4HLZG

Crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCGTSGFTLTDDYMTWVRQPPGKALEWLGFIRDRANGYTTEYSASVKGRFTISRDNSQSIVYLQMNTLRVEDSATYYCARPKGYFPYAMDYWGQGTSVIVSSTKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a classical broadly neutralizing stem antibody in complex with a pandemic h2 influenza virus hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
total genus 36
structure length 223
sequence length 223
chains with identical sequence I, K
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzG01
3LRGA 3PWLA 4MQ7A 4W4OC 3SGDI 4QF1B 1UM6H 3VXOB 4YHMH 2BNQE 3MLPA 4O2FB 4Z7VE 5B38A 2XRAL 3AS0A 4BQ8A 5I1JH 5SX4I 3QAZC 1RFDH 4J3WA 4LBEA 3TZVB 1S9WA 2BSSB 1FO0H 4XRCA 4EDWL 1INEH 2X4OB 1BLNB 2VDRH 5JW3H 2FX8H 4XP1H 4Q0XH 2IQAB 2YZ1A 2R2EA 2FL5B 1FO0B 1IC5H 1FAKT 3RNQB 2HH0H 2L4OA 3DXAD 3PHOB 1NEUA 2D7TL 3BYTA 5FECA 2MQCA 4LU5L 5JLZB 1FVDB 5JO5B 5D96C 5DC9B 3SGKA 3BRDA 3HG1B 3QWRD 4PJDF 2IANA 4PJHE 5HHME 1PLGH 4ONFL 5F7WC 2MSPA 4LPXA 4NRZB 5DHVH 1FZOB 3LQMA 3IB4A 4Z7QF 3VFNB 1YY9D 2EXYD 3HC0B 2GJZB 2CLZA 5JIIA 1CL7I 1MWAA 5CBEB 4N5EC 5C0RL 4UZGA 1OP5H 2EC9T 3SO3B 5DRXB 2I07A 3UJTH 4WHTA 3X11A 2CMRL 2ENYA 4XBEH 1UKTA 5H94A 32C2B 5CZXD 2GSIB 2J88L 3TZVC 1S7SB 1XGRA 4ZDHB 3TO4C 3H9SB 1UC6A 5KVDL 1LEKA 1IQWL 4S11A 1MFAL 3IDIA 4TSAL 3T2OA 1A6UL 3E6HA 5FV1L 5C07D 2BMKA 2MOVA 3NCJL 4K3EL 4BJLA 1I3VA 2IPUK 2YUVA 3BKMH 5TGBB 2DD8H 1TVDA 3DGGA 2MMXA 3DROB 1NCBH 1RIUH 3PGDA 5DI8B 2I07B 5GGSA 4CVUA 4OQTL 2E9IA 4WHYG 3RWGA 2R1WB 5F72S 2GTZA 2OI9C 3QDMA 5BQ7A 3ZKXC 5BZWB 1BWMA 4JFHD 1U6AL 5IGXL 4GG6A 4WWKA 3U7YH 4IOIA 1OLZA 1RZ7H 5IMLA 1WZLA 4MCZA 5KAQG 3NH7L 2BSED 1SM3H 3WIIH 4GW4B 2X4PB 2DOCA 4IRSC 1A6TB 3TA3C 3ISWA 1TJHH 3RRQA 4J3UA 2OTWB 1BFTA 1YA5A 5DVLA 43CAB 3GK8L 4G8EB 3CX5J 4ZSOE 8FABA 2KPNA 3NOIA 1XGQA 1E27B 4ZUWB 3CK0H 5AUMB 15C8H 4HKXA 4WJ5A 4MD5A 1KEML 5DK2A 1JHTB 1TQBB 4GW4A 1YMMB 1A6AA 3IFLL 1ZVHA 3T0BA 1SVCP 4PRBB 3MA9H 4MX7A 1HSBA 4RWHA 5EOQL 2NY6C 2X4NA 3X3GL 4F8TA 1XFPA 4LNRB 3EYVB 2YD7A 5JQHC 4IMKA 2R1WA 5DUML 1KJMB 2LVCA 3IDYB 3SKUD 1MREH 5L8KB 3HI5H 3KJ6L 1AR2A 3MRKB 3WFZA 4PP1C 1ZVSB 3EAKA 1PY9A 4KI5D 5I75B 3PHQB 3WXWL 3MUJA 4DUVA 3FT3B 2UZXB 5J7CC 1LQSR 4M7ZC 3AREC 4Y5XC 2A6DB 5L88L 3QUKA 5I1AB 1FVEA 3NIDF 5CJXA 1X7QB 2BHZA 2WWMD 5DURD 3X11B 2GJ6B 3BQUB 4JG0H 1PKQA 4JDZB 2FATL 1N3NB 2J8UF 2ZUYA 1CFTB 5H35B 1I9IH 1NGPL 3BPOB 5INDA 1S7XB 1A9EB 2OMNA 1B0GB 2PYEE 1RIVH 3GO1L 3OAZH 5LCVL 5JNYA 1VACA 5EU6D 3N0PB 1J7VR 1XF3A 1C5CH 2R4SH 4QRPE 4OLUH 5EBMB 1AE6L 3KYOA 3UTZA 1WBXA 4GQPH 3S37X 5C0ND 2V5YA 4KH2A 4KKCC 1U93A 1ZTXL 3OX8A 4HWEL 1JTTA 3HR6A 1JHLH 1MCRA 1BJ1J 5T1KA 4GKZA 3VFGL 4YPGB 2XV6B 5DRZB 1RIHH 1QFUL 1RZGA 1JTOA 4CVZA 2A6JA 4H1LG 3AY4C 4HWUA 3LDBB 2DN7A 4KTDL 4NN7B 2LAGB 3QXWA 3BEWA 3EDDA 1TJIH 4KKNA 1DN0A 4XGZB 2UWEA 1F00I 2P47B 1NCBL 1RIUL 4RGMB 4YHNB 2FD6L 5DRZA 2CK0H 4HJJL 4HF5L 1URLA 3WKNA 4UT9L 4GKZB 2B0SL 5DMGD 3QB7C 1G7LA 2G75B 1G9ML 5IB5B 1RY7B 4RSVA 4X99B 4P2QB 4WTXA 3W9DA 3ARDD 4E41A 5F9JB 4HHAB 1MCCA 5F7DB 4MCYB 4AL8H 5I16B 3CU1A 2HFGH 4JY5H 2QADD 5T5FL 1SM3L 5BJTB 4PRPA 43C9A 1A7RH 3NTCH 3HMXL 3WHE0 5J1AB 1U2HA 2YKLH 5ADOL 5IHUH 3IU4L 5HJ3B 4JREB 3PWPB 1EH9A 3ARBD 2LU4A 4NRZA 3V6ZB 4L8DB 5GJSL 1MF2L 4NT6A 5JR1H 3REWB 2AQ2A 2RQ8A 3VD3A 3QG7H 3RGVA 1GHFH 4HIIA 4LGPB 5IMLB 1SYSB 3U83A 1W0VB 2ZUVA 3QIUA 3ZDZF 4KHTH 1AO7D 3WFHA 2OI9B 5CGTA 5CP7A 4Y4KD 1ZLSL 3HB3C 3GGWA 2OYPA 1FVEB 1MFEL 5FOBA 1P4IH 1QNZL 4WO4A 3BJLA 3X3GH 3RVVC 3V79C 2A77L 3JV4B 3VFRB 2WBWB 2HJLB 1LEKB 1OQOA 2W38A 3LB6D 2C4FT 4PG9A 4U1IB 2AJVL 5FYLE 3D25B 1NMBL 3QCTH 4CW1B 3MCKA 1E4XH 3TWCH 1AO7A 3I84A 2YBRA 3EYFB 1GJIA 3I50L 1QBMH 3ZT7A 2X9YA 4NQXB 3EDEA 1QSEE 3CX5K 4J7RA 3QUZA 4M7ZB 1BIIA 1S8DA 5CLWA 3BH9A 3MYJB 2DMCA 4C56D 3FOLB 3V7AE 3VA2C 4OUUA 4NZUL 4HFUH 3TNMB 5J3HD 1FC1A 3NFSL 4F7EA 4YDIL 2XZAL 1JF1A 3VXMB 1JF6A 3MNZA 1R5WA 4GBXC 4J8RA 5FKPB 3C60A 3BKJL 2ICCA 2ZZUT 4OQ1A 5CEZH 3KLDA 1DEDA 2OTWA 4HS6B 4WDIA 4I9WD 4GG8B 4EUPG 3FN0L 1LEIA 4HH9A 2R29H 5IW6A 1CICC 2WUBL 2GEEA 1OM3H 3GSNB 4JM2F 3L3JA 5I76A 2ILLA 1QZ1A 5FUCC 3MFGB 4QKXB 1DQLH 4MXQD 2Z4QA 2F54A 1X5AA 4OCYH 2QHLA 5GRWA 4JO1L 4ZXBA 5JOEA 4JFOB 1EHXA 3UTTA 3IS1X 2ZG3A 1ZE3C 4GG8A 3EGSA 1W72A 4PRPE 4PGDA 1GAFH 3QUYD 3QXDB 5FKPA 4P9MH 4PJBA 4FQLH 1FNLA 3F6IA 3PGDB 5DI8A 5I9QC 4YHNA 4GKSB 1Q9WA 2V5MA 3QDAA 3BI9X 4GXVH 4PJFB 5K9OB 3QDJB 4KRPD 1I9RH 3O4LA 4U0RB 1CFSA 4GRLD 3MOAL 3QO1B 5HHOB 1TITA 1EEYA 4DKFH 5CSZA 1SMAA 2RCSL 2Z8SA 1U8KB 1TLKA 5EPMB 3P4OB 1GZQA 2E5EA 2J8UB 5DD5H 5FO7A 1JYWA 3DX9A 2WBJA 5L2KD 2CRIA 1AXSB 4NYLA 5JXED 1RUML 3FFCA 3TA3D 1ROWA 2ZCKL 4UV4L 4ERSH 1LP9F 2F58L 5K9KB 2EDYA 3QUXD 2CO6B 3MRPA 3PDGA 1OGAD 1BGXH 1NCNA 5T5FH 1UWGH 3MGOA 1X5JA 5C7XL 3TO4B 4RMTA 4PYHA 4AMKL 3BHBB 4PV9B 2NY1B 3MRQB 5BOPA 1CTNA 4HIHA 5D1XA 3K1KC 2G2RB 4Z0BH 1L0XA 1AP2A 3BUYA 1MRCH 1OP9A 3FTGA 4JN1L 4F8QA 1X4XA 1YEHL 3BQUA 2DKUA 5FECB 1QFWI 2Y07L 3QQ3A 4HH8A 4NQED 2VAJA 2AQ1A 1RUPL 2ZOKB 3BW9B 4FXKA 2ZSWB 3RX7A 1PG7H 1QO3B 1SBBA 1JNLH 2H32B 5L6YL 5ETUB 4QOKD 2HKFL 3H3PH 