4HM7B

Naphthalene 1,2-dioxygenase bound to styrene
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to styrene
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm7B00
3FF0A 5DRVA 5D83A 3K7CA 3A76A 5G2GA 4R1KA 5FW5A 1Q40B 1W01A 3CU3A 3CNXA 3NV0B 3S5CA 4HKVB 4MJDA 4HZ9B 1UUVB 2I9WA 3NBRA 3NHXA 2GBWB 3F8HA 4XDWA 5AIGA 1JB2A 4L8OA 1W6YA 3JUMA 3F14A 2BMQB 4LGQA 3STDA 4LEHA 2BNGA 3OX9A 4XBYA 4N3VA 2R4IA 3DXOA 1ISKA 2W2CA 3NUVA 4HM4B 2A15A 1OHSA 2Z77A 1E3VA 3CPOA 4HM3B 5KP3A 1W00A 2GXFA 3EBYA 3DM8A 1OCVA 2B24B 1NWWA 3T8UA 2HMMB 2HMKB 8CHOA 4J9AA 2GEYA 1EG9B 3GRDA 3I0YA 3HZPA 3UNLA 4ORLA 1EA2A 4HM6B 1GY7A 1ZO2A 1UUWB 4XBTA 5KP1A 1TUHA 3BB9A 2HMOB 4CDLA 3SOYA 1GY6A 5TGNA 4L7KA 4WYKB 5D81A 2HMNB 4K1UA 4I4KA 3G0KA 4GB5A 3T8NA 1JN5B 3H51A 2IMJA 2GEXA 2YFLB 2UX0A 3JUPA 3UJMA 4OUQA 1QJGA 3DUKA 3MKIA 1ULJB 1TP6A 5AIIA 1O7WB 3NM2A 2XRXB 3GWRA 3G16A 3EN1B 4XB5A 3FH1A 5BXQA 7STDA 5CXOA 2F99A 1NU3A 3H3HA 3OXAA 4IIAA 5CF2A 3LYGA 1OF5A 4H3UA 3ECFA 1O7PB 1GS3A 3G8ZA 2K54A 4WP5A 2YFIB 3F7XA 5IG5A 2Z76A 4RZMA 1ASKA 3HK4A 5D82A 2XSOB 4HM0B 3FF2A 3EN8A 3FGYA 3VSYA 4HJLB 5IG4A 5HGRA 2HMLB 5KP4A 4U13A 3EQQB 1AR0A 3F8XA 3FKAA 1JB4A 1U5OA 3CNMA 3F7SA 3DMCA 3ROBA 3EHCA 3KE7A 3SOAA 2RCDA 1Q42A 1ZX2A 4STDA 3FLJA 3EF8A 4HVNA 1W02A 3KSPA 2BMOB 5BVBA 2F98A 3GZXB 5CF1A 3D9RA 3MYTA 2RFRA 3B7CA 1OGZA 2F86B 1Z1SA 1K41A 1VZZA 1OHPA 4X2OA 5IERA 5AI1A 1E97A 4HM7B 5JPPA 1DMNA 3FZWA 4XBXA 1C7HA 3MHEA 4WWUC 2CKFB 4R9LA 1OGXA 4OVMA 1CQSA 3OWUA 1Q40A 4FCJA 3MG3A 5AIHA 3NV0A 3Q90A 4X2HA 4KVHA 3B4OA 3BLZA 2QGUA 3GZBA 4HM2B 2JQ5A 3GZYB 3DZLA 5DREA 5IEOA 4HZBB 1WQLB 1OH0A 1BUQA 2XSHB 1GY5A 1NDOB 4L8PA 3MG1A 3K0ZA 1STDA 5IF6A 5IEPA 2CHCA 4XM4A 3MG2A 1O7GB 2HMJB 3E99A 3EJVA 3F40A 2XR8B 5CLKA 3B8LA 4LMIA 2YFJB 5JPUA 2Z7AA 1O7HB 2QIYA 5IG3A 3JUOA 1S5AA 3MSOA 4HM8B 5AIFA 1SJWA 1IDPA 1DMMA 1O7MB 1JKGA 1OF5B 3OWYA 4K1VA 3HX8A 5EVHA 3FSDA 1E3RA 3LZAA 1QMAA 3GZRA 2PZVA 3KKGA 4Q53A 3F9SA 1HKXA 4HM1B 4R9KA 3JUNA 3ER7A 3M8CA 5CK6A 2STDA 6STDA 3VGNA 3OV4A 3WMDA 5AEUB 4PEJA 3EC9A 1A2KA 5IG0A 1JKGB 2B1XB 3IPTA 1ULIB 4WYKA 3OWSA 1O7NB 3RGAA 3B4PA 3JUQA 2BMRB 5STDA 1JN5A 3NXJA 5AEWB 1JB5A 2RGQA 1DMQA 3KZTA 3EBTA 4XDVA 1GYBA 2GBXB 1OUNA 2INXA 1OPYA 4HM5B 3EX9A 3SEDA 4FCMA 2OWPA 3RGRA 4J8TA 1OHOA 5IENA
