA 1XD7A 4P9UA 1YO5C 1R1UA 5CJ9A 3M8EA 4UXNA 2PBIA 4F7ZA 2FBHA 1ZRDA 1B1BA 1BC7C 3LWFA 2RGVA 2BEOA 3GUDA 2HDCA 1ZN2A 1WWXA 3KZZA 2M5WA 2HKOA 5L3DA 5ICEA 3P9IA 4EM2A 5TRDA 5CVIA 2Z9OA 4ETSA 2WV0A 2VE8A 1ZG1A 2EFWA 4HDUA 1ZGJA 3EQLF 4N0BA 5F6FA 1K78B 2ZMEB 4AWXB 1OPCA 5L3FA 3WODF 3BPXA 1KQ8A 3IRQA 4WF2A 3RKXA 5EEGA 3KCCA 3GW2A 2IA2A 3GF2A 2M45A 4O5VA 3FMRA 3IKTA 1HXDA 1FP1D 1IRFA 3DXJF 4HQMA 4IPAA 3VFZA 1TQIA 5CVRA 1QPMA 1Z1DA 2CWEA 3F6VA 5LLQA 4YIIA 4NQWA 4BH9A 3OV8A 5DCMA 2XAJA 3GLXA 3IL2A 4IRHA 2DAOA 5HDNA 1W7PD 3REOA 1IW7F 4WXDA 1QBJA 2A6HF 2BBYA 2FF4A 3TQNA 2ETHA 1FT9A 3BJAA 3R0JA 2IJLA 2OA4A 1PUEE 1QNTA 3ZMDA 1UB9A 1Z05A 2NRAC 1IXSB 2FMLA 4CHUA 3N97A 3CO6C 1R22A 2V79A 1IAWA 3NRVA 1U5TC 2P8TA 4YFXF 3PFIA 3JW4A 3WE2A 4RAZA 1KQ9A 1XMKA 4Y13A 3FM3A 3IRRA 5A2QZ 4LD5A 3E5QA 1FNNA 4I09A 5ICGA 4RB0A 3L7WA 3MCZA 4IRGA 1MZBA 5AIPA 1F9NA 1YQAA 3CUOA 4O6JA 2FMYA 2JRTA 3GWZA 4QLCU 3DV8A 2DTRA 1D8KA 4P5OA 2PJPA 1ZG3A 3R60A 1FSHA 3K1NA 3BWGA 2IVMA 2LF7A 3CUQB 1YTYA 1G3YA 5DUIA 4KDPA 2Z3YA 5L3BA 2IA1A 4L0ZB 3TDZC 3HTUA 3LA7A 2CGPA 2JZYA 4LJZF 2C6YA 1HW5A 5DV5A 1PP7U 1ZREA 3E6CC 3HSEA 4M72A 3DFGA 5FB2A 3IC7A 1UHMA 4KICA 2QZ8A 1GXQA 1MDMB 3GFMA 3SXYA 3SFZA 4IHTA 2PMUA 2FNPA 2IPQX 3KFWX 3W6JB 5DYMA 3I71A 2QQAA 3KP2A 5HDKA 1HW1A 4P9FA 1OYIA 2FRHA 2UZKA 5FGMA 1H9TA 4AVPA 2RKHA 5HVQC 5L3GA 1MDMA 4EM1A 1QZZA 4ENJA 5E8GA 1G3TA 4GYIA 4G94A 3F23A 4M71A 5JR3A 3E6BA 4CICA 2PEXA 3WTZA 5DCFA 3FXUA 2E7WA 1XMAA 2EWNA 4RS8A 2COMA 2A69F 1FBSA 4HF0A 2KJBA 5H6QA 4EJVA 4KMFA 4U7DA 4CYDA 2EFOA 4LLGF 4YG2F 4IVNA 2W84A 3F21A 1JXSA 4R8HA 1D3YA 2CQKA 1MGTA 2YR2A 2TDXA 4BHBA 1T98A 1FYMA 2OAZA 3JAMZ 2YPRA 3I5UA 1YLFA 3DP7A 2Z5UA 4XLNF 4HLYA 3L00A 3BY6A 3TGNA 2ZNZA 4ENKA 1D5VA 1BM9A 2RDPA 3OOPA 4XBFA 1T2KA 2EFNA 1STZA 2KIMA 2V1UA 2LNBA 3HSFA 1H9GA 1O7FA 3L9FA 1W7PA 3GFLA 5E1ZB 3BDDA 3G3ZA 4LB6B 1P2FA 4MQVA 2XKOA 4M9XA 1IRGA 4PCQA 2STTA 3M7GA 4UVAA 4UUVA 2NAZA 4A0XA 4ESFA 1KU9A 3FXRA 3CJNA 2M87A 5D6FA 4OIRF 3EDPA 4RB3C 4EGZA 4G7ZF 1LQ1A 3E5UA 2HOEA 4A2UA 5L3CA 3T1BA 2FBKA 2P5KA 1ZG5A 3G73A 3KP4A 2O0YA 5FD5A 3ROUA 3FF5A 3RDIA 1FPQA 3FX3A 3ZP5A 5IT9Z 4HOBA 2K02A 1LVAA 2V6CA 2VC0A 2VBXA 3ISPA 1RIOH 2H6CA 2NS0A 3IWFA 2F2EA 2QBYA 3F3XA 1SAXA 1T0FA 3CDHA 3CLOA 1ON1A 3L2CA 3B02A 3MQ0A 1K79A 4KUMA 1USTA 4HDVA 4IRIA 2O03A 4GO1A 3WG9A 3ZPLA 1FP2A 3VOEA 2JT1A 5D6EA 3E6DA 4EM0B 2VT2A 2HFHA 4UVCA 4Q48A 4ASNA 3WE3A 5ERIA 2Z33A 2XGXA 5IT3A 2PN6A 1I6XA 1HW2A 1PP8F 4LG0B 4XSZF 2G7UA 3O3KA 2FQ3A 3BROA 5CLSA 2V1DA 3I59B 1J59A 3J81K 3ZMSA 1GHCA 2HTJA 4ENMA 4YIFA 2VC1A 1IN5A 1FSEA 2EV0A 4UHTA 3ZMUA 2DQRA 3CO7C 3V8JA 1MD0A 4KNYA 2AXLA 4GGGA 1R5HA 3R4KA 3DF8A 4N9HA 1ZYRF 4HF2A 3ELKA 1QQIA 2KRFA 1D8JA 3WTUC 2L02A 2XAHA 3QRFF 1MJBA 4L9TA 5LGTA 5EEHA 1Z7UA 1XDSA 5DCMB 1G6NA 3FXQA 2CYYA 4A6DA 4G6QA 2MA3A 2IW5A 3JSPA 4WK8F 5HOOA 1Z6RA 5LRSA 4XSXF 3E5XA 3H92A 1SFEA 1YW8A 2GXBA 4M73A 3QU3A 5ILSA 1U2WA 1O3SA 1XGSA 4JQFA 1BBYA 2GWRA 3PQKA 4UVBA 3TDUC 3HOSA 2OZ6A 5D5XB 2RNJA 4IHSA 2P5VA 2A07F 5BMZA 5HS8A 3WTSC 5E20A 1KA8A 4OMYA 3C3WA 1RI7A 2ESNA 2DQLA 1OMIA 4CDGA 3E6MA 3N4MA 2FBIA 5BS6A 1FX7A 2PI0A 1REPC 2HZTA 3SZTA 5E17F 5D8LB 5KVRA 1IZ1A 5LHIA 5E1XA 2O8XA 4I0BA 4LB5A 2BE5F 3SQNA 2LDUA 2VOPA 3FMSA 2J5PA 1DP7P 4KFCA 2EFPA 5CVUA 4B09A 4A6EA 4FX0A 4A0YA 4BAYA 1MJAA 3HRSA 3F8BA 5ILVA 4EJWA 2MH9A 3W6KB 3FM5A 1FBQA 2UXXA 2KJCA 3ZMTA 2MD5A 1ODDA 1XN7A 1UHWA 4I2OA 1SMYF 2OBPA 3T8TA 2ZJ2A 1Z91A 1ZRFA 3WU1B 2IA0A 1KYWA 5LEJA 3EETA 5H6RA 2EJRA 1XDUA 1BI1A 3GVAA 2EA4A 4M6YA 4GXOA 4ZH4F 2EK5A 3VB2A 4BQAA 4I0AA 1FBUA 3CUQC 4A0ZA 2GA2A 5LHHA 1BC8C 3R6SA 2FU4A 4NHJA 1YS6A 2Q2EA 1G4DA 4ON0A 1SMTA 2DPUA 1FYLA 3K9TA 3MZYA 4CO8A 3C18A 2NNYA 1I27A 2XV4S 4CGZA 1S7AA 4A5MA 5DUKA 3TOBA 3PQJA 4S04A 2QWWA 2AS5F 1UCRA 2P6TA 3AAFA 4Q4ZF 2DPDA 2CSOA 4BYYA 2FEZA 2HR3A 5E8IA 1BI2A 2Y48A 3M9AA 2A68F 4CXFA 1QZYA 1ON2A 1LB2A 4D0PA 4L5IA 1FWZA 4K2EA 5J8FA 5FFZA 4GYGA 2FOKA 1DDNA 3LFKA 4HX8A 5ILUA 1TNTA 4JK1X 2F5FA 4Y17A 4EVIA 1R23A 4Q47A 2RVCA 4KYWA 2L54A 5K5OA 3TKYA 3J81Z 5JI6A 2NYXA 3IKVA 1B9NA 3RYPA 3GFIA 1A04A 3ABTA 3BP8A 3WTVC 4HYEA 1J2XA 4O3MA 5BOXA 3I4PA 2V1XA 3GYHX 1J9IA 4U88A 2R3SA 4KA4A 1LDDA 2M1BA 4OIQF 2WC2A 2KIFA 5BPDA 4AIHA 2OZUA 4L9VA 1W5TA 2FSWA 2R7DA 3SHFA 4OIPF 4JBAA 2WWYA 3KLNA 4YFKF 3LAJA 4OINF 3ULQB 3WTYC 3T0YA 2NNNA 3MAJA 1J7KA 2VOOA 1XSXA 3QPHA 2XUBA 4KMUX 1TQPA 3NEUA 4RGRA 3BOQA 2JPCA 1B6AA 5FFXA 5D4RA 1BI3A 3KETA 2LSOA 2L01A 2PFBA 4HV6A 3RIRA 4NB5A 5ED4A 2RC4A 1IUYA 5CVVA 5IT9K 1LEAA 4HA8A 3HRMA 1U3EM 3WGGA 2QQ9A 3DQVC 1XGNA 3KEQA 1E17A 3V8KA 2MC3A 1EH8A 1L3LA 1SD7A 1B59A 1KQ0A 1HKTA 4PZJA 4RGXA 1ZAOA 3KP7A 1YFHA 2FNAA 2HYGD 5ICCA 1P92A 4MEXF 2X4HA 3LAPA 2XKPA 4RGUA 5F1RA 5AIQA 1V4RA 3WTXC 3FHZA 4EGYA 1HSJA 1T39A 3ZN1A 4ZYEA 3I58A 1ZRCA 2D45A 2P7VB 1TW3A 2EV5A 3RI4A 1RZ4A 4G9YA 3GZ5A 3EUHA 2O3FA 3WGHA 2GXGA 4M74A 5CVJA 1TTYA 4PDKA 2F5EA 2MLKA 4MTDA 4KIGA 1ZHFA 3F22A 2DK5A 3ECHA 2XAFA 2VODA 3K1MA 3ML6A 5FO5A 2K7LA 3TO6A 4ZZLA 3K2ZA 1HKSA 1YG2A 1I5ZA 2QYOA 5K1YA 1LNWA 3O2PE 2ZFWA 3K69A 1EV7A 1LDKB 2ADUA 2RV8A 4L5JA 1TQMA 5D5UB 1NHAA 2BYVE 2CG4A 2R7FA 4KT5C 1FOKA 4IF4A 3T8RA 1K6OA 1R5GA 2F5DA 3V7CA 2P5LC 3BJ6A 4HV5A 4EJUA 3QP5A 4G8XA 3I59A 2HQNA 2WTEA 1ZLJA 4I01A 4HX4A 4WXCA 3VODA 1JHHA 3D0SA 1HQCA 2JTVA 1UFMA 2W85A 2DO7A 4HZFA 1TW2A 5D5VB 3KE2A 3FZVA 2M8EA 1CF7B 2EFQA 4LMYA 4RGSA 3M1EA 4P96A 1SD5A 2FE3A 4BNCA 2A5YB 4HF1A 2P7CB 2QUFA 5LGUA 4HW0A 3TO9A 2H27A 5HS9A 2XVCA 3GEZA 3FWEA 3WTWC 2KKOA 4RAYA 1QO0D 3U1DA 3RYRA 3JSOA 3COAC 3HRTA 1RUNA 1J5YA 4H0EA 1W4MA 5BPIA 4BHPA 1YS7A 3DPTA 2BGCA 2XHKA 2ZO4A 1XSDA 5K5QA 1KYZA 3D5LA 3O6BB 1HKQA 1Z6TA 2A6EF 3BZ6A 1YIOA 5J8CA 1USSA 2GQQA 2B0LA 2O61A 3Q5FA 3QAHA 5ICFA 1WQ2A 3MEXA 3QPTA 1LEBA 1EH6A 3LQQA 1IN8A 3GZ6A 1O3TA 3V4GA 2ELHA 2ISYA 4MHGA 4G6DA 5KK1A 1FYKA 1R58A 1HSTA 5HLHA 1GVJA 1YW9A 4KIBA 2VXZA 3QOPA 2QQBA 2UXNA 4BHCA 3S2WA 5LRRA 4WX9A 2ZXJA 1I1GA 1B4AA 4YFNF 3RTRA 2M30A 1KU2A 2ZBKA 4G7OF 1F4KA 3E97A 1S7OA 3RPQA 4L9NA 3R61A 5CYVA 1SFUA 3K1PA 4BXUA 2ZKZA 2CO5A 3P9CA 4IJAA 1TNSA 3H3UA 1U78A 4QWQA 1OR7A 5E18F 2Y75A 2FA5A 3Q9VA 5JFRA 2DI3A 2MH2A 3U2RA 2UWMA 1BJAA 4TV7A 3FMQA 3F8NA 2K4JA 3R0AA 3F8CA 2GA1A 3JAMK 1XB4A 1U8RA 1KU3A 4FHTA 1XCVA 5TJJA 2QBYB 1AOYA 2PLYA 1MKMA 3EYIA 4ENNA 3GO5A 1IN6A 2JPBA 1IXCA 1S3JA 1WRJA 1XGMA 3DKWA 1QGPA 4M9ZA 1BIBA 1ULYA 2IP2A 5DDGA 4A12A 3QP6A 2RN7A 3HHHA 1IN4A 3HYIA 5DD8A 1H0MA 4ZYDA 2ACJA 1OYWA 3HRUA 2G7HA 4B8XA 3MZHA 1U5TB 2STWA 1G3SA 2YU3A 2W57A 3WGIA 3B73A 2ZMEA 3ZMVA 3KZYA 1U6GA 2D1HA 5DEQA 2KIUA 2Q8KA 4I98B 1X3UA 1VTNC 4ESJA 3WTTC 1E2XA 4E70A 3GX4X 3F72A 3IWZA 5HLIA 2HYFA 2K86A 5LBQA 1IXRC 2A61A 1FLIA 3HOTA 2DK8A 2OD5A 1P4WA 2W25A 4OMZA 2GZWA 3WU0A 2EV6A 3ZMZA 2G9WA 4EJTA 2ZNYA 1LDJA 3EYYA 4ZZDA 2HGCA 2YX4A 1S8NA 1R1TA 2DFIA 2RQPA 1R36A 4N9IA 4HLXA 3J7AO 1O57A 1IN7A 3RPUA 2Y0MA 1DPRA 1WSUA 3CTAA 2QLZA 2XAGA 3V7SA 1KGSA 3KP5A 2LKPA 1P4AA 3NQOA 1O3QA 4HBLA 4GCVA 2JSCA 4FX4A 3HUGA 4U0VA 2HWVA 4OOIA 2BV6A 2VBWA 3MWMA 1Q1HA 1BOAA 2E7XA 1OYYA 4RB2C 1YW7A 1L0OC 2OU2A 2QVOA 1T6SA 3MFKA 2PMHA 2EB7A 4P55A 2VT3A 3ABUA 3LSTA 1V3FA 3J80Z 4EQQA 2LF8A 5FLXK 2YX7A 4LLNA 4AIJA 1WKMA 5A2QK 3I64A 3JTGA 2A3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DW4 A;  4WXH A;  2XAS A;  4L9J A;  1AWC A;  1TBX A;  2XRN A;  1FY7 A;  2P4W A;  1P6R A;  3BJO A;  3HHG A;  2DU9 A;  4UV9 A;  5H20 A;  2P6S A;  3HTS B;  3P7N A;  1K78 A;  4U0Y A;  3VEP A;  2OQG A;  1J75 A;  5JVT A;  4AD9 A;  1HBX G;  2J5O A;  1W5S A;  1XSV A;  3ERE D;  3LA3 A;  1CGP A;  2ISZ A;  1XCB A;  5JHU A;  4EV0 A;  1JE8 A;  1ZGA A;  3KP3 A;  4Q5S F;  2E1N A;  2PG4 A;  3KEO A;  3P9K A;  1JGS A;  3K0L A;  1BN5 A;  5K5R A;  3F6O A;  3QU6 A;  4MQ9 F;  4PGH A;  1Z9C A;  4LK1 F;  1DUX C;  1OKR A;  2L4A A;  2VON A;  5LHG A;  4U0W A;  5HS7 A;  