2NQCA 2XXMB 2HRPL 1QSFD 1KC5L 4G9FD 4JO3L 1MCBA 3O3DA 3ZYJA 1DE4A 3W11C 2YPVH 1FQ9C 4HWZB 4Z8FH 5HGGS 1QACA 1MIMH 1EO8L 4NM4H 1MJUH 4G42A 3N9GH 1YY9C 1MY7A 1AGCB 3C2AH 1MAML 4X6FB 2C7UA 2G5BB 1MCWM 2AXGB 4RRPG 4NQEB 3SKJL 4KHXL 2HN7B 5T33L 3MOBH 2EDEA 3VMPA 1H0DB 3LZFH 2BOCA 4ONFH 4X7TA 1MCOL 2SEBB 1ADQL 4L4VE 3NCFB 3U0WL 4FTVD 1C5DA 1NC2B 2HWZH 2VDKL 2FDBP 3N1MC 3SCMD 4O2CA 4NCC1 1A9BA 1G7HB 2V5TA 5EU6E 3GMLA 1R3HA 3VRLE 2V2XB 4HCRL 3EJZC 1M1SA 2FSEB 3NCYS 4H0IA 4CNIA 3KR3H 3E0GA 3S6CA 4JG0L 1DL7L 5SX5K 4DW2H 4Z7VA 3CPLA 1NEZA 1KN2H 1OAZH 2YUZA 3LVEA 5GGRY 4L8SC 3RGVB 3AUVA 1E4XI 1GSMA 1MAJA 4FZEL 4A6YA 5EIIB 5GGSY 2KZ1B 5E08H 5HGDB 1R5WB 3VGDA 3NFNA 5C1MB 4HIEA 3QUYC 1S7QA 5ESQB 4PJ5E 2VLRE 4H0GA 3NCBB 4NQCB 3QJFB 4I0KA 3VXUB 2OXHA 2ZNXA 2I27N 4JDZA 4LDEB 2FECL 3F7VA 5EIQA 3PNWA 4B0MM 4YE4H 3MODL 1YQVH 1JYNA 1U6AH 4NJ9L 3HUJF 4OZ4B 5E2WH 3BD3A 1U8MA 4N9OB 2WWKT 3HZVB 2PCPB 1PEZA 3LPGA 3ZT5A 3G6JA 3N85L 4UU9A 3JTSB 3ULVH 4JHWL 1I9JL 2L7JA 3Q1SL 4OQTA 1IKNA 2E7LC 3UEZA 3FRUA 1Q9WB 4YPJA 2A0LC 2VXQH 2VLME 1Q0YL 5DRXA 2VKXA 4S1DD 3ZHLA 1IEBB 4XAKD 2B39A 4JM2B 1CIUA 5IHZB 4NQSB 2AK1H 5E5MB 4IRJB 4GSDH 3VFUA 3L5JA 4PRHB 3S5LB 4Y16C 5EIIA 1FORH 2BC4B 1FRGL 5F3HA 4LQFL 2XTJB 4B5EA 2HFGL 3I6GA 2X09A 3LKQA 4LASL 4FNLL 4MHHI 1XT5A 5DJDB 3UTPD 5GHWL 3LB6C 3MACL 5T1DH 3KYKL 4X4MA 5ABDE 1UACH 2YZ8A 1K4CA 4JFQA 5GS2D 3VH8A 2E7CA 1A1MB 2EDRA 4KKAD 2CLVA 4R0LB 1VEOA 2JB6B 2AJYL 4ODTL 5EBWA 2DM3A 1NMAH 4CU8A 3WIHA 4XT1C 5MP6H 4H5SB 5IIEA 5KVFL 5BMFH 4Z7WF 3TH3T 4IJ3B 4F9PA 2BOCB 4LBEB 3TZVA 4UB0H 5HDBE 3ARQA 1WAAE 1IEAB 5E1AB 1WFUA 1ZHNB 3RZCC 2XN9E 2AJXH 3O3BB 4W81A 1LP9B 3IXTA 4BELD 1DANT 3CLEH 4KJQC 2ZKHH 5D4QA 4YDVA 5GGTL 3T4AA 2EH8L 5HY9B 5T3ZD 5JOPD 4G3YH 2QADC 2FRGP 1KV3A 1B88A 5B4MC 3H2WA 3ZYOA 2A83B 2PTVA 1MHHB 4HEME 4F33B 1JZ3A 3VA6A 5CP7B 2YC1A 2NY3B 5ETUA 5E8EA 1ODAA 1IC7L 3MV8A 1IE5A 1YMMD 4XP4L 1LP9A 3IAGC 1WBYA 3SCMC 1EJOH 2IBBA 3SQOL 5I73C 3U9PH 4HFUL 2AJXL 1XGTB 4F15C 4LOUC 1YN7B 4X0KA 1UVQB 5FM8A 4PJEE 2VOTA 1C12A 4YXHL 3ET9F 3O8XB 4CU6A 3IJHB 5K9JL 5T1MA 4XVJL 2AS5M 4LVOC 1DQTA 5D7IA 2P5EE 1YNLH 3VWJA 2AV7B 3O4LD 4PJGE 5HHNB 1RZKH 3KPSA 4IM8A 4ZPTA 1J1PL 1E6OH 3U79A 1ES0A 5FA3A 1MCNA 1EX0A 4EI5A 1R0AL 1D7FA 1CQKA 4MCYA 5DDHA 3QIWB 1DR9A 2OL3B 1JPFA 3L1OL 2AK4A 2XTJE 5DJ6A 3QEGL 5GGUA 4YHLH 1ZHBA 1IZJA 3VFMB 4NQDD 1U8OB 4X9GA 1QFHA 4FMKA 1RJLB 3KLSA 2DD8L 1N26A 4XPTH 5D2LF 3PJSA 3QXDA 3JWOC 4OLZL 4WV1B 3DI3B 2DLEA 2GSIA 1UB6B 4TRPH 3S35X 5DJCB 3UYPA 3DBXA 3U4BH 3SGEI 1RZJC 1CDUA 1RZ7L 1MCFA 1CR9L 1XIWC 4MNHB 1JGVH 4XP5H 5J89A 5IP4A 3VXRD 5HHNA 3NH7H 5IJKA 2VWEE 5GHWH 3SE9L 4QHKI 5A40E 5F7LB 5DEGA 4PJBE 3V0WL 3AM8A 5CBAA 2UWEE 5E2UH 5INCA 5C0EA 1A3LH 1JNNH 1VHPA 5D7SH 4LEXH 3U0TB 5E99L 4R2GD 5F7UA 1JZ8A 4IOIB 3GI8L 1NEZB 4GMTL 4DGIH 1RZ8A 2EKSB 4NUJB 3MRFB 3I9GL 2R2BB 1N3NA 3ILPB 5C71A 5KZCD 4H8WH 4Y19B 5E8EB 1C16A 2X7LA 5DHYA 1IGCL 1RUQL 4LIQH 3FHQA 5I2IA 4MXQC 3BP6B 4O2CB 3RX5A 3TC9A 2AJZA 4K2UL 1GL4B 2XACC 4XWOC 1EIBA 2VJXA 1UYWH 3D85B 5GRZA 1UA6L 5IVOA 4Z77B 4WW2F 2WSKA 2P7TB 4HULB 4JFDD 4YUEH 2H6PB 1AXSA 3VI4E 3GI9L 3HI1B 3CNKA 4GXUN 1RUAL 3LSOA 2YPLB 1OSPL 5E1AA 2OJEB 1U3HB 4POYA 3S37L 5FYKH 1A6AB 3E8UH 3KPNA 3QDMD 3HCVA 3NAAL 4UILH 4NQCA 4KROD 1TMCB 4P4KB 3U9PL 1MNUL 5E0QA 4APQB 1EHLL 1FH5H 4RFNC 2OTUA 4TVPH 1SBSH 1J0KA 5LXGL 4N9GA 1F58H 5EZOH 4OLVH 1A3RL 4Z7WB 5KSBE 2VLJD 1XZ0B 4P46D 2LAAA 2R69L 1KN4L 3CMGA 5CZXC 5KANI 4JHBA 1ZWIB 2M1KA 2P24A 1MFBL 1BBJA 5I66A 3L5WB 2VISA 4NC1C 3V52L 5C0CA 2FL5A 1ACYH 1J1PH 3O9WD 5L2JB 2X05A 1G7HA 3GJEB 1Q0XL 3CDYA 4KRLB 2DMKA 4JM2A 4TVPL 1MSPA 2FHCA 4MSWB 5ITBH 3GMOB 4OM0H 3T08A 2RHEA 3FB8B 4ZO8A 2Z35A 3K3QA 4CMMA 2ICWB 2NY5C 3BOVA 5EU7E 1NCAL 3NGBC 1EEZB 3WFEH 5AZEL 1I85C 3VXPB 4PJXA 1BFSA 4PBVC 3SKMB 4JFFA 5DQ9B 1FFRA 4I5BB 2H9GA 3FB7B 5FM5O 5I8CA 2X1XR 5ISZA 3FAXA 3U1SH 1EXUA 2Z31D 3BPNB 4YPGA 5E95B 5IB1A 1ZLVH 4M5YL 3AB0C 4FQXA 5JDSB 1MCEA 2E8YA 3QPQC 1TQBC 3QDJD 1DFBL 4LP4A 5D1ZB 5DXWA 3LN9A 3S35H 3TCLB 1AQDB 4IIQB 4PREA 4NBYB 5EOQH 5T5NG 2J7LA 4PLOB 3IJHA 2AJ3A 5MERB 4YWGL 1ONQA 2AJSL 3FONB 2EYTB 2UVFA 5EG6C 1NLBL 1ZA3B 5I71B 1HI6B 5EA0L 2GK0B 2GJ6D 5IK3B 1TFHA 4LK4A 3QR2A 4UDUA 1R24A 5E8OB 3PIQB 4X4YB 4U1GB 3KHOA 2LVEA 3KXFE 4DGIL 1KCKA 3I3BA 2VAAA 3PXHA 5TE4H 5JLZA 3AY4A 4HKBB 1LHZA 3FQTA 4DN3L 5DZNA 1FVCA 5AYUH 5J1AA 3BT2H 1EAPB 1WZMA 4M6NH 5SWZE 3O9WC 4XPFL 3GHBH 3AMLA 2I5YL 4MJ5B 5TPWL 4Q97A 4CBPA 1I85A 3RJQB 1N6QH 3WUWB 1CGWA 3G6JF 4NWUL 3WDJA 1QG3A 2HH0L 3CVHA 4NNXB 4U1SA 4XNUH 3HMWH 4HJ0D 4AG4H 1MRFH 4NC0B 4RWYL 1B0RA 1B3JA 4HKJB 1KB5A 1SEBA 2ICWA 4MXWH 1EFXD 4A2LA 5BZDB 1AE6H 4PRBA 4POUB 5JIHA 1ZOXA 4XPAL 3ARRA 1EAPA 5HI5C 1H3XA 2VB5A 4MAYD 3S36H 1E4JA 2DTSA 2DLFH 3VFPA 4L9LC 2V17L 1JWUB 3TIDB 4ZXBB 4ZOCA 3CFJA 5EZOL 5EFIA 4X4YA 2I9LA 3OR7B 3TF7C 1NLDH 4GKNA 1P4LB 5GGVH 5HGAB 1NGZA 1N59B 5DJXB 4HX1B 2UY6A 3BWAB 3QIUB 1R3IH 3S88H 1UGNA 4ODXA 3I6GB 5DRWA 3SO5A 1ULVA 4K8RD 1K8IB 2PW1A 2B4CC 3F7PC 1T1WB 2BVOA 3VXQB 2HA1A 3VXTA 3LEVH 3Q5OA 3MUZ1 1RZKL 4FXLA 5EUOE 