4HM7B

Naphthalene 1,2-dioxygenase bound to styrene
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to styrene
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm7B00
1K41A 3Q90A 3SEDA 1TUHA 2XSHB 4HM8B 3T8NA 2R4IA 1GS3A 2Z76A 1NWWA 5EVHA 2B1XB 5DREA 3CNMA 5KP1A 4XM4A 3GRDA 4K1VA 2JQ5A 3BB9A 3DMCA 1ISKA 4L8PA 4IIAA 3LZAA 5AIHA 2YFLB 1JKGA 2INXA 3BLZA 3E99A 3FKAA 3RGAA 5AIGA 5CLKA 5CF2A 3KSPA 5JPPA 4J8TA 4L8OA 1Q42A 5HGRA 5IF6A 3MG3A 3FH1A 1E3RA 4WYKB 2QIYA 3JUQA 1O7PB 3G16A 2Z7AA 3CNXA 3LYGA 5IEPA 2UX0A 3NM2A 3S5CA 3NV0B 4WP5A 3EC9A 5IG5A 2RFRA 4HZ9B 1JB4A 3STDA 2BMRB 3OX9A 3GZYB 3EQQB 3GZBA 1GY7A 5AIFA 3KZTA 5IEOA 3F8XA 4Q53A 5STDA 3CPOA 3JUMA 3MHEA 5BVBA 3B4OA 3MG2A 3F7XA 5CK6A 5AEWB 1NU3A 3FLJA 3T8UA 3OV4A 2F99A 4PEJA 1O7NB 4U13A 1TP6A 4HVNA 1OGZA 3FSDA 3KKGA 1E97A 2HMJB 3F7SA 1W02A 4R9LA 2GXFA 3NV0A 1OCVA 2HMLB 4X2OA 3GZRA 3NUVA 2PZVA 5IG4A 3KE7A 1JN5B 4HJLB 4HM0B 2BMOB 1DMMA 3EHCA 1Z1SA 5DRVA 3FZWA 1IDPA 2K54A 2CKFB 3EN1B 5KP4A 3B8LA 4HM6B 2QGUA 4R1KA 2GBXB 4LEHA 3UJMA 4HM3B 4XDVA 4HM1B 3F8HA 2STDA 1E3VA 4WWUC 5JPUA 3NHXA 2XRXB 3EN8A 4FCJA 3K0ZA 3NBRA 2BNGA 1U5OA 4HKVB 1ULJB 2GEXA 3HZPA 4H3UA 4ORLA 3ROBA 3IPTA 5IG3A 5IENA 3OWSA 1JN5A 2CHCA 4N3VA 3OXAA 4X2HA 3GWRA 1O7GB 4J9AA 5G2GA 3CU3A 1GY5A 3HX8A 1UUWB 3WMDA 1SJWA 1OPYA 4R9KA 5TGNA 1JB5A 1OF5B 5IERA 3G8ZA 1GYBA 3MKIA 1O7HB 4HM4B 1AR0A 1ULIB 1OHPA 4LGQA 1VZZA 3JUPA 4GB5A 8CHOA 3H3HA 5BXQA 2HMMB 3NXJA 4HM7B 1HKXA 4HM5B 1EA2A 3EJVA 3EX9A 4WYKA 2GBWB 3FF2A 3ECFA 1W00A 1CQSA 1W01A 1OHSA 2BMQB 3F14A 1QMAA 1WQLB 5D82A 5FW5A 5CF1A 1DMNA 5CXOA 3HK4A 2I9WA 4XDWA 3OWUA 1OF5A 3MYTA 4L7KA 4MJDA 4XB5A 5IG0A 1ZX2A 4LMIA 3ER7A 3FGYA 6STDA 1A2KA 3DM8A 2HMNB 1JB2A 7STDA 2RGQA 1QJGA 4FCMA 3UNLA 2HMKB 1NDOB 2B24B 3K7CA 4KVHA 2IMJA 3OWYA 5D81A 3B4PA 2RCDA 2XSOB 3M8CA 1DMQA 2YFIB 1OHOA 1Q40B 3GZXB 3B7CA 1ASKA 3JUNA 5D83A 5AEUB 4HM2B 5AI1A 3MG1A 2XR8B 3MSOA 4XBXA 1ZO2A 3VGNA 1EG9B 3FF0A 3SOAA 3VSYA 2OWPA 4XBYA 1OUNA 3I0YA 2YFJB 1OGXA 3EBTA 1UUVB 5AIIA 1STDA 3A76A 1O7WB 1Q40A 3H51A 3SOYA 4XBTA 3G0KA 1O7MB 4I4KA 3DUKA 3JUOA 3RGRA 1OH0A 3D9RA 3DZLA 2HMOB 1C7HA 1W6YA 3EF8A 4OVMA 2GEYA 4STDA 2F98A 4OUQA 1BUQA 1S5AA 4HZBB 2F86B 3DXOA 2A15A 5KP3A 2W2CA 1GY6A 3F9SA 1JKGB 3F40A 4RZMA 4CDLA 2Z77A 4K1UA 3EBYA
chains in the Genus database with same CATH superfamily
1K41A 3X42A 3Q90A 1GD4A 4FMDA 3SEDA 1TUHA 3LT8A 1YNVX 1VQ73 2WGQA 2XSHB 4HM8B 4IT7A 3N54B 3CPW2 3K63A 1GOYA 1NB5I 1UUGB 1DVDA 2XGNA 3T8NA 1VQ63 1JNQA 1GS3A 1X1UA 2R4IA 3ZFZA 1RN4A 2Z76A 3S27A 1B2ZA 1NWWA 5EVHA 1FW7A 1ZGXA 1FZUA 2IYJA 1RCKA 2B1XB 4MMZB 5DREA 3CNMA 6GSPA 5KP1A 1I0XA 2YX9A 2OTJ3 1DETA 1FGQA 2QA43 1JBTA 4XM4A 1W6CA 1M9GA 2F5MA 3GRDA 1LQMB 2JQ5A 3KN4A 3LOYA 3BB9A 4K1VA 3DMCA 8RNTA 1STFI 1FA3A 4FMBA 2MF7A 1ISKA 4L8PA 1JZOA 2IY2A 3AHWA 2WOFA 4GSPA 2XF3A 1N9EA 1VQM3 1IQYA 3LZAA 4IIAA 4N6MA 2QEX3 1B2SA 2CW9A 3X41A 5AIHA 1FYSA 3V92A 3G4S3 2YFLB 1JKGA 2INXA 4O02B 2OQEC 3BLZA 3D5IA 3D3LA 3GSPA 3E99A 3FKAA 1WMPA 5AIGA 1BNSA 3RGAA 3CD63 3SXXA 1HYFA 5CLKA 1TRQA 1UCLA 3HIIA 1JJ22 5CF2A 3KSPA 5JPPA 2JDIH 4J8TA 1TJDA 4L8OA 2CFGA 1I3IA 1OACA 1Q42A 1RSNA 5HGRA 5RNTA 5IF6A 1WMOA 2W03A 3LTBA 3CC73 3SLUA 4JF8A 1MWRA 1DVCA 3MG3A 3FH1A 4QWTA 1E3RA 1MGWA 4FMCA 4NHFA 4RNYA 1NB3I 4WYKB 2QIYA 1EKMA 3JUQA 1DYUA 1O7PB 2FXTA 3G16A 2Z7AA 4FMAA 3CNXA 3LYGA 4O2HA 1AV4A 5IEPA 5LC6A 4EBGA 1MNLA 1N8R4 1RTUA 2W9QA 2UX0A 4BIRA 1QVG2 4BL2A 3NM2A 3J7Yd 1TFOA 2L4VA 4N6LA 1TTOA 3S5CA 1IV9A 2BU4A 3NV0B 1BSAA 4WP5A 3EC9A 2FNQA 1AVLA 3DGYA 5IG5A 1IYYA 2RFRA 3MPHA 1JB4A 4HZ9B 3STDA 3WR2A 1BNRA 2BMRB 3AGNA 1FUSA 3OX9A 1D6ZA 1D6YA 3GZYB 3EQQB 3GZBA 1GY7A 3CC43 3RDEA 5AIFA 3LT9A 1I2GA 3KZTA 3MWZA 1BRKA 5IEOA 3F8XA 1S723 2XFSA 2ZDJA 2BHMA 3KCHA 4Q53A 2K0MA 4GL6A 5STDA 1PU4A 3CCQ3 1BVIA 1Q864 3BNBA 1YJ93 1BOXA 1TFKA 3BIRA 3CPOA 1V74A 3JUMA 3LXUX 3T0UA 3SX1A 3MHEA 3WOFB 4EV5A 3BNCA 5BVBA 4JRFA 3B4OA 1RGLA 3MG2A 2CX0A 1X1XA 3F7XA 4O8SA 1BIRA 3SYUA 2KRTA 1QVF2 2F4YA 2P38A 1SQWA 5CK6A 5AEWB 1NU3A 3FLJA 3DGOA 1RMSA 2CWUA 2GSPA 3D4AA 3DGLA 3T8UA 3OV4A 2F99A 1A2PA 3NX0A 4PEJA 1O7NB 1UCKA 4U13A 3IMAB 4FR9A 3NQYA 1T2IA 1TP6A 1LOYA 3UL5A 1LXEA 1I2EA 4HVNA 1L5GB 3AGOA 1WTHA 2Z6BA 1UI7A 4BU4A 1OGZA 3FSDA 1GD3A 3KKGA 1E97A 