4M6X A;  3CUQ A;  1ZH5 A;  3HIF A;  5D4S A;  1SD6 A;  1FC3 A;  3RKY A;  3DEU A;  1XGO A;  1S6L A;  2IT0 A;  4HQE A;  4Z2Y A;  3M8F A;  2Q0O A;  2E1C A;  1ZAR A;  2YSR A;  5LGN A;  2H94 A;  3GFJ A;  4KN4 X;  1T38 A;  3F8M A;  2F5C A;  4MGR A;  4KIF A;  5D5W B;  2DBB A;  3C7J A;  1GXP A;  3E3V A;  1YYV A;  4WCG A;  3I53 A;  2IRF G;  2H09 A;  4LLL A;  4Y15 A;  1KU7 A;  4KN7 X;  5J6X A;  2VBY A;  3ECO A;  3SZP A;  4AIK A;  2DT5 A;  4IXA A;  4EMS A;  4DQ2 A;  3TOA A;  2CFX A;  4EJO A;  6PAX A;  1RUO A;  4FT8 A;  1J0R A;  4CZZ A;  4S05 A;  1F1Z A;  1I1S A;  5FD6 A;  2QEN A;  3HSR A;  1K7A A;  4L18 B;  1R7J A;  2V9V A;  1ZLK A;  1PDN C;  1WI9 A;  2HQR A;  3L09 A;  2CW0 F;  4LG0 A;  2GAU A;  2W24 A;  4XRF A;  4XLP F;  2Z99 A;  4R79 A;  2D1V A;  2HEO A;  2XAQ A;  2HS5 A;  1R1V A;  4MNU A;  2X0L A;  2ESH A;  3GXO A;  3RKW A;  1SFX A;  1LJ9 A;  2VN2 A;  2K27 A;  5FLX Z;  1G3W A;  1JHF A;  1U5T A;  3ZN0 A;  2MBF A;  5D8K B;  3J80 K;  4OU0 A;  1EH7 A;  3U9G A;  2K4B A;  2EA2 A;  1O7L A;  1SD4 A;  1FZP B;  4DNC A;  4LK0 F;  1B9M A;  2L3D A;  2XRO A;  4A5N A;  2L4M A;  2FXA A;  2MLG A;  1C0W A;  3KLO A;  2GIV A;  5HDG A;  1BIA A;  4PGG A;  2PQ8 A;  2H6B A;  1S29 A;  3BPV A;  4LFU A;  5DD4 A;  2ZCW A;  3RJP A;  4UNO A;  3V7R A;  1CF7 A;  1RNL A;  3KP6 A;  2VBZ A;  3F8F A;  4OIO F;  3DPL C;  5LEK A;  2HTS A;  1ONV A;  4ESB A;  5E1W A;  1R00 A;  3LQR A;  4U7B A;  1BI0 A;  4R1H A;  5HLG A;  3H3Z A;  2HKX A;  2O6G E;  2XIG A;  3I54 A;  5AON A;  4UV8 A;  4HAM A;  3ZQ7 A;  4I7H A;  1F5T A;  1Y0U A;  3TO7 A;  5F64 A;  3C1D A;  3JTH A;  2D2W A;  3V8L A;  2VE9 A;  4HX7 A;  3LA2 A;  1P4X A;  5L3E A;  1W7P B;  4MTE A;  4MEY F;  3Q9S A;  4M9S A;  2QM3 A;  5BQT A;  4L0Y B;  4WWC A;  1MJ9 A;  3I0T A;  4ZYH A;  2DLL A;  4G7H F;  4ZYG A;  4I02 A;  4RB1 A;  1IF1 A;  1TLH B;  1O3R A;  1DPU A;  3IHU A;  4LGW A;  2OQR A;  3T5X A;  1XD7 A;  4P9U A;  1YO5 C;  1R1U A;  5CJ9 A;  3M8E A;  4UXN A;  2PBI A;  4F7Z A;  2FBH A;  1ZRD A;  1B1B A;  1BC7 C;  3LWF A;  2RGV A;  2BEO A;  3GUD A;  2HDC A;  1ZN2 A;  1WWX A;  3KZZ A;  2M5W A;  2HKO A;  5L3D A;  5ICE A;  3P9I A;  4EM2 A;  5TRD A;  5CVI A;  2Z9O A;  4ETS A;  2WV0 A;  2VE8 A;  1ZG1 A;  2EFW A;  4HDU A;  1ZGJ A;  3EQL F;  4N0B A;  5F6F A;  1K78 B;  2ZME B;  4AWX B;  1OPC A;  5L3F A;  3WOD F;  3BPX A;  1KQ8 A;  3IRQ A;  4WF2 A;  3RKX A;  5EEG A;  3KCC A;  3GW2 A;  2IA2 A;  3GF2 A;  2M45 A;  4O5V A;  3FMR A;  3IKT A;  1HXD A;  1FP1 D;  1IRF A;  3DXJ F;  4HQM A;  4IPA A;  3VFZ A;  1TQI A;  5CVR A;  1QPM A;  1Z1D A;  2CWE A;  3F6V A;  5LLQ A;  4YII A;  4NQW A;  4BH9 A;  3OV8 A;  5DCM A;  2XAJ A;  3GLX A;  3IL2 A;  4IRH A;  2DAO A;  5HDN A;  1W7P D;  3REO A;  1IW7 F;  4WXD A;  1QBJ A;  2A6H F;  2BBY A;  2FF4 A;  3TQN A;  2ETH A;  1FT9 A;  3BJA A;  3R0J A;  2IJL A;  2OA4 A;  1PUE E;  1QNT A;  3ZMD A;  1UB9 A;  1Z05 A;  2NRA C;  1IXS B;  2FML A;  4CHU A;  3N97 A;  3CO6 C;  1R22 A;  2V79 A;  1IAW A;  3NRV A;  1U5T C;  2P8T A;  4YFX F;  3PFI A;  3JW4 A;  3WE2 A;  4RAZ A;  1KQ9 A;  1XMK A;  4Y13 A;  3FM3 A;  3IRR A;  5A2Q Z;  4LD5 A;  3E5Q A;  1FNN A;  4I09 A;  5ICG A;  4RB0 A;  3L7W A;  3MCZ A;  4IRG A;  1MZB A;  5AIP A;  1F9N A;  1YQA A;  3CUO A;  4O6J A;  2FMY A;  2JRT A;  3GWZ A;  4QLC U;  3DV8 A;  2DTR A;  1D8K A;  4P5O A;  2PJP A;  1ZG3 A;  3R60 A;  1FSH A;  3K1N A;  3BWG A;  2IVM A;  2LF7 A;  3CUQ B;  1YTY A;  1G3Y A;  5DUI A;  4KDP A;  2Z3Y A;  5L3B A;  2IA1 A;  4L0Z B;  3TDZ C;  3HTU A;  3LA7 A;  2CGP A;  2JZY A;  4LJZ F;  2C6Y A;  1HW5 A;  5DV5 A;  1PP7 U;  1ZRE A;  3E6C C;  3HSE A;  4M72 A;  3DFG A;  5FB2 A;  3IC7 A;  1UHM A;  4KIC A;  2QZ8 A;  1GXQ A;  1MDM B;  3GFM A;  3SXY A;  3SFZ A;  4IHT A;  2PMU A;  2FNP A;  2IPQ X;  3KFW X;  3W6J B;  5DYM A;  3I71 A;  2QQA A;  3KP2 A;  5HDK A;  1HW1 A;  4P9F A;  1OYI A;  2FRH A;  2UZK A;  5FGM A;  1H9T A;  4AVP A;  2RKH A;  5HVQ C;  5L3G A;  1MDM A;  4EM1 A;  1QZZ A;  4ENJ A;  5E8G A;  1G3T A;  4GYI A;  4G94 A;  3F23 A;  4M71 A;  5JR3 A;  3E6B A;  4CIC A;  2PEX A;  3WTZ A;  5DCF A;  3FXU A;  2E7W A;  1XMA A;  2EWN A;  4RS8 A;  2COM A;  2A69 F;  1FBS A;  4HF0 A;  2KJB A;  5H6Q A;  4EJV A;  4KMF A;  4U7D A;  4CYD A;  2EFO A;  4LLG F;  4YG2 F;  4IVN A;  2W84 A;  3F21 A;  1JXS A;  4R8H A;  1D3Y A;  2CQK A;  1MGT A;  2YR2 A;  2TDX A;  4BHB A;  1T98 A;  1FYM A;  2OAZ A;  3JAM Z;  2YPR A;  3I5U A;  1YLF A;  3DP7 A;  2Z5U A;  4XLN F;  4HLY A;  3L00 A;  3BY6 A;  3TGN A;  2ZNZ A;  4ENK A;  1D5V A;  1BM9 A;  2RDP A;  3OOP A;  4XBF A;  1T2K A;  2EFN A;  1STZ A;  2KIM A;  2V1U A;  2LNB A;  3HSF A;  1H9G A;  1O7F A;  3L9F A;  1W7P A;  3GFL A;  5E1Z B;  3BDD A;  3G3Z A;  4LB6 B;  1P2F A;  4MQV A;  2XKO A;  4M9X A;  1IRG A;  4PCQ A;  2STT A;  3M7G A;  4UVA A;  4UUV A;  2NAZ A;  4A0X A;  4ESF A;  1KU9 A;  3FXR A;  3CJN A;  2M87 A;  5D6F A;  4OIR F;  3EDP A;  4RB3 C;  4EGZ A;  4G7Z F;  1LQ1 A;  3E5U A;  2HOE A;  4A2U A;  5L3C A;  3T1B A;  2FBK A;  2P5K A;  1ZG5 A;  3G73 A;  3KP4 A;  2O0Y A;  5FD5 A;  3ROU A;  3FF5 A;  3RDI A;  1FPQ A;  3FX3 A;  3ZP5 A;  5IT9 Z;  4HOB A;  2K02 A;  1LVA A;  2V6C A;  2VC0 A;  2VBX A;  3ISP A;  1RIO H;  2H6C A;  2NS0 A;  3IWF A;  2F2E A;  2QBY A;  3F3X A;  1SAX A;  1T0F A;  3CDH A;  3CLO A;  1ON1 A;  3L2C A;  3B02 A;  3MQ0 A;  1K79 A;  4KUM A;  1UST A;  4HDV A;  4IRI A;  2O03 A;  4GO1 A;  3WG9 A;  3ZPL A;  1FP2 A;  3VOE A;  2JT1 A;  5D6E A;  3E6D A;  4EM0 B;  2VT2 A;  2HFH A;  4UVC A;  4Q48 A;  4ASN A;  3WE3 A;  5ERI A;  2Z33 A;  2XGX A;  5IT3 A;  2PN6 A;  1I6X A;  1HW2 A;  1PP8 F;  4LG0 B;  4XSZ F;  2G7U A;  3O3K A;  2FQ3 A;  3BRO A;  5CLS A;  2V1D A;  3I59 B;  1J59 A;  3J81 K;  3ZMS A;  1GHC A;  2HTJ A;  4ENM A;  4YIF A;  2VC1 A;  1IN5 A;  1FSE A;  2EV0 A;  4UHT A;  3ZMU A;  2DQR A;  3CO7 C;  3V8J A;  1MD0 A;  4KNY A;  2AXL A;  4GGG A;  1R5H A;  3R4K A;  3DF8 A;  4N9H A;  1ZYR F;  4HF2 A;  3ELK A;  1QQI A;  2KRF A;  1D8J A;  3WTU C;  2L02 A;  2XAH A;  3QRF F;  1MJB A;  4L9T A;  5LGT A;  5EEH A;  1Z7U A;  1XDS A;  5DCM B;  1G6N A;  3FXQ A;  2CYY A;  4A6D A;  4G6Q A;  2MA3 A;  2IW5 A;  3JSP A;  4WK8 F;  5HOO A;  1Z6R A;  5LRS A;  4XSX F;  3E5X A;  3H92 A;  1SFE A;  1YW8 A;  2GXB A;  4M73 A;  3QU3 A;  5ILS A;  1U2W A;  1O3S A;  1XGS A;  4JQF A;  1BBY A;  2GWR A;  3PQK A;  4UVB A;  3TDU C;  3HOS A;  2OZ6 A;  5D5X B;  2RNJ A;  4IHS A;  2P5V A;  2A07 F;  5BMZ A;  5HS8 A;  3WTS C;  5E20 A;  1KA8 A;  4OMY A;  3C3W A;  1RI7 A;  2ESN A;  2DQL A;  1OMI A;  4CDG A;  3E6M A;  3N4M A;  2FBI A;  5BS6 A;  1FX7 A;  2PI0 A;  1REP C;  2HZT A;  3SZT A;  5E17 F;  5D8L B;  5KVR A;  1IZ1 A;  5LHI A;  5E1X A;  2O8X A;  4I0B A;  4LB5 A;  2BE5 F;  3SQN A;  2LDU A;  2VOP A;  3FMS A;  2J5P A;  1DP7 P;  4KFC A;  2EFP A;  5CVU A;  4B09 A;  4A6E A;  4FX0 A;  4A0Y A;  4BAY A;  1MJA A;  3HRS A;  3F8B A;  5ILV A;  4EJW A;  2MH9 A;  3W6K B;  3FM5 A;  1FBQ A;  2UXX A;  2KJC A;  3ZMT A;  2MD5 A;  1ODD A;  1XN7 A;  1UHW A;  4I2O A;  1SMY F;  2OBP A;  3T8T A;  2ZJ2 A;  1Z91 A;  1ZRF A;  3WU1 B;  2IA0 A;  1KYW A;  5LEJ A;  3EET A;  5H6R A;  2EJR A;  1XDU A;  1BI1 A;  3GVA A;  2EA4 A;  4M6Y A;  4GXO A;  4ZH4 F;  2EK5 A;  3VB2 A;  4BQA A;  4I0A A;  1FBU A;  3CUQ C;  4A0Z A;  2GA2 A;  5LHH A;  1BC8 C;  3R6S A;  2FU4 A;  4NHJ A;  1YS6 A;  2Q2E A;  1G4D A;  4ON0 A;  1SMT A;  2DPU A;  1FYL A;  3K9T A;  3MZY A;  4CO8 A;  3C18 A;  2NNY A;  1I27 A;  2XV4 S;  4CGZ A;  1S7A A;  4A5M A;  5DUK A;  3TOB A;  3PQJ A;  4S04 A;  2QWW A;  2AS5 F;  1UCR A;  2P6T A;  3AAF A;  4Q4Z F;  2DPD A;  2CSO A;  4BYY A;  2FEZ A;  2HR3 A;  5E8I A;  1BI2 A;  2Y48 A;  3M9A A;  2A68 F;  4CXF A;  1QZY A;  1ON2 A;  1LB2 A;  4D0P A;  4L5I A;  1FWZ A;  4K2E A;  5J8F A;  5FFZ A;  4GYG