chains in the Genus database with same CATH superfamily
3FF0A 1UI8A 3AMOA 1YVSA 1BIRA 2W6JH 1DVCA 1SIIA 1AY7A 1T3BA 5LC7A 8RNTA 1WMPA 5DRVA 1LXEA 5D83A 1UGIA 4G1MB 1R4CA 4GSPA 1W7CA 3BIRA 3N9HA 2Y74A 1IU7A 3K7CA 4FMCA 3KFQC 3CCS3 1TFOA 3DGLA 4N6UA 1PFPA 2CG1A 1T2HA 3A76A 1C54A 5G2GA 3U1WA 1KWIA 1A2VA 4R1KA 4R80A 1Q40B 5FW5A 5IENA 4HBRA 4K90B 4WFOA 1W2ZA 1W01A 3EB8A 3CU3A 5ELUA 3CNXA 3DH2A 3NV0B 3CC43 3S5CA 1PYLA 4HKVB 2Q07A 2C10A 4MJDA 4HZ9B 3WA2X 3LOYA 1UUVB 2H0IA 1M1XB 1IT8A 3DGYA 2I9WA 3NBRA 2CWUA 3NHXA 1QALA 2GBWB 1Q7Y4 1IVXA 3SXXA 4HYZA 2ZL8A 3S29A 3BNBA 1QAFA 3F8HA 4XDWA 2RSXA 5AIGA 1BRSA 1JB2A 4N6OB 4L8OA 7GSPA 2BHMA 1M1K4 2XEPA 2GU3A 1W6YA 3G6E3 2W0QA 5CXOA 1BVIA 3F14A 1B20A 2BMQB 3EE1A 3BU4A 3JUMA 4LGQA 3G4S3 1VQK3 2BO9B 2L1SA 3PCSA 3STDA 4LZIA 4LEHA 4IT7A 2BU4A 1Y4KA 2BNGA 1AVLA 3OX9A 4XBYA 2QA43 1B2SA 4N3VA 2CX1A 2OOVA 3AGNA 2R4IA 1RRLA 2CH9A 3DXOA 1ISKA 3X3YA 3PS8A 2W2CA 4EXRA 4MMXB 3TDGA 4JRFA 1B21A 1X1UA 3NUVA 4LYLB 1K734 1T5YA 4HM4B 2A15A 1YI23 2CFKA 3SX1A 2CG0A 1OHSA 2O3OA 1BNGA 4EV2A 3QK9A 4MEIA 1BNEA 3GSPA 1BRGA 2Z77A 1E3VA 3CPOA 4HM3B 5KP3A 1DYUA 1W00A 2F56A 4TX4A 5EQLA 2GXFA 3EBYA 1FYSA 2RNTA 3UL5A 3DM8A 1BUJA 1OCVA 3HOHA 3KIIA 1LNIA 2GU1A 1GMPA 2B24B 3RDEA 4BTXA 1IVWA 1BNFA 2KCDA 3LTBA 1FUWA 1IV7A 1FUTA 3O8YA 5BU4A 1FGTA 1NWWA 3T8UA 2HMMB 2HMKB 4RBNA 8CHOA 4J9AA 3J7Yd 1FGQA 3S28A 4EC6A 1S723 2GEYA 1JBTA 1N5PA 1VQM3 3S67A 1VQ43 1EG9B 1D6UA 4WHAA 1ZS7A 3X3XA 1FZUA 3ZG0A 1RMSA 1W5ZA 2BIRA 3GRDA 3HZPA 3I0YA 4ILFA 4O02B 3UNLA 2LYXA 2ZA4A 4DKIA 1VQP3 3CCQ3 1BSBA 2CFDA 3SVAA 4ORLA 5IW9A 1GOYA 1BNIA 1MWRA 1EA2A 4HM6B 4FCZA 1YJN3 3PYJA 1EQKA 2KF5A 1SIHA 1EEJA 4IPBA 1GY7A 1ZO2A 4KFDA 4N6MA 3SLUA 1UUWB 1UW1A 4XBTA 4AKZA 3CC23 5KP1A 3WODG 1TUHA 1K8A4 1G0TA 2OQEC 4KFFA 3BB9A 3HI7A 2HMOB 4BL2A 4CDLA 3SOYA 4EBGA 1ROVA 4BTWA 4KZ1A 4N6V0 1GY6A 2M7OA 1OACA 1FUSA 1VQ83 5TGNA 5AYRB 1VQQA 4L7KA 4WYKB 1AQZA 5D81A 4BU4A 2HMNB 2P05A 1RGLA 2WO0A 4K1UA 1TU5A 1B2ZA 1ZGXA 4I4KA 1V58A 1LQMB 3KN4A 4O2HA 