2W56B 3PZWA 4HYZA 3LTDA 3JVCA 2HMJB 3F7SA 3CME3 1W02A 1RKYA 4R9LA 1RN1A 2GXFA 2W9PA 4N6UA 3NV0A 1B2UA 2O3OA 1YIT3 1MWSA 2CK3H 2LYXA 2Q07A 4KFDA 5I97A 1OCVA 4RBNA 3HOHA 2HMLB 3LH4A 2KCDA 1RGGA 3GZRA 4X2OA 3L0RA 1VQP3 5M18A 2P09A 1YJN3 1RGFA 3CCV3 3NBJA 1HU9A 1Q9EA 3NUVA 3PCRA 4MMXB 5FGOA 2PZVA 5IG4A 1V58A 4EXRA 3Q2PA 3KE7A 1Y4KA 2XGLA 1UGIA 4DKIA 1JN5B 2AAEA 3IJEB 5ELUA 4N6NB 1B2XA 1LRAA 4HJLB 1BSBA 1JZDA 4O3VA 1TRPA 5LC7A 2ZHXB 3ALAA 1BAOA 1CEWI 3NBBA 4HM0B 2BMOB 1DMMA 3EHCA 1LNIA 1YJW3 2C4BA 1Z1SA 1JRQA 3HIGA 1AY7A 5DRVA 3FZWA 3CCL3 1IDPA 3BU4A 4EV2A 3CXC2 1RRLA 2K54A 2CKFB 1SIHA 3EN1B 1LOXA 3DH2A 5KP4A 1UGHI 5M1AA 3B8LA 4HM6B 2QGUA 3FG4A 1A2VA 4HBRA 3RNTA 1LOWA 4R1KA 5GSPA 1IQXA 2GBXB 4LEHA 1R4YA 1BSCA 3UJMA 1IVWA 4R4KA 4HM3B 4XDVA 1BU4A 4HM1B 1IT7A 3F8HA 1FUTA 2STDA 2K3DA 1E3VA 1M1K4 2KF3A 3AMOB 4WWUC 3WDGB 5JPUA 3OW22 3NHXA 2XRXB 4H61A 3EN8A 4FCJA 2LQVA 3K0ZA 4BTXA 3NBRA 2BNGA 2CX1A 1KWIA 1BRSA 1U5OA 1N5HA 3URPA 2P0XA 2FGTA 4HKVB 1ULJB 1I0VA 1GMQA 2GEXA 3HZPA 4H3UA 4ORLA 3ZG5A 3ROBA 3FG3A 3IPTA 4N6V0 5IG3A 1IVXA 5IENA 3OWSA 3Q1CA 4OK0A 1JN5A 2CHCA 4N3VA 5AYSC 3CCM3 1DE3A 3OXAA 4X2HA 3GWRA 1O7GB 4J9AA 5G2GA 4TX4A 4AKYA 1K734 3CU3A 3PCSA 3D5GA 1GMRA 2ML5A 1GY5A 1C54A 3HX8A 1UUWB 2Y74A 4EC6A 1YVSA 3K9MC 3DY5A 3V99A 3WMDA 2P0MA 3BNEA 1RN7A 2KF4A 1SJWA 1OPYA 2D42A 4R9KA 2CFDA 5TGNA 3WA3A 1IV7A 1JB5A 3X3YA 5BIRA 1OF5B 4EW5A 3G8ZA 1GYBA 3MKIA 1O7HB 1YVBI 3FG1A 5IERA 3CCS3 4HM4B 1Q7Y4 1BRGA 1AR0A 1BSDA 1FGRA 1OHPA 1ULIB 4LGQA 1G0TA 1VZZA 5BU4A 6RNTA 3JUPA 4GB5A 4KFEA 2XFTA 1YGWA 2Y73A 2WGOA 1MWUA 4CPKA 8CHOA 3H3HA 4AKZA 1D6UA 1G02A 1M1XB 3AMOA 1GSPA 5BXQA 1A67A 4KFFA 2HMMB 1PFPA 1AVKA 3UL6A 1IK3A 1BRHA 1GMPA 3NXJA 4HM7B 4ILFA 1HKXA 3D79A 1EA2A 3EJVA 3HI7A 3EX9A 4HM5B 4LZIA 3I563 3N9HA 1IVVA 3CCE3 4WYKA 1KC84 1VQ53 4G1MB 2GBWB 3FF2A 4N6OB 3ECFA 1W00A 2P05A 2GU1A 2SBLA 1CQSA 1BNEA 1W01A 4HOHA 2CG1A 4BTYA 1OHSA 1PY3A 1X1WA 2BMQB 4WHAA 3S28A 3F14A 1QMAA 2R41A 2H0HA 1WNHA 1WQLB 3CMA3 5D82A 1MOLA 5FW5A 3PXMA 2CFKA 5CF1A 2WO0A 1DMNA 1RGEA 1UCJA 2E2VA 2V1LA 4FCZA 5CXOA 3HK4A 1BANA 3NM7A 3G713 2I9WA 2CFWA 4EYCA 3KIIA 4XDWA 3OWUA 2O9UX 2IUJA 1OF5A 3UB1A 1KSIA 1N8QA 4KT3B 4CJNA 5A0OB 3DGMA 2L1SA 2ZA4A 3MYTA 2OCTA 3FCSB 4L7KA 1RNTA 4MJDA 3S67A 1UCIA 7RNTA 1T5YA 4XB5A 5IG0A 1ZX2A 4LMIA 3X3ZA 3ER7A 1N5PA 2ZL8A 3FGYA 6STDA 3KFQC 1JBSA 2W0QA 1NO3A 3WODG 2KF6A 1A2KA 1K8A4 3DM8A 1ZS7A 1GOVA 1JB2A 2HMNB 1BNIA 1VQQA 1EUIC 1BRIA 2HOHA 7STDA 3I553 2OOVA 2J8XB 2H0IA 2KXGA 1N9JA 2RGQA 1QJGA 4FCMA 3V98A 1K9M4 3LMLA 3UNLA 2MC8A 1MGRA 1CH0A 1W2ZA 2HMKB 2F5WA 4K61A 1NDOB 2B24B 1W4NA 3K7CA 5ELJA 2RNTA 1FUWA 2SARA 4KVHA 1W5ZA 2GU3A 2IMJA 2W56A 3LTAA 3OWYA 1GOUA 2CH9A 5D81A 3DGNA 1EQKA 4BTWA 1I3FA 3B4PA 2RCDA 4KZ1A 2KF5A 4LSOA 4GHOA 2XSOB 3EB8A 3M8CA 1IVUA 3QRDA 3QK9A 3CCR3 1M904 1DMQA 1RGKA 1Q7HA 2YFIB 1OHOA 1Q40B 1BNGA 1K28A 2CC3A 2E2TA 2RBIA 3GZXB 4RNTA 3B7CA 3NQZA 3CCU3 3S29A 1VQO3 1ASKA 4I5QA 2XH9A 3JUNA 4ZM8A 1T3BA 2UGIA 3N8BA 2W04A 4AEQA 7GSPA 1B21A 1JBRA 5D83A 5AEUB 3U1WA 2F56A 4HM2B 5AI1A 1Q824 2OQEA 3SVAA 1I70A 3MG1A 3X3XA 2ML6A 5EEOA 1RDSA 2UUGC 1YIJ3 1FGOA 1NNVA 3ZG0A 5AYRB 1RLSA 3LTCA 2XR8B 3Q3FA 4RNZA 1FGMA 3MSOA 4XBXA 1IT8A 1ZO2A 1TIJA 3VGNA 3VF1A 1EG9B 3FF0A 1A90A 1BRJA 5HOHA 1SPUA 5JBSA 1Q814 3SOAA 2RSXA 3VSYA 1RJOA 4J5KA 1G96A 1CYVA 5EQLA 2OWPA 4XBYA 1OUNA 3I0YA 3U97A 1RHLA 2CWTA 2YFJB 3KSED 1OGXA 1UI8A 5G1KA 4N6TA 1WMNA 3EBTA 1UUVB 5AIIA 1VQN3 2CG0A 1JV2B 1BSEA 1RGHA 1STDA 1TU5A 4MEIA 1QALA 2M7OA 1YHQ3 3A76A 1VQ93 1VQ83 3A5EA 1O7WB 1RRHA 1BNFA 2C11A 4CCVA 1W2B2 2AADA 1YI23 1Q40A 1LQGC 3H51A 3SOYA 4XBTA 3G0KA 4HAAA 1O7MB 4I4KA 1YGEA 4R80A 1CYUA 1SIIA 3DUKA 3JUOA 3RGRA 1LOVA 9RNTA 1VQ43 1HZ1A 1OH0A 3D9RA 4J5GA 1SARA 2BT3A 3O8YA 1BNJA 3DZLA 2HMOB 2W6JH 1C7HA 1F8NA 1UDII 1W6YA 3EF8A 4OVMA 1VQK3 2CWVA 1B3SA 2GEYA 2BO9B 3EE1A 4STDA 1KD14 1J2BA 2F98A 4LYLB 4OUQA 1ROVA 3BNDA 3CC23 3PGBA 1BUQA 3X40A 4NPBA 1MWTA 1S5AA 2IA7A 4HZBB 2D1WA 2E2UA 1RGCA 2F86B 1EEJA 3PYJA 1RNBA 2H0GA 3DXOA 2A15A 1B27A 3PS8A 1B20A 1AQZA 3WHOA 1B2MA 5KP3A 3WA2X 1UW1A 2W2CA 1LVNA 3TDGA 1KQS2 1GY6A 4K90B 2IUKA 3F9SA 3G6E3 1JKGB 2CFLA 1NJI4 3F40A 1I2FA 4IPBA 4RZMA 3CCJ3 2BIRA 3K5TA 1QAKA 1US1A 1QAFA 1W7CA 4MMYB 1T2HA 1RCLA 1I8VA 4BL3A 2OTL3 2KAAA 5G1LA 2C10A 1IQ8A 1PYLA 1BGSA 2OOVC 3WOEB 2PNCA 1W6GA 5M19A 4CDLA 1V57A 1BUJA 1IU7A 2XEPA 2Z77A 3GAXA 1R4CA 4K1UA 1VQL3 1LNHA 1RGAA 1ROAA 1FGTA 5IW9A 2CIUA 1U8CB 1BRNL 1X1YA 3AHSA 3EBYA 4NREA 2WOHA 4WFOA