1OAQL 4NQSA 4N90D 3KLHD 1TDQA 2QQNH 1BZ7B 3FB5A 4JKPL 1R3JA 4QHKJ 1RJCA 1IGJA 1QBAA 1NLDL 3Q3GA 3AXLB 1T66C 1XF2A 4NZRH 4JY5L 5DD0L 2QSQA 3RAJH 3QDGA 1AGDA 1OW0C 4OJFL 3C9NA 4P5MB 2GJ6E 2FX9H 3BVNA 4FFVC 4X5XB 3KXFA 2XZCH 2H3NA 4HIJA 1N64H 4YIQB 3ULSA 4OZFG 4OZHE 4XZUB 3O6FB 4OCSH 2DBLH 3B5GA 4YC2B 3OXSA 3ROLB 1EEUA 2VLRA 5KSAA 4PJBB 5CJXC 2CKBL 1YEEH 2P5EA 4OZFB 4LLMA 4PJDE 1MWAB 2DL9A 3CUPA 5CBEA 4F9LC 5T1LA 1TZHA 4OLWL 2B1AL 3T2NL 3F8UB 1U8IB 4U1MA 3I6LE 3FO1B 3BYYA 5EULV 3QZWA 5EC1A 1DVFB 4Q6YA 1F3DH 2XQYK 4KMTL 1JMZA 1KIRA 3OGOE 4H88L 4XP9H 5DO2D 3LS5L 5CHNA 3T77A 3F12A 4E0RA 1UM4H 4HUWB 5F1SA 3RWHA 4POZC 5GJSH 3MLUL 1M6OA 4LGRB 1PG7L 1ZHKA 1J8HD 3WIFB 4JZJB 1PQZA 5B39B 2DJUA 3MJ9H 1FFPA 4N0UA 1BLNA 2WP3T 2ICES 1ZT1B 2FB4L 3HI6H 1S8DB 4JANB 5DUPL 4KY1H 5DA0B 1T5XB 1F2QA 1A6VH 4WWKB 2DWDB 1YJDH 4JFXB 1I8LA 1SJEA 4PIRF 5EO0A 4RAUB 5DLML 2ORBH 2Z93B 1AKJA 1KTLB 2A6IA 3QHZH 1I7ZA 3WS3B 4RGNE 1IILE 4NOBA 4N0UB 5K33A 4TTDC 3RVXC 4GW5A 4LOUD 4PJ8B 3QI9C 3BAEL 1F97A 3MLVL 1MI5B 4PJ5D 4R4FL 4M9OA 1VFBA 1CD8A 3X12A 4Z95H 3QYCA 3CVIL 2FJGA 3DYMA 3TESA 1X5GA 1DBBL 2PO6C 2PYFA 3F7QA 5L2KB 3QDME 2BHUA 1X5KA 3C08H 5EOTB 3VXSD 4LL9A 1FYTE 3NIGF 4HZAA 3W9EA 2W0LA 4U2ZA 3ZYZA 1MWAH 1CLOL 3O6KH 3SEPA 4LHQB 2FR4A 4UNUA 3RFZC 3IFOB 3RU8H 3DVFA 3UDWA 4M6OH 5F9DC 2Q20A 2AEQH 5EB9A 1Z9SA 3WD5L 3SDDA 2ATKA 3L7EB 2F53D 3E3QC 3H0TA 5AWNH 5SWSA 5LGJA 3QUKB 4M7JH 1CT8B 3STBA 2FBJL 5T1LD 1BVKB 5IB5A 5IEKA 3PL6D 3PJSB 3FT2A 2VYRE 3FFCB 3MFFB 2DQIH 1R5IB 1YC7A 4JHAL 1B9ZA 4KKAC 3RWDA 1YEKL 5IFHL 2O5YL 5I74B 3MR9B 2C3WA 2EDXA 5I0ZA 5MENE 4EZMA 4NRYB 2F19H 2VWEC 1IVLA 4OT1L 2WBJD 4FFZH 2FEDD 4AEHH 5IM7A 3P4MA 1SMOA 1N5YH 2IG2L 1FBIH 1P2CB 4DEPC 1F02I 3QPQD 4K8RL 3D3VE 4L4TD 3VXOA 1QFPA 2HLFD 3S96B 2DLTA 4DVRH 4GT7A 1T7WA 4PUBH 4IIQC 2MJWA 4HLZG 3I75A 3QFJB 4PJGF 4XTRC 4Z7VB 4UTAL 5TQ2H 3D3VD 3VG9B 4WFHD 4LQFH 5TDNB 4G7YL 5IG7B 2YPVL 3VGHA 3QUMH 5IWLC 1ED3A 5F6HI 4PJIF 5GXBB 1JWUA 5HGBB 1NANH 4OUOA 4ZNEA 2DWDA 3WCYA 5I1HH 3VFOB 1L0QA 1KCVL 3DX7B 4JZOB 4J8RB 2CLRB 3V0VA 4PJXE 2Y23A 3D2UB 1QSZA 1JV5B 4PJ9B 4HKJA 4WW2C 1FDLH 2W9EL 1QFOA 1DLFH 1P4BL 4BA8A 3HI6L 1G6RL 3MYJA 3T0EA 3FOLA 4E42B 4HLJA 3ABZA 3T77B 3IJYB 3HNVL 4HQQL 3PWUA 4ELME 4NO0A 1PKOA 3RWJA 3FRUB 2ARJA 4JPIA 4L8CA 2AQ3A 2C3VA 1CU4L 3B5TA 4O9HL 4MJ6B 4WUUD 3P0VH 4JRXB 4ZSOA 3QH3A 5IMOA 3VWKC 1JGDA 3D0VA 1KCVH 5J56B 3RWCA 2W60B 4Z6AT 2O93L 4YK4C 5GRJH 5M94B 3C6SA 3ULUD 3QUZD 3WLBB 4LARL 2FIKB 3EJZD 4AEIL 4LLWB 1L6ZA 3IJYA 1DQLL 3H9SD 4Y19D 3WFHB 5F88B 3QQ4A 3UAJD 1FSKB 5TE6L 4EUPH 2PO6B 4UIKL 2CPCA 5KW9L 4NKDB 5C0JA 2HRLA 2AJ3B 4RNRA 3VFNA 3TBVA 1QLFA 3D85D 3LKSA 4ZS7L 2VDRL 5JW3L 1IC5L 3BZEA 3NZ8B 4I2XB 1XF4B 3GRWH 4I9WE 5DMKA 4OCWH 5SWZA 5K9JH 1N0XL 3QDGB 4OFDA 2PR4L 3STZB 3MV7E 5HYJD 5IB3A 4XCNB 1I8MA 4L8BA 43C9B 1NC2D 4UQ3A 4GAFB 4OD3L 1B2WL 2A9NL 4U1HB 1KB5L 3D69A 5C0AB 4P5TC 3T0AA 1AXTL 3OJ2C 5IBLC 1MAKA 4FQXD 1F4XL 1FJ1A 3DX8B 1UB5B 4OI7A 3SN6N 3H3KA 1JYXA 4QWWC 1D5IH 4OKVB 1VFOA 3QFDB 4M62H 5JIKA 5DZOA 4JPKL 3JXAA 3BO8A 5MEOB 1I8LC 1MQKH 5GJTH 4RX4D 1WICA 1NH6A 4XB7A 3P0YH 3MRLB 4XMKH 4XCEA 4Z0BL 2IH3B 1N4XL 3ZTNL 3JWOH 2ZOLB 3PNWB 4G6JL 4PJ7E 1OTTC 1CK0L 3TV3L 5F93C 3KJ4B 3IDXH 1UJ3C 5GZNC 4K7PX 4UB0L 3JV5A 1X5IA 1WV7T 4PRNB 3RUGF 3BT2L 3ZKQD 1KSRA 4V2CB 3MBEC 1JTPA 4U3HA 4MWFB 4RDQF 4B7LA 2XTLA 1BQLL 4PRIA 3QQNA 1XCTA 4JAMA 4GG6E 3EOTL 5D7JC 1H3GA 3HNSL 3H9YA 1KPRA 2HMID 2GJ6A 3HMWL 2QHRH 3G08A 1TJHL 1HE7A 1X7QA 3O6MH 12E8L 2CRMA 1JVKA 5K9KA 2BERA 3T09A 3C6SB 3X12B 1WBZA 1NBZA 4ONGL 4NJAH 2YC1B 5GSVB 1VKXA 2FB4H 1GZPA 5FFLA 2XA8H 2AJUH 4Y5YA 5H2BB 4Z7WE 1A6VL 3A0OA 5IBUG 3HS0A 4X8XA 2AERT 5B38B 7FABH 4Z7VF 3TT3L 3PXJA 4I77H 4Y2DB 1N7ML 2YUWA 3RX8A 2IH1B 3VGBA 5FM5M 4YAQB 4IHOA 4GKOA 2WIMA 1ZHLA 4ZFOA 5KVMC 3C5ZC 4OF7A 1HOCB 3CFCL 5EWIL 1QTYT 2GW5A 2YPLE 1WC7B 1QD0A 4K3JL 1GOFA 5E6ZA 3WFBH 2AJUL 3WFCH 1A1NB 4QRRD 3TPUB 1LO3L 4B7IA 3CGTA 4PRDA 2ZUQC 2NR6D 4MDIB 5ESVB 4LLVB 5CHNB 3FQUB 3GRWA 1DZBA 1A4KB 4XBEL 3KHQA 3U30B 4GRLC 2NY5L 4CVWA 2FX9L 4NKMA 3LKRB 4Y0GA 1MCQA 1UH4A 3QZWB 2VZVA 4MCZB 3WE6B 5IT2L 2Q76B 3EHBC 1YNLL 3G5XA 3WLWC 2WZPD 3TIEB 5AD0A 4GG6B 4GBXB 4QRRA 1T04A 5J12B 5IMMB 3HB3D 4OFYA 4WI8A 5JMRA 3OB8A 1QFWL 1DBML 4OGYH 3IU3B 2ICEA 5L2KE 1J1OL 1MEXH 1F4XH 4XGZA 1ZA6A 4ZXBD 3UYOD 2DQHH 4OBRA 3DGGB 4LSTL 3BZFB 4LRIC 5GGSB 5FGCB 4L8BB 1ZWIA 2B1AH 2E9WA 1T22A 2FZ3A 2X1QA 2BDNL 4R3SA 5KZCB 1FFOA 1DBKH 2GHWB 4AEEA 5GS1C 5E6IC 2G60H 5ACZA 5CINL 1HXMB 5FYJU 3PE9A 3HPLA 1U93B 3S34H 5HHXH 4RMVA 4IMLA 4UNTA 1ITBB 1QHPA 4YHIB 2XZQH 4NZTH 1D5MA 1U8LB 4GRWB 1W72B 4ZUTA 2CLZB 5KOMC 5DSCB 4G80B 4OIBA 2JLLA 4MA3B 3U36B 2X4QB 3DI2B 4RQQB 2P1YA 4MD4A 4XC3L 3PQYB 5C0GA 3S4SA 3O2WL 1OVZA 4HXAL 3WSQH 1RMFL 1SYSA 3ZKXB 1U8HA 3UPAA 5C0FA 3OAYK 4J3XA 4Z18A 1N5AB 3LKOB 1P6FA 2DLGA 2NXYC 4JRYB 3K80A 3UTSE 3NACL 1DTUA 1VFAA 4MJID 1J1XL 4TOYH 3MO1A 1OHQA 3O6FC 5D7IF 3ARBB 3HMXH 3MRJB 4LRNH 4OGAC 2P46B 3QUMA 3QG7L 5A16B 1GOHA 1BVZA 4F7EB 2VDQL 5F9JA 2XWTA 4WVRA 1G9NH 4BSWA 1U41A 3RHWF 2I9TA 3V6FB 4Q9QH 