A;  2FOK A;  1DDN A;  3LFK A;  4HX8 A;  5ILU A;  1TNT A;  4JK1 X;  2F5F A;  4Y17 A;  4EVI A;  1R23 A;  4Q47 A;  2RVC A;  4KYW A;  2L54 A;  5K5O A;  3TKY A;  3J81 Z;  5JI6 A;  2NYX A;  3IKV A;  1B9N A;  3RYP A;  3GFI A;  1A04 A;  3ABT A;  3BP8 A;  3WTV C;  4HYE A;  1J2X A;  4O3M A;  5BOX A;  3I4P A;  2V1X A;  3GYH X;  1J9I A;  4U88 A;  2R3S A;  4KA4 A;  1LDD A;  2M1B A;  4OIQ F;  2WC2 A;  2KIF A;  5BPD A;  4AIH A;  2OZU A;  4L9V A;  1W5T A;  2FSW A;  2R7D A;  3SHF A;  4OIP F;  4JBA A;  2WWY A;  3KLN A;  4YFK F;  3LAJ A;  4OIN F;  3ULQ B;  3WTY C;  3T0Y A;  2NNN A;  3MAJ A;  1J7K A;  2VOO A;  1XSX A;  3QPH A;  2XUB A;  4KMU X;  1TQP A;  3NEU A;  4RGR A;  3BOQ A;  2JPC A;  1B6A A;  5FFX A;  5D4R A;  1BI3 A;  3KET A;  2LSO A;  2L01 A;  2PFB A;  4HV6 A;  3RIR A;  4NB5 A;  5ED4 A;  2RC4 A;  1IUY A;  5CVV A;  5IT9 K;  1LEA A;  4HA8 A;  3HRM A;  1U3E M;  3WGG A;  2QQ9 A;  3DQV C;  1XGN A;  3KEQ A;  1E17 A;  3V8K A;  2MC3 A;  1EH8 A;  1L3L A;  1SD7 A;  1B59 A;  1KQ0 A;  1HKT A;  4PZJ A;  4RGX A;  1ZAO A;  3KP7 A;  1YFH A;  2FNA A;  2HYG D;  5ICC A;  1P92 A;  4MEX F;  2X4H A;  3LAP A;  2XKP A;  4RGU A;  5F1R A;  5AIQ A;  1V4R A;  3WTX C;  3FHZ A;  4EGY A;  1HSJ A;  1T39 A;  3ZN1 A;  4ZYE A;  3I58 A;  1ZRC A;  2D45 A;  2P7V B;  1TW3 A;  2EV5 A;  3RI4 A;  1RZ4 A;  4G9Y A;  3GZ5 A;  3EUH A;  2O3F A;  3WGH A;  2GXG A;  4M74 A;  5CVJ A;  1TTY A;  4PDK A;  2F5E A;  2MLK A;  4MTD A;  4KIG A;  1ZHF A;  3F22 A;  2DK5 A;  3ECH A;  2XAF A;  2VOD A;  3K1M A;  3ML6 A;  5FO5 A;  2K7L A;  3TO6 A;  4ZZL A;  3K2Z A;  1HKS A;  1YG2 A;  1I5Z A;  2QYO A;  5K1Y A;  1LNW A;  3O2P E;  2ZFW A;  3K69 A;  1EV7 A;  1LDK B;  2ADU A;  2RV8 A;  4L5J A;  1TQM A;  5D5U B;  1NHA A;  2BYV E;  2CG4 A;  2R7F A;  4KT5 C;  1FOK A;  4IF4 A;  3T8R A;  1K6O A;  1R5G A;  2F5D A;  3V7C A;  2P5L C;  3BJ6 A;  4HV5 A;  4EJU A;  3QP5 A;  4G8X A;  3I59 A;  2HQN A;  2WTE A;  1ZLJ A;  4I01 A;  4HX4 A;  4WXC A;  3VOD A;  1JHH A;  3D0S A;  1HQC A;  2JTV A;  1UFM A;  2W85 A;  2DO7 A;  4HZF A;  1TW2 A;  5D5V B;  3KE2 A;  3FZV A;  2M8E A;  1CF7 B;  2EFQ A;  4LMY A;  4RGS A;  3M1E A;  4P96 A;  1SD5 A;  2FE3 A;  4BNC A;  2A5Y B;  4HF1 A;  2P7C B;  2QUF A;  5LGU A;  4HW0 A;  3TO9 A;  2H27 A;  5HS9 A;  2XVC A;  3GEZ A;  3FWE A;  3WTW C;  2KKO A;  4RAY A;  1QO0 D;  3U1D A;  3RYR A;  3JSO A;  3COA C;  3HRT A;  1RUN A;  1J5Y A;  4H0E A;  1W4M A;  5BPI A;  4BHP A;  1YS7 A;  3DPT A;  2BGC A;  2XHK A;  2ZO4 A;  1XSD A;  5K5Q A;  1KYZ A;  3D5L A;  3O6B B;  1HKQ A;  1Z6T A;  2A6E F;  3BZ6 A;  1YIO A;  5J8C A;  1USS A;  2GQQ A;  2B0L A;  2O61 A;  3Q5F A;  3QAH A;  5ICF A;  1WQ2 A;  3MEX A;  3QPT A;  1LEB A;  1EH6 A;  3LQQ A;  1IN8 A;  3GZ6 A;  1O3T A;  3V4G A;  2ELH A;  2ISY A;  4MHG A;  4G6D A;  5KK1 A;  1FYK A;  1R58 A;  1HST A;  5HLH A;  1GVJ A;  1YW9 A;  4KIB A;  2VXZ A;  3QOP A;  2QQB A;  2UXN A;  4BHC A;  3S2W A;  5LRR A;  4WX9 A;  2ZXJ A;  1I1G A;  1B4A A;  4YFN F;  3RTR A;  2M30 A;  1KU2 A;  2ZBK A;  4G7O F;  1F4K A;  3E97 A;  1S7O A;  3RPQ A;  4L9N A;  3R61 A;  5CYV A;  1SFU A;  3K1P A;  4BXU A;  2ZKZ A;  2CO5 A;  3P9C A;  4IJA A;  1TNS A;  3H3U A;  1U78 A;  4QWQ A;  1OR7 A;  5E18 F;  2Y75 A;  2FA5 A;  3Q9V A;  5JFR A;  2DI3 A;  2MH2 A;  3U2R A;  2UWM A;  1BJA A;  4TV7 A;  3FMQ A;  3F8N A;  2K4J A;  3R0A A;  3F8C A;  2GA1 A;  3JAM K;  1XB4 A;  1U8R A;  1KU3 A;  4FHT A;  1XCV A;  5TJJ A;  2QBY B;  1AOY A;  2PLY A;  1MKM A;  3EYI A;  4ENN A;  3GO5 A;  1IN6 A;  2JPB A;  1IXC A;  1S3J A;  1WRJ A;  1XGM A;  3DKW A;  1QGP A;  4M9Z A;  1BIB A;  1ULY A;  2IP2 A;  5DDG A;  4A12 A;  3QP6 A;  2RN7 A;  3HHH A;  1IN4 A;  3HYI A;  5DD8 A;  1H0M A;  4ZYD A;  2ACJ A;  1OYW A;  3HRU A;  2G7H A;  4B8X A;  3MZH A;  1U5T B;  2STW A;  1G3S A;  2YU3 A;  2W57 A;  3WGI A;  3B73 A;  2ZME A;  3ZMV A;  3KZY A;  1U6G A;  2D1H A;  5DEQ A;  2KIU A;  2Q8K A;  4I98 B;  1X3U A;  1VTN C;  4ESJ A;  3WTT C;  1E2X A;  4E70 A;  3GX4 X;  3F72 A;  3IWZ A;  5HLI A;  2HYF A;  2K86 A;  5LBQ A;  1IXR C;  2A61 A;  1FLI A;  3HOT A;  2DK8 A;  2OD5 A;  1P4W A;  2W25 A;  4OMZ A;  2GZW A;  3WU0 A;  2EV6 A;  3ZMZ A;  2G9W A;  4EJT A;  2ZNY A;  1LDJ A;  3EYY A;  4ZZD A;  2HGC A;  2YX4 A;  1S8N A;  1R1T A;  2DFI A;  2RQP A;  1R36 A;  4N9I A;  4HLX A;  3J7A O;  1O57 A;  1IN7 A;  3RPU A;  2Y0M A;  1DPR A;  1WSU A;  3CTA A;  2QLZ A;  2XAG A;  3V7S A;  1KGS A;  3KP5 A;  2LKP A;  1P4A A;  3NQO A;  1O3Q A;  4HBL A;  4GCV A;  2JSC A;  4FX4 A;  3HUG A;  4U0V A;  2HWV A;  4OOI A;  2BV6 A;  2VBW A;  3MWM A;  1Q1H A;  1BOA A;  2E7X A;  1OYY A;  4RB2 C;  1YW7 A;  1L0O C;  2OU2 A;  2QVO A;  1T6S A;  3MFK A;  2PMH A;  2EB7 A;  4P55 A;  2VT3 A;  3ABU A;  3LST A;  1V3F A;  3J80 Z;  4EQQ A;  2LF8 A;  5FLX K;  2YX7 A;  4LLN A;  4AIJ A;  1WKM A;  5A2Q K;  3I64 A;  3JTG A;  2A3S A; 
#chains in the Genus database with same CATH topology
 2W1O A;  4E7J A;  2DW4 A;  4Y52 J;  2HI3 A;  3CCE I;  5B1B H;  4WXH A;  2XAS A;  4L9J A;  3CCV I;  1JTX A;  3E0J B;  1AWC A;  1TBX A;  2UUZ A;  2XRN A;  4XKV A;  1XS9 A;  2O8K A;  3CMY A;  1FY7 A;  4JP0 A;  2P4W A;  3EUH C;  1P6R A;  2M9H A;  4GFB A;  3BJO A;  3HHG A;  2DU9 A;  4UV9 A;  5H20 A;  2P6S A;  4H4K C;  3HTS B;  1ZR2 A;  3OIO A;  3P7N A;  1K78 A;  4U0Y A;  3OYL A;  3VEP A;  4V2F A;  3GTK J;  4PK4 A;  2OQG A;  3TBI A;  3AL0 C;  1M1E B;  2R5Y B;  1J75 A;  5JVT A;  3OYG A;  4AD9 A;  2LLK A;  4ZC3 A;  1HBX G;  2J5O A;  1W5S A;  1XSV A;  3ERE D;  3LA3 A;  1CGP A;  5CPR B;  2ISZ A;  1XCB A;  5JHU A;  4EV0 A;  1MMA A;  1JE8 A;  1ZGA A;  2OCC H;  3KP3 A;  4Q5S F;  2E1N A;  5GTI C;  2PG4 A;  1B8I B;  5EF6 A;  3KEO A;  3P9K A;  1JGS A;  3K0L A;  2WV1 A;  1H88 C;  1VQ9 I;  2EZH A;  1BN5 A;  5K5R A;  3F6O A;  3QU6 A;  4MQ9 F;  2JA6 J;  4B48 A;  4PGH A;  1VQ6 I;  1Z9C A;  3DEW A;  4LK1 F;  4Z6Y A;  1DUX C;  3I4M J;  3HGY A;  3SEZ A;  4B43 A;  1OKR A;  2L4A A;  3HC7 A;  5CQE A;  2VON A;  1GV2 A;  2V9K A;  1X4O A;  5LHG A;  3JRC A;  4U0W A;  5HS7 A;  1OCC H;  4ITV A;  3A2K A;  4M6X A;  2IGO A;  3CUQ A;  2Y2Z A;  4PSX A;  3DLA A;  3ZQH A;  1ZH5 A;  3HIF A;  2E2I J;  4PFO A;  2DOA A;  4QSH A;  5D4S A;  1SD6 A;  1FC3 A;  3ZRG A;  4Y3O A;  1UAA A;  3RKY A;  3DEU A;  3CMM A;  1BW5 A;  1XGO A;  1S6L A;  2IT0 A;  4HQE A;  4Z2Y A;  3DKY A;  3M8F A;  2Q0O A;  2DT7 B;  2E1C A;  1ZAR A;  2YSR A;  5LGN A;  2H94 A;  3GFJ A;  4KN4 X;  1T38 A;  3F8M A;  4PFP A;  3CCR I;  4IZZ A;  2F5C A;  4XNF A;  4MGR A;  4KIF A;  5D5W B;  5KAI C;  2DBB A;  3C7J A;  1GXP A;  3E3V A;  1YYV A;  4WCG A;  1QHH D;  3I53 A;  1POG A;  3DU6 A;  2HXI A;  2VB6 A;  2IRF G;  2H09 A;  2JRM A;  4LLL A;  3FXO A;  4Y15 A;  1KU7 A;  1WCM J;  4KN7 X;  5J6X A;  3BT9 A;  2M7B A;  5JLX A;  3BG6 A;  1G2H A;  2ID6 A;  3H3V K;  2VBY A;  3ECO A;  3NWT A;  3SZP A;  4AIK A;  1IV8 A;  5DM6 F;  4IOA F;  2DT5 A;  1WJC A;  1Y6I A;  1Z0X A;  4IXA A;  4EMS A;  4DQ2 A;  3TOA A;  2DJN A;  2OPT A;  3ZCO A;  2CFX A;  2LC2 A;  4EJO A;  5IYC J;  2ECC A;  3BG9 A;  6PAX A;  1TWA J;  4FT8 A;  3K70 D;  4LOC A;  1J0R A;  3W2W A;  4CZZ A;  4S05 A;  1RUO A;  3EUK L;  1F1Z A;  1I1S A;  1MSE C;  2QEX I;  5FD6 A;  1DU0 A;  2QEN A;  2HOT A;  3HSR A;  1K7A A;  4L18 B;  3S17 J;  2CH0 A;  1R7J A;  2V9V A;  3GTJ J;  1ZLK A;  2MFZ A;  1KZH A;  2XF6 A;  3IAS 2;  1PDN C;  2DOF A;  1WI9 A;  4A3L J;  2HQR A;  1VND A;  3SYT A;  1LFU P;  4BBR J;  3L09 A;  2CW0 F;  4LG0 A;  2GAU A;  2W24 A;  4XRF A;  2MW8 A;  4XLP F;  3CZ6 A;  2Z99 A;  4R79 A;  2D1V A;  2HEO A;  2XAQ A;  2HS5 A;  4A3F J;  1R1V A;  1OCZ H;  4MNU A;  2JA2 A;  3K4L A;  4I76 A;  1RET A;  2X0L A;  4RLQ A;  2E1M B;  2ESH A;  2R4G A;  2QSF X;  3GXO A;  1G8X A;  4QPQ A;  2WAE A;  3RKW A;  1SFX A;  4XKC A;  1LJ9 