chains in the Genus database with same CATH topology
1K41A 3X42A 3Q90A 1GD4A 4FMDA 3SEDA 1TUHA 3LT8A 1VQ73 2WGQA 2XSHB 4HM8B 4IT7A 3N54B 3CPW2 3K63A 1NB5I 1DVDA 2XGNA 3T8NA 1VQ63 1JNQA 1GS3A 2R4IA 2Z76A 3S27A 1NWWA 5EVHA 1EQKA 2B1XB 4MMZB 5DREA 3CNMA 5KP1A 2YX9A 2OTJ3 1FGQA 2QA43 4XM4A 1W6CA 1M9GA 3GRDA 3LOYA 4K1VA 2JQ5A 3KN4A 1FA3A 3BB9A 3DMCA 1STFI 4FMBA 2MF7A 1ISKA 4L8PA 2WOFA 2XF3A 1N9EA 1VQM3 1IQYA 3LZAA 4IIAA 4N6MA 2QEX3 2CW9A 3X41A 5AIHA 3V92A 3G4S3 2YFLB 1JKGA 2INXA 4O02B 2OQEC 3BLZA 3D3LA 3E99A 3FKAA 1WMPA 5AIGA 3RGAA 3CD63 3SXXA 5CLKA 3HIIA 1JJ22 5CF2A 3KSPA 5JPPA 2JDIH 4J8TA 4L8OA 2CFGA 1OACA 1Q42A 5HGRA 3CC73 5IF6A 1WMOA 2W03A 3LTBA 3SLUA 4JF8A 1DVCA 3MG3A 3FH1A 4QWTA 1E3RA 4FMCA 4NHFA 4RNYA 1NB3I 4WYKB 2QIYA 1EKMA 3JUQA 1DYUA 1O7PB 2FXTA 3G16A 2Z7AA 4FMAA 3CNXA 3LYGA 4O2HA 1AV4A 5IEPA 5LC6A 4EBGA 1MNLA 1N8R4 2W9QA 2UX0A 1QVG2 3NM2A 3J7Yd 1TFOA 2L4VA 4N6LA 3S5CA 1IV9A 3NV0B 4WP5A 3EC9A 2FNQA 1AVLA 5IG5A 2RFRA 3MPHA 1JB4A 4HZ9B 3STDA 2BMRB 3OX9A 1D6ZA 1D6YA 3GZYB 3EQQB 3GZBA 1GY7A 3CC43 3RDEA 5AIFA 3LT9A 3KZTA 3MWZA 5IEOA 3F8XA 1S723 2XFSA 2ZDJA 2BHMA 4Q53A 2K0MA 4GL6A 5STDA 1PU4A 3CCQ3 1Q864 3BNBA 1YJ93 1TFKA 3CPOA 1V74A 3JUMA 3LXUX 3T0UA 3SX1A 3MHEA 3WOFB 4EV5A 3BNCA 5BVBA 4JRFA 3B4OA 3MG2A 3F7XA 4O8SA 1QVF2 2KRTA 2P38A 1SQWA 5CK6A 5AEWB 1NU3A 3FLJA 3DGOA 2CWUA 3DGLA 3T8UA 3OV4A 2F99A 3NX0A 4PEJA 1O7NB 4U13A 3IMAB 4FR9A 3NQYA 1TP6A 3UL5A 1LXEA 4HVNA 1L5GB 1WTHA 2Z6BA 1UI7A 1OGZA 3FSDA 1GD3A 3KKGA 1E97A 2W56B 3PZWA 4HYZA 3LTDA 3JVCA 2HMJB 3F7SA 3CME3 1W02A 1RKYA 4R9LA 2GXFA 2W9PA 4N6UA 3NV0A 2O3OA 1YIT3 2CK3H 2LYXA 2Q07A 4KFDA 5I97A 1OCVA 4RBNA 2HMLB 3LH4A 2KCDA 4X2OA 3GZRA 3L0RA 1VQP3 2P09A 1YJN3 3CCV3 3NBJA 1HU9A 3NUVA 3PCRA 4MMXB 5FGOA 2PZVA 5IG4A 4EXRA 3Q2PA 3KE7A 1Y4KA 2XGLA 1JN5B 3IJEB 5ELUA 4N6NB 4HJLB 4O3VA 5LC7A 3ALAA 1CEWI 4HM0B 3NBBA 2BMOB 1DMMA 3EHCA 1YJW3 1Z1SA 1JRQA 3HIGA 5DRVA 3FZWA 3CCL3 1IDPA 4EV2A 3CXC2 1RRLA 2K54A 2CKFB 1SIHA 3EN1B 1LOXA 5KP4A 3B8LA 4HM6B 2QGUA 3FG4A 1A2VA 4HBRA 4R1KA 1IQXA 2GBXB 4LEHA 3UJMA 1IVWA 4R4KA 4HM3B 4XDVA 4HM1B 1IT7A 3F8HA 2STDA 1E3VA 1M1K4 3AMOB 4WWUC 3WDGB 5JPUA 3OW22 3NHXA 2XRXB 4H61A 3EN8A 4FCJA 2LQVA 3K0ZA 4BTXA 3NBRA 2BNGA 1KWIA 1U5OA 1N5HA 2P0XA 2FGTA 4HKVB 1ULJB 2GEXA 3HZPA 4H3UA 4ORLA 3ROBA 3FG3A 3IPTA 4N6V0 5IG3A 1IVXA 5IENA 3OWSA 3Q1CA 4OK0A 1JN5A 2CHCA 4N3VA 5AYSC 3CCM3 3OXAA 4X2HA 3GWRA 1O7GB 4J9AA 5G2GA 4TX4A 4AKYA 1K734 3CU3A 3PCSA 2ML5A 1GY5A 3HX8A 1UUWB 2Y74A 4EC6A 3K9MC 3DY5A 3V99A 3WMDA 2P0MA 3BNEA 1RN7A 1SJWA 2D42A 1OPYA 4R9KA 2CFDA 5TGNA 3WA3A 1IV7A 1JB5A 3X3YA 1OF5B 5IERA 3G8ZA 1GYBA 3MKIA 1O7HB 1YVBI 3FG1A 3CCS3 1Q7Y4 4HM4B 1AR0A 1FGRA 1OHPA 1ULIB 4LGQA 1VZZA 3JUPA 4GB5A 4KFEA 2XFTA 2Y73A 2WGOA 8CHOA 3H3HA 4AKZA 1D6UA 1M1XB 3AMOA 5BXQA 1A67A 4KFFA 2HMMB 1PFPA 1AVKA 3UL6A 1IK3A 3NXJA 4HM7B 3CCR3 1HKXA 4HM5B 1EA2A 3EJVA 3HI7A 3EX9A 4LZIA 3I563 3CCE3 3N9HA 1IVVA 1KC84 4WYKA 1VQ53 4G1MB 2GBWB 3FF2A 4N6OB 3ECFA 1W00A 2P05A 2GU1A 2SBLA 1CQSA 1W01A 2CG1A 4BTYA 1OHSA 4WHAA 3S28A 2BMQB 3F14A 1QMAA 1WNHA 1WQLB 3CMA3 5D82A 1MOLA 5FW5A 3PXMA 2CFKA 5CF1A 2WO0A 1DMNA 2E2VA 2V1LA 4FCZA 5CXOA 3HK4A 3NM7A 3G713 2I9WA 2CFWA 4EYCA 3KIIA 4XDWA 3OWUA 2O9UX 2IUJA 1OF5A 3UB1A 1KSIA 1N8QA 5A0OB 3DGMA 3MYTA 2OCTA 3FCSB 4L7KA 3S67A 4MJDA 1T5YA 4XB5A 5IG0A 1ZX2A 4LMIA 3X3ZA 3ER7A 1N5PA 2ZL8A 3FGYA 6STDA 3KFQC 2W0QA 1NO3A 3WODG 1A2KA 1K8A4 3DM8A 2HMNB 1JB2A 7STDA 3I553 2OOVA 2KXGA 1N9JA 2RGQA 1QJGA 4FCMA 3V98A 1K9M4 3LMLA 3UNLA 2MC8A 1W2ZA 4K61A 2HMKB 1NDOB 2B24B 1W4NA 3K7CA 5ELJA 1FUWA 4KVHA 1W5ZA 2GU3A 2IMJA 2W56A 3LTAA 3OWYA 2CH9A 5D81A 3DGNA 4BTWA 3B4PA 2RCDA 4KZ1A 4LSOA 2XSOB 3EB8A 3M8CA 1IVUA 3QRDA 3QK9A 1M904 1DMQA 2YFIB 1OHOA 1Q40B 2CC3A 1K28A 2E2TA 3GZXB 3B7CA 3NQZA 3CCU3 3S29A 1VQO3 1ASKA 2XH9A 3JUNA 4ZM8A 3N8BA 2W04A 4AEQA 5D83A 5AEUB 3U1WA 4HM2B 5AI1A 1Q824 2OQEA 3SVAA 3MG1A 3X3XA 2ML6A 5EEOA 1YIJ3 1FGOA 5AYRB 3LTCA 2XR8B 4RNZA 1FGMA 3MSOA 4XBXA 1IT8A 1ZO2A 1TIJA 3VGNA 3VF1A 