2FGTA 3WA3A 3G0KA 1AVKA 4GB5A 2CFGA 3T8NA 2W9PA 2W04A 1V74A 3CCV3 1JN5B 1LOXA 3H51A 4RNTA 3CC73 4RNZA 3URPA 2IMJA 2GEXA 2YFLB 1UI7A 2UX0A 1BSCA 3JUPA 9RNTA 3AHWA 3UJMA 2E2VA 3KCHA 4OUQA 1NJI4 1YVBI 2SARA 1QJGA 3JVCA 1EKMA 1DETA 4OK0A 2IY2A 2SBLA 3DUKA 5M18A 3MKIA 1ULJB 1TP6A 3X3ZA 2XFSA 5AIIA 4GL6A 1O7WB 3BNEA 3NBJA 2WOFA 3NX0A 1RGFA 3K5TA 3NM2A 4KFEA 2IA7A 1Q864 2XRXB 3LT8A 3GWRA 3G16A 3EN1B 5FGOA 4XB5A 4BL3A 3FH1A 1IYYA 5BXQA 1RGEA 5JBSA 7STDA 3I553 3BNCA 1N9JA 2OCTA 1MWTA 1NU3A 2F99A 3H3HA 1D6ZA 1RGGA 2ZHXB 3OXAA 1KD14 2FNQA 4NPBA 4IIAA 5HOHA 5CF2A 2CFLA 3LYGA 1NB5I 1OF5A 1IQXA 2AADA 1RCLA 1BRJA 1V57A 2XGNA 3LTDA 4H3UA 4KT3B 4N6NB 1KQS2 3CPW2 3ECFA 4GHOA 2IYJA 1VQO3 1O7PB 1GS3A 3AMOB 2XF3A 2Z6BA 1GMRA 3G8ZA 4MMYB 1YHQ3 2K54A 3LMLA 4WP5A 1RGHA 7RNTA 2YFIB 3F7XA 6RNTA 5IG5A 1B27A 3ALAA 1HU9A 1I2GA 4FMBA 2V1LA 3QRDA 1I8VA 3CD63 2Z76A 1YGEA 3DY5A 2E2UA 4RZMA 2WOHA 1JZOA 2FXTA 2HOHA 1VQ53 1JBRA 1TIJA 1ASKA 3HK4A 3RNTA 5D82A 1W6CA 5M19A 2C4BA 2XSOB 1IQYA 1MGRA 1LNHA 4AKYA 4HM0B 1GSPA 1SPUA 2W03A 1DVDA 3FF2A 3L0RA 1EUIC 2F5MA 1YIT3 3EN8A 3FGYA 2XH9A 3PCRA 3VSYA 1KC84 4HJLB 4CJNA 1G02A 1MOLA 1RGKA 5IG4A 5HGRA 2HMLB 3NBBA 2IUJA 5KP4A 2WGOA 1BNJA 5LC6A 4U13A 4EYCA 5A0OB 1N8R4 3EQQB 1RN4A 1Q9EA 1AR0A 3F8XA 3FKAA 5G1KA 1JB4A 1I3IA 2UUGC 2WGQA 1TRPA 1BNRA 4N6LA 1U5OA 1BGSA 1B2UA 1JRQA 2CC3A 3Q2PA 2P38A 1HZ1A 3CNMA 4HOHA 3F7SA 3DMCA 3ROBA 3EHCA 3CXC2 3KE7A 3SOAA 2RCDA 3PGBA 1Q42A 1A90A 3MPHA 1ZX2A 4STDA 5AYSC 1LOVA 3ZFZA 3FLJA 2BT3A 1RJOA 3EF8A 2P09A 4HVNA 1W4NA 1W02A 1UUGB 3KSPA 2PNCA 3NQYA 2BMOB 3NQZA 3BNDA 4AEQA 3CCL3 1BANA 1RNBA 3UL6A 1NB3I 5BVBA 2F98A 3GZXB 1A67A 4FMDA 1FGRA 1R4YA 3WHOA 5CF1A 3K9MC 3D9RA 3MYTA 4LSOA 2RFRA 3MWZA 1BRNL 3B7CA 1OGZA 3PZWA 2F86B 1Z1SA 3LH4A 2C11A 1I0VA 1RGCA 1K41A 2OOVC 1VZZA 2KXGA 1OHPA 1FA3A 1PY3A 4X2OA 1FW7A 5IERA 1I2EA 5AI1A 1KSIA 1E97A 3DGMA 4HM7B 5JPPA 1I0XA 3CCJ3 4O8SA 1DMNA 1L5GB 2P0XA 3FZWA 1MNLA 3CCR3 1X1WA 4XBXA 5GSPA 1C7HA 3MHEA 1JZDA 3IMAB 2CKFB 4WWUC 3T0UA 3X41A 3A5EA 2F5WA 4R9LA 5I97A 1M904 1A2PA 1B2XA 1GD4A 2KF4A 1Q824 1UCKA 1OGXA 4OVMA 1RTUA 1X1XA 1WTHA 3S27A 2AAEA 6GSPA 1K28A 1TRQA 