3KPOA 1FNSL 3ARVA 5ICYA 4XNQA 4UDTA 1GHFL 5EZLB 3TP4A 3VXRA 5JZ7C 2NY7H 4F3FA 3WYRA 3HUJB 3IGAA 1HH6A 3V7AG 5F7HA 4I18C 5D72L 4U6XB 1KFAH 3S4SG 3GSOB 3CD4A 4JKWA 1IM3A 5DEGB 1VADA 3QCVH 1N7MH 4BKLB 1IFHL 5KG9B 4J4PD 3RUGB 5HPMA 3A6CH 4UDTB 5JOPE 4EVNA 4LRNL 1NL0H 4GRMA 5ALBL 1EFXA 4F9LA 4U0QB 4CVZB 1BWWA 4LLUA 3FO2A 2DL2A 1A7OH 4M1GL 3W5NA 4GUPA 1FNSH 1TJGH 3CSYB 5IVNA 3EOAA 4CVXB 1BREA 4EQ3A 1MELA 2NY7L 1T21B 4LAQH 3IFPA 4HS3B 4QTIH 3CC5B 4RRPA 2Y5TA 3MROA 1WBXB 1OAUL 4ODSH 1RHFA 5JXEA 1UB5A 2X5PA 1U3HC 1JHKH 3UJIL 1RIHL 5BVJB 1AY1H 1Q9LA 2D7MA 5IFHH 1NFIA 4JM4H 5F7FA 3QAZB 1AR1C 5BQ7B 3CUPB 2XKSA 2R69H 4N8VA 1OD7A 5BJTA 5FUCE 4GW1B 1KG0B 1MFBH 5D1ZA 1CE6A 3RIFF 4LIQE 1F11A 1Z3GH 4PS4H 1Z2KA 5T3ZL 3MRPB 1J1OH 1MEXL 3GMPA 3SDAB 2BMKB 2AGJL 1LE5B 3S36X 4JPWH 5JORB 4XBPB 1LD9A 2HT4D 5F1OB 5DQJA 1UCTA 5D7LD 1RZIB 3KLAA 3TBVB 3B9KC 5EU4B 3OKDA 4CDGC 2ED7A 5D6DA 1P5UA 5E56A 2OJZH 1JRHL 1FNAA 2ZNWA 4F57L 2Y5EA 1EERB 2DBLL 4XC1H 4P2YA 3GHEL 2BOBB 1I1AD 1MCJA 4D0BB 4HG4J 3NA9L 4QYOB 2Z92B 3O4LE 4H8WC 1NCCL 3ARYA 1T89A 4PBXA 3BSZL 1IAKA 4ZOEA 3FQXA 3MLWL 1CZ8H 1OPGH 1P1ZA 2EO1A 1JPSL 2IBZX 2DQJL 4YDJA 3INUH 3R4DA 2BRRH 1EFXB 3GHBL 1E28B 5JXEC 2OL3H 4ISVA 1KBGL 5E03A 4X6DF 5FYJE 5BV7C 2R4RL 4FQCH 5GISH 1RUQH 1OAXH 5DRNB 2A1WL 3ARGA 1DUYA 2D4FA 2DQTH 3UDWC 2GUOA 5AAMA 2XXCB 4G9DB 4KV5E 3TO4D 4LSVL 2IQAA 5BV7H 3DV6A 4PJCA 3RVTC 4FABH 1RZJH 2IWGA 1PKQB 4PJDA 3MOBL 3ZDZE 1I1AC 2BNQB 5I1LA 5ID1A 4M1CC 3SDCA 4YH6A 5J6HB 3WNNA 4RGND 2AVGA 4NP4H 4QOKE 1EJ6A 4Y4KA 4NSKB 1L7TH 3EYQD 4FQJH 5J6GA 3MA9L 1MNUH 3MNVA 4M43H 4JDTL 3CLFL 1ZS8A 2HVJB 2DQFA 2ZCLH 1P7HL 3QCVL 5KSAC 3UO1L 3O3AB 2FWOA 3A6BH 4WHCA 5IW1B 4OAWB 1BFVH 3EYVA 1TZGH 3O8XC 4YHOH 5FO8B 2HVKA 5D5ME 4AK1A 5CEXA 2ZSWA 4GXUM 4RGNB 4NP4L 2GSGB 4R90H 4ZOBA 3TBSB 1QSFA 4QTHB 3L5HA 1C16B 3ARFB 1LVEA 4DJMA 4Z7NF 3FOMB 2XN9A 5SWSD 2BY1A 4HKXB 3UBXI 4IMLB 3CXHJ 1K5NB 3LY6A 3G6AB 4U6TA 3TVMD 3HNTH 2ITCB 2NY3C 4Q74A 4KVCL 1I8KA 4P9ML 3MRCB 3MLXH 1UEMA 4ZFFA 5IEKB 3MXVH 1LD9B 5F8QC 1NFDF 3C2SA 2A2QT 4R3SB 4KJPC 3WJLC 3LN5A 3I2CL 3BD4A 1QQDB 1CGXA 2AEWA 1OOAA 5F9WB 2I26N 1BQUA 3H9HA 3G5VA 2FYYA 3MRMB 4DW2L 3R06B 4G6MH 4Y4HA 5JUEL 1U8PB 3BE1L 3BEVB 2R2EB 1JGUL 2IH3A 4X9FA 5FM4A 4DKEH 3P4OA 2P5WE 2Y6SD 1D9KD 2UUDH 3QP3A 2DQIL 1J0HA 3O4OB 3MRBA 2P45B 2DQHL 3U4AA 5MEQB 4JZJC 5I1DB 4RA0C 1YQ2A 1WEJL 2XIDA 1BX2B 1YQVL 3HC4L 5C0BD 2EDQA 1J18A 3HA0A 1WWAX 4WW2B 4HX1A 4F57H 4DN4H 5FB8B 1T7ZA 2P8MA 4MGXA 4ZDHA 3BDBA 4R8WH 5SWSE 1DQJB 1NCCH 3LRSA 4NQCD 3BE1H 3OKOB 4YLQT 4ZG1A 3VXUD 3IDNA 4CL7A 1MHCB 4D0DA 3RWFB 5DTFB 2Z4QB 3D39E 4ZTPH 2IGFL 3HRZB 1MCSA 1OP3H 1IKFH 3NPSB 5BS0B 2AK4E 1REIA 4XX1G 1ZLWK 1TETL 3BMVA 3PP3H 4P2QD 1QSED 1NAKL 3P30H 5HBBA 1C7TA 4JANA 1K2DB 4S1RH 1CVRA 5EZLA 3SGDH 3GKWL 4X4ZA 4UOJA 3RA7H 2EXWC 4LHUA 3WUWA 5IOPA 3MXWL 3EO0B 4R8WL 4M3JA 1NANI 4OIIL 4H88H 4LEXL 3IT8D 2XPGA 3KPSD 4M03A 5GS1B 4XNUL 3MRHB 1U58A 1FO0A 4BZ1H 3DUSB 2WINA 4CJ0A 1ND0A 4X7SL 4HKBA 2V5RA 1ZKAA 4UMGA 1B90A 3WO4B 3K46A 5ITFA 3OXRB 1DBBH 5C0NC 1Y6NR 2XPGB 1U8HB 1V3JA 4XI5C 4U1MB 3WFBL 2AXHA 5E5UB 3CSBA 4RGOH 4R4BB 4K2UH 3UPCA 3HPJA 3EO0A 3BN3B 5DD1L 5FOBB 4AY0A 1V8HA 4HXBH 3VXME 3KPRE 2N7AA 5D6DC 1KCRL 4OZHF 4IOFC 1FNGB 5A2JH 3GSRA 4X6DB 4RGNC 3PV7A 1R6VA 3WLWD 3IXAB 1S9YA 2HTLD 1JI1A 5I1CH 4OD1L 3U9UA 5IWLA 3I6KA 3RVTD 3VRJA 1G6RA 1O7VA 4MD5B 5DK2B 2WBJB 3H7BA 3JSSA 2VLLA 4P5KA 5I8CB 4G7VL 1T3FA 1MCLA 2CH8A 4W4OA 5I8EA 1KIPA 5KJRL 4JKKA 1OGTA 3BKYH 2D4DA 4IRZL 3OR6A 2OBGA 2H32H 4HHAA 5D5MB 3FN3A 3X14A 3GSXB 5JA8B 2OSLB 3A67H 4OJFH 4HUXB 3KS0J 3MV7D 3V5DB 5F3HB 4PLJD 4L3CB 1AFVH 4O58H 5EOCL 2VC2H 5FDWA 1Q0XH 3VRIA 3GJEA 4NIKB 3T3MF 3U4EB 1KXTB 3IRPX 3C60D 2E27L 4LPYA 5CZVL 3TJHC 4PJGA 3U4BL 4OI8A 4U1JA 2Q8BH 4OTXH 4IJ3C 3CFJB 3B9KD 4R9HA 3EYOA 3HE6D 3JUYA 3STZA 4J1UA 1LEIB 1VGEL 5C0BA 4KUCD 4PP2B 3FAWA 1YY8A 1G6RB 1AC6A 2Y72A 3H9SA 1KXVC 3GM8A 1FZKA 5DUBA 2HT3C 4ELMB 1HHIA 3D18A 4U1KB 3WO3B 3FO2B 4M1CD 4X8JA 5C0DB 1D9KA 1IT9L 4S2SA 1A1OB 5IMKA 1MCDA 5EBMA 4PD4J 3AROA 5TQ0H 3EO1B 3R8BB 4L5FH 2ZJSH 3SPVA 2X1WL 4WHTB 2KL6A 3Q48A 3QUZB 2HJKA 4K3DH 5HHPA 4OLYH 1WT5A 3OKDB 4NN5B 5CZKA 5MP6L 1KEMH 2J1KA 3QIBA 4EIZC 1DQMH 2D7OA 3K81A 1J87A 3VXRB 2FBOJ 3VG0H 3IAPA 2H45A 4HWBH 5K9QG 3X3FH 1G0DA 1NKOA 4MS8D 3HHRB 1IT9H 1YEHH 2R9HD 1BOGB 1JPGA 4LARH 4X6CA 4PTTB 4KZDL 4LEOA 3B6SB 3PHOA 5LBSH 5GGQH 2N4IA 4YO0A 4MA8L 4YBQD 4J2XA 4GMTH 4Z76A 4BQCA 4TN9A 5E5RB 3FN9A 1XCTB 2YPKB 1DLFL 3HAEG 2E7LA 3BH8A 1T7VA 3ALXA 4ZO9A 5D93B 2VUYA 2NY0D 3HAEH 4NBZB 4NNYA 4OF5A 2O61A 4JO3H 4YHZL 1I3GH 3T0WA 1P69B 1LWRA 2VDNH 2HT4C 4P4RB 1KCRH 1BJ8A 2ZCLL 3HAEB 4FG6D 3MRGB 4L4TA 3UTSA 4BZ2H 4RIRB 4TVPE 3V6BR 3A6BL 4Y16A 1XCQA 3IDNB 4LSQL 4D0DB 1HSAA 5CEYA 1IQWH 3SDXA 5CGYD 5SX4H 3TH2T 2BCKA 5A2LH 4R0LA 4EBQH 1C5BL 3NCJH 3T3PF 5DUBB 3MJ7B 1X5FA 2NY0B 2AABH 1FFOB 1EO5A 3OGCB 3D5OF 3FQNB 2C3HA 4NGHH 4K3HA 4JDVB 4JEGB 4WO4C 3H9SE 1G7MA 4G9FA 4EN3D 1WGOA 4JFDB 5I1DA 1EGJL 3L3DB 4Z5RA 2XWJA 1ZGLM 4K9EL 5EZJB 1I3RA 3MLRH 5I18L 2A9MH 3QDMB 1BJ1H 1J5OL 