1EG9B 3FF0A 1A90A 1SPUA 5JBSA 1Q814 3SOAA 2RSXA 3VSYA 1RJOA 1G96A 1CYVA 5EQLA 2OWPA 4XBYA 1OUNA 3I0YA 3U97A 2CWTA 2YFJB 3KSED 1OGXA 1UI8A 4N6TA 1WMNA 3EBTA 1UUVB 5AIIA 1VQN3 2CG0A 1JV2B 1STDA 1TU5A 4MEIA 1QALA 2M7OA 1YHQ3 3A76A 1VQ93 1VQ83 1O7WB 1RRHA 2C11A 4CCVA 1W2B2 1YI23 1Q40A 3H51A 3SOYA 4XBTA 3G0KA 1O7MB 4I4KA 1YGEA 4R80A 1CYUA 1SIIA 3DUKA 3JUOA 3RGRA 1VQ43 1OH0A 3D9RA 2BT3A 3O8YA 3DZLA 2HMOB 2W6JH 1C7HA 1F8NA 1W6YA 3EF8A 1VQK3 4OVMA 2CWVA 2GEYA 3EE1A 2BO9B 1J2BA 4STDA 1KD14 2F98A 4OUQA 1ROVA 3BNDA 3CC23 3PGBA 1BUQA 3X40A 1S5AA 2IA7A 4HZBB 2D1WA 2E2UA 2F86B 3PYJA 3DXOA 2A15A 3PS8A 5KP3A 3WA2X 1UW1A 2W2CA 1LVNA 3TDGA 1KQS2 1GY6A 4K90B 2IUKA 3F9SA 3G6E3 1JKGB 2CFLA 1NJI4 3F40A 4IPBA 4RZMA 3CCJ3 3K5TA 1QAKA 1US1A 1QAFA 1W7CA 4MMYB 2OTL3 2C10A 1IQ8A 2OOVC 3WOEB 2PNCA 1W6GA 4CDLA 1IU7A 2Z77A 2XEPA 3GAXA 1R4CA 4K1UA 1VQL3 1LNHA 1ROAA 1FGTA 5IW9A 2CIUA 1U8CB 3EBYA 4NREA 2WOHA 4WFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K41 A;  3Q90 A;  3SED A;  1TUH A;  2XSH B;  4HM8 B;  3T8N A;  2R4I A;  1GS3 A;  2Z76 A;  1NWW A;  5EVH A;  2B1X B;  5DRE A;  3CNM A;  5KP1 A;  4XM4 A;  3GRD A;  4K1V A;  2JQ5 A;  3BB9 A;  3DMC A;  1ISK A;  4L8P A;  4IIA A;  3LZA A;  5AIH A;  2YFL B;  1JKG A;  2INX A;  3BLZ A;  3E99 A;  3FKA A;  3RGA A;  5AIG A;  5CLK A;  5CF2 A;  3KSP A;  5JPP A;  4J8T A;  4L8O A;  1Q42 A;  5HGR A;  5IF6 A;  3MG3 A;  3FH1 A;  1E3R A;  4WYK B;  2QIY A;  3JUQ A;  1O7P B;  3G16 A;  2Z7A A;  3CNX A;  3LYG A;  5IEP A;  2UX0 A;  3NM2 A;  3S5C A;  3NV0 B;  4WP5 A;  3EC9 A;  5IG5 A;  2RFR A;  4HZ9 B;  1JB4 A;  3STD A;  2BMR B;  3OX9 A;  3GZY B;  3EQQ B;  3GZB A;  1GY7 A;  5AIF A;  3KZT A;  5IEO A;  3F8X A;  4Q53 A;  5STD A;  3CPO A;  3JUM A;  3MHE A;  5BVB A;  3B4O A;  3MG2 A;  3F7X A;  5CK6 A;  5AEW B;  1NU3 A;  3FLJ A;  3T8U A;  3OV4 A;  2F99 A;  4PEJ A;  1O7N B;  4U13 A;  1TP6 A;  4HVN A;  1OGZ A;  3FSD A;  3KKG A;  1E97 A;  2HMJ B;  3F7S A;  1W02 A;  4R9L A;  2GXF A;  3NV0 A;  1OCV A;  2HML B;  4X2O A;  3GZR A;  3NUV A;  2PZV A;  5IG4 A;  3KE7 A;  1JN5 B;  4HJL B;  4HM0 B;  2BMO B;  1DMM A;  3EHC A;  1Z1S A;  5DRV A;  3FZW A;  1IDP A;  2K54 A;  2CKF B;  3EN1 B;  5KP4 A;  3B8L A;  4HM6 B;  2QGU A;  4R1K A;  2GBX B;  4LEH A;  3UJM A;  4HM3 B;  4XDV A;  4HM1 B;  3F8H A;  2STD A;  1E3V A;  4WWU C;  5JPU A;  3NHX A;  2XRX B;  3EN8 A;  4FCJ A;  3K0Z A;  3NBR A;  2BNG A;  1U5O A;  4HKV B;  1ULJ B;  2GEX A;  3HZP A;  4H3U A;  4ORL A;  3ROB A;  3IPT A;  5IG3 A;  5IEN A;  3OWS A;  1JN5 A;  2CHC A;  4N3V A;  3OXA A;  4X2H A;  3GWR A;  1O7G B;  4J9A A;  5G2G A;  3CU3 A;  1GY5 A;  3HX8 A;  1UUW B;  3WMD A;  1SJW A;  1OPY A;  4R9K A;  5TGN A;  1JB5 A;  1OF5 B;  5IER A;  3G8Z A;  1GYB A;  3MKI A;  1O7H B;  4HM4 B;  1AR0 A;  1ULI B;  1OHP A;  4LGQ A;  1VZZ A;  3JUP A;  4GB5 A;  8CHO A;  3H3H A;  5BXQ A;  2HMM B;  3NXJ A;  4HM7 B;  1HKX A;  4HM5 B;  1EA2 A;  3EJV A;  3EX9 A;  4WYK A;  2GBW B;  3FF2 A;  3ECF A;  1W00 A;  1CQS A;  1W01 A;  1OHS A;  2BMQ B;  3F14 A;  1QMA A;  1WQL B;  5D82 A;  5FW5 A;  5CF1 A;  1DMN A;  5CXO A;  3HK4 A;  2I9W A;  4XDW A;  3OWU A;  1OF5 A;  3MYT A;  4L7K A;  4MJD A;  4XB5 A;  5IG0 A;  1ZX2 A;  4LMI A;  3ER7 A;  3FGY A;  6STD A;  1A2K A;  3DM8 A;  2HMN B;  1JB2 A;  7STD A;  2RGQ A;  1QJG A;  4FCM A;  3UNL A;  2HMK B;  1NDO B;  2B24 B;  3K7C A;  4KVH A;  2IMJ A;  3OWY A;  5D81 A;  3B4P A;  2RCD A;  2XSO B;  3M8C A;  1DMQ A;  2YFI B;  1OHO A;  1Q40 B;  3GZX B;  3B7C A;  1ASK A;  3JUN A;  5D83 A;  5AEU B;  4HM2 B;  5AI1 A;  3MG1 A;  2XR8 B;  3MSO A;  4XBX A;  1ZO2 A;  3VGN A;  1EG9 B;  3FF0 A;  3SOA A;  3VSY A;  2OWP A;  4XBY A;  1OUN A;  3I0Y A;  2YFJ B;  1OGX A;  3EBT A;  1UUV B;  5AII A;  1STD A;  3A76 A;  1O7W B;  1Q40 A;  3H51 A;  3SOY A;  4XBT A;  3G0K A;  1O7M B;  4I4K A;  3DUK A;  3JUO A;  3RGR A;  1OH0 A;  3D9R A;  3DZL A;  2HMO B;  1C7H A;  1W6Y A;  3EF8 A;  4OVM A;  2GEY A;  4STD A;  2F98 A;  4OUQ A;  1BUQ A;  1S5A A;  4HZB B;  2F86 B;  3DXO A;  2A15 A;  5KP3 A;  2W2C A;  1GY6 A;  3F9S A;  1JKG B;  3F40 A;  4RZM A;  4CDL A;  2Z77 A;  4K1U A;  3EBY A; 
#chains in the Genus database with same CATH topology