3U97A 2CK3H 5RNTA 1CQSA 2CX0A 1Q40A 3OWUA 4FCJA 2MF7A 3V92A 3X42A 1J2BA 1IV9A 3MG3A 1BSDA 4J5KA 1IQ8A 4K61A 1RGAA 5AIHA 3KSED 3NV0A 3Q90A 4X2HA 4KVHA 2QEX3 4BIRA 3B4OA 2O9UX 3BLZA 2QGUA 3GZBA 4HM2B 2JQ5A 1LQGC 3GZYB 2GSPA 3DZLA 1I2FA 1LVNA 3CCE3 5DREA 3CMA3 1YNVX 1N8QA 4J5GA 1I3FA 5IEOA 4HZBB 1DE3A 1WQLB 1BAOA 1W6GA 1OH0A 1VQ93 1BUQA 2XSHB 4EW5A 1UCIA 1GY5A 1NDOB 2CWTA 1F8NA 1YJW3 3GAXA 1K9M4 1HYFA 1M9GA 4L8PA 5G1LA 1MGWA 3MG1A 3K0ZA 2W56A 1STDA 2JDIH 3V98A 2J8XB 1RLSA 5IF6A 3D5IA 5IEPA 1JV2B 2CHCA 1IT7A 1VQ73 2UGIA 1FGMA 2P0MA 4MMZB 4XM4A 1BNSA 1STFI 1O7GB 2KRTA 2ZDJA 3FG4A 3MG2A 2F4YA 3D3LA 2HMJB 3E99A 1GD3A 2R41A 3EJVA 3WOEB 2XR8B 3F40A 5CLKA 3B8LA 3WDGB 4CCVA 4LMIA 1QVG2 2YFJB 5JPUA 2Z7AA 4O3VA 4BTYA 5BIRA 1IVUA 1O7HB 2QIYA 5IG3A 1PU4A 1WMOA 3JUOA 1S5AA 3MSOA 3LT9A 3LXUX 2OTJ3 4EV5A 4HM8B 5AIFA 2H0GA 1VQ63 1SJWA 4ZM8A 1JNQA 1IDPA 1DMMA 3CME3 2K3DA 1BSEA 2YX9A 1O7MB 1AV4A 1JKGA 1BRHA 1OF5B 3OWYA 4K1VA 3DGOA 3HX8A 3N54B 3CCU3 3IJEB 1WMNA 4CPKA 5EVHA 3FSDA 2W56B 1E3RA 1UGHI 1N5HA 2CWVA 3Q3FA 3LZAA 4FR9A 2OQEA 2CW9A 4NREA 3WOFB 1RNTA 1RCKA 1QMAA 1BOXA 3PXMA 3GZRA 1X1YA 2PZVA 3D79A 1JJ22 1CYUA 3SYUA 1LOYA 1QVF2 2XGLA 1TJDA 3KKGA 4Q53A 3F9SA 1HKXA 4HM1B 1LRAA 3HIGA 3Q1CA 4R9KA 3JUNA 3V99A 1IK3A 2ML5A 1FGOA 5EEOA 3ER7A 1BRIA 3N8BA 1MWSA 4QWTA 3M8CA 1TTOA 3CCM3 1VQL3 1QAKA 1YGWA 5CK6A 1W2B2 3HIIA 1UCLA 2STDA 1MWUA 6STDA 1GOVA 2IUKA 2K0MA 1VQN3 3VGNA 3OV4A 3WMDA 5AEUB 2RBIA 1G96A 3AHSA 4PEJA 2D1WA 3EC9A 2OTL3 1A2KA 5IG0A 1JKGB 2B1XB 3IPTA 2D42A 3I563 1SQWA 3X40A 1GOUA 1ULIB 1CYVA 2KAAA 4WYKA 1T2IA 3OWSA 1RKYA 1JBSA 1BU4A 1O7NB 1NO3A 3RGAA 2E2TA 3B4PA 3OW22 1RSNA 3JUQA 1RDSA 4H61A 1SARA 1WNHA 2BMRB 3D5GA 3LTAA 5STDA 3UB1A 2CFWA 4FMAA 3G713 1JN5A 1D6YA 1I70A 2XFTA 1RHLA 1N9EA 3NXJA 4HAAA 5AEWB 1LOWA 1JB5A 1GMQA 2KF6A 4JF8A 2W9QA 1UDII 2RGQA 1TFKA 2Y73A 2LQVA 2MC8A 1DMQA 3KZTA 1YIJ3 4I5QA 3EBTA 4XDVA 1US1A 3ZG5A 1GYBA 3LTCA 4RNYA 1RN1A 1B2MA 2GBXB 2CIUA 3FCSB 3K63A 1OUNA 2INXA 3DGNA 1OPYA 3AGOA 1CEWI 1Q814 4HM5B 3FG1A 4R4KA 3WR2A 5M1AA 3EX9A 2H0HA 3SEDA 1Q7HA 1ROAA 5ELJA 1U8CB 2KF3A 1YJ93 1RN7A 1RRHA 1NNVA 4NHFA 1BSAA 1BRKA 1CH0A 2L4VA 3D4AA 3VF1A 4FCMA 2OWPA 3RGRA 4N6TA 1B3SA 4J8TA 2ML6A 1OHOA 3NM7A 1UCJA 3FG3A 1IVVA