A;  3OYA A;  2VN2 A;  1Y1V J;  1U9N A;  2K27 A;  5FLX Z;  1G3W A;  2MD0 A;  1JHF A;  1U5T A;  3ZN0 A;  2MBF A;  3GZN B;  3ESW B;  5D8K B;  2MAB A;  4OU0 A;  3J80 K;  3E1S A;  1EH7 A;  3U9G A;  1MBK A;  2K4B A;  2EA2 A;  1O7L A;  1SD4 A;  3GLL A;  3S16 J;  3DKX A;  4C30 A;  4LK0 F;  4DNC A;  4AVZ A;  1B9M A;  2L3D A;  5J1U A;  2XRO A;  1FZP B;  4A3G J;  3ASN H;  4A5N A;  2L4M A;  2FXA A;  1MNM C;  2L7M P;  5E3M A;  2MLG A;  3OYJ A;  1C0W A;  4XOT A;  2ZSI B;  2RQQ A;  3KLO A;  2GIV A;  5HOD A;  5GPC A;  5HDG A;  1DU6 A;  1FJL A;  1BIA A;  4PGG A;  3HOY J;  2E5Z A;  2PQ8 A;  2H6B A;  3PNY A;  3ZXS A;  1S29 A;  3BPV A;  1TWF J;  4LFU A;  1TT5 B;  2MG4 A;  5DD4 A;  2ZCW A;  3RJP A;  4UNO A;  3V7R A;  1QPI A;  3FKJ A;  5KCM A;  4CA0 A;  2JA8 J;  1CF7 A;  1RNL A;  3KP6 A;  2VBZ A;  4D5F A;  2CU7 A;  3KYC B;  5E3L A;  1JUM A;  2XDV A;  3F8F A;  4OIO F;  2HVQ A;  3DPL C;  5LEK A;  2DA2 A;  2HTS A;  1ZK8 A;  2HPM A;  1ONV A;  4ESB A;  5E1W A;  3BTL A;  1R00 A;  3LQR A;  4YEL A;  5FKK A;  1S5L C;  1W0U A;  3OYB A;  3RCO A;  3MKY B;  2O7O A;  4U7B A;  1BI0 A;  1UMQ A;  4R1H A;  2W7N A;  2F4O B;  4XLH A;  2QF7 A;  5HLG A;  3H3Z A;  5JLW A;  2G0E A;  2HKX A;  2O6G E;  2XIG A;  3I54 A;  1MMD A;  2VAS A;  5AON A;  4X0G A;  1IC8 A;  4IHV A;  4UV8 A;  2EZI A;  4HAM A;  2R7U A;  3ZQ7 A;  5FLV A;  4I7H A;  1F5T A;  1Y0N A;  1Y0U A;  3TO7 A;  5F64 A;  3I4N J;  3C1D A;  1R9T J;  3G71 I;  3JTH A;  3LNQ A;  2E1O A;  2D2W A;  2ZJQ F;  3V8L A;  4ZDP A;  2M3A A;  2BXZ A;  2VE9 A;  2NVQ J;  4HX7 A;  3LA2 A;  1P4X A;  5L3E A;  1Z77 A;  2IEK A;  1P7J A;  1A35 A;  1W7P B;  4FAS D;  4MTE A;  5F1J A;  4MEY F;  3HKZ N;  2XB0 X;  2FJ1 A;  3Q9S A;  4M9S A;  2QM3 A;  3H1C A;  5DTD A;  5BQT A;  4L0Y B;  2IXS A;  4AU7 A;  1MJ9 A;  4WWC A;  3H0D A;  3I0T A;  4ZYH A;  3J7Z I;  3GTL J;  2DA6 A;  3FK6 A;  2DLL A;  2CQ7 A;  3I3L A;  2NOG A;  4G7H F;  4ZYG A;  3HPH A;  1D0X A;  4I02 A;  4RB1 A;  1IF1 A;  1TLH B;  1R4N B;  1YRN A;  1BL0 A;  3K4K A;  1O3R A;  2IGM A;  2OCE A;  1DPU A;  3IHU A;  3BR2 A;  4LGW A;  2OQR A;  2R7Q A;  2DFF A;  3T5X A;  1XD7 A;  3HGG A;  4P9U A;  1YO5 C;  4A3B J;  1R1U A;  3OL3 A;  5CJ9 A;  2XPW A;  1A31 A;  1T08 B;  3M8E A;  4C3J J;  4UXN A;  2PBI A;  4F7Z A;  5FKM A;  1UG0 A;  2M8G X;  2FBH A;  3VWB A;  2CFO A;  1ZRD A;  4LIV A;  1B1B A;  2LYC A;  1BC7 C;  3LWF A;  4HG2 A;  1ETO A;  2RGV A;  3MKL A;  2BEO A;  3GUD A;  2HDC A;  1ZN2 A;  1WWX A;  2VKD A;  3KZZ A;  4BEH A;  2M5W A;  2HKO A;  2VQH A;  4PJJ A;  5L3D A;  5ICE A;  1UJ8 A;  3P9I A;  4EM2 A;  2W82 A;  5K7Z A;  2CUJ A;  5KNL A;  3BCA A;  3LOC A;  1V5G A;  5TRD A;  5CVI A;  2R7Z J;  2Z9O A;  1X1B A;  5E79 C;  2WV0 A;  4ETS A;  3S3N A;  2CV0 A;  4II2 A;  1X1C A;  2K5C A;  1TP4 A;  2VE8 A;  1ZG1 A;  2EFW A;  4HDU A;  5CQG A;  1YE9 A;  1ZGJ A;  3B6A A;  3EQL F;  4N0B A;  1UHS A;  2ME6 A;  3HOV J;  2HNH A;  3CCJ I;  2OUM A;  3BR1 A;  1J09 A;  4A3E J;  4Y33 A;  5F6F A;  1K78 B;  2ZME B;  4AWX B;  1OPC A;  2XF5 A;  5L3F A;  3WOD F;  4CYC A;  2NVT J;  3BPX A;  2BOL A;  1KQ8 A;  1OR7 C;  3IRQ A;  4WF2 A;  3RKX A;  2LTP A;  5EEG A;  3KCC A;  3GW2 A;  4E4H A;  1R4M B;  2IA2 A;  3GF2 A;  2M45 A;  3OWT A;  4RBO A;  2K9N A;  3FMR A;  4O5V A;  2DCE A;  3H9Q A;  4QPO A;  3IKT A;  1HXD A;  1FP1 D;  4E7K A;  3D5R C;  1IRF A;  1ETY A;  3DXJ F;  3LSI A;  4HQM A;  4IPA A;  3VFZ A;  1TQI A;  2F4M B;  4BJ6 C;  4CUG A;  5CVR A;  2KPM A;  9ANT A;  1QPM A;  1Z1D A;  3OMY A;  3F6V A;  2CWE A;  1TWG J;  2EIM H;  1XG1 A;  2DFH A;  4YII A;  4NQW A;  4BH9 A;  5LLQ A;  3OV8 A;  5DCM A;  1ZR4 A;  2XAJ A;  3CME I;  2LY1 A;  3GLX A;  1DP3 A;  3IL2 A;  4IRH A;  2DAO A;  5HDN A;  4IX7 A;  1W7P D;  3REO A;  1WGX A;  1IW7 F;  4WXD A;  4QIW N;  2A6H F;  1QBJ A;  2BBY A;  5F27 A;  3X2Q H;  2MSY A;  1X3W B;  2FF4 A;  2V7F A;  3TQN A;  4XRS G;  2ETH A;  3HBL A;  3QYE A;  1FT9 A;  3BJA A;  3IV5 A;  1FOY A;  3R0J A;  2IJL A;  2OA4 A;  5HNF A;  4BU2 A;  4XID A;  1PUE E;  1V5F A;  1QNT A;  2MYS A;  3HM5 A;  2R7S A;  3ZMD A;  1UB9 A;  2EIK H;  1Z05 A;  1IRZ A;  3UKG A;  3OIQ A;  3VPR A;  2NRA C;  2V1N A;  3WHB A;  3HOW J;  3LL7 A;  1IXS B;  1SFK A;  2FML A;  4CHU A;  3N97 A;  2DT6 A;  3CO6 C;  1R22 A;  2HDD A;  2X1C A;  2V79 A;  1IAW A;  4D7M A;  3NRV A;  1U5T C;  2CW7 A;  2P8T A;  3SFI A;  4YFX F;  1AKH B;  3OS1 A;  3PFI A;  4F92 B;  3JW4 A;  3WE2 A;  2MGQ A;  2E36 A;  1BR4 A;  4RAZ A;  2X85 A;  1KQ9 A;  1LFB A;  1XMK A;  3MVP A;  4Y13 A;  3FM3 A;  3IRR A;  2VJI A;  1W36 C;  2OTJ I;  2EIJ H;  4PJ0 C;  5A2Q Z;  4LD5 A;  2W48 A;  3E5Q A;  1FNN A;  2WAD A;  3Q0V A;  4B1R A;  2XSD C;  4I09 A;  4NC7 A;  5ICG A;  4RB0 A;  1APL C;  3GCM A;  3L7W A;  3OS0 A;  2K40 A;  4B3A A;  4LIU A;  1V54 H;  2DXI A;  3MCZ A;  2LK2 A;  4IRG A;  2DA3 A;  3CCQ I;  1MZB A;  1Z3Y A;  2CS3 A;  3MMY B;  5AIP A;  1F9N A;  1YQA A;  2AO9 A;  3CUO A;  4DBQ A;  2R7O A;  4O6J A;  2HQ5 A;  2FMY A;  2JRT A;  3GWZ A;  1AHD P;  4QLC U;  1P9Q C;  3DV8 A;  1JI8 A;  5TGT A;  3A03 A;  1U9O A;  2DTR A;  3GTQ J;  4XRM A;  2E60 A;  5EGO A;  2DA1 A;  2K3P A;  1D8K A;  4RDU A;  1WZ2 A;  4P5O A;  1T95 A;  2PJP A;  1ZG3 A;  2NS8 A;  3R60 A;  4CCJ A;  3I9V 2;  4XK4 A;  1H8A C;  5M5W J;  1FSH A;  5J1Y A;  3K1N A;  3BWG A;  1W5C C;  1R5I D;  2IVM A;  3PL8 A;  1GT0 C;  4HRI A;  3RPU D;  2LF7 A;  3CUQ B;  3HXL A;  3AG2 H;  4J19 A;  3DBL B;  3K2A A;  3F9K A;  4D5C A;  2LD5 A;  2WAF A;  2FX0 A;  1W0T A;  3QPS A;  1VQ7 I;  1YTY A;  3GTM J;  1G3Y A;  3A02 A;  5DUI A;  4KDP A;  2OJE D;  2ZXW H;  2Z3Y A;  5L3B A;  2IA1 A;  1G59 A;  3TDZ C;  4L0Z B;  3HTU A;  1S72 I;  3LA7 A;  2CGP A;  2Y0S A;  2JZY A;  3BLY A;  3LFU A;  4LJZ F;  3S32 A;  2C6Y A;  2WA0 A;  1HW5 A;  2E34 A;  1WH5 A;  1I3A A;  4NBQ A;  5DV5 A;  1PP7 U;  3GTG J;  1ZRE A;  1WJD A;  3ZQF A;  4X6A J;  3E6C C;  2I8D A;  3JRI A;  3CJR B;  2VKE A;  3HSE A;  4M72 A;  3DFG A;  1JKR C;  5FB2 A;  1A5J A;  3IC7 A;  1UHM A;  4KIC A;  2QZ8 A;  4CCO A;  1GXQ A;  1MDM B;  3GFM A;  1A6I A;  3ONQ A;  2DYS H;  1JUP A;  2LFB A;  2Y31 A;  1MNE A;  3CF2 A;  3SXY A;  4AYB N;  3H0G J;  1LVK A;  2KIQ A;  3SFZ A;  4DBR A;  2CW8 A;  2PMU A;  3D5S C;  4IHT A;  1OCO H;  2FNP A;  3BTI A;  4BJ5 C;  2IPQ X;  2GOM A;  2LOO A;  2M4K A;  3KFW X;  3W6J B;  5DYM A;  5C4J J;  1HF0 A;  1MMS A;  2YU9 J;  2IS2 A;  3I71 A;  4BUP A;  2QQA A;  1MND A;  3KP2 A;  4XKW A;  4IEJ A;  1Z3X A;  4ZTJ A;  1JKP C;  5IYD J;  3L2Q A;  3WHC A;  5HDK A;  1VQM I;  1HW1 A;  4P9F A;  2B63 J;  1OYI A;  4B44 A;  2FRH A;  2UZK A;  5FGM A;  3TW7 A;  1H9T A;  4AVP A;  2ZSH B;  2RKH A;  5HVQ C;  2Q1Z B;  2COB A;  5L3G A;  1MDM A;  3BCB A;  1Y8Q B;  4EM1 A;  3CLQ A;  1QZZ A;  4S0H B;  4ENJ A;  2VI6 A;  2M2E A;  5E8G A;  1G3T A;  4GYI A;  4G94 A;  3F23 A;  4M71 A;  5JR3 A;  3E6B A;  2ICW G;  5FKO A;  4CIC A;  2PEX A;  1HA8 A;  3WTZ A;  5K7F A;  4XLC A;  2VPR A;  5DCF A;  3FXU A;  1FTZ A;  2E7W A;  4RA2 A;  1XMA A;  2VPL A;  3QWL A;  2EWN A;  2KMU A;  4RS8 A;  2COM A;  4NUB A;  1R49 A;  2A69 F;  1FBS A;  1YJ9 I;  4HF0 A;  4HSR A;  1ETX A;  3A01 B;  2KJB A;  5H6Q A;  2A05 A;  4EJV A;  4KMF A;  4U7D A;  4CYD A;  3PIP F;  2EFO A;  4LLG F;  4E7L A;  4YG2 F;  1ETV A;  4IVN A;  2W84 A;  3F21 A;  1JXS A;  2HU9 A;  4R8H A;  1IG7 A;  1D3Y A;  4ZTF A;  3K4B A;  2DJI A;  4JYK A;  2CQK A;  1MGT A;  4RLF A;  4V19 K;  2YR2 A;  2TDX A;  4BHB A;  4ZYA A;  4RAG A;  1K4S A;  1T98 A;  2OAZ A;  3JAM Z;  1R71 A;  1FYM A;  2YPR A;  2CQQ A;  1YLF A;  3I5U A;  3VYT B;  3DP7 A;  2Z5U A;  4XLN F;  1T33 A;  1MW7 A;  4U87 A;  3ZGK A;  4HLY A;  4IHX A;  3L00 A;  1XPX A;  1N78 A;  3OYH A;  3CJT B;  3SDB A;  4MIM A;  3BY6 A;  3HUG B;  2EPF A;  3TGN A;  2ZNZ A;  3I55 I;  