 1K41 A;  3X42 A;  3Q90 A;  1GD4 A;  4FMD A;  3SED A;  1TUH A;  3LT8 A;  1YNV X;  1VQ7 3;  2WGQ A;  2XSH B;  4HM8 B;  4IT7 A;  3N54 B;  3CPW 2;  3K63 A;  1GOY A;  1NB5 I;  1UUG B;  1DVD A;  2XGN A;  3T8N A;  1VQ6 3;  1JNQ A;  1GS3 A;  1X1U A;  2R4I A;  3ZFZ A;  1RN4 A;  2Z76 A;  3S27 A;  1B2Z A;  1NWW A;  5EVH A;  1FW7 A;  1ZGX A;  1FZU A;  2IYJ A;  1RCK A;  2B1X B;  4MMZ B;  5DRE A;  3CNM A;  6GSP A;  5KP1 A;  1I0X A;  2YX9 A;  2OTJ 3;  1DET A;  1FGQ A;  2QA4 3;  1JBT A;  4XM4 A;  1W6C A;  1M9G A;  2F5M A;  3GRD A;  1LQM B;  2JQ5 A;  3KN4 A;  3LOY A;  3BB9 A;  4K1V A;  3DMC A;  8RNT A;  1STF I;  1FA3 A;  4FMB A;  2MF7 A;  1ISK A;  4L8P A;  1JZO A;  2IY2 A;  3AHW A;  2WOF A;  4GSP A;  2XF3 A;  1N9E A;  1VQM 3;  1IQY A;  3LZA A;  4IIA A;  4N6M A;  2QEX 3;  1B2S A;  2CW9 A;  3X41 A;  5AIH A;  1FYS A;  3V92 A;  3G4S 3;  2YFL B;  1JKG A;  2INX A;  4O02 B;  2OQE C;  3BLZ A;  3D5I A;  3D3L A;  3GSP A;  3E99 A;  3FKA A;  1WMP A;  5AIG A;  1BNS A;  3RGA A;  3CD6 3;  3SXX A;  1HYF A;  5CLK A;  1TRQ A;  1UCL A;  3HII A;  1JJ2 2;  5CF2 A;  3KSP A;  5JPP A;  2JDI H;  4J8T A;  1TJD A;  4L8O A;  2CFG A;  1I3I A;  1OAC A;  1Q42 A;  1RSN A;  5HGR A;  5RNT A;  5IF6 A;  1WMO A;  2W03 A;  3LTB A;  3CC7 3;  3SLU A;  4JF8 A;  1MWR A;  1DVC A;  3MG3 A;  3FH1 A;  4QWT A;  1E3R A;  1MGW A;  4FMC A;  4NHF A;  4RNY A;  1NB3 I;  4WYK B;  2QIY A;  1EKM A;  3JUQ A;  1DYU A;  1O7P B;  2FXT A;  3G16 A;  2Z7A A;  4FMA A;  3CNX A;  3LYG A;  4O2H A;  1AV4 A;  5IEP A;  5LC6 A;  4EBG A;  1MNL A;  1N8R 4;  1RTU A;  2W9Q A;  2UX0 A;  4BIR A;  1QVG 2;  4BL2 A;  3NM2 A;  3J7Y d;  1TFO A;  2L4V A;  4N6L A;  1TTO A;  3S5C A;  1IV9 A;  2BU4 A;  3NV0 B;  1BSA A;  4WP5 A;  3EC9 A;  2FNQ A;  1AVL A;  3DGY A;  5IG5 A;  1IYY A;  2RFR A;  3MPH A;  1JB4 A;  4HZ9 B;  3STD A;  3WR2 A;  1BNR A;  2BMR B;  3AGN A;  1FUS A;  3OX9 A;  1D6Z A;  1D6Y A;  3GZY B;  3EQQ B;  3GZB A;  1GY7 A;  3CC4 3;  3RDE A;  5AIF A;  3LT9 A;  1I2G A;  3KZT A;  3MWZ A;  1BRK A;  5IEO A;  3F8X A;  1S72 3;  2XFS A;  2ZDJ A;  2BHM A;  3KCH A;  4Q53 A;  2K0M A;  4GL6 A;  5STD A;  1PU4 A;  3CCQ 3;  1BVI A;  1Q86 4;  3BNB A;  1YJ9 3;  1BOX A;  1TFK A;  3BIR A;  3CPO A;  1V74 A;  3JUM A;  3LXU X;  3T0U A;  3SX1 A;  3MHE A;  3WOF B;  4EV5 A;  3BNC A;  5BVB A;  4JRF A;  3B4O A;  1RGL A;  3MG2 A;  2CX0 A;  1X1X A;  3F7X A;  4O8S A;  1BIR A;  3SYU A;  2KRT A;  1QVF 2;  2F4Y A;  2P38 A;  1SQW A;  5CK6 A;  5AEW B;  1NU3 A;  3FLJ A;  3DGO A;  1RMS A;  2CWU A;  2GSP A;  3D4A A;  3DGL A;  3T8U A;  3OV4 A;  2F99 A;  1A2P A;  3NX0 A;  4PEJ A;  1O7N B;  1UCK A;  4U13 A;  3IMA B;  4FR9 A;  3NQY A;  1T2I A;  1TP6 A;  1LOY A;  3UL5 A;  1LXE A;  1I2E A;  4HVN A;  1L5G B;  3AGO A;  1WTH A;  2Z6B A;  1UI7 A;  4BU4 A;  1OGZ A;  3FSD A;  1GD3 A;  3KKG A;  1E97 A;  2W56 B;  3PZW A;  4HYZ A;  3LTD A;  3JVC A;  2HMJ B;  3F7S A;  3CME 3;  1W02 A;  1RKY A;  4R9L A;  1RN1 A;  2GXF A;  2W9P A;  4N6U A;  3NV0 A;  1B2U A;  2O3O A;  1YIT 3;  1MWS A;  2CK3 H;  2LYX A;  2Q07 A;  4KFD A;  5I97 A;  1OCV A;  4RBN A;  3HOH A;  2HML B;  3LH4 A;  2KCD A;  1RGG A;  3GZR A;  4X2O A;  3L0R A;  1VQP 3;  5M18 A;  2P09 A;  1YJN 3;  1RGF A;  3CCV 3;  3NBJ A;  1HU9 A;  1Q9E A;  3NUV A;  3PCR A;  4MMX B;  5FGO A;  2PZV A;  5IG4 A;  1V58 A;  4EXR A;  3Q2P A;  3KE7 A;  1Y4K A;  2XGL A;  1UGI A;  4DKI A;  1JN5 B;  2AAE A;  3IJE B;  5ELU A;  4N6N B;  1B2X A;  1LRA A;  4HJL B;  1BSB A;  1JZD A;  4O3V A;  1TRP A;  5LC7 A;  2ZHX B;  3ALA A;  1BAO A;  1CEW I;  3NBB A;  4HM0 B;  2BMO B;  1DMM A;  3EHC A;  1LNI A;  1YJW 3;  2C4B A;  1Z1S A;  1JRQ A;  3HIG A;  1AY7 A;  5DRV A;  3FZW A;  3CCL 3;  1IDP A;  3BU4 A;  4EV2 A;  3CXC 2;  1RRL A;  2K54 A;  2CKF B;  1SIH A;  3EN1 B;  1LOX A;  3DH2 A;  5KP4 A;  1UGH I;  5M1A A;  3B8L A;  4HM6 B;  2QGU A;  3FG4 A;  1A2V A;  4HBR A;  3RNT A;  1LOW A;  4R1K A;  5GSP A;  1IQX A;  2GBX B;  4LEH A;  1R4Y A;  1BSC A;  3UJM A;  1IVW A;  4R4K A;  4HM3 B;  4XDV A;  1BU4 A;  4HM1 B;  1IT7 A;  3F8H A;  1FUT A;  2STD A;  2K3D A;  1E3V A;  1M1K 4;  2KF3 A;  3AMO B;  4WWU C;  3WDG B;  5JPU A;  3OW2 2;  3NHX A;  2XRX B;  4H61 A;  3EN8 A;  4FCJ A;  2LQV A;  3K0Z A;  4BTX A;  3NBR A;  2BNG A;  2CX1 A;  1KWI A;  1BRS A;  