4GQ9L 4YHKL 4UOW1 1E4WL 4P57B 4E9LA 1Y18B 3O45B 3BPLC 3L7FB 5D2NA 1Z9MA 4M5YH 4NFCA 5D5MA 1N5AA 5IKCA 3VXSA 5ESVA 2F54E 3T4YA 1BGXL 4N0UE 1I8KB 4UUJB 4PV8A 5ITBL 3SDXB 5T1MB 3L9RB 1U8NA 4G80A 4R26L 1WEJH 3UMTA 3O2DA 3V5KB 3N06B 1WC7A 1I7RB 1FL5B 1GGUA 1F3RB 4L3EA 3TBSA 4QTHA 4D9QD 2VNCA 1ZT7B 3MRRB 2GJZA 1U9KA 5E2VH 1QYGH 4KZEH 5I8OH 4RZCA 5IMOB 5BVPH 1SVZA 2H2SC 4X6EA 5C0IB 5AEAA 3D85A 1G84A 2HKFH 5D7LB 1BAFH 2X42A 4AIXA 3WN5B 2RJMA 1AIFA 4PB9H 2WIIA 3LPWA 3NFPB 2OZ4A 5ITFB 4YBLC 3WNKA 2WK2A 5ANMB 3L3OB 1W72L 1CU4H 5HHMD 1I1RA 2V7NB 3LV3A 4P5TA 1NAML 5SX5H 5C7XH 4FQIL 5IQ7L 1SJXA 2VE6A 4WJ5B 2QQLH 1PQZB 2XWBB 1OWRM 1A4KA 5EBWB 4PJHB 3L3OA 3OV6A 4HZLA 1TTGA 1F4HA 1K2DA 2AEPH 4ZAKC 4M6NL 4MNHA 3T0ED 2N56A 3WFDH 2J8UE 1J86A 3CH1B 4U1KA 4S1QL 3P9LA 3HE7A 3Q6FA 3KNBA 3RWFA 3N1GC 1NC4A 4ZUUB 1T1ZB 2UYLB 1FVCB 1TVBB 2BNQD 2E6JA 5CJ5A 2W0KA 4DVBB 2QSCL 3S7GA 3MGTA 1EO8H 2PKDA 3BW9A 4NM4L 3P4NA 3VXSE 3BFOA 2Q8AL 1HXYB 2BSTA 1AGEB 3L3GB 3VE0A 2BVYA 5TFSH 1NAMA 3RWIA 2FO4A 4P23A 4OF6A 1L7IL 1OTSC 3ROLA 4PRID 1KIQB 3VRIB 5CLTA 2DYPD 4XPGH 4Y2DD 4MLIA 4YR6A 2MTPA 1HINL 4YIQA 5SWQB 1HYSD 5CUSH 3QIBC 1HDMB 3TT1H 3MRBB 3QNXA 3T4YB 1QRKA 3PGFL 2YN3A 2AI0L 1U8MB 4TUKH 2Y4SA 5I30H 4LVHC 4DZ8A 4M1DH 1KT2B 4NKOA 4OCSL 5IB4B 5E9DB 2X2YA 5I16A 2L7UA 1C8PA 5KTEL 3RZCB 1S5HB 2HT2D 5GZOC 2Q3ZA 1S7QB 5ESQA 3CMOL 1KIQA 1JHLL 2DQEL 2VXUH 4D8PA 1DBMH 4OGYL 1FZOA 4F7PA 5F96H 3VFTB 5FA4B 3TN0B 5FUOH 2XWJB 2OZ4L 4RNRB 5DJAA 4M7KL 4WI6A 4M7LL 3U6RA 1GXEA 3L3KB 3W0WA 2LQRA 3EYSL 1T5WA 3GSQB 3MV7A 1NAMB 3HE7C 5CS7A 4EKXA 5IBLD 4JFFD 4JB9L 4FFWD 4L8SA 5CAYB 4OT1H 1V7NH 2ADFL 5B21A 1IJ9A 1S9VB 4X80L 3HZYA 1FBIL 5DC0A 5K59F 3D0LA 3K8MA 2GJJA 4MNGA 3N85H 4NNPL 3RY5A 4WNQB 2VISB 4XX1E 2R23A 4U1JB 1XCQB 4LMQE 5T1KB 3WS6C 5TQ0L 4U3CA 3T04D 1T5WB 1S78D 4BKLA 3CDFA 1S9XA 3OWEA 1SJVA 5SWZD 3H42L 1B0RB 3V8OA 4XVSH 2XWBA 3QULA 1MJJA 1YEEL 3FCTB 4QXGL 1FC2D 4BSVB 4NNYB 1TXKA 1W8OA 1EGJA 1FCCA 4AJ0A 3BP7B 1T0PB 1CXEA 2ORBL 4UT6H 5E70A 1X9QA 4I0PA 1LK2B 2MKWA 3IS0X 3TNMA 5GRYA 4QRPA 1Q9OA 3SDXF 4N90E 3MCG1 1CGUA 4U7KA 1NCWH 4HIXH 3DTXB 4R2GB 3SGEH 2VLLB 4P5KB 3HE7D 4V1DE 3VWKD 1EVTC 1ZSDA 1YYML 1QBLH 3J8F7 3VFSA 3MZTA 4S1SH 1DUYB 3RDTB 3QIWC 1MFEH 4K3JH 2V17H 4PRHA 1AP2B 3S5LA 2HTKD 5E00B 4PJCE 4JQIH 4M61B 5IFAL 4DGYL 3TJHD 3OQ3B 1VCAA 4TPRL 1KPVA 4FQXC 2ICWJ 2J12B 2J4WL 3KLHC 2OQJB 3G5YB 1BFVL 2D3VA 3GI9H 1KJVA 1RJYB 2O5ZH 4K7FB 3GMNB 4I8DA 1YJDL 3EO1A 5ENWA 1X6LA 1U36A 1GGCL 4U6YA 4WGWB 1T2QL 2Q8AH 3C8KA 4KK5D 2EE3A 4OF0A 1J11A 1K9TA 1Y6KR 5TFSL 3TPKA 3ULSB 1T4KB 2O5XL 4JG1L 4UIKH 3KXFB 5AG8A 1M7IB 1T1XA 4KTEH 1NGWB 2JCCA 3TBWA 3VXMD 1PX4A 4RFOH 4OI9A 4DGYH 1QVOA 3G9AB 4APQD 2P5WD 4UBDC 4PJ7B 5JHLH 3MPCA 4LGSB 4KQ4L 4CRPA 1R3JB 3VXSB 3SE8L 4TUKL 1YDPB 1CF8H 4XWGL 1BOYA 4MAYC 1UCBH 4CMMB 1IGFL 3P77B 1CS6A 3MBXH 4PJIA 4ETQB 2R1YB 3P9WB 2XZCL 4AMKH 3OJDA 3ULVL 1UKQA 4LF3A 1U3JA 1BMGA 4LSSL 4BSVA 2Y36H 3MV9A 2BSRA 2J6EA 4FQ1L 3WDIA 2ZWLT 2QL1A 3KXFD 5LG1A 2ITCA 3RIAK 1NGYA 1HZHH 4QY8A 1K5NA 1A0QL 5HGBA 2QQQA 3E3QE 3EYUH 3OAYH 3QI9A 4TVPD 4XCYA 4P23B 1GAFL 1NCDH 5BRZB 4QEGA 3GUTA 4OLUL 2FSEA 4F58L 2NX5E 2V2XA 4ODUA 2DQUH 5AZ2H 2FIRT 3QRGL 1HILA 1JZ4A 4OZGB 4BFBD 3KDMA 5DEZA 3I3DA 5GJTL 2FH8A 1RJZA 3ZZ1A 4PJCF 3U9UB 1CICA 2IF7A 1WZKA 2Y06H 5DD5L 1QLEH 5TF1H 4MD0A 4I2XE 4U1LB 5DWUL 3LHPL 4LKCA 5MEQA 4JRXD 5D7KE 4XB8A 3C5JA 3TA3B 5J11B 1K6QL 4DFHA 3OJVC 1CDGA 2EXWD 1AKJB 1KTLA 5I8OL 3B9VA 4KI5E 2BY0A 2Y7QA 4JPVL 4MA8H 3QFJE 3MLZH 1I1FB 1S5IH 2FEEI 4PV8B 5DD3L 3VW3H 3MUHL 3AAZB 3VD7A 4OSUL 4HUUB 1OGAB 4DFIA 3W81A 4MAYA 3RDTA 4X0KB 1MRDL 3OXRA 5TDOB 5L9DH 5EBGA 1J12A 2AJZB 4F37F 5F71A 1MRCL 3TVMB 1DANU 1I75A 1KTKE 5DLMH 3PWUB 3DHMA 1LK3L 1AGFB 2AKRA 1F6LL 5IHUL 3ARUA 1OGAA 5F7EL 5E7FA 4OCRH 5GS3A 3CDCA 3RWIB 5HY9A 3G9VA 4WY7L 3WDHA 3NIFF 3H6JA 3GI8H 4G8IA 4O51A 2ADGB 4EOWH 2Y5TB 4WEMB 3FQNA 1CCZA 4JCMA 3RPIB 1D9KC 2PF6A 4S2SB 3CLFH 2V2WA 3OHXA 1N6UA 1NUFA 2WUCL 4G8FA 1FZMB 1SJHA 2BVEA 3HRZA 2IMMA 3DXAB 3MLRL 4NHUA 3CXDH 1NDMB 5GGRB 3RL2B 4MXWL 3H7LA 2BVTA 4QXUL 1NBVL 2H41A 3P0VL 3HLAB 2NY2D 3EYOB 3PGCB 3ESVF 5DO2C 1EK3A 2DLFL 5HYIA 1P7QD 2WAHA 4ODHH 1H8SA 2V2TA 5C07A 3WIHL 5IM7B 3MNWA 5BOZG 3UTOA 1U8OA 1WSST 4O02L 5IESL 3HUJA 1QRNE 3E6FA 3IGAB 5A2KH 5DJAB 4JY4B 4NM8L 1RHHA 1T2JA 1QA9B 3GUTB 5I6XB 1A6WL 5L7XH 2IBGA 1CFNB 1AGBB 3A6OA 1XGPB 4MB5A 5E5MA 1FZJA 4Y5YC 3QEGH 3ARDA 2RCSH 2P5ED 1KUMA 5HYJB 3CDGA 1IM9D 2IBZY 4GS7C 4JY4A 2YD3A 2BFVH 4O00A 3QNYB 3N1QC 1ZLUK 5IW6B 4D0CB 3E6FB 1KIPB 2KZWA 1P7QB 1KIRB 5I8EB 1CGSL 4H20L 1I9EA 5D7LA 8CGTA 5J13B 3UTQB 3NZ8A 1UH3A 5AG9A 1IL1A 4G9FE 4CADA 4HUMB 5DZLA 5C0CE 3MNZB 1FE8L 3QDGD 1DFBH 3HZVA 3VDBA 5ILTH 3T2QA 3TIDA 5DR5H 5A2IH 4I13B 2Y7QB 1MIEH 2CJUH 5KSUB 3DUHA 1OB1A 1A6ZA 1OAXL 1EBAA 1F6AB 3VRJB 4YBQC 5T3XL 4QRRE 2NW2A 1YEDA 1I4FA 4WI2A 1P53A 4R2GC 3V0WH 2HJFA 5F97E 2EIDA 1IAOA 3EOBB 4POZD 2F5BL 1F4WL 3HI1A 3HPJB 2R8SH 3ES6A 5IQ9A 1IL1B 1G7PB 4CADB 2W9DH 1QKZL 3KDMB 1JGDB 3D0VB 4ODVH 4W4NA 4XBPA 4PJ8A 1X5ZA 5C0BB 5H37H 1AJ7H 1HCFX 5DJ8A 