4I99 C;  4ENK A;  2WB1 A;  1D5V A;  1WJE A;  1BM9 A;  1BR2 A;  5GAG J;  2RDP A;  3M07 A;  5EZH A;  2HOS A;  1DGW Y;  3OOP A;  2X51 A;  4XBF A;  2OTL I;  1YX5 A;  1T2K A;  1D5Y A;  2R7T A;  2EFN A;  4HNU A;  1STZ A;  2KIM A;  2V1U A;  2LNB A;  1LE8 A;  3HSF A;  2V6E A;  1H9G A;  1O7F A;  1WJB A;  2L7F P;  2XAU A;  3L9F A;  3M1C A;  2TRT A;  1DGR M;  1W7P A;  1VZ0 A;  2DA7 A;  2W4S A;  3WG7 H;  3GFL A;  5E1Z B;  3WU2 C;  4FE7 A;  3RQ4 A;  5GAH J;  3BDD A;  3G3Z A;  3NWS A;  4LB6 B;  1P2F A;  3KEY A;  4MQV A;  2XKO A;  4M9X A;  4RAF A;  1IRG A;  4PCQ A;  2STT A;  3CES A;  3M7G A;  4B3X A;  2E1M C;  2A5W A;  4UVA A;  4UUV A;  2NAZ A;  3AL0 B;  4A0X A;  4ESF A;  1KU9 A;  1TL8 A;  4UUT A;  4BDZ A;  3DTI A;  3FXR A;  5GAD J;  2IS4 A;  2X1D A;  3CJN A;  2OC6 A;  2M87 A;  1GV5 A;  4V2G A;  2M34 A;  5D6F A;  1WJF A;  2WAQ N;  3DTK A;  1HDP A;  3N05 A;  4OIR F;  3EDP A;  4L5E A;  1V55 H;  4RB3 C;  3JRE A;  4EGZ A;  4A3I J;  3ASO H;  2JK3 A;  4G7Z F;  4XQF A;  1LQ1 A;  2X1E A;  5EEA A;  3FIS A;  3PNT A;  3E5U A;  1VQO I;  2LY2 A;  2R7V A;  2HOE A;  4A2U A;  5L3C A;  3T1B A;  2FBK A;  5FRO A;  3JRB A;  1P7I A;  4JX6 A;  2P5K A;  1ZG5 A;  5GTH C;  3G73 A;  4IQJ A;  3KP4 A;  3OYI A;  1MIJ A;  2O0Y A;  5FD5 A;  3QQA A;  3ROU A;  3H9G A;  2ZXI A;  3FF5 A;  2JUG A;  1FPQ A;  2Q2E B;  3RDI A;  1JUS A;  4CH7 A;  3FX3 A;  5J1R A;  1D0Y A;  3ZP5 A;  5IT9 Z;  4HOB A;  3ZQG A;  3CMA I;  3CCY A;  2K02 A;  1LVA A;  2V6C A;  1D1B A;  2VBX A;  2VC0 A;  1MBH A;  3ISP A;  1RIO H;  1RKT A;  2H6C A;  5C44 J;  2NS0 A;  3IWF A;  2F2E A;  2QBY A;  3F3X A;  2IAI A;  1SAX A;  1LUJ B;  2HQA A;  1GVD A;  2LRD A;  1RES A;  3PFY A;  1T0F A;  1OLT A;  2KLO A;  3CDH A;  3FXL A;  5FJ8 J;  3CLO A;  5FLM J;  1ON1 A;  3J7Y J;  3L2C A;  3B02 A;  3MQ0 A;  1K79 A;  4KUM A;  4NQW B;  1UST A;  4HDV A;  4CSW A;  2R7X A;  4IRI A;  2Z1D A;  2O03 A;  4GO1 A;  1RKW A;  3CD6 I;  3WG9 A;  3ZPL A;  5CKT A;  1FP2 A;  2JA7 J;  1T8I A;  3VOE A;  2JT1 A;  5D6E A;  2XGE A;  3E6D A;  4EM0 B;  2VT2 A;  5M5X J;  4FET A;  4C2T A;  2HFH A;  4UVC A;  4Q48 A;  4ASN A;  3WE3 A;  3F0C A;  2XGX A;  4XN3 A;  5ERI A;  5IT3 A;  2Z33 A;  2PN6 A;  2XGC A;  4XIC A;  1I6X A;  1HW2 A;  2CV1 A;  5F04 A;  1PP8 F;  4NC6 A;  1PUF B;  4LG0 B;  2K85 A;  4XSZ F;  5EG0 A;  2G7U A;  3CDI A;  2Y9Z A;  4CYC B;  3O3K A;  4ZJZ A;  4F55 A;  1U8B A;  4X1E A;  2FQ3 A;  3BRO A;  5CLS A;  5B5E C;  2KQR A;  2V1D A;  1ACI A;  2OF7 A;  3I59 B;  3FK7 A;  4XON A;  1TT0 A;  4YRV A;  1W36 D;  1J59 A;  2BVM A;  3OSG A;  3J81 K;  1ZEL A;  3ZMS A;  1GHC A;  4FQG A;  3FKI J;  4BY1 J;  5J4V A;  4J01 A;  1PUF A;  3NAR A;  2HTJ A;  4ENM A;  2E35 A;  2HYJ A;  4YIF A;  3L2W A;  2PMZ N;  3SDG A;  3HKZ A;  2VC1 A;  1ZKG A;  2AQE A;  3BTJ A;  4II3 A;  1IN5 A;  1FSE A;  1OCR H;  2EV0 A;  4UHT A;  1K6Y A;  3G1O A;  3ZMU A;  2DQR A;  1FIA A;  3CO7 C;  2BY1 A;  4I6Z A;  5J40 A;  3RKQ A;  3V8J A;  1MD0 A;  4KNY A;  2AXL A;  1HCR A;  3A01 A;  4GGG A;  4DOZ A;  3BC8 A;  1R5H A;  1DQU A;  3EPZ A;  2QCO A;  3R4K A;  1OJL A;  1EKE A;  3S15 J;  3DF8 A;  4UB6 C;  2GOX B;  4N9H A;  1U0J A;  2K9Q A;  1ZYR F;  4HF2 A;  5J4Y A;  3SZG A;  1HDD C;  3ELK A;  4A69 C;  2DOE A;  1QQI A;  2KRF A;  3QPL A;  4UUS A;  3U21 A;  1D8J A;  4RMN A;  2R0Q C;  1E0E A;  5DM7 F;  5GAE J;  2HDW A;  3WTU C;  2L02 A;  2XAH A;  1LFP A;  3QRF F;  1MJB A;  5HNH A;  4L9T A;  5LGT A;  4BXX J;  5EEH A;  3K4C A;  2W00 A;  1Z7U A;  1XDS A;  5DCM B;  1G6N A;  2K9M A;  2K9L A;  4XM3 A;  3FXQ A;  2CYY A;  4A6D A;  4G6Q A;  3KPH A;  2MA3 A;  2P0W A;  2IW5 A;  3JSP A;  4XOP A;  2X48 A;  4WK8 F;  5IPA A;  2ZC2 A;  2HZD A;  5HOO A;  1Z6R A;  3KZI C;  1GUU A;  3QOD A;  4XSX F;  5LRS A;  2HVR A;  3E5X A;  3H92 A;  1K4T A;  5TIS C;  2JN6 A;  1SFE A;  1YW8 A;  2GXB A;  4M73 A;  2F4I A;  3QU3 A;  5ILS A;  1PJR A;  1U2W A;  1O3S A;  1XGS A;  2ZB9 A;  1ZGW A;  2VXD A;  3AG1 H;  4JQF A;  1VQ8 I;  1BBY A;  2GWR A;  5GPA A;  3PQK A;  2DMT A;  4UVB A;  3TDU C;  4E6K G;  1JKO C;  2R5Y A;  4F93 B;  3BG7 A;  3W2V A;  3HOS A;  1TZL A;  2FOW A;  2OZ6 A;  4DYQ A;  5D5X B;  4KIS A;  4F52 A;  2PJR A;  2ZME C;  2RNJ A;  1RR7 A;  4IHS A;  2H1L A;  2P5V A;  2ME0 A;  2A07 F;  5M5Y J;  2R92 J;  2VL8 A;  5BMZ A;  3HB9 A;  5H2F C;  5M3M J;  3BR0 A;  5HS8 A;  1K61 A;  4E7S A;  3WTS C;  2GBY A;  4PJM A;  3JRH A;  1VQL I;  5E20 A;  1KA8 A;  3CCL I;  4OMY A;  2BY0 A;  3RZO J;  1X1A A;  3VSK A;  4OAY A;  2EQR A;  3UNG C;  3C3W A;  1RI7 A;  2ESN A;  3H5R A;  2DQL A;  1NTC A;  1OMI A;  3E6M A;  4CDG A;  3N4M A;  3K4J A;  1CQT A;  2FBI A;  4BEH B;  5BS6 A;  1FX7 A;  2PI0 A;  1REP C;  2HZT A;  3SZT A;  2M7A A;  2DMP A;  2XF7 A;  3PNV A;  1SAU A;  3ZR8 X;  4A3K J;  5E17 F;  2L2O A;  5D8L B;  2V26 A;  2JUC A;  2X6W A;  4BKX A;  5KVR A;  3GME A;  2EZK A;  3GTP J;  2KL4 A;  3FDY A;  1IZ1 A;  5LHI A;  1MBG A;  2DA5 A;  2QQ8 A;  2O8X A;  4I0B A;  5E1X A;  4LB5 A;  2BE5 F;  3SQN A;  2LDU A;  3DBH B;  3CC2 I;  4GDF A;  1S7E A;  2VOP A;  3L1P A;  3FMS A;  2J5P A;  1DP7 P;  1IJW C;  4KFC A;  4RM2 A;  5IOZ A;  2EFP A;  2LRE A;  3LSH A;  4MO7 A;  5CVU A;  4B09 A;  4A6E A;  1N75 A;  4FX0 A;  4XL9 A;  1YJN I;  4A0Y A;  1X1P A;  4BAY A;  1MJA A;  3HRS A;  2XPV A;  3TW6 A;  4IOC F;  1TWH J;  3F8B A;  5ILV A;  4EJW A;  2MH9 A;  2ID3 A;  3W6K B;  1UEL B;  4BGD A;  1FMW A;  2CJJ A;  1HLV A;  3FM5 A;  2ELK A;  1FBQ A;  2UXX A;  2KJC A;  4MLO A;  2KT0 A;  3ZMT A;  1YX3 A;  2MD5 A;  3A4C A;  3S3M A;  1ODD A;  1XN7 A;  4PSW A;  2LKX A;  1UHW A;  4I2O A;  1SMY F;  2OBP A;  2B7E A;  2AXT C;  3FIW A;  2E2J J;  3T8T A;  3ZQQ A;  4ANJ A;  1QVU A;  2ZJ2 A;  3HEF A;  1IDZ A;  1Z91 A;  2DOD A;  3VDX A;  1ZRF A;  2FQ4 A;  3WU1 B;  2IA0 A;  2KHM A;  1BA5 A;  1KYW A;  5LEJ A;  3EET A;  5H6R A;  3K70 C;  2EJR A;  3HJE A;  1XDU A;  1BI1 A;  3GVA A;  2L9N A;  2LVS A;  3TED A;  2EA4 A;  3AG3 H;  4M6Y A;  4GXO A;  4ZH4 F;  2EK5 A;  2XGD A;  2LR8 A;  3QOE A;  2KRC A;  3DWL E;  3VB2 A;  4BQA A;  1AKH A;  3OL4 A;  4I0A A;  1FBU A;  1YOV B;  2DYR H;  3CUQ C;  4A0Z A;  2GA2 A;  2NOJ B;  5LHH A;  3A0H C;  1Z7L A;  3G6E I;  1YI2 I;  3OYC A;  1JJ8 C;  2L5Q A;  4MFE A;  1BC8 C;  4CCM A;  4XLE A;  5M3F J;  3R6S A;  2FU4 A;  2HOA A;  4NHJ A;  2CRG A;  1YS6 A;  4OAZ A;  3L2V A;  2Q2E A;  5FKL A;  4Y7N J;  1G4D A;  4ON0 A;  3JCU C;  4BJT A;  1SMT A;  2DPU A;  4XRS A;  1FYL A;  2Y0S N;  3K9T A;  1FOW A;  3MZY A;  4CO8 A;  4M3D A;  3C18 A;  2BHY A;  2NNY A;  5E3N A;  1ERD A;  2DDA A;  2R93 J;  1I27 A;  1QZE A;  2XV4 S;  4AUX A;  4CGZ A;  1S7A A;  3UR3 C;  4D7N A;  4A5M A;  3SJM A;  2GXA A;  5DUK A;  3TOB A;  3PQJ A;  2F48 A;  2QWW A;  4DGW B;  1UCR A;  4S04 A;  2AS5 F;  3B6C A;  2P6T A;  2BXY A;  3BZC A;  3IP4 B;  3AAF A;  3VYS B;  3HDD A;  4Q4Z F;  4BDY A;  2CSO A;  3PM1 A;  2DPD A;  3CP8 A;  4BYY A;  1BOB A;  2FEZ A;  3K6G A;  5IP9 J;  1WJ5 A;  1D0Z A;  2HR3 A;  5E8I A;  1BI2 A;  2Y48 A;  3HOU J;  3BG5 A;  1IUF A;  3VSL A;  3M9A A;  3G2B A;  2A68 F;  3W2A A;  4CXF A;  1QZY A;  1ON2 A;  5F0H A;  1NH3 A;  4D0P A;  4L5I A;  3KIO A;  1LB2 A;  1VQ4 I;  1FWZ A;  4K2E A;  1ETQ A;  1VF9 A;  1X1D A;  4BBS J;  5J8F A;  1Y39 A;  4G12 A;  5FFZ A;  4GYG A;  2PJR B;  2K9S A;  1AU7 A;  2FOK A;  4B47 A;  2NXN B;  3LSP A;  2KP6 A;  1E3O C;  1DDN A;  3LFK A;  3CC7 I;  2O9L A;  3C2G A;  4HX8 A;  5ILU A;  2LP0 A;  2Z16 A;  4HPQ A;  2FD5 A;  1TNT A;  4JK1 X;  5B1A H;  5HLT A;  3QYF A;  3W6V A;  2F5F A;  4Y17 A;  4PJL A;  2NS7 A;  4EVI A;  1R23 A;  2H8W A;  4BY7 J;  3DCF A;  4Q47 A;  1RC9 A;  2RVC A;  4HNT A;  4KYW A;  2L54 A;  5K5O A;  1XMX A;  2VUM J;  4EAT A;  2JVH A;  3TKY A;  3S93 A;  5JI6 A;  3J81 Z;  1NK2 P;  2NYX A;  3IKV A;  1B9N A;  2LH9 