chains in the Genus database with same CATH topology
3FF0A 1UI8A 3AMOA 2W6JH 1DVCA 1SIIA 5LC7A 1WMPA 5DRVA 1LXEA 5D83A 4G1MB 1R4CA 1W7CA 3N9HA 2Y74A 1IU7A 3K7CA 4FMCA 3KFQC 3CCS3 1TFOA 3DGLA 4N6UA 1PFPA 2CG1A 3A76A 5G2GA 3U1WA 1KWIA 1A2VA 4R1KA 4R80A 1Q40B 5FW5A 5IENA 4HBRA 4K90B 4WFOA 1W2ZA 1W01A 3EB8A 3CU3A 5ELUA 3CNXA 3NV0B 3CC43 3S5CA 4HKVB 2Q07A 2C10A 4MJDA 4HZ9B 3WA2X 3LOYA 1UUVB 1M1XB 1IT8A 2I9WA 3NBRA 2CWUA 3NHXA 1QALA 2GBWB 1Q7Y4 1IVXA 3SXXA 4HYZA 2ZL8A 3S29A 3BNBA 1QAFA 3F8HA 4XDWA 2RSXA 5AIGA 1JB2A 4N6OB 1M1K4 4L8OA 2BHMA 2XEPA 2GU3A 1W6YA 3G6E3 2W0QA 3JUMA 3F14A 2BMQB 3EE1A 4LGQA 3G4S3 2BO9B 3PCSA 3STDA 4LZIA 4LEHA 4IT7A 1Y4KA 2BNGA 1AVLA 3OX9A 4XBYA 2QA43 4N3VA 2OOVA 2R4IA 1RRLA 2CH9A 3DXOA 1ISKA 3X3YA 3PS8A 2W2CA 4EXRA 4MMXB 3TDGA 4JRFA 3NUVA 1K734 1T5YA 4HM4B 2A15A 1YI23 2CFKA 3SX1A 2CG0A 1OHSA 2O3OA 4EV2A 3QK9A 4MEIA 2Z77A 1E3VA 3CPOA 4HM3B 5KP3A 1DYUA 1W00A 4TX4A 5EQLA 2GXFA 3EBYA 3UL5A 3DM8A 1OCVA 3KIIA 2GU1A 3RDEA 2B24B 4BTXA 1IVWA 2KCDA 3LTBA 1FUWA 1IV7A 3O8YA 1FGTA 1NWWA 3T8UA 2HMMB 2HMKB 4RBNA 8CHOA 4J9AA 3J7Yd 1FGQA 3S28A 4EC6A 1S723 2GEYA 1N5PA 1VQM3 3S67A 1VQ43 1D6UA 1EG9B 4WHAA 3X3XA 1W5ZA 3GRDA 3HZPA 3I0YA 4O02B 3UNLA 2LYXA 1VQP3 3CCQ3 2CFDA 3SVAA 4ORLA 5IW9A 1EA2A 4HM6B 4FCZA 1YJN3 3PYJA 1EQKA 1SIHA 4N6MA 4IPBA 1GY7A 1ZO2A 4KFDA 3SLUA 1UUWB 1UW1A 4XBTA 4AKZA 5KP1A 3WODG 1TUHA 1K8A4 2OQEC 4KFFA 3BB9A 3HI7A 2HMOB 4CDLA 4EBGA 3SOYA 1ROVA 4BTWA 4KZ1A 4N6V0 1GY6A 2M7OA 1OACA 1VQ83 5TGNA 5AYRB 4L7KA 4WYKB 5D81A 2HMNB 2P05A 4K1UA 2WO0A 1TU5A 4O2HA 4I4KA 3KN4A 2FGTA 3WA3A 3G0KA 1AVKA 4GB5A 2CFGA 3T8NA 2W9PA 2W04A 1V74A 3CCV3 1JN5B 1LOXA 3H51A 3CC73 1VQK3 4RNZA 2IMJA 2GEXA 2YFLB 1UI7A 2UX0A 3JUPA 3UJMA 2E2VA 4OUQA 1NJI4 1YVBI 3JVCA 1QJGA 1EKMA 4OK0A 2SBLA 3DUKA 3MKIA 1ULJB 1TP6A 3X3ZA 2XFSA 5AIIA 4GL6A 1O7WB 3BNEA 3NBJA 2WOFA 3NX0A 4KFEA 3K5TA 3NM2A 2IA7A 1Q864 2XRXB 3LT8A 3GWRA 3G16A 3EN1B 5FGOA 4XB5A 3FH1A 5BXQA 5JBSA 7STDA 3I553 3BNCA 1N9JA 2OCTA 2F99A 1NU3A 3H3HA 3OXAA 1D6ZA 5CXOA 1KD14 2FNQA 4IIAA 5CF2A 