1T22B 2FZ3B 1MI5E 2O26U 3Q3GB 1XF2B 4CMHC 2YXFA 3AVEA 1MIEL 2CJUL 4AIZB 3C8HA 4DK6A 4H26A 3WNOA 3V6OE 2EIBA 3LD8B 4BUGA 4Y8AA 3KPPB 4ONHA 4PJEB 1WBZB 4S1RL 1YEFL 1FP5A 2R2BA 2ZUUA 1QBBA 4FFWC 4GOSA 2YD1A 1MLBA 2X4OA 4N0YL 5D2NC 4KHXH 4Z78B 3MJ8A 4NO3A 4PRIE 3W39B 4JJHA 4TQEL 4C57C 2PW1B 5I74C 3V6ZA 2W9DL 1G7MB 4H5SA 5IIEB 3I6LD 9CGTA 3QIBB 2HWZL 2VDKH 5DGQA 1DLHB 5I1EL 2AXJA 2DKSA 4MWFA 5GZOD 1AQDA 5DK3A 1F8TH 4PY8J 1OSZB 4PGCA 1EO7A 1V7ML 5CJQL 1T3FB 1T1XB 2VQUA 4X6CE 4YXKL 1JIBA 4XPFH 3MXVL 3GSWB 1S7WA 5C9JA 3HE6B 4JZNB 4ZFOB 4I3SL 4OD2B 3WJJA 2PR4H 1L9NA 3G5ZB 4L29A 1E6JH 1J8KA 3Q6GH 5KVEL 1NQBA 1S9VA 3C2AL 5HYQA 3LQAH 4PLNC 5IEHA 4HC1A 4LVHB 4LAQL 5ICYB 3TEUA 3QXTA 2QJDA 3V5KA 4L4JA 3AREB 4Y5XB 1CE1H 3UC0L 5E00A 4OF3A 5DURB 4QRRB 3B6SA 2GT9A 4G8GB 2FGWL 3RBSA 1FFQA 4C56E 1NPUA 2VIRB 2XKNB 5HPOA 1ORQB 4PRHE 2WQRA 4M4PA 4U1GC 3VD5A 4KGLA 1E6JL 3HN3A 4LCUB 5D1QC 3L5WA 2VABA 3G5VB 2ATPA 4HJ0C 4ZAKA 5C2BH 4WWKC 5IOPB 3TBWB 4KJQD 2K1MA 4PRIB 3ULUF 5J9PB 4QNPE 1T20B 3O11A 3CSPA 3T1WA 4KJWD 2QSVA 3C5JB 1P9MC 3TA3A 3MRCA 1RHHB 1H8OA 1S3KL 5L2KA 3WL9B 1YUHB 3NPSC 1OT2A 5ENWB 1HXMA 3PP4H 3DOSA 4RFEA 1LEGA 3RI5K 4NZRL 1AGEA 3WJJC 3MLTA 1L9MA 4GLRI 3CFDA 5I0DA 5E8NB 1I1YA 3O6FD 4YHPA 3PDOA 2P5WA 3SGJC 3RVUD 2A6IB 1EEZA 4P46C 3GIZL 2Z35B 1DLHA 4JVWA 4BQ9A 1RK0A 4YXLL 2CKBH 3TN0C 5BCAA 3MNVB 2VL4A 1A7NH 4NHCL 4NZUH 4MNQB 5DC4B 4J12A 4G8IB 4O51B 3FQWB 4KFZC 1JFQH 4FN0A 3KPOB 4XXCA 3ILQC 4XNQB 1HHHB 1RZFL 3O3DB 1TCMA 5B8CC 1Q94A 3ARZA 4ETYA 1MIML 3IYLW 3KPSE 5E8DL 2EDOA 1JGEA 3QUMB 3KGRA 4HUWA 3BP4B 3RWHB 4NPYA 4WU7A 1FAIL 3RP1A 3BAEH 4PY7B 2ZPKL 2WIIB 3LDBC 1KB9J 2AAVA 1CDBA 1AIFB 3VU2A 1RK0B 4OCRL 5HI3D 2OP4H 5SWZB 4P99A 5DMKB 3O2DH 2BX5A 2VITA 3LKOA 1A7NL 3R0MA 4ORZC 4I0CC 3ULUL 2EEDA 4GMSL 2CQVA 5GSRA 2BC4A 7CGTA 4HUUA 1T1YB 3T65B 5IR1B 5DFVC 4FA8A 4K9EH 4B41A 1NFKA 3FONA 1TCRA 2IH1A 1UA6H 2NMSA 4I48A 4C58B 1SYVB 5BXFB 5DQDL 5JHDB 2OJEA 3JTTA 3IKCA 2YPLD 4NKIL 1E4WH 1L0YA 4P9HH 4PJEF 4OKVA 5EOCJ 1SY6L 4RMWA 4R97B 2RFXB 1VKXB 4JFPB 3HG1D 4LCCA 5CEZE 4I3GA 1C5BH 5ACZB 5ALBH 2YXMA 2W07A 1EHLH 4CN1A 3UTQA 1E4KA 5C0RH 4UAOB 4ZAKB 1S5HA 3FB7A 1NFDE 4NPYB 4WU7B 4B53A 3S5LG 2Z91B 4RMQA 4H25A 4KJYB 4KROC 5B8CA 4Y5VB 1OQXA 2Q86A 2IFFL 1JN6B 1OAKH 1VA9A 2CDFB 2F9BT 3E1F1 4MXVF 5IMMA 3UJIH 2BVOB 3V5DA 1HWHB 2YD5A 3RVWC 1OLLA 3MLWH 2DLIA 4KDTC 1H5BC 3KPTA 3UYRH 4GKNB 1P4LA 5HGAA 1KENL 1T83A 1MPAH 2P5WB 4WNQA 3MUGA 4LLYA 1A3QA 4GSDL 1T0NA 1IGIH 1FYTD 5IVZB 4PG2C 3HZMB 3N1FC 3RTQB 3RL2A 5DJ0A 3QEQA 5I1HL 3OKMA 1T4KA 4MJ6A 1OCWL 3OX8B 3SJVB 5JW5A 4P2CG 3HFMH 4N0RA 2DAVA 2ARJB 3SDDC 1GIGL 1HWGB 2C7UB 2G5BA 1FIGL 4Y2DA 3T4AB 5KG9A 3BSZH 2GAZA 4NNXA 4MHHG 4JRWA 2X6MA 4O5LH 2YPLA 4HK3N 1OW0A 3W0WE 4NHCH 1AJ7L 1QPPA 4OLZH 1D6VH 3O0RL 3G6DH 1LO5B 1N8ZB 4NKQB 5DS8A 5LAXB 5C6PB 2QV2A 4HCRH 3DURA 1C08A 2HT3D 3GSVA 3WNPA 3MQIA 5E4EB 5M7QA 4I2XA 4H1LB 2MNUA 4QT5A 2MPAH 4JFZL 3LKSB 1NCWL 4HIXL 1J0IA 1W8NA 4JFQB 1LNUB 4TQEH 1CTOA 2H2PC 2I24N 5GGVY 5GRXG 4WUKH 3TGXA 5DJ8B 1I1FA 3C8DA 5E8PB 3WUWG 1UXSA 3LMJH 1HHKB 1BF2A 3QQ4B 5EC1B 3GB7A 1IC7H 2XZAH 4ZS6D 1G9NC 2QQNL 2V9RA 2N7BA 1WFTA 3SQOH 4BH8A 3AC0A 1U3ZA 1OAUH 4ODSL 5JZ7D 2W65A 1AH1A 3WS6A 2QR0B 3UCRA 1CG9A 5E2TH 4P5TD 4JRXA 4N8VG 1UWEH 5BO1H 1Y6MR 1U92B 5ICXB 1QP1A 3CFCH 1CDJA 1A02N 4K23L 1GGBL 4JFFB 4OV6F 4R96B 4PJXB 2DB8A 4LPWA 3BVNB 4MQXD 3RDTC 4C54A 5IJVA 1ZHNA 2RGSA 2ICEB 2OR7A 5KJRH 5HYFA 2O61B 4X83A 5T1KD 3GBNL 4MDJB 3RKPA 2HTLC 5CIPB 1BD2B 1YEGH 5FA4A 3RL1A 2F53E 3TN0A 3DYPA 1MLBB 3BZ4B 1BZ7A 1DJSA 4R4ND 3S98A 2NY5H 2BVPB 1T03H 2X4UB 1PYWA 4U31A 3EFDL 4KVCH 4G43A 1OL0A 4LSRH 4JFYB 3W2DL 3VXTB 1PZ5B 5DRNA 4Y4HB 4X5LA 4P2QE 1RU9L 1RUMH 2UZIH 3NCEB 1FV1B 4G6KL 4HF5H 4M00A 1LO4L 5F3BB 5DD6B 1SEQL 2X89A 5DJZB 3S3JA 1G7PA 2IAMC 1XF4A 4NCC2 5KS9F 1PZ5A 5KVFH 1UWGL 2MKLC 2HKHL 3RI5F 4AENA 5M95B 1AI1L 4M8VA 3S3PA 4ZQKB 2BOBA 4HKZA 3ZMRA 5HDQL 4F7CB 2B5IB 1GC1H 1RULL 4QRUB 5D9SB 2IADA 4Y1AD 3ZSSA 1CBVH 1UXWB 1CLYH 5IMKB 3ARPA 3QG6B 4JRYE 4P4RA 2KKQA 2CXKA 3B5HA 2YOCA 1R5IA 2H6PA 1ZVYA 5D2NE 4DKFL 3FT2B 1ZGLP 1UKSA 5HHVH 3QQ9D 3GJFH 1BVKA 4OAWA 4ZSOB 5IKCB 1IKNC 5E94A 2A83A 2FWOB 2VITB 4J1UB 3VW3L 1B6DA 5CD3A 5I1EH 3CJJA 5L88H 3QPXH 3DUSA 1NAKH 3ARDC 1D6EB 1T0MA 1CXLA 4PR5A 5J12C 4IDJL 1ZV5A 5F9WC 4DKAA 1WCBB 3BDYL 3BXNB 3D39D 2MPAL 1R3KB 4QCIA 4KRMB 3C5ZD 3V0VB 4MJIB 1KPRB 3MJGX 1WUNT 2B7DT 4M4RA 1D5XA 4HJGB 3LZFL 3FJTA 4HAGA 1FAIH 3FCTA 1OSPH 3GSXA 2AEQL 2ZUXA 3E2HC 4Q6IC 4ORGA 3CSYA 2KQMA 1QFWM 1ZTXH 4WWKD 5IG7A 3DO3A 3NFPA 5FYKU 5F7DA 1JI2A 3KPQA 3TPUA 1S7RA 3BISA 3PL6C 4NQDA 2CIKA 1BIHA 1M05A 4S0SD 4X99A 4N8CH 3GSUA 3QXUA 3JWDC 4Y4FD 2JIXB 2VDML 4KWUA 2Q6WB 5TPWH 2ZUTA 3KWWA 3GIVA 1IC4L 1MJ8H 3BPOC 2X4RA 2XYCA 1J0ZA 4PJ8D 2OX5A 3V4VL 1B0WA 1A0QH 4LLDA 4L3EB 5DVNA 4MQSB 1G7QA 4PJAE 3W0WD 5JMOC 5MEOA 5J0BA 2IQ9L 2Z8WC 2I9TB 1I1AA 1AQKH 3NZHH 3EZ8A 2X41A 3BIAX 1XR8B 4KTEL 1RPQA 1P7KB 1PVHA 3OPZH 3VFVA 4Q9RL 1ETZA 4WU5A 5DQJB 3KWWB 1ORSA 1Z9LA 3HZMA 3LH2H 4O2EA 1Z5LB 3SDXE 5DHXB 1OP5K 3RWEA 4G6AC 3SE9H 5EU5A 