A;  3RYP A;  3GFI A;  1A04 A;  1YHQ I;  2L7Z A;  3ABT A;  3HL2 A;  2DN0 A;  1OQY A;  3BP8 A;  3WTV C;  4E7H A;  4HYE A;  2L9S A;  1QRY A;  4A3D J;  1J2X A;  4O3M A;  5BOX A;  3I4P A;  2V1X A;  2DTZ A;  3GYH X;  1J9I A;  4U88 A;  2VJJ A;  2R3S A;  4KJZ A;  2GLO A;  4KA4 A;  1LDD A;  2M1B A;  4OIQ F;  5FRM A;  3FHN A;  2WC2 A;  4NDL A;  2KIF A;  5BPD A;  4AIH A;  1ENH A;  2OZU A;  2CQN A;  3PUB A;  2JJ7 A;  2V4J C;  3BQY A;  4L9V A;  2ZJR F;  2NVX J;  1RPW A;  1W5T A;  2FSW A;  2R7D A;  3SHF A;  4DZP A;  4OIP F;  4JBA A;  2WWY A;  3KLN A;  4RM3 A;  2JA5 J;  4YFK F;  3PO2 J;  3LAJ A;  4OIN F;  3ULQ B;  1I3Q J;  4UUS B;  2VQG A;  3WTY C;  3T0Y A;  3S2H J;  2BW3 B;  2XPU A;  2NNN A;  2BY3 A;  4DW6 A;  3MAJ A;  1J7K A;  2VOO A;  1BW6 A;  2DMU A;  1XSX A;  3QPH A;  2XUB A;  1Z21 A;  4KMU X;  4IO9 F;  1TQP A;  3NEU A;  3JRF A;  4RGR A;  3BOQ A;  4BQO A;  2JPC A;  4HEA 2;  1B6A A;  5FFX A;  5D4R A;  3MKZ A;  1BI3 A;  3OOU A;  3KET A;  2LSO A;  5IOY A;  2L01 A;  2PFB A;  3ABK H;  4HV6 A;  3RIR A;  1MMG A;  1B72 B;  1GDT A;  4AM3 A;  4A3J J;  4NB5 A;  5ED4 A;  1QHG A;  2RC4 A;  1IUY A;  5CVV A;  5IT9 K;  1LEA A;  4HA8 A;  1ETK A;  3HRM A;  4OWR B;  1U3E M;  3WGG A;  4CCK A;  2QQ9 A;  3DQV C;  1XGN A;  2F6C A;  3KEQ A;  1E17 A;  2CV2 A;  3V8K A;  3ERM A;  3OYN A;  2X6X A;  4M3E A;  2MC3 A;  1EH8 A;  5IP6 A;  1L3L A;  3M4O J;  1X3Z B;  3BG3 A;  1SD7 A;  2KZV A;  1B59 A;  1KQ0 A;  1HKT A;  3OIP A;  3ZQI A;  4PZJ A;  2NVY J;  4RGX A;  1ZAO A;  1WPK A;  3KP7 A;  1YFH A;  4UB8 C;  2FNA A;  3O8H A;  2BZT A;  2VQL A;  2HYG D;  5ICC A;  3H9J A;  1UZC A;  3EUA A;  4C3H J;  4C2U A;  1P92 A;  3CF5 F;  4MEX F;  2L9V A;  3IH4 A;  2X4H A;  3OYE A;  3LAP A;  1I6H J;  2AQF A;  2WB1 N;  2JSP A;  2XKP A;  4RGU A;  4DIQ A;  5F1R A;  5AIQ A;  1V4R A;  3WTX C;  3FHZ A;  4EGY A;  1HSJ A;  1T39 A;  2TCT A;  2E2H J;  3ZN1 A;  4ZYE A;  3Q3S A;  1VQN I;  3HG9 A;  3I58 A;  1JKQ C;  1ZRC A;  2D45 A;  4YIR X;  1MMN A;  2P7V B;  1TW3 A;  2EV5 A;  3HOX J;  3RI4 A;  1JT0 A;  1RZ4 A;  2AHQ A;  2QSG X;  2LKS A;  4G9Y A;  3OSF A;  3GZ5 A;  3S1M J;  2P81 A;  3EUH A;  2O3F A;  3WGH A;  2GXG A;  4M74 A;  5CVJ A;  1MH4 A;  3BR3 A;  1TTY A;  4M3B A;  3SEQ A;  4PDK A;  2F5E A;  2MLK A;  4MTD A;  2WY8 Q;  2RNG A;  1RRJ A;  4KIG A;  1EF4 A;  1ZHF A;  3JR9 A;  3F22 A;  3W3C A;  2DK5 A;  4XKB A;  3ECH A;  5EDN A;  5EYR A;  2XRL A;  5F0F A;  5B66 C;  2EIN H;  2XAF A;  2VOD A;  2IGK A;  3K1M A;  3ML6 A;  5FO5 A;  2K7L A;  3TO6 A;  4XMY A;  4ZZL A;  1YIJ I;  5EGO B;  3K2Z A;  3RSN A;  1HKS A;  1YG2 A;  4PUS A;  1I5Z A;  2QYO A;  3PSI A;  1SVO A;  4C3I J;  2ECB A;  1E3P A;  5K1Y A;  1LNW A;  3IH2 A;  2X6Y A;  3O2P E;  2DMN A;  3G1L A;  2ZFW A;  3K69 A;  3S2D J;  1EV7 A;  2DMQ A;  1LDK B;  1X2M A;  2ADU A;  2RV8 A;  4L5J A;  1TQM A;  5D5U B;  3L2R A;  3PUF A;  4BS9 A;  4ZDL A;  1NHA A;  2BYV E;  1NK3 P;  5IY5 H;  2CG4 A;  4CCL A;  3FBI B;  2BY2 A;  2R7F A;  4KT5 C;  4IF4 A;  1FOK A;  4P1W A;  3T8R A;  2CMP A;  1K6O A;  2H1K A;  2LMD A;  4M3F A;  3S8P A;  1MBF A;  1R5G A;  5JVG F;  2F5D A;  2QKM B;  3V7C A;  2R5Z A;  3CJQ B;  4Y4R A;  2P5L C;  1R6R A;  3BJ6 A;  1X4P A;  2QA4 I;  3OR2 C;  4HV5 A;  1PYV A;  4ABZ A;  4IQ4 A;  4EJU A;  4HST A;  3H5A A;  2QGU A;  2GM4 A;  3LSR A;  4IKF A;  2IGN A;  3CCU I;  2EZL A;  3QP5 A;  4G8X A;  4BE1 A;  4FIS A;  1LPQ A;  1ORK A;  4M6V A;  3I59 A;  3HOZ J;  1I50 J;  2HQN A;  4QTR A;  2WTE A;  3OS2 A;  4IHW A;  1ZLJ A;  4I01 A;  2YS9 A;  3IH3 A;  4HX4 A;  2R5Z B;  4WXC A;  4YEJ A;  1YRN B;  3VOD A;  3KYL A;  3ZQL A;  1JHH A;  3D0S A;  4BAC A;  1HQC A;  2JTV A;  1UFM A;  2W85 A;  3CC4 I;  4FCY A;  2LG4 A;  2DO7 A;  4HZF A;  1TW2 A;  5D5V B;  3S1R J;  1MBJ A;  3FZV A;  3KE2 A;  2M8E A;  1CF7 B;  2EFQ A;  4XLA A;  1X2N A;  4LMY A;  1N25 A;  3OY9 A;  4RGS A;  3M1E A;  2V9P A;  1IRX A;  4P96 A;  1X19 A;  3AG4 H;  1SD5 A;  2FE3 A;  3K7A J;  2LBF B;  1IV6 A;  2A6T A;  2L7K A;  3BR6 A;  2CUF A;  1F36 A;  3DTE A;  4AC0 A;  4BNC A;  2A5Y B;  4HF1 A;  3S1Q J;  2P7C B;  4KT6 A;  2QUF A;  5LGU A;  1F43 A;  1IDY A;  3NAU A;  4HW0 A;  3TO9 A;  2R7R A;  2CQX A;  2H27 A;  5HS9 A;  2XVC A;  3GEZ A;  2XC7 A;  3G4S I;  4DZJ A;  3FWE A;  1SC7 A;  3U1K A;  2E5N A;  3WTW C;  2KDO A;  3AKZ A;  1WHU A;  4BQN A;  3L2U A;  2KKO A;  1ZQ3 P;  4JX5 A;  3CP2 A;  4RAY A;  1QO0 D;  3M8J A;  1IO2 A;  3U1D A;  2XB5 A;  1IGN A;  3RYR A;  2LY9 A;  4E7I A;  4M3G A;  3VYU B;  3JSO A;  3COA C;  1JT6 A;  3HRT A;  1RUN A;  2E71 A;  1S9H A;  2DDB A;  1J5Y A;  4H0E A;  1W4M A;  5BPI A;  3ZQC A;  4BHP A;  5J47 A;  3FBN B;  1OFC X;  2EBI A;  1SVL A;  2VJ4 A;  1H89 C;  2ZJP F;  4BE2 A;  1FMV A;  2O5R A;  3HPG A;  2L0K A;  4XR6 A;  4EEF G;  1YS7 A;  3DPT A;  5IYB J;  2L9R A;  2BGC A;  2XHK A;  2ZO4 A;  1XSD A;  5K5Q A;  1KYZ A;  1B8I A;  3S3O A;  3D5L A;  3FXM A;  3O6B B;  1HKQ A;  1Z6T A;  2A6E F;  2ZXH A;  3BZ6 A;  4JOM A;  5JHF A;  4LIT A;  1YIO A;  5J8C A;  1USS A;  5LD2 C;  1T0F C;  3P5J A;  2EH3 A;  2X6O A;  4MFD A;  2WAQ A;  4UY8 I;  3DBR B;  2GQQ A;  2B0L A;  2O61 A;  3Q5F A;  3TMO A;  1QU3 A;  1XX5 A;  3S14 J;  2CUZ A;  3QAH A;  4A93 J;  5ICF A;  1WQ2 A;  2ZFU A;  1ETW A;  1FIP A;  3MEX A;  3PSF A;  3QPT A;  1QA6 A;  1LEB A;  4HNV A;  1VQ5 I;  2F5V A;  1EH6 A;  3LQQ A;  1IN8 A;  3GZ6 A;  1FOX A;  2PX9 A;  1SEU A;  1O3T A;  5FRN A;  3CQZ J;  2VKV A;  3IAM 2;  4DJA A;  3V4G A;  4G6T B;  2BW3 A;  2ELH A;  2ISY A;  4PJN A;  2RAE A;  2I5U A;  4N4O B;  4MHG A;  3RQI A;  3LSM A;  4G6D A;  5KK1 A;  1FYK A;  1R58 A;  4BE0 A;  1HST A;  2KDZ A;  5HLH A;  3GTO J;  1XC5 A;  2KZG A;  1GVJ A;  1YW9 A;  2IBD A;  1TWC J;  3PIO F;  4KIB A;  5K7H A;  2VXZ A;  3QOP A;  5C4X J;  2QQB A;  2DFE A;  2UXN A;  1Y1W J;  2KIS A;  4BHC A;  2PMZ A;  3PO3 J;  3S2W A;  5LRR A;  4WX9 A;  5BNG A;  2ZXJ A;  3DPU A;  2VJ5 A;  4AYB A;  3PJR A;  2HPI A;  2YUS A;  1I1G A;  1B4A A;  4YFN F;  3RTR A;  2M30 A;  3LSJ A;  1KU2 A;  4XN0 A;  3C2B A;  1ZTR A;  3DEE A;  4ZDO A;  2VKH A;  2ZBK A;  4G7O F;  1F4K A;  3E97 A;  1S7O A;  5F08 A;  3RPQ A;  4L9N A;  3A0B C;  3R61 A;  3OYD A;  1BR1 A;  5CYV A;  5F0C A;  4CCN A;  1SFU A;  3K1P A;  4BXU A;  2ZKZ A;  2MC4 A;  5C3E J;  2CO5 A;  2VIX A;  3P9C A;  1VQK I;  4IJA A;  4IHY A;  3CCS I;  1BJZ A;  1TNS A;  3H3U A;  3H35 A;  1U78 A;  2UV1 A;  4QWQ A;  1OR7 A;  3BR5 A;  3D1N I;  5E18 F;  2Y75 A;  2FA5 A;  5B3S H;  1OCT C;  3Q9V A;  2IS1 A;  2E19 A;  3M3Y J;  3K4M A;  4DYR A;  2Y30 A;  1NG7 A;  5JFR A;  3DLL F;  4A3C J;  3LSG A;  1HC8 A;  1QVT A;  3KYD B;  2DI3 A;  2MH2 A;  4AID A;  3H5N A;  3U2R A;  2UWM A;  1HOM A;  1BJA A;  4TV7 A;  3I56 I;  2HXO A;  3FMQ A;  3CDL A;  4F3Q A;  3F8N A;  2K4J A;  1JJ6 C;  5EG0 B;  3R0A A;  3MN2 A;  5LFA A;  3F8C A;  3VYR B;  4XLF A;  2GA1 A;  3JAM K;  4C2M J;  4N4N B;  2GIZ A;  1T56 A;  3ZOB A;  1XB4 A;  3CCM I;  2D5V A;  1OCP A;  3DU5 A;  4A3M J;  1U8R A;  3K4N A;  3JRA A;  1KU3 A;  4FHT A;  1VQP I;  1XCV A;  5TJJ A;  2QBY B;  1UG2 A;  1AOY A;  2PLY A;  1WH7 A;  1MKM A;  3EYI A;  4ENN A;  3GO5 A;  3S1N J;  1IN6 A;  4NNJ A;  2JPB A;  2Y69 H;  3TP0 A;  3C2H A;  2KRH A;  1VI0 A;  1IXC A;  1S3J A;  1WRJ A;  1V5E A;  1XGM A;  2LBF A;  2JWT A;  3DKW A;  1QGP A;  4M9Z A;  1BIB A;  4W1U A;  1Q1V A;  1ULY A;  2IP2 A;  3MZ8 A;  5DDG A;  5GP9 A;  3J7A Y;  2H8R A;  4A12 A;  1Z67 A;  2Z2S B;  3LSK A;  4LG3 A;  1LKX A;  3QP6 A;  2M4G A;  2RN7 A;  2X9D A;  3OYF A;  3HHH A;  1IN4 A;  1NG6 A;  3HYI A;  5DD8 A;  1H0M A;  1FTT A;  3ABL H;  4BXF A;  1MBE A;  4ZYD A;  2KFD A;  1A6Q A;  1A36 A;  2ACJ A;  4F91 B;  4FE4 A;  1OYW A;  5J3L A;  1SVM A;  4GRI A;  3HRU A;  1WVR A;  2G7H A;  4B8X A;  4CZC A;  3MZH A;  1AA7 A;  1U5T B;  