2CFLA 3LYGA 1OF5A 1IQXA 2XGNA 3LTDA 4H3UA 4N6NB 1KQS2 3CPW2 3ECFA 1VQO3 1O7PB 1GS3A 3AMOB 2XF3A 2Z6BA 3G8ZA 1YHQ3 4MMYB 2K54A 3LMLA 4WP5A 2YFIB 3F7XA 5IG5A 4FMBA 3ALAA 1HU9A 2V1LA 3QRDA 3CD63 2Z76A 1YGEA 3DY5A 2E2UA 4RZMA 2WOHA 2FXTA 1VQ53 1TIJA 1ASKA 3HK4A 5D82A 1W6CA 2XSOB 1IQYA 1LNHA 4AKYA 4HM0B 1SPUA 2W03A 1DVDA 3FF2A 3L0RA 1YIT3 3EN8A 3FGYA 2XH9A 3PCRA 3VSYA 1KC84 4HJLB 1MOLA 5IG4A 5HGRA 2HMLB 3NBBA 2IUJA 5KP4A 2WGOA 5LC6A 4U13A 4EYCA 5A0OB 1N8R4 3EQQB 1AR0A 3F8XA 3FKAA 1JB4A 2WGQA 4N6LA 1U5OA 1JRQA 3Q2PA 2CC3A 2P38A 3CNMA 3F7SA 3DMCA 3ROBA 3EHCA 3CXC2 3KE7A 3SOAA 2RCDA 3PGBA 1Q42A 1A90A 3MPHA 1ZX2A 4STDA 5AYSC 3FLJA 2BT3A 1RJOA 3EF8A 2P09A 4HVNA 1W4NA 1W02A 3KSPA 2PNCA 3NQYA 2BMOB 3NQZA 3BNDA 4AEQA 3CCL3 3UL6A 1NB3I 5BVBA 2F98A 3GZXB 1A67A 4FMDA 1FGRA 5CF1A 3K9MC 3D9RA 3MYTA 4LSOA 2RFRA 3MWZA 3B7CA 1OGZA 3PZWA 2F86B 1Z1SA 3LH4A 2C11A 2OOVC 1K41A 1VZZA 2KXGA 1OHPA 1FA3A 4X2OA 5IERA 5AI1A 1KSIA 1E97A 3DGMA 4HM7B 5JPPA 3CCJ3 4O8SA 1DMNA 1L5GB 2P0XA 3FZWA 1MNLA 3CCR3 4XBXA 1C7HA 3MHEA 3IMAB 4WWUC 2CKFB 3T0UA 3X41A 4R9LA 5I97A 1M904 1GD4A 1Q824 1OGXA 4OVMA 3S27A 3CC23 1WTHA 1K28A 3U97A 2CK3H 1CQSA 3OWUA 1Q40A 4FCJA 3X42A 2MF7A 3V92A 1J2BA 1IV9A 3MG3A 4K61A 1IQ8A 5AIHA 2QEX3 1NB5I 3KSED 3NV0A 3Q90A 4X2HA 4KVHA 3B4OA 2O9UX 3BLZA 2QGUA 3GZBA 4HM2B 2JQ5A 3GZYB 3DZLA 1LVNA 3CCE3 5DREA 3CMA3 1N8QA 5IEOA 4HZBB 1WQLB 1W6GA 1OH0A 1VQ93 1BUQA 2XSHB 1GY5A 1NDOB 2CWTA 1F8NA 1YJW3 3GAXA 1K9M4 1M9GA 4L8PA 3MG1A 3K0ZA 2W56A 1STDA 2JDIH 3V98A 5IF6A 5IEPA 1JV2B 2CHCA 1IT7A 1VQ73 1FGMA 2P0MA 4MMZB 4XM4A 1STFI 3MG2A 1O7GB 2KRTA 2ZDJA 3FG4A 3D3LA 2HMJB 3E99A 1GD3A 3EJVA 3WOEB 2XR8B 3F40A 5CLKA 3B8LA 3WDGB 4CCVA 4LMIA 1QVG2 2YFJB 5JPUA 2Z7AA 4O3VA 4BTYA 1IVUA 1O7HB 2QIYA 5IG3A 1PU4A 1WMOA 3JUOA 1S5AA 3MSOA 3LT9A 3LXUX 2OTJ3 4EV5A 4HM8B 5AIFA 1VQ63 1SJWA 4ZM8A 1JNQA 1IDPA 1DMMA 3CME3 2YX9A 1O7MB 1AV4A 1JKGA 1OF5B 3OWYA 4K1VA 3DGOA 3HX8A 3N54B 3CCU3 3IJEB 1WMNA 5EVHA 3FSDA 2W56B 1E3RA 1N5HA 2CWVA 4FR9A 3LZAA 2OQEA 2CW9A 4NREA 3WOFB 1QMAA 3PXMA 3GZRA 2PZVA 1JJ22 1CYUA 1QVF2 2XGLA 3KKGA 4Q53A 3F9SA 1HKXA 4HM1B 3HIGA 3Q1CA 4R9KA 3JUNA 3V99A 