1DUZB 2GTWA 3IFNL 1OARL 1PX3A 3SDDB 4YFLI 2IAND 4OGXL 4PFEA 1ZA3A 4DTGH 1MUJB 3MV9D 4WTWA 5EOCH 4JVUA 3MRQA 2EDDA 4G6JH 1AQKL 3VFPB 4MJIE 4NKDA 4W6YB 3W11D 3FOMA 5HSFA 2VLRB 5KSAB 3GSNH 1QLFB 4MYWB 1LO0H 4R7DA 2PETA 4XMPH 2J5LB 3VG0L 5JO5A 3RWEB 1XR9A 3EKCA 4F2MB 3IETB 3VGFA 3AMKA 4N1EA 4UV7H 4I4WB 4LHJB 5DF0A 1EDQA 5IV2A 1T0MB 3SKOB 1G7JA 1PY4A 3O3AA 5D7LE 1MJ7L 1LK3H 5KVGH 2HMIC 4L8CB 2K3TA 4GRMB 3QO1A 5HHOA 2QHRL 3T0XA 1A8JH 4EXKA 5E6YA 3FB5B 1QSFE 3O6ML 5E24E 4KRNA 4HZLB 2ESVE 1BVLA 3FB8A 5FUZH 4BQBA 3LD8C 3OB0H 4JY6B 1W0YT 4YJZL 1JV5A 3QSKB 1IGTA 4MAUL 5J6GB 5GZND 4NC1E 5GS1A 5C6TL 3BKJH 3X3FL 6CGTA 1VEPA 1OTTD 5MERA 4KUZL 5DJXA 2JELL 1OGTB 4YFDB 5GPRA 5IQ7H 4PRDB 3MUY1 3J7HA 1Y0LA 4R4FH 5JW4Q 1CFVL 3UX9B 1IAIL 3UZEA 2B5IC 1ACYL 1MVUA 2VDPL 1JWSB 4JO1H 5DJDA 3U0WH 3MLYH 1INEL 3RGHA 3V4UH 3ZL4L 1HQ4B 5E2JA 1NGXB 1JHKL 1LO3H 3UPRA 3SHSA 1K4DB 2R0WL 4NDMB 4HK0A 3NN8A 5GGVL 3VXRE 2BVPA 1G6VK 1T80A 1AR1D 1IEBA 3ZDYE 1NCAH 3WFEL 1NBYA 1NMCC 2AV1A 3I02A 4D3CL 5F7KC 3U6RB 3CFEB 2NYYD 1JK8A 1F58L 4XZUA 3N1PC 3PWNB 4ODWB 5FKAB 1MREL 5EO9B 4HIJB 3BJ91 4Q2ZB 3VFSB 3JTSA 2GY5A 4TNVK 3MA7A 1EMTH 3QISA 1ZSDB 4KVNL 5I1KH 5DJ6B 4MMXC 5H94B 4NO0B 5I6XC 2J8UA 2X4TB 5D1XD 4PRPD 4NGHL 1ZEAH 2QQKH 4PGEB 2PYEA 2XNAA 4R26H 5IF0B 1EGJH 4LLQB 4P46B 5DVMA 4XCNA 1I8MB 2V5SA 2MQ3A 1MH5A 1YPZE 3QUXA 1FPTL 3RNKA 3OTTA 2VR4A 2YD4A 1XF3B 2IMNA 2Q7YA 2J88H 3QEUB 5H8DA 2CR3A 4UQ2A 4EI6B 2CK0L 5JUEH 3ULUC 1A7PH 1EHNA 2OTUB 4YFLF 1G9MH 4NQVB 1F6FB 1YZZA 3SDAD 4GQ9H 4M8QB 2JCCE 1A6UH 1BQSA 5C07B 4PRPB 5B39G 3ARFA 3DECA 3U7WL 3OR6B 1LO4H 4MDIA 3VG9C 3BKML 3VDAA 1Z9OA 2ZOLA 4WEBL 3GMLB 5GISL 3B2VH 5FHAH 4EIGB 1FE8H 2VLKE 5JOFA 1HIML 2BZDA 2DQTL 3DRQA 4OLXL 2YSSB 1F42A 4WDIB 4RBPH 4HBCH 2A73A 1YNTB 4XP6H 1FLTX 2BSSA 1N8ZA 3VXMA 7FABL 2HFEA 3CCHA 5KVGL 1CI5A 2F53A 5EO0B 1RJLA 4PYGA 2C3VB 2YMXH 3RWJB 4IMKC 4KI1A 3S35L 3TJEH 1X5LA 4ZTPL 1UENA 3ARBC 4MSWA 2DTML 2EDWA 5IBTL 4X6FA 3VFTA 4G42B 1FGNH 4F7PB 4IS6A 3U82B 3FT4A 2RAMA 1YJDC 2X4NB 3MCLH 5DMYA 5B39A 3JUZA 4QXGH 5D1QA 4V1DB 1A21A 4MNQE 4PG9B 4U1IA 3VD4A 1QSEB 3QNZB 2P24B 1CL7L 4U6HB 4YEEA 2D31A 3V6OC 1CG9B 3DVGB 1NBZB 2HLFC 5DMGC 2Z31C 5I1GH 4P2OA 1IMHC 2NY4C 4KAQL 1MFCL 3BZEB 4QHMA 4M6AA 1IAIM 1NAMH 3QQ3B 3F12B 4KUCF 4FQIH 5IJKC 1MCPL 4FQ2H 1JP5A 4FS0A 4Y88A 1E28A 4A6YL 5CEZD 2W59A 5E08L 4UILL 4NFBA 3I75B 3QFJA 1N0LA 5GS2H 3VI4F 3ZL4H 1CGTA 5C0FB 5F1IA 5TE7H 3QEUA 3I85A 3LS4H 3MGOB 5T33H 1DBAL 1MHEA 4FTVB 4LSTH 3WXWH 1A3RH 4PJEA 4HC1L 4U7SA 3Q6FB 4X9BA 2I25N 1AO7E 1HEZA 2WNGA 4D3CH 2PYEB 2XNAB 1J8HA 5IF0A 1EVUA 4V1DA 2A9ML 1MCPH 5I1CL 1KB5H 3I3EA 5EU4A 5E94B 4UUJA 4YHKH 1C1EL 3NCMA 3KR3L 3ORJA 1TZIA 1X44A 3T0EB 1S7SA 1XGRB 2VLKA 5T3ZH 3REVA 5TE7L 5D70H 3C9NB 4IBLT 4WCYL 4WWID 5BRZA 3QDJA 4CDHA 4IRSD 3LPFA 4LSUH 1T6VN 3EOBA 5SWSB 2UWEB 2ZUQB 1SEQH 3BPCB 2X4SB 3CFEA 4WTZG 1Q9KB 1CE6B 5E7BA 3PF2A 3LN4B 3B9AA 3K2UL 4XXDA 5CUSL 4PBWD 3U7YL 1L6XA 1LE9B 2H8PA 2YSSA 1E27A 4ZUWA 3O8XA 2GUOB 3DSFL 3NIFE 4P0DA 5AD0B 1U8JB 2XOTA 2XI9A 4U1NB 1OARH 3HMXA 2AK4D 3IDGA 4MZ2A 2HFFA 2EEAA 5J06A 4JDVA 1MVUB 1DVFC 3CC5A 1KF9B 1A1NA 2H8PB 4M5ZL 4OZIE 4ODTH 4Z7WA 5CFHA 4HFWB 1NGZB 4ZFZA 1YEJH 4WU5B 4WEBH 4AH2B 3C60B 3DMMC 4HJJH 3VFVB 4YGAB 3P40A 1A9EA 1CDCA 1AC0A 1A5FL 3IDJA 4WFHE 5ALCH 5I19H 2R4RH 4FQCL 3FO9B 1D5ZB 2B4CH 3REVB 5FIEA 1UZ8A 3FQWA 1X6NA 4JN1H 1IGTB 1VSCA 2AK4B 2YMXL 5FO9A 5CD5C 1A7RL 3OXSB 1GRWA 4Y4HC 5I1AA 2CIIA 4Z9KB 1HKLL 3K4DA 4O2FA 3WLBA 1AGCA 5HVWA 2W60A 3B4NA 4XMKL 4XHJD 4WFED 3VFRA 2HJLA 4HWZA 1NC4D 4HXAH 5BS0D 1G7IB 4FQPA 2X40A 1Q72H 5EBLB 2OMBA 3H9ZA 5MEPA 1CN4A 4AT6B 1J9CT 5C8JB 4RGMC 4JRYD 1MVFA 2PW2B 3K0WA 1V7MH 4JR9H 5CJQH 4I4WA 3NN8B 1NEZG 3NACH 1QPXA 3BKCL 1WWWX 4J6RH 2APFA 1FHGA 1C12B 4P9HL 1A6PA 3PIQA 4URTB 5C3TA 4JFDA 1JHTA 2BJML 3K4AA 4YDLB 3CXHK 3CPLB 1MJJB 5CBAB 3RNKB 2BY2A 3F62A 5HI4D 2MHAA 1AD0B 3NA4A 3TZVD 1KOAA 4UT7H 5BS0A 3RY6A 5F7NC 1D6EA 3PWJB 1QUNA 1QSEA 3VH8G 3BDXA 3GSVB 2ADIA 4L9LB 4C56B 4M9PA 5ISZB 3GBML 3HNTL 1Z5LA 4N5ED 2E8ZA 1V05A 2FJHB 3VFWA 3L1OH 4J6RL 3QBTB 4XP4H 4OLVL 1OAZL 1ORSB 3HAEA 3IXTB 3SGJA 5FB8A 4PP2A 3WNLA 4KK8C 1KB5B 1SEBB 5BZWA 1QHOA 5LGHL 4FQ1H 2R0KL 2XQBL 4U6XA 4M1GH 1MHPL 2VDOH 3AXLA 1ZHBB 2D7NA 3F7VB 3WKMH 1QFWH 5HYJE 4UT7L 1Q38A 3V52H 1MRFL 3C5SB 1B6UA 5LWYH 3SJVD 5F9AC 3O4LB 4OFIA 4HS8H 1MPAL 3UAJC 4OTXL 3BWUC 3UPRB 1FO0L 1XGUA 5FYKD 5DT1L 3B9KA 4HFWA 1S3KH 4ZFZB 5DJZA 5EUOF 1W2KT 3T2PA 2GCYA 2R0LH 1KCSH 3FQTB 4RMUA 2BVQB 1UCBL 2ARJQ 4XVUD 3C6LD 1A7QH 3UTZB 3FQUA 4XNZB 3O81A 5B4MD 1OAKL 3IU4H 3VWJB 5I71C 4C83A 5FDYA 4X80H 2Y36L 4OQTH 4ENED 3VCLB 2NXZD 4PV9A 1T7XA 2E9JA 3DXAE 3MX0A 3H3BC 3SKNA 2DLHA 1AFVL 3KG5A 4ZUVA 5F8RC 3T0VA 2PNDA 3B9DA 2JJTC 1UVQA 4F58H 3ARTA 3KPLA 3TBYB 1U3HA 3FFCE 3G6JE 5FCSH 5HGHA 4MLSA 4FQHB 1WF5A 4FNLH 3KJ4C 4P23C 2HG5B 5DYOA 4KMTH 3L6FA 2JF1A 3G6JB 3TJEL 4YE4L 5K59E 2EYSB 1QRNB 4OFKA 3VWJD 4PJ9C 4JLRB 2WWKO 2DQCL 2CRZA 2DQDH 5F89A 4AL8L 2DQFB 1I1AB 1DSFH 4HV8B 2H1PL 4MJ5A 4R4BA 3FB6B 4U6VH 1E4KC 2H26A 3U46A 4DGVL 3SKMA 3MJ6A 