2STW A;  1G3S A;  3BTC A;  3O8G A;  2YU3 A;  2W57 A;  3WGI A;  3TL4 X;  3B73 A;  2ZME A;  1OIS A;  2CUE A;  3ZMV A;  3BQZ A;  3KZY A;  1WI3 A;  3Q0U A;  1U6G A;  2D1H A;  2ELJ A;  1JTY A;  2KIU A;  5DEQ A;  4I98 B;  2Q8K A;  1X3U A;  2QKL B;  3GBG A;  2VLA A;  1VTN C;  1VFC A;  5DS9 A;  4ESJ A;  3WTT C;  1E2X A;  1GLN A;  2EIL H;  3H36 A;  4E70 A;  3GX4 X;  3F72 A;  3IWZ A;  5HLI A;  3MKW B;  2HYF A;  2K86 A;  5LBQ A;  1IXR C;  2A61 A;  3LMM A;  2DA4 A;  1FLI A;  1EJ9 A;  3OYM A;  2IS6 A;  3HOT A;  2BHZ A;  2DK8 A;  2OD5 A;  4J00 A;  1P4W A;  2W25 A;  1Y8R B;  4OMZ A;  1XTA A;  4FTH A;  2GZW A;  3WU0 A;  1MSF C;  2EV6 A;  3ZMZ A;  3BZK A;  2G9W A;  1MH3 A;  4EJT A;  2ZNY A;  3JRD A;  1K83 J;  1YIT I;  1LDJ A;  2NVU B;  2N8G A;  3EYY A;  3Q0W A;  4ZZD A;  2JVG A;  2K3F A;  1B72 A;  1YJW I;  5KAF C;  2HGC A;  2JMW A;  2YX4 A;  4KIT B;  5EZG A;  1D1C A;  1S8N A;  2VQC A;  1R1T A;  3RZD J;  2DFI A;  2M0C A;  2RQP A;  2XSJ C;  3KX2 A;  1EA3 A;  1R36 A;  4N9I A;  5IP7 J;  2I10 A;  3QYB A;  3OYK A;  4HLX A;  3FXK A;  3MD2 A;  3J7A O;  2BVL A;  3AFH A;  3E7L A;  1O57 A;  1IN7 A;  3RPU A;  1WJA A;  1N77 A;  2Y0M A;  1DPR A;  1FEX A;  1WSU A;  1KON A;  3CTA A;  2QLZ A;  1JGG A;  5FKN A;  2XAG A;  1ITY A;  3V7S A;  4W97 A;  1SFO J;  1KGS A;  2B9S A;  1LE8 B;  3KP5 A;  2LKP A;  1Y56 A;  2JQ7 A;  1P4A A;  3NQO A;  5EJC A;  2R7W A;  1O3Q A;  1O4X A;  2FUG 2;  4HBL A;  4GCV A;  2JSC A;  4FX4 A;  1W1W E;  3TP3 A;  2WY7 Q;  5KHD A;  2HVS A;  3HUG A;  4U0V A;  4E7Z A;  3FXJ A;  2HWV A;  4OOI A;  2BV6 A;  2VBW A;  2WBM A;  2OV7 A;  3MWM A;  1Q1H A;  1BOA A;  2E7X A;  1OYY A;  3ABM H;  4C9Y A;  1D1A A;  4RB2 C;  2Y9Y A;  1YW7 A;  4JX4 A;  1L0O C;  1RR8 C;  2OU2 A;  4BL0 B;  1X58 A;  2RRE A;  2QVO A;  4XOR A;  2M0M A;  1T6S A;  3MFK A;  2PMH A;  3A1Y A;  4B4C A;  1WFX A;  2EB7 A;  3G1M A;  3HZJ A;  4P55 A;  3JRG A;  2VT3 A;  3OR1 C;  4BQQ A;  4IL6 C;  3ABU A;  1TC3 C;  3LST A;  1V3F A;  3J80 Z;  3K10 A;  3V42 A;  4D1Q A;  3IUO A;  4EQQ A;  2LF8 A;  4NC8 A;  5FLX K;  1I39 A;  2YX7 A;  4LLN A;  1E3H A;  1PVE A;  4AIJ A;  1WKM A;  4DYC A;  5E3O A;  5A2Q K;  4D9J A;  3I64 A;  2QSH X;  3JTG A;  1SAN A;  2A3S A; 
#chains in the Genus database with same CATH homology
 2DW4 A;  4WXH A;  2XAS A;  4L9J A;  1AWC A;  1TBX A;  2XRN A;  1FY7 A;  2P4W A;  1P6R A;  3BJO A;  3HHG A;  2DU9 A;  4UV9 A;  5H20 A;  2P6S A;  3HTS B;  3P7N A;  1K78 A;  4U0Y A;  3VEP A;  2OQG A;  1J75 A;  5JVT A;  4AD9 A;  1HBX G;  2J5O A;  1W5S A;  1XSV A;  3ERE D;  3LA3 A;  1CGP A;  2ISZ A;  1XCB A;  5JHU A;  4EV0 A;  1JE8 A;  1ZGA A;  3KP3 A;  4Q5S F;  2E1N A;  2PG4 A;  3KEO A;  3P9K A;  1JGS A;  3K0L A;  1BN5 A;  5K5R A;  3F6O A;  3QU6 A;  4MQ9 F;  4PGH A;  1Z9C A;  4LK1 F;  1DUX C;  1OKR A;  2L4A A;  2VON A;  5LHG A;  4U0W A;  5HS7 A;  4M6X A;  3CUQ A;  1ZH5 A;  3HIF A;  5D4S A;  1SD6 A;  1FC3 A;  3RKY A;  3DEU A;  1XGO A;  1S6L A;  2IT0 A;  4HQE A;  4Z2Y A;  3M8F A;  2Q0O A;  2E1C A;  1ZAR A;  2YSR A;  5LGN A;  2H94 A;  3GFJ A;  4KN4 X;  1T38 A;  3F8M A;  2F5C A;  4MGR A;  4KIF A;  5D5W B;  2DBB A;  3C7J A;  1GXP A;  3E3V A;  1YYV A;  4WCG A;  3I53 A;  2IRF G;  2H09 A;  4LLL A;  4Y15 A;  1KU7 A;  4KN7 X;  5J6X A;  2VBY A;  3ECO A;  3SZP A;  4AIK A;  2DT5 A;  4IXA A;  4EMS A;  4DQ2 A;  3TOA A;  2CFX A;  4EJO A;  6PAX A;  1RUO A;  4FT8 A;  1J0R A;  4CZZ A;  4S05 A;  1F1Z A;  1I1S A;  5FD6 A;  2QEN A;  3HSR A;  1K7A A;  4L18 B;  1R7J A;  2V9V A;  1ZLK A;  1PDN C;  1WI9 A;  2HQR A;  3L09 A;  2CW0 F;  4LG0 A;  2GAU A;  2W24 A;  4XRF A;  4XLP F;  2Z99 A;  4R79 A;  2D1V A;  2HEO A;  2XAQ A;  2HS5 A;  1R1V A;  4MNU A;  2X0L A;  2ESH A;  3GXO A;  3RKW A;  1SFX A;  1LJ9 A;  2VN2 A;  2K27 A;  5FLX Z;  1G3W A;  1JHF A;  1U5T A;  3ZN0 A;  2MBF A;  5D8K B;  3J80 K;  4OU0 A;  1EH7 A;  3U9G A;  2K4B A;  2EA2 A;  1O7L A;  1SD4 A;  1FZP B;  4DNC A;  4LK0 F;  1B9M A;  2L3D A;  2XRO A;  4A5N A;  2L4M A;  2FXA A;  2MLG A;  1C0W A;  3KLO A;  2GIV A;  5HDG A;  1BIA A;  4PGG A;  2PQ8 A;  2H6B A;  1S29 A;  3BPV A;  4LFU A;  5DD4 A;  2ZCW A;  3RJP A;  4UNO A;  3V7R A;  1CF7 A;  1RNL A;  3KP6 A;  2VBZ A;  3F8F A;  4OIO F;  3DPL C;  5LEK A;  2HTS A;  1ONV A;  4ESB A;  5E1W A;  1R00 A;  3LQR A;  4U7B A;  1BI0 A;  4R1H A;  5HLG A;  3H3Z A;  2HKX A;  2O6G E;  2XIG A;  3I54 A;  5AON A;  4UV8 A;  4HAM A;  3ZQ7 A;  4I7H A;  1F5T A;  1Y0U A;  3TO7 A;  5F64 A;  3C1D A;  3JTH A;  2D2W A;  3V8L A;  2VE9 A;  4HX7 A;  3LA2 A;  1P4X A;  5L3E A;  1W7P B;  4MTE A;  4MEY F;  3Q9S A;  4M9S A;  2QM3 A;  5BQT A;  4L0Y B;  4WWC A;  1MJ9 A;  3I0T A;  4ZYH A;  2DLL A;  4G7H F;  4ZYG A;  4I02 A;  4RB1 A;  1IF1 A;  1TLH B;  1O3R A;  1DPU A;  3IHU A;  4LGW A;  2OQR A;  3T5X A;  1XD7 A;  4P9U A;  1YO5 C;  1R1U A;  5CJ9 A;  3M8E A;  4UXN A;  2PBI A;  4F7Z A;  2FBH A;  1ZRD A;  1B1B A;  1BC7 C;  3LWF A;  2RGV A;  2BEO A;  3GUD A;  2HDC A;  1ZN2 A;  1WWX A;  3KZZ A;  2M5W A;  2HKO A;  5L3D A;  5ICE A;  3P9I A;  4EM2 A;  5TRD A;  5CVI A;  2Z9O A;  4ETS A;  2WV0 A;  2VE8 A;  1ZG1 A;  2EFW A;  4HDU A;  1ZGJ A;  3EQL F;  4N0B A;  5F6F A;  1K78 B;  2ZME B;  4AWX B;  1OPC A;  5L3F A;  3WOD F;  3BPX A;  1KQ8 A;  3IRQ A;  4WF2 A;  3RKX A;  5EEG A;  3KCC A;  3GW2 A;  2IA2 A;  3GF2 A;  2M45 A;  4O5V A;  3FMR A;  3IKT A;  1HXD A;  1FP1 D;  1IRF A;  3DXJ F;  4HQM A;  4IPA A;  3VFZ A;  1TQI A;  5CVR A;  1QPM A;  1Z1D A;  2CWE A;  3F6V A;  5LLQ A;  4YII A;  4NQW A;  4BH9 A;  3OV8 A;  5DCM A;  2XAJ A;  3GLX A;  3IL2 A;  4IRH A;  2DAO A;  5HDN A;  1W7P D;  3REO A;  1IW7 F;  4WXD A;  1QBJ A;  2A6H F;  2BBY A;  2FF4 A;  3TQN A;  2ETH A;  1FT9 A;  3BJA A;  3R0J A;  2IJL A;  2OA4 A;  1PUE E;  1QNT A;  3ZMD A;  1UB9 A;  1Z05 A;  2NRA C;  1IXS B;  2FML A;  4CHU A;  3N97 A;  3CO6 C;  1R22 A;  2V79 A;  1IAW A;  3NRV A;  1U5T C;  2P8T A;  4YFX F;  3PFI A;  3JW4 A;  3WE2 A;  4RAZ A;  1KQ9 A;  1XMK A;  4Y13 A;  3FM3 A;  3IRR A;  5A2Q Z;  4LD5 A;  3E5Q A;  1FNN A;  4I09 A;  5ICG A;  4RB0 A;  3L7W A;  3MCZ A;  4IRG A;  1MZB A;  5AIP A;  1F9N A;  1YQA A;  3CUO A;  4O6J A;  2FMY A;  2JRT A;  3GWZ A;  4QLC U;  3DV8 A;  2DTR A;  1D8K A;  4P5O A;  2PJP A;  1ZG3 A;  3R60 A;  1FSH A;  3K1N A;  3BWG A;  2IVM A;  2LF7 A;  3CUQ B;  1YTY A;  1G3Y A;  5DUI A;  4KDP A;  2Z3Y A;  5L3B A;  2IA1 A;  4L0Z B;  3TDZ C;  3HTU A;  3LA7 A;  2CGP A;  2JZY A;  4LJZ F;  2C6Y A;  1HW5 A;  5DV5 A;  1PP7 U;  1ZRE A;  3E6C C;  3HSE A;  4M72 A;  3DFG A;  5FB2 A;  3IC7 A;  1UHM A;  4KIC A;  2QZ8 A;  1GXQ A;  1MDM B;  3GFM A;  3SXY A;  3SFZ A;  4IHT A;  2PMU A;  2FNP A;  2IPQ X;  3KFW X;  3W6J B;  5DYM A;  3I71 A;  2QQA A;  3KP2 A;  5HDK A;  1HW1 A;  4P9F A;  1OYI A;  2FRH A;  2UZK A;  5FGM A;  1H9T A;  4AVP A;  2RKH A;  5HVQ C;  5L3G A;  1MDM A;  4EM1 A;  1QZZ A;  4ENJ A;  5E8G A;  1G3T A;  4GYI A;  4G94 A;  3F23 A;  4M71 A;  5JR3 A;  3E6B A;  4CIC A;  2PEX A;  3WTZ A;  5DCF A;  3FXU A;  2E7W A;  1XMA A;  2EWN A;  4RS8 A;  2COM A;  2A69 F;  1FBS A;  4HF0 A;  2KJB A;  5H6Q A;  4EJV A;  4KMF A;  4U7D A;  4CYD A;  2EFO A;  4LLG F;  4YG2 F;  4IVN A;  2W84 A;  3F21 A;  1JXS A;  4R8H A;  1D3Y A;  2CQK A;  1MGT A;  2YR2 A;  2TDX A;  4BHB A;  1T98 A;  1FYM A;  2OAZ A;  3JAM Z;  2YPR A;  3I5U A;  1YLF A;  3DP7 A;  2Z5U A;  4XLN F;  4HLY A;  3L00 A;  3BY6 A;  3TGN A;  2ZNZ A;  4ENK A;  1D5V A;  1BM9 A;  2RDP A;  3OOP A;  4XBF A;  1T2K A;  2EFN A;  1STZ A;  2KIM A;  2V1U A;  2LNB A;  3HSF A;  1H9G A;  1O7F A;  3L9F A;  1W7P A;  3GFL A;  5E1Z B;  3BDD A;  3G3Z A;  4LB6 B;  1P2F A;  4MQV A;  2XKO A;  4M9X A;  1IRG A;  4PCQ A;  2STT A;  3M7G A;  4UVA A;  4UUV A;  2NAZ A;  4A0X A;  4ESF A;  1KU9 A;  3FXR A;  3CJN A;  2M87 A;  5D6F A;  4OIR F;  3EDP A;  