1U5O A;  1N5H A;  3URP A;  2P0X A;  2FGT A;  4HKV B;  1ULJ B;  1I0V A;  1GMQ A;  2GEX A;  3HZP A;  4H3U A;  4ORL A;  3ZG5 A;  3ROB A;  3FG3 A;  3IPT A;  4N6V 0;  5IG3 A;  1IVX A;  5IEN A;  3OWS A;  3Q1C A;  4OK0 A;  1JN5 A;  2CHC A;  4N3V A;  5AYS C;  3CCM 3;  1DE3 A;  3OXA A;  4X2H A;  3GWR A;  1O7G B;  4J9A A;  5G2G A;  4TX4 A;  4AKY A;  1K73 4;  3CU3 A;  3PCS A;  3D5G A;  1GMR A;  2ML5 A;  1GY5 A;  1C54 A;  3HX8 A;  1UUW B;  2Y74 A;  4EC6 A;  1YVS A;  3K9M C;  3DY5 A;  3V99 A;  3WMD A;  2P0M A;  3BNE A;  1RN7 A;  2KF4 A;  1SJW A;  1OPY A;  2D42 A;  4R9K A;  2CFD A;  5TGN A;  3WA3 A;  1IV7 A;  1JB5 A;  3X3Y A;  5BIR A;  1OF5 B;  4EW5 A;  3G8Z A;  1GYB A;  3MKI A;  1O7H B;  1YVB I;  3FG1 A;  5IER A;  3CCS 3;  4HM4 B;  1Q7Y 4;  1BRG A;  1AR0 A;  1BSD A;  1FGR A;  1OHP A;  1ULI B;  4LGQ A;  1G0T A;  1VZZ A;  5BU4 A;  6RNT A;  3JUP A;  4GB5 A;  4KFE A;  2XFT A;  1YGW A;  2Y73 A;  2WGO A;  1MWU A;  4CPK A;  8CHO A;  3H3H A;  4AKZ A;  1D6U A;  1G02 A;  1M1X B;  3AMO A;  1GSP A;  5BXQ A;  1A67 A;  4KFF A;  2HMM B;  1PFP A;  1AVK A;  3UL6 A;  1IK3 A;  1BRH A;  1GMP A;  3NXJ A;  4HM7 B;  4ILF A;  1HKX A;  3D79 A;  1EA2 A;  3EJV A;  3HI7 A;  3EX9 A;  4HM5 B;  4LZI A;  3I56 3;  3N9H A;  1IVV A;  3CCE 3;  4WYK A;  1KC8 4;  1VQ5 3;  4G1M B;  2GBW B;  3FF2 A;  4N6O B;  3ECF A;  1W00 A;  2P05 A;  2GU1 A;  2SBL A;  1CQS A;  1BNE A;  1W01 A;  4HOH A;  2CG1 A;  4BTY A;  1OHS A;  1PY3 A;  1X1W A;  2BMQ B;  4WHA A;  3S28 A;  3F14 A;  1QMA A;  2R41 A;  2H0H A;  1WNH A;  1WQL B;  3CMA 3;  5D82 A;  1MOL A;  5FW5 A;  3PXM A;  2CFK A;  5CF1 A;  2WO0 A;  1DMN A;  1RGE A;  1UCJ A;  2E2V A;  2V1L A;  4FCZ A;  5CXO A;  3HK4 A;  1BAN A;  3NM7 A;  3G71 3;  2I9W A;  2CFW A;  4EYC A;  3KII A;  4XDW A;  3OWU A;  2O9U X;  2IUJ A;  1OF5 A;  3UB1 A;  1KSI A;  1N8Q A;  4KT3 B;  4CJN A;  5A0O B;  3DGM A;  2L1S A;  2ZA4 A;  3MYT A;  2OCT A;  3FCS B;  4L7K A;  1RNT A;  4MJD A;  3S67 A;  1UCI A;  7RNT A;  1T5Y A;  4XB5 A;  5IG0 A;  1ZX2 A;  4LMI A;  3X3Z A;  3ER7 A;  1N5P A;  2ZL8 A;  3FGY A;  6STD A;  3KFQ C;  1JBS A;  2W0Q A;  1NO3 A;  3WOD G;  2KF6 A;  1A2K A;  1K8A 4;  3DM8 A;  1ZS7 A;  1GOV A;  1JB2 A;  2HMN B;  1BNI A;  1VQQ A;  1EUI C;  1BRI A;  2HOH A;  7STD A;  3I55 3;  2OOV A;  2J8X B;  2H0I A;  2KXG A;  1N9J A;  2RGQ A;  1QJG A;  4FCM A;  3V98 A;  1K9M 4;  3LML A;  3UNL A;  2MC8 A;  1MGR A;  1CH0 A;  1W2Z A;  2HMK B;  2F5W A;  4K61 A;  1NDO B;  2B24 B;  1W4N A;  3K7C A;  5ELJ A;  2RNT A;  1FUW A;  2SAR A;  4KVH A;  1W5Z A;  2GU3 A;  2IMJ A;  2W56 A;  3LTA A;  3OWY A;  1GOU A;  2CH9 A;  5D81 A;  3DGN A;  1EQK A;  4BTW A;  1I3F A;  3B4P A;  2RCD A;  4KZ1 A;  2KF5 A;  4LSO A;  4GHO A;  2XSO B;  3EB8 A;  3M8C A;  1IVU A;  3QRD A;  3QK9 A;  3CCR 3;  1M90 4;  1DMQ A;  1RGK A;  1Q7H A;  2YFI B;  1OHO A;  1Q40 B;  1BNG A;  1K28 A;  2CC3 A;  2E2T A;  2RBI A;  3GZX B;  4RNT A;  3B7C A;  3NQZ A;  3CCU 3;  3S29 A;  1VQO 3;  1ASK A;  4I5Q A;  2XH9 A;  3JUN A;  4ZM8 A;  1T3B A;  2UGI A;  3N8B A;  2W04 A;  4AEQ A;  7GSP A;  1B21 A;  1JBR A;  5D83 A;  5AEU B;  3U1W A;  2F56 A;  4HM2 B;  5AI1 A;  1Q82 4;  2OQE A;  3SVA A;  1I70 A;  3MG1 A;  3X3X A;  2ML6 A;  5EEO A;  1RDS A;  2UUG C;  1YIJ 3;  1FGO A;  1NNV A;  3ZG0 A;  5AYR B;  1RLS A;  3LTC A;  2XR8 B;  3Q3F A;  4RNZ A;  1FGM A;  3MSO A;  4XBX A;  1IT8 A;  1ZO2 A;  1TIJ A;  3VGN A;  3VF1 A;  1EG9 B;  3FF0 A;  1A90 A;  1BRJ A;  5HOH A;  1SPU A;  5JBS A;  1Q81 4;  3SOA A;  2RSX A;  3VSY A;  1RJO A;  4J5K A;  1G96 A;  1CYV A;  5EQL A;  2OWP A;  4XBY A;  1OUN A;  3I0Y A;  3U97 A;  1RHL A;  2CWT A;  2YFJ B;  3KSE D;  1OGX A;  1UI8 A;  5G1K A;  4N6T A;  1WMN A;  3EBT A;  1UUV B;  5AII A;  1VQN 3;  2CG0 A;  1JV2 B;  1BSE A;  1RGH A;  1STD A;  1TU5 A;  4MEI A;  1QAL A;  2M7O A;  1YHQ 3;  3A76 A;  1VQ9 3;  1VQ8 3;  3A5E A;  1O7W B;  1RRH A;  1BNF A;  2C11 A;  4CCV A;  1W2B 2;  2AAD A;  1YI2 3;  1Q40 A;  1LQG C;  3H51 A;  3SOY A;  4XBT A;  3G0K A;  4HAA A;  1O7M B;  4I4K A;  1YGE A;  4R80 A;  1CYU A;  1SII A;  3DUK A;  3JUO A;  3RGR A;  1LOV A;  9RNT A;  1VQ4 3;  1HZ1 A;  1OH0 A;  3D9R A;  4J5G A;  1SAR A;  2BT3 A;  3O8Y A;  1BNJ A;  3DZL A;  2HMO B;  2W6J H;  1C7H A;  