1IK3A 2ML5A 1FGOA 5EEOA 3ER7A 3N8BA 4QWTA 3M8CA 3CCM3 1VQL3 1QAKA 5CK6A 1W2B2 3HIIA 2STDA 6STDA 1VQN3 2IUKA 2K0MA 3VGNA 3OV4A 3WMDA 5AEUB 4PEJA 1G96A 2D1WA 3EC9A 2OTL3 1A2KA 5IG0A 1JKGB 2B1XB 3IPTA 2D42A 3I563 1SQWA 3X40A 1ULIB 1CYVA 4WYKA 1RKYA 3OWSA 1O7NB 1NO3A 3RGAA 2E2TA 3B4PA 3OW22 3JUQA 4H61A 1WNHA 2BMRB 3LTAA 5STDA 3UB1A 2CFWA 4FMAA 3G713 1JN5A 1D6YA 2XFTA 3NXJA 1N9EA 5AEWB 1JB5A 4JF8A 2W9QA 2RGQA 1TFKA 2Y73A 2LQVA 2MC8A 1DMQA 3KZTA 1YIJ3 3EBTA 4XDVA 1US1A 1GYBA 3LTCA 4RNYA 2GBXB 2CIUA 3FCSB 3K63A 1OUNA 2INXA 3DGNA 1OPYA 1CEWI 1Q814 4HM5B 3FG1A 4R4KA 3EX9A 3SEDA 1ROAA 5ELJA 1U8CB 1YJ93 1RN7A 1RRHA 4NHFA 2L4VA 3VF1A 4FCMA 2OWPA 3RGRA 4N6TA 4J8TA 2ML6A 1OHOA 3NM7A 3FG3A 1IVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF0 A;  5DRV A;  5D83 A;  3K7C A;  3A76 A;  5G2G A;  4R1K A;  5FW5 A;  1Q40 B;  1W01 A;  3CU3 A;  3CNX A;  3NV0 B;  3S5C A;  4HKV B;  4MJD A;  4HZ9 B;  1UUV B;  2I9W A;  3NBR A;  3NHX A;  2GBW B;  3F8H A;  4XDW A;  5AIG A;  1JB2 A;  4L8O A;  1W6Y A;  3JUM A;  3F14 A;  2BMQ B;  4LGQ A;  3STD A;  4LEH A;  2BNG A;  3OX9 A;  4XBY A;  4N3V A;  2R4I A;  3DXO A;  1ISK A;  2W2C A;  3NUV A;  4HM4 B;  2A15 A;  1OHS A;  2Z77 A;  1E3V A;  3CPO A;  4HM3 B;  5KP3 A;  1W00 A;  2GXF A;  3EBY A;  3DM8 A;  1OCV A;  2B24 B;  1NWW A;  3T8U A;  2HMM B;  2HMK B;  8CHO A;  4J9A A;  2GEY A;  1EG9 B;  3GRD A;  3I0Y A;  3HZP A;  3UNL A;  4ORL A;  1EA2 A;  4HM6 B;  1GY7 A;  1ZO2 A;  1UUW B;  4XBT A;  5KP1 A;  1TUH A;  3BB9 A;  2HMO B;  4CDL A;  3SOY A;  1GY6 A;  5TGN A;  4L7K A;  4WYK B;  5D81 A;  2HMN B;  4K1U A;  4I4K A;  3G0K A;  4GB5 A;  3T8N A;  1JN5 B;  3H51 A;  2IMJ A;  2GEX A;  2YFL B;  2UX0 A;  3JUP A;  3UJM A;  4OUQ A;  1QJG A;  3DUK A;  3MKI A;  1ULJ B;  1TP6 A;  5AII A;  1O7W B;  3NM2 A;  2XRX B;  3GWR A;  3G16 A;  3EN1 B;  4XB5 A;  3FH1 A;  5BXQ A;  7STD A;  5CXO A;  2F99 A;  1NU3 A;  3H3H A;  3OXA A;  4IIA A;  5CF2 A;  3LYG A;  1OF5 A;  4H3U A;  3ECF A;  1O7P B;  1GS3 A;  3G8Z A;  2K54 A;  4WP5 A;  2YFI B;  3F7X A;  5IG5 A;  2Z76 A;  4RZM A;  1ASK A;  3HK4 A;  5D82 A;  2XSO B;  4HM0 B;  3FF2 A;  3EN8 A;  