4RB3 C;  4EGZ A;  4G7Z F;  1LQ1 A;  3E5U A;  2HOE A;  4A2U A;  5L3C A;  3T1B A;  2FBK A;  2P5K A;  1ZG5 A;  3G73 A;  3KP4 A;  2O0Y A;  5FD5 A;  3ROU A;  3FF5 A;  3RDI A;  1FPQ A;  3FX3 A;  3ZP5 A;  5IT9 Z;  4HOB A;  2K02 A;  1LVA A;  2V6C A;  2VC0 A;  2VBX A;  3ISP A;  1RIO H;  2H6C A;  2NS0 A;  3IWF A;  2F2E A;  2QBY A;  3F3X A;  1SAX A;  1T0F A;  3CDH A;  3CLO A;  1ON1 A;  3L2C A;  3B02 A;  3MQ0 A;  1K79 A;  4KUM A;  1UST A;  4HDV A;  4IRI A;  2O03 A;  4GO1 A;  3WG9 A;  3ZPL A;  1FP2 A;  3VOE A;  2JT1 A;  5D6E A;  3E6D A;  4EM0 B;  2VT2 A;  2HFH A;  4UVC A;  4Q48 A;  4ASN A;  3WE3 A;  5ERI A;  2Z33 A;  2XGX A;  5IT3 A;  2PN6 A;  1I6X A;  1HW2 A;  1PP8 F;  4LG0 B;  4XSZ F;  2G7U A;  3O3K A;  2FQ3 A;  3BRO A;  5CLS A;  2V1D A;  3I59 B;  1J59 A;  3J81 K;  3ZMS A;  1GHC A;  2HTJ A;  4ENM A;  4YIF A;  2VC1 A;  1IN5 A;  1FSE A;  2EV0 A;  4UHT A;  3ZMU A;  2DQR A;  3CO7 C;  3V8J A;  1MD0 A;  4KNY A;  2AXL A;  4GGG A;  1R5H A;  3R4K A;  3DF8 A;  4N9H A;  1ZYR F;  4HF2 A;  3ELK A;  1QQI A;  2KRF A;  1D8J A;  3WTU C;  2L02 A;  2XAH A;  3QRF F;  1MJB A;  4L9T A;  5LGT A;  5EEH A;  1Z7U A;  1XDS A;  5DCM B;  1G6N A;  3FXQ A;  2CYY A;  4A6D A;  4G6Q A;  2MA3 A;  2IW5 A;  3JSP A;  4WK8 F;  5HOO A;  1Z6R A;  5LRS A;  4XSX F;  3E5X A;  3H92 A;  1SFE A;  1YW8 A;  2GXB A;  4M73 A;  3QU3 A;  5ILS A;  1U2W A;  1O3S A;  1XGS A;  4JQF A;  1BBY A;  2GWR A;  3PQK A;  4UVB A;  3TDU C;  3HOS A;  2OZ6 A;  5D5X B;  2RNJ A;  4IHS A;  2P5V A;  2A07 F;  5BMZ A;  5HS8 A;  3WTS C;  5E20 A;  1KA8 A;  4OMY A;  3C3W A;  1RI7 A;  2ESN A;  2DQL A;  1OMI A;  4CDG A;  3E6M A;  3N4M A;  2FBI A;  5BS6 A;  1FX7 A;  2PI0 A;  1REP C;  2HZT A;  3SZT A;  5E17 F;  5D8L B;  5KVR A;  1IZ1 A;  5LHI A;  5E1X A;  2O8X A;  4I0B A;  4LB5 A;  2BE5 F;  3SQN A;  2LDU A;  2VOP A;  3FMS A;  2J5P A;  1DP7 P;  4KFC A;  2EFP A;  5CVU A;  4B09 A;  4A6E A;  4FX0 A;  4A0Y A;  4BAY A;  1MJA A;  3HRS A;  3F8B A;  5ILV A;  4EJW A;  2MH9 A;  3W6K B;  3FM5 A;  1FBQ A;  2UXX A;  2KJC A;  3ZMT A;  2MD5 A;  1ODD A;  1XN7 A;  1UHW A;  4I2O A;  1SMY F;  2OBP A;  3T8T A;  2ZJ2 A;  1Z91 A;  1ZRF A;  3WU1 B;  2IA0 A;  1KYW A;  5LEJ A;  3EET A;  5H6R A;  2EJR A;  1XDU A;  1BI1 A;  3GVA A;  2EA4 A;  4M6Y A;  4GXO A;  4ZH4 F;  2EK5 A;  3VB2 A;  4BQA A;  4I0A A;  1FBU A;  3CUQ C;  4A0Z A;  2GA2 A;  5LHH A;  1BC8 C;  3R6S A;  2FU4 A;  4NHJ A;  1YS6 A;  2Q2E A;  1G4D A;  4ON0 A;  1SMT A;  2DPU A;  1FYL A;  3K9T A;  3MZY A;  4CO8 A;  3C18 A;  2NNY A;  1I27 A;  2XV4 S;  4CGZ A;  1S7A A;  4A5M A;  5DUK A;  3TOB A;  3PQJ A;  4S04 A;  2QWW A;  2AS5 F;  1UCR A;  2P6T A;  3AAF A;  4Q4Z F;  2DPD A;  2CSO A;  4BYY A;  2FEZ A;  2HR3 A;  5E8I A;  1BI2 A;  2Y48 A;  3M9A A;  2A68 F;  4CXF A;  1QZY A;  1ON2 A;  1LB2 A;  4D0P A;  4L5I A;  1FWZ A;  4K2E A;  5J8F A;  5FFZ A;  4GYG A;  2FOK A;  1DDN A;  3LFK A;  4HX8 A;  5ILU A;  1TNT A;  4JK1 X;  2F5F A;  4Y17 A;  4EVI A;  1R23 A;  4Q47 A;  2RVC A;  4KYW A;  2L54 A;  5K5O A;  3TKY A;  3J81 Z;  5JI6 A;  2NYX A;  3IKV A;  1B9N A;  3RYP A;  3GFI A;  1A04 A;  3ABT A;  3BP8 A;  3WTV C;  4HYE A;  1J2X A;  4O3M A;  5BOX A;  3I4P A;  2V1X A;  3GYH X;  1J9I A;  4U88 A;  2R3S A;  4KA4 A;  1LDD A;  2M1B A;  4OIQ F;  2WC2 A;  2KIF A;  5BPD A;  4AIH A;  2OZU A;  4L9V A;  1W5T A;  2FSW A;  2R7D A;  3SHF A;  4OIP F;  4JBA A;  2WWY A;  3KLN A;  4YFK F;  3LAJ A;  4OIN F;  3ULQ B;  3WTY C;  3T0Y A;  2NNN A;  3MAJ A;  1J7K A;  2VOO A;  1XSX A;  3QPH A;  2XUB A;  4KMU X;  1TQP A;  3NEU A;  4RGR A;  3BOQ A;  2JPC A;  1B6A A;  5FFX A;  5D4R A;  1BI3 A;  3KET A;  2LSO A;  2L01 A;  2PFB A;  4HV6 A;  3RIR A;  4NB5 A;  5ED4 A;  2RC4 A;  1IUY A;  5CVV A;  5IT9 K;  1LEA A;  4HA8 A;  3HRM A;  1U3E M;  3WGG A;  2QQ9 A;  3DQV C;  1XGN A;  3KEQ A;  1E17 A;  3V8K A;  2MC3 A;  1EH8 A;  1L3L A;  1SD7 A;  1B59 A;  1KQ0 A;  1HKT A;  4PZJ A;  4RGX A;  1ZAO A;  3KP7 A;  1YFH A;  2FNA A;  2HYG D;  5ICC A;  1P92 A;  4MEX F;  2X4H A;  3LAP A;  2XKP A;  4RGU A;  5F1R A;  5AIQ A;  1V4R A;  3WTX C;  3FHZ A;  4EGY A;  1HSJ A;  1T39 A;  3ZN1 A;  4ZYE A;  3I58 A;  1ZRC A;  2D45 A;  2P7V B;  1TW3 A;  2EV5 A;  3RI4 A;  1RZ4 A;  4G9Y A;  3GZ5 A;  3EUH A;  2O3F A;  3WGH A;  2GXG A;  4M74 A;  5CVJ A;  1TTY A;  4PDK A;  2F5E A;  2MLK A;  4MTD A;  4KIG A;  1ZHF A;  3F22 A;  2DK5 A;  3ECH A;  2XAF A;  2VOD A;  3K1M A;  3ML6 A;  5FO5 A;  2K7L A;  3TO6 A;  4ZZL A;  3K2Z A;  1HKS A;  1YG2 A;  1I5Z A;  2QYO A;  5K1Y A;  1LNW A;  3O2P E;  2ZFW A;  3K69 A;  1EV7 A;  1LDK B;  2ADU A;  2RV8 A;  4L5J A;  1TQM A;  5D5U B;  1NHA A;  2BYV E;  2CG4 A;  2R7F A;  4KT5 C;  1FOK A;  4IF4 A;  3T8R A;  1K6O A;  1R5G A;  2F5D A;  3V7C A;  2P5L C;  3BJ6 A;  4HV5 A;  4EJU A;  3QP5 A;  4G8X A;  3I59 A;  2HQN A;  2WTE A;  1ZLJ A;  4I01 A;  4HX4 A;  4WXC A;  3VOD A;  1JHH A;  3D0S A;  1HQC A;  2JTV A;  1UFM A;  2W85 A;  2DO7 A;  4HZF A;  1TW2 A;  5D5V B;  3KE2 A;  3FZV A;  2M8E A;  1CF7 B;  2EFQ A;  4LMY A;  4RGS A;  3M1E A;  4P96 A;  1SD5 A;  2FE3 A;  4BNC A;  2A5Y B;  4HF1 A;  2P7C B;  2QUF A;  5LGU A;  4HW0 A;  3TO9 A;  2H27 A;  5HS9 A;  2XVC A;  3GEZ A;  3FWE A;  3WTW C;  2KKO A;  4RAY A;  1QO0 D;  3U1D A;  3RYR A;  3JSO A;  3COA C;  3HRT A;  1RUN A;  1J5Y A;  4H0E A;  1W4M A;  5BPI A;  4BHP A;  1YS7 A;  3DPT A;  2BGC A;  2XHK A;  2ZO4 A;  1XSD A;  5K5Q A;  1KYZ A;  3D5L A;  3O6B B;  1HKQ A;  1Z6T A;  2A6E F;  3BZ6 A;  1YIO A;  5J8C A;  1USS A;  2GQQ A;  2B0L A;  2O61 A;  3Q5F A;  3QAH A;  5ICF A;  1WQ2 A;  3MEX A;  3QPT A;  1LEB A;  1EH6 A;  3LQQ A;  1IN8 A;  3GZ6 A;  1O3T A;  3V4G A;  2ELH A;  2ISY A;  4MHG A;  4G6D A;  5KK1 A;  1FYK A;  1R58 A;  1HST A;  5HLH A;  1GVJ A;  1YW9 A;  4KIB A;  2VXZ A;  3QOP A;  2QQB A;  2UXN A;  4BHC A;  3S2W A;  5LRR A;  4WX9 A;  2ZXJ A;  1I1G A;  1B4A A;  4YFN F;  3RTR A;  2M30 A;  1KU2 A;  2ZBK A;  4G7O F;  1F4K A;  3E97 A;  1S7O A;  3RPQ A;  4L9N A;  3R61 A;  5CYV A;  1SFU A;  3K1P A;  4BXU A;  2ZKZ A;  2CO5 A;  3P9C A;  4IJA A;  1TNS A;  3H3U A;  1U78 A;  4QWQ A;  1OR7 A;  5E18 F;  2Y75 A;  2FA5 A;  3Q9V A;  5JFR A;  2DI3 A;  2MH2 A;  3U2R A;  2UWM A;  1BJA A;  4TV7 A;  3FMQ A;  3F8N A;  2K4J A;  3R0A A;  3F8C A;  2GA1 A;  3JAM K;  1XB4 A;  1U8R A;  1KU3 A;  4FHT A;  1XCV A;  5TJJ A;  2QBY B;  1AOY A;  2PLY A;  1MKM A;  3EYI A;  4ENN A;  3GO5 A;  1IN6 A;  2JPB A;  1IXC A;  1S3J A;  1WRJ A;  1XGM A;  3DKW A;  1QGP A;  4M9Z A;  1BIB A;  1ULY A;  2IP2 A;  5DDG A;  4A12 A;  3QP6 A;  2RN7 A;  3HHH A;  1IN4 A;  3HYI A;  5DD8 A;  1H0M A;  4ZYD A;  2ACJ A;  1OYW A;  3HRU A;  2G7H A;  4B8X A;  3MZH A;  1U5T B;  2STW A;  1G3S A;  2YU3 A;  2W57 A;  3WGI A;  3B73 A;  2ZME A;  3ZMV A;  3KZY A;  1U6G A;  2D1H A;  5DEQ A;  2KIU A;  2Q8K A;  4I98 B;  1X3U A;  1VTN C;  4ESJ A;  3WTT C;  1E2X A;  4E70 A;  3GX4 X;  3F72 A;  3IWZ A;  5HLI A;  2HYF A;  2K86 A;  5LBQ A;  1IXR C;  2A61 A;  1FLI A;  3HOT A;  2DK8 A;  2OD5 A;  1P4W A;  2W25 A;  4OMZ A;  2GZW A;  3WU0 A;  2EV6 A;  3ZMZ A;  2G9W A;  4EJT A;  2ZNY A;  1LDJ A;  3EYY A;  4ZZD A;  2HGC A;  2YX4 A;  1S8N A;  1R1T A;  2DFI A;  2RQP A;  1R36 A;  4N9I A;  4HLX A;  3J7A O;  1O57 A;  1IN7 A;  3RPU A;  2Y0M A;  1DPR A;  1WSU A;  3CTA A;  2QLZ A;  2XAG A;  3V7S A;  1KGS A;  3KP5 A;  2LKP A;  1P4A A;  3NQO A;  1O3Q A;  4HBL A;  4GCV A;  2JSC A;  4FX4 A;  3HUG A;  4U0V A;  2HWV A;  4OOI A;  2BV6 A;  2VBW A;  3MWM A;  1Q1H A;  1BOA A;  2E7X A;  1OYY A;  4RB2 C;  1YW7 A;  1L0O C;  2OU2 A;  2QVO A;  1T6S A;  3MFK A;  2PMH A;  2EB7 A;  4P55 A;  2VT3 A;  3ABU A;  3LST A;  1V3F A;  3J80 Z;  4EQQ A;  2LF8 A;  5FLX K;  2YX7 A;  4LLN A;  4AIJ A;  1WKM A;  5A2Q K;  3I64 A;  3JTG A;  2A3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...