1F8N A;  1UDI I;  1W6Y A;  3EF8 A;  4OVM A;  1VQK 3;  2CWV A;  1B3S A;  2GEY A;  2BO9 B;  3EE1 A;  4STD A;  1KD1 4;  1J2B A;  2F98 A;  4LYL B;  4OUQ A;  1ROV A;  3BND A;  3CC2 3;  3PGB A;  1BUQ A;  3X40 A;  4NPB A;  1MWT A;  1S5A A;  2IA7 A;  4HZB B;  2D1W A;  2E2U A;  1RGC A;  2F86 B;  1EEJ A;  3PYJ A;  1RNB A;  2H0G A;  3DXO A;  2A15 A;  1B27 A;  3PS8 A;  1B20 A;  1AQZ A;  3WHO A;  1B2M A;  5KP3 A;  3WA2 X;  1UW1 A;  2W2C A;  1LVN A;  3TDG A;  1KQS 2;  1GY6 A;  4K90 B;  2IUK A;  3F9S A;  3G6E 3;  1JKG B;  2CFL A;  1NJI 4;  3F40 A;  1I2F A;  4IPB A;  4RZM A;  3CCJ 3;  2BIR A;  3K5T A;  1QAK A;  1US1 A;  1QAF A;  1W7C A;  4MMY B;  1T2H A;  1RCL A;  1I8V A;  4BL3 A;  2OTL 3;  2KAA A;  5G1L A;  2C10 A;  1IQ8 A;  1PYL A;  1BGS A;  2OOV C;  3WOE B;  2PNC A;  1W6G A;  5M19 A;  4CDL A;  1V57 A;  1BUJ A;  1IU7 A;  2XEP A;  2Z77 A;  3GAX A;  1R4C A;  4K1U A;  1VQL 3;  1LNH A;  1RGA A;  1ROA A;  1FGT A;  5IW9 A;  2CIU A;  1U8C B;  1BRN L;  1X1Y A;  3AHS A;  3EBY A;  4NRE A;  2WOH A;  4WFO A; 
#chains in the Genus database with same CATH homology
 1K41 A;  3X42 A;  3Q90 A;  1GD4 A;  4FMD A;  3SED A;  1TUH A;  3LT8 A;  1VQ7 3;  2WGQ A;  2XSH B;  4HM8 B;  4IT7 A;  3N54 B;  3CPW 2;  3K63 A;  1NB5 I;  1DVD A;  2XGN A;  3T8N A;  1VQ6 3;  1JNQ A;  1GS3 A;  2R4I A;  2Z76 A;  3S27 A;  1NWW A;  5EVH A;  1EQK A;  2B1X B;  4MMZ B;  5DRE A;  3CNM A;  5KP1 A;  2YX9 A;  2OTJ 3;  1FGQ A;  2QA4 3;  4XM4 A;  1W6C A;  1M9G A;  3GRD A;  3LOY A;  4K1V A;  2JQ5 A;  3KN4 A;  1FA3 A;  3BB9 A;  3DMC A;  1STF I;  4FMB A;  2MF7 A;  1ISK A;  4L8P A;  2WOF A;  2XF3 A;  1N9E A;  1VQM 3;  1IQY A;  3LZA A;  4IIA A;  4N6M A;  2QEX 3;  2CW9 A;  3X41 A;  5AIH A;  3V92 A;  3G4S 3;  2YFL B;  1JKG A;  2INX A;  4O02 B;  2OQE C;  3BLZ A;  3D3L A;  3E99 A;  3FKA A;  1WMP A;  5AIG A;  3RGA A;  3CD6 3;  3SXX A;  5CLK A;  3HII A;  1JJ2 2;  5CF2 A;  3KSP A;  5JPP A;  2JDI H;  4J8T A;  4L8O A;  2CFG A;  1OAC A;  1Q42 A;  5HGR A;  3CC7 3;  5IF6 A;  1WMO A;  2W03 A;  3LTB A;  3SLU A;  4JF8 A;  1DVC A;  3MG3 A;  3FH1 A;  4QWT A;  1E3R A;  4FMC A;  4NHF A;  4RNY A;  1NB3 I;  4WYK B;  2QIY A;  1EKM A;  3JUQ A;  1DYU A;  1O7P B;  2FXT A;  3G16 A;  2Z7A A;  4FMA A;  3CNX A;  3LYG A;  4O2H A;  1AV4 A;  5IEP A;  5LC6 A;  4EBG A;  1MNL A;  1N8R 4;  2W9Q A;  2UX0 A;  1QVG 2;  3NM2 A;  3J7Y d;  1TFO A;  2L4V A;  4N6L A;  3S5C A;  1IV9 A;  3NV0 B;  4WP5 A;  3EC9 A;  2FNQ A;  1AVL A;  5IG5 A;  2RFR A;  3MPH A;  1JB4 A;  4HZ9 B;  3STD A;  2BMR B;  3OX9 A;  1D6Z A;  1D6Y A;  3GZY B;  3EQQ B;  3GZB A;  1GY7 A;  3CC4 3;  3RDE A;  5AIF A;  3LT9 A;  3KZT A;  3MWZ A;  5IEO A;  3F8X A;  1S72 3;  2XFS A;  2ZDJ A;  2BHM A;  4Q53 A;  2K0M A;  4GL6 A;  5STD A;  1PU4 A;  3CCQ 3;  1Q86 4;  3BNB A;  1YJ9 3;  1TFK A;  3CPO A;  1V74 A;  3JUM A;  3LXU X;  3T0U A;  3SX1 A;  3MHE A;  3WOF B;  4EV5 A;  3BNC A;  5BVB A;  4JRF A;  3B4O A;  3MG2 A;  3F7X A;  4O8S A;  1QVF 2;  2KRT A;  2P38 A;  1SQW A;  5CK6 A;  5AEW B;  1NU3 A;  3FLJ A;  3DGO A;  2CWU A;  3DGL A;  3T8U A;  3OV4 A;  2F99 A;  3NX0 A;  4PEJ A;  1O7N B;  4U13 A;  3IMA B;  4FR9 A;  3NQY A;  1TP6 A;  3UL5 A;  1LXE A;  4HVN A;  1L5G B;  1WTH A;  2Z6B A;  1UI7 A;  1OGZ A;  3FSD A;  1GD3 A;  3KKG A;  1E97 A;  2W56 B;  3PZW A;  4HYZ A;  3LTD A;  3JVC A;  2HMJ B;  3F7S A;  3CME 3;  1W02 A;  1RKY A;  4R9L A;  2GXF A;  2W9P A;  4N6U A;  3NV0 A;  2O3O A;  1YIT 3;  2CK3 H;  2LYX A;  2Q07 A;  4KFD A;  5I97 A;  1OCV A;  4RBN A;  2HML B;  3LH4 A;  2KCD A;  4X2O A;  3GZR A;  3L0R A;  1VQP 3;  2P09 A;  1YJN 3;  3CCV 3;  3NBJ A;  1HU9 A;  3NUV A;  3PCR A;  4MMX B;  5FGO A;  2PZV A;  5IG4 A;  4EXR A;  3Q2P A;  3KE7 A;  1Y4K A;  2XGL A;  1JN5 B;  3IJE B;  5ELU A;  4N6N B;  4HJL B;  4O3V A;  5LC7 A;  3ALA A;  1CEW I;  4HM0 B;  3NBB A;  2BMO B;  1DMM A;  3EHC A;  1YJW 3;  1Z1S A;  1JRQ A;  3HIG A;  5DRV A;  3FZW A;  3CCL 3;  1IDP A;  4EV2 A;  3CXC 2;  1RRL A;  2K54 A;  2CKF B;  1SIH A;  3EN1 B;  1LOX A;  5KP4 A;  3B8L A;  4HM6 B;  2QGU A;  3FG4 A;  1A2V A;  4HBR A;  4R1K A;  1IQX A;  2GBX B;  4LEH A;  3UJM A;  1IVW A;  4R4K A;  4HM3 B;  4XDV A;  4HM1 B;  1IT7 A;  3F8H A;  2STD A;  1E3V A;  1M1K 4;  3AMO B;  4WWU