3C6LC 4XVUC 3PV6A 4Z77A 2Y9RT 5HPMB 2Z93A 3JV4A 5CCKH 1FYTB 2FHFA 2VDPH 4Y16D 1IAII 3MTRA 3GB7B 3O3EA 1N2RA 1VERA 5IVXF 3WN5C 4KXZI 1YYLH 3WSQL 4HIHB 1ONQB 1FRGH 1TNNA 2NZ9D 2CD0A 1W0VA 1ZLUH 1NJ9B 5EZIH 5D1XC 3OR7A 1NBVH 2CLVB 5EFIB 1K4CB 3DHJA 4L8DA 5IB3B 2ED9A 3OL2A 4LKXA 2BNRE 3TM6A 3ZKMD 4HS6A 3BN9C 5F9OH 2BVQA 3ARGD 2XA3A 2VKWA 5AYQA 1DVFA 5I1JL 5C92A 4KK5C 4NO5A 5C0IA 3K2MC 5IW3A 1J88A 4Y1AA 2X1OA 1R3KA 3TFKC 4QLRA 5B3JE 4EDWH 3FO0H 4KQ3H 5KANG 1FNGA 3F7YA 2NXZC 4LLMB 4XXDB 1HK6A 3GO1H 5CMAB 5LGHH 2NNAA 3WJLA 3V7MA 3VRLF 5K9OA 2D7TH 1BX2A 1X4YA 3MCKB 3IDIB 1DL7H 5IT2H 3GNML 4GAJH 4WFGD 2OL3A 2PO6D 4O58L 4JPWL 4M7JL 1KN4H 1OAQH 1GGIL 3ARFD 5FEBA 1NCDL 5C0AD 4HPOH 1F3JB 3QG6A 3SDAA 3MLXL 3QI9D 4WFFE 1KENH 4Z7QE 1WCQA 4YEFA 1I4FB 1NDMA 3JWDH 1XIWD 3BZFA 3L3HA 3RQ3A 1DDHB 4PGJA 1TENA 3QXAA 5IFJA 4XPHL 4R7DB 5HD8D 1VGKB 2NX5B 2OM5A 4XCFH 3BZDA 5HGDA 3NFNB 1Q8MA 5E2VL 4IIQA 4PREB 3WNMA 1MFDL 4NC2B 4PRNA 5T3ZE 4DKEL 4M3KB 3UBXA 2R0ZH 4ODXB 4NWTH 3Q5YA 5JW4N 4HWNA 5IFJB 4HS3A 1KB9K 5JW4M 2IC2A 1VFMA 6FABH 2NPLX 2J5LC 1M7XA 4PGEA 2OZ4H 1AGFA 1XIWB 1MHCA 4O5LL 4MA1C 1INQA 3ZHDA 3NIDE 4LCYA 4X98A 3O4OC 1ORQA 3QDJE 1YECH 1IM9B 3BMWA 3QNXB 1G7QB 4MS8C 2SEBA 1QFUH 2D31B 5EO9A 2DQCH 3B83A 4F33A 1QR1A 1VADB 5EORL 3PWPD 2BHYA 1KIUA 2E6PA 1F90L 2I60L 1NBQA 5HDOA 3I9GH 1KJMA 4KHTL 1HXYA 4RAUA 3GSUB 4QF1A 2AJSH 4HT1H 2FNBA 2NXYB 4LSPH 4DVBA 3FRPG 2D9QB 2X4RB 3MLSH 3VWKA 4TUOA 4BH7A 4TNWF 2X44D 5C9JB 3QUXC 5F1NB 1JPSH 4Y1AB 4RDQG 4FZ8H 4H1LH 5EH1A 4NN5C 1WWCA 4HGWA 1NUNB 5F44A 3H0TB 2VDMH 1OAYH 3KPSB 5E2TL 3LEXA 4JJ5B 3DUUA 4ZFFB 2EE9A 1DQQB 1VENA 1XMWA 1INQB 4LVOB 5KVEH 2F8OA 3T0EE 2F5AL 4QXUH 1HKFA 3F5WB 3DBXB 1RZJL 1NUGA 4PR5B 3PHSA 2LU3A 4XNZC 4AT6A 5FGRA 1U8IA 3B2UC 4LSUL 2IJ0C 4KQ3L 2BRQA 5ANMA 3MV8E 3NIGE 4LP5A 3DNKA 4K8RC 2BY3A 2WMPA 4J3SA 1WJ3A 1XH3A 3T0EC 5DHVA 4FFYL 2ICWI 4Q7DA 3SE3A 3FB6A 3U46B 5IVXB 4YXHH 2A6JB 1CICD 3PWVB 1CD1A 4M6OL 3ULVC 1HNFA 5E9DE 1GYAA 5DQ9A 1LEGB 1Z3GL 5I17B 4LAJH 2NTSP 5D7IE 3I50H 1ZAGA 2W9LA 1ZT4B 3SBWA 4GBXD 1IAOB 2VDLH 5HI5D 2C4FU 2EIZA 2HFEB 3CCHB 3TBYA 1BM3L 4QHNB 1PZUB 1OF2B 5BS0E 2J8OA 4NUGH 2XT1B 1W0WB 3QJHB 4G8GD 3PL6B 2YS4A 4K3GA 4IOFD 4PGBA 4X98B 5IHBA 8FABB 1F3DJ 3ULVE 3BWAA 3EJJX 5I76B 2AI0H 4N0CD 5C08E 3GSNA 4D9QE 4WW1A 2PXYA 4XI5D 3L7FA 4WI7A 5C0CD 1HKLH 4IRSB 4HBQA 3CVHH 1NGYB 4QY8B 2DS4A 3RVVD 2A9NH 3PL6A 5GS0D 4NQTA 5FUZL 4P23D 3B9KB 2FD6H 2B1HL 3NABH 3LEYL 4MDJA 1P7KA 1JF1B 1U42A 4U4BA 4LCCC 2HP4A 2VLJA 1MH5B 3QUXB 4QRQB 4TUOB 3VFMA 3BZ4A 5DK0A 1WTGT 3WO4C 3K74B 4CMHB 5HYEA 3P2TA 1TZIB 3KPNB 4GS7B 4ZNEE 2R2HA 3ZYIA 1SJEB 3B43A 4ACPA 1MJ7H 4PJXF 2RIKA 5DDHB 2JIXA 5CILL 4GG6F 5K9QI 1NDGA 5F6IC 1HH9A 3TBTB 4S1SL 2B1HH 3NABL 5ICXA 4GMSH 5GGTA 4GAYB 5GIRB 2EEBA 2ERJC 1J8HB 1T0NB 3MBEB 4BH8B 2YEZB 3T1FB 4BQ6A 1QRNA 1ZANL 3OAUH 2XZZA 4D94A 2GK0A 1JPTH 3C5ZA 1KPVB 3AB0B 4P48A 5IUSA 4FTVA 2VERN 3NMEA 2M26A 1I1CA 5BVJA 3BHBA 1T1YA 4MB3A 3T65A 4AM0B 5LVEA 1BF8A 1WITA 3ZHKA 1R24B 1MJ8L 1BZ9B 4WHYH 4WUUB 2Q87A 1EPFA 5D96B 4HK3J 4KK8D 2GFBA 3IKKA 3S4SB 1FVDA 1VGKA 2NX5A 3CZFA 3OZ9H 2R4SL 4WY7H 5KS9B 2GIYA 4RFNB 5C8JA 4NQCE 5MEPB 3QCUL 4KROB 4D9RE 1LO5A 4P2OB 1PGRB 1Q9OB 1C08B 1Q94B 4ZNCD 5TDOA 2CUHA 5CJ8A 1I7ZB 1HH9B 3TBTA 1UWXH 3LKNA 5C08A 1KN2L 4UI2A 1FPTH 1M4KA 2GT9B 5BZDA 2D03H 2RFXA 3FZUD 2CR6A 4J23A 3LEVL 4NQEA 2HAZA 2YK1H 5EPMA 3AREA 4Y5XA 4FFZL 3TVMC 4AEHL 4TSBH 3AS1A 1QYGL 5DMJB 4GAJL 2VLJE 5GGUB 4JKPH 3FO9A 2H26B 4XVTL 3ROOA 2F53B 3HZYB 5ESAB 4JRXE 5L0QB 4ZUUA 2ENSA 3AGVA 3L6FB 4KI5C 2EH7H 2J6EH 3BIKA 4KRPB 2FBJH 4FQHA 3VMOA 2OR8A 1JZ7A 5D93C 4ZPTB 1UADC 4XNYL 3L3JB 3FTGB 1EZVX 5F6IB 5HYJA 4ZO6A 5IBTH 1NJ9A 3DRTA 4X6CF 5DA4A 3OAZK 4M48L 2P8PA 5C86A 2Z31B 5EOTA 1FORL 4X6BB 5IB4A 1VFUA 5ALCL 4GO6B 1PBYA 3VJ6A 4WFEE 5CZVH 3DMMD 4O2EB 1YDPA 2Q8BL 3T8XB 4CW1A 4TSCL 3U2SB 2FCBA 3QWRA 1CLYL 1GGTA 1YYLL 4KTYA 2DKMA 3PWVA 1JGVL 1RZKC 5I1IL 1GZQB 3HS0B 4OZIA 2F54D 1RURL 4JPIB 1A22B 5GGRA 5H2BA 3QA3A 1D5BB 2G9HB 3DXAA 3O2VL 5I2IB 15C8L 5BW7C 1XH3B 1SJHB 4G6AD 4MZ3A 5EA0H 5FAAA 4KDTA 4K3EH 3OKEA 3MREA 2DJ4A 3T8XA 5KS9A 4PLJC 4JQVA 4JO4L 1T89C 4LSPL 4EOWL 1CXFA 1TVBA 5TE4L 3RIFK 5JHDA 1ZT7A 1GPOL 3MRRA 4HUKB 4UAOC 5FHBL 4CUCA 2Q76A 5F1IB 2NTFB 1GGYA 4QRUA 1FLRL 5D9SA 5J3HC 1S7TB 1DQDH 2YA0A 2IAMA 1UXSB 5INCB 1WISA 1F6AA 5DD1H 2P44B 1J05B 1P4BH 1RK1B 4NQEE 5KSUA 3VFOA 1EV2E 5IR1A 1L7TL 4C56A 5I1IH 2F54B 3ZE0E 4U2YA 2CXGA 3DVIA 1BECA 2OR9H 4DEPB 5L9DL 4K71C 4NKIH 1C1EH 2YEZA 4PJAB 2XKUA 4E0RB 3MRNA 4LCUA 1J1XH 1N6VA 4Y4FC 1RK1A 1FNHA 1EZVY 4KRPC 3DVGA 5DS8B 2GCYB 4DQOL 4D0CA 1Y18A 1CGVA 5F1NA 2D2OA 4JGMA 4KU1A 1RAMA 2R1XA 5L0QC 3ROOB 4DOHE 1AD9B 3JWDL 3N50A 3UP1A 4HC1H 3VMNA 4U1SB 3PWLB 4MQ7B 3PV6B 3BPLB 3FMGL 1FH5L 1UWEL 3MOQA 4YDIH 3S88L 4JB9H 4NRXB 2KBGA 4LU5H 5BW7A 4RCAA 3OKMB 3GRWL 4JN2A 4UU9B 2H3NB 4HWEH 4XVTH 1BPVA 4YQXL 3RTQA 3PDOB 3LKNB 5C08B 3NZHL 2HG5A 3ALWA 4NQDE 2R29L 4ZD3L 4YHPB 2E27H 4U49A 1CIDA 1JRHI 2IADB 2Z31A 2PYED 1OSZA 2O5YH 3BGFB 4PGCB 4Z95L 2IPKB 1UJ3B 4Q6IA 4XVSL 5TF0A 3P30L