C;  3WDG B;  5JPU A;  3OW2 2;  3NHX A;  2XRX B;  4H61 A;  3EN8 A;  4FCJ A;  2LQV A;  3K0Z A;  4BTX A;  3NBR A;  2BNG A;  1KWI A;  1U5O A;  1N5H A;  2P0X A;  2FGT A;  4HKV B;  1ULJ B;  2GEX A;  3HZP A;  4H3U A;  4ORL A;  3ROB A;  3FG3 A;  3IPT A;  4N6V 0;  5IG3 A;  1IVX A;  5IEN A;  3OWS A;  3Q1C A;  4OK0 A;  1JN5 A;  2CHC A;  4N3V A;  5AYS C;  3CCM 3;  3OXA A;  4X2H A;  3GWR A;  1O7G B;  4J9A A;  5G2G A;  4TX4 A;  4AKY A;  1K73 4;  3CU3 A;  3PCS A;  2ML5 A;  1GY5 A;  3HX8 A;  1UUW B;  2Y74 A;  4EC6 A;  3K9M C;  3DY5 A;  3V99 A;  3WMD A;  2P0M A;  3BNE A;  1RN7 A;  1SJW A;  2D42 A;  1OPY A;  4R9K A;  2CFD A;  5TGN A;  3WA3 A;  1IV7 A;  1JB5 A;  3X3Y A;  1OF5 B;  5IER A;  3G8Z A;  1GYB A;  3MKI A;  1O7H B;  1YVB I;  3FG1 A;  3CCS 3;  1Q7Y 4;  4HM4 B;  1AR0 A;  1FGR A;  1OHP A;  1ULI B;  4LGQ A;  1VZZ A;  3JUP A;  4GB5 A;  4KFE A;  2XFT A;  2Y73 A;  2WGO A;  8CHO A;  3H3H A;  4AKZ A;  1D6U A;  1M1X B;  3AMO A;  5BXQ A;  1A67 A;  4KFF A;  2HMM B;  1PFP A;  1AVK A;  3UL6 A;  1IK3 A;  3NXJ A;  4HM7 B;  3CCR 3;  1HKX A;  4HM5 B;  1EA2 A;  3EJV A;  3HI7 A;  3EX9 A;  4LZI A;  3I56 3;  3CCE 3;  3N9H A;  1IVV A;  1KC8 4;  4WYK A;  1VQ5 3;  4G1M B;  2GBW B;  3FF2 A;  4N6O B;  3ECF A;  1W00 A;  2P05 A;  2GU1 A;  2SBL A;  1CQS A;  1W01 A;  2CG1 A;  4BTY A;  1OHS A;  4WHA A;  3S28 A;  2BMQ B;  3F14 A;  1QMA A;  1WNH A;  1WQL B;  3CMA 3;  5D82 A;  1MOL A;  5FW5 A;  3PXM A;  2CFK A;  5CF1 A;  2WO0 A;  1DMN A;  2E2V A;  2V1L A;  4FCZ A;  5CXO A;  3HK4 A;  3NM7 A;  3G71 3;  2I9W A;  2CFW A;  4EYC A;  3KII A;  4XDW A;  3OWU A;  2O9U X;  2IUJ A;  1OF5 A;  3UB1 A;  1KSI A;  1N8Q A;  5A0O B;  3DGM A;  3MYT A;  2OCT A;  3FCS B;  4L7K A;  3S67 A;  4MJD A;  1T5Y A;  4XB5 A;  5IG0 A;  1ZX2 A;  4LMI A;  3X3Z A;  3ER7 A;  1N5P A;  2ZL8 A;  3FGY A;  6STD A;  3KFQ C;  2W0Q A;  1NO3 A;  3WOD G;  1A2K A;  1K8A 4;  3DM8 A;  2HMN B;  1JB2 A;  7STD A;  3I55 3;  2OOV A;  2KXG A;  1N9J A;  2RGQ A;  1QJG A;  4FCM A;  3V98 A;  1K9M 4;  3LML A;  3UNL A;  2MC8 A;  1W2Z A;  4K61 A;  2HMK B;  1NDO B;  2B24 B;  1W4N A;  3K7C A;  5ELJ A;  1FUW A;  4KVH A;  1W5Z A;  2GU3 A;  2IMJ A;  2W56 A;  3LTA A;  3OWY A;  2CH9 A;  5D81 A;  3DGN A;  4BTW A;  3B4P A;  2RCD A;  4KZ1 A;  4LSO A;  2XSO B;  3EB8 A;  3M8C A;  1IVU A;  3QRD A;  3QK9 A;  1M90 4;  1DMQ A;  2YFI B;  1OHO A;  1Q40 B;  2CC3 A;  1K28 A;  2E2T A;  3GZX B;  3B7C A;  3NQZ A;  3CCU 3;  3S29 A;  1VQO 3;  1ASK A;  2XH9 A;  3JUN A;  4ZM8 A;  3N8B A;  2W04 A;  4AEQ A;  5D83 A;  5AEU B;  3U1W A;  4HM2 B;  5AI1 A;  1Q82 4;  2OQE A;  3SVA A;  3MG1 A;  3X3X A;  2ML6 A;  5EEO A;  1YIJ 3;  1FGO A;  5AYR B;  3LTC A;  2XR8 B;  4RNZ A;  1FGM A;  3MSO A;  4XBX A;  1IT8 A;  1ZO2 A;  1TIJ A;  3VGN A;  3VF1 A;  1EG9 B;  3FF0 A;  1A90 A;  1SPU A;  5JBS A;  1Q81 4;  3SOA A;  2RSX A;  3VSY A;  1RJO A;  1G96 A;  1CYV A;  5EQL A;  2OWP A;  4XBY A;  1OUN A;  3I0Y A;  3U97 A;  2CWT A;  2YFJ B;  3KSE D;  1OGX A;  1UI8 A;  4N6T A;  1WMN A;  3EBT A;  1UUV B;  5AII A;  1VQN 3;  2CG0 A;  1JV2 B;  1STD A;  1TU5 A;  4MEI A;  1QAL A;  2M7O A;  1YHQ 3;  3A76 A;  1VQ9 3;  1VQ8 3;  1O7W B;  1RRH A;  2C11 A;  4CCV A;  1W2B 2;  1YI2 3;  1Q40 A;  3H51 A;  3SOY A;  4XBT A;  3G0K A;  1O7M B;  4I4K A;  1YGE A;  4R80 A;  1CYU A;  1SII A;  3DUK A;  3JUO A;  3RGR A;  1VQ4 3;  1OH0 A;  3D9R A;  2BT3 A;  3O8Y A;  3DZL A;  2HMO B;  2W6J H;  1C7H A;  1F8N A;  1W6Y A;  3EF8 A;  1VQK 3;  4OVM A;  2CWV A;  2GEY A;  3EE1 A;  2BO9 B;  1J2B A;  4STD A;  1KD1 4;  2F98 A;  4OUQ A;  1ROV A;  3BND A;  3CC2 3;  3PGB A;  1BUQ A;  3X40 A;  1S5A A;  2IA7 A;  4HZB B;  2D1W A;  2E2U A;  2F86 B;  3PYJ A;  3DXO A;  2A15 A;  3PS8 A;  5KP3 A;  3WA2 X;  1UW1 A;  2W2C A;  1LVN A;  3TDG A;  1KQS 2;  1GY6 A;  4K90 B;  2IUK A;  3F9S A;  3G6E 3;  1JKG B;  2CFL A;  1NJI 4;  3F40 A;  4IPB A;  4RZM A;  3CCJ 3;  3K5T A;  1QAK A;  1US1 A;  1QAF A;  1W7C A;  4MMY B;  2OTL 3;  2C10 A;  1IQ8 A;  2OOV C;  3WOE B;  2PNC A;  1W6G A;  4CDL A;  1IU7 A;  2Z77 A;  2XEP A;  3GAX A;  1R4C A;  4K1U A;  1VQL 3;  1LNH A;  1ROA A;  1FGT A;  5IW9 A;  2CIU A;  1U8C B;  3EBY A;  4NRE A;  2WOH A;  4WFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...