3FGY A;  3VSY A;  4HJL B;  5IG4 A;  5HGR A;  2HML B;  5KP4 A;  4U13 A;  3EQQ B;  1AR0 A;  3F8X A;  3FKA A;  1JB4 A;  1U5O A;  3CNM A;  3F7S A;  3DMC A;  3ROB A;  3EHC A;  3KE7 A;  3SOA A;  2RCD A;  1Q42 A;  1ZX2 A;  4STD A;  3FLJ A;  3EF8 A;  4HVN A;  1W02 A;  3KSP A;  2BMO B;  5BVB A;  2F98 A;  3GZX B;  5CF1 A;  3D9R A;  3MYT A;  2RFR A;  3B7C A;  1OGZ A;  2F86 B;  1Z1S A;  1K41 A;  1VZZ A;  1OHP A;  4X2O A;  5IER A;  5AI1 A;  1E97 A;  4HM7 B;  5JPP A;  1DMN A;  3FZW A;  4XBX A;  1C7H A;  3MHE A;  4WWU C;  2CKF B;  4R9L A;  1OGX A;  4OVM A;  1CQS A;  3OWU A;  1Q40 A;  4FCJ A;  3MG3 A;  5AIH A;  3NV0 A;  3Q90 A;  4X2H A;  4KVH A;  3B4O A;  3BLZ A;  2QGU A;  3GZB A;  4HM2 B;  2JQ5 A;  3GZY B;  3DZL A;  5DRE A;  5IEO A;  4HZB B;  1WQL B;  1OH0 A;  1BUQ A;  2XSH B;  1GY5 A;  1NDO B;  4L8P A;  3MG1 A;  3K0Z A;  1STD A;  5IF6 A;  5IEP A;  2CHC A;  4XM4 A;  3MG2 A;  1O7G B;  2HMJ B;  3E99 A;  3EJV A;  3F40 A;  2XR8 B;  5CLK A;  3B8L A;  4LMI A;  2YFJ B;  5JPU A;  2Z7A A;  1O7H B;  2QIY A;  5IG3 A;  3JUO A;  1S5A A;  3MSO A;  4HM8 B;  5AIF A;  1SJW A;  1IDP A;  1DMM A;  1O7M B;  1JKG A;  1OF5 B;  3OWY A;  4K1V A;  3HX8 A;  5EVH A;  3FSD A;  1E3R A;  3LZA A;  1QMA A;  3GZR A;  2PZV A;  3KKG A;  4Q53 A;  3F9S A;  1HKX A;  4HM1 B;  4R9K A;  3JUN A;  3ER7 A;  3M8C A;  5CK6 A;  2STD A;  6STD A;  3VGN A;  3OV4 A;  3WMD A;  5AEU B;  4PEJ A;  3EC9 A;  1A2K A;  5IG0 A;  1JKG B;  2B1X B;  3IPT A;  1ULI B;  4WYK A;  3OWS A;  1O7N B;  3RGA A;  3B4P A;  3JUQ A;  2BMR B;  5STD A;  1JN5 A;  3NXJ A;  5AEW B;  1JB5 A;  2RGQ A;  1DMQ A;  3KZT A;  3EBT A;  4XDV A;  1GYB A;  2GBX B;  1OUN A;  2INX A;  1OPY A;  4HM5 B;  3EX9 A;  3SED A;  4FCM A;  2OWP A;  3RGR A;  4J8T A;  1OHO A;  5IEN A; 
#chains in the Genus database with same CATH topology
 3FF0 A;  1UI8 A;  3AMO A;  1YVS A;  1BIR A;  2W6J H;  1DVC A;  1SII A;  1AY7 A;  1T3B A;  5LC7 A;  8RNT A;  1WMP A;  5DRV A;  1LXE A;  5D83 A;  1UGI A;  4G1M B;  1R4C A;  4GSP A;  1W7C A;  3BIR A;  3N9H A;  2Y74 A;  1IU7 A;  3K7C A;  4FMC A;  3KFQ C;  3CCS 3;  1TFO A;  3DGL A;  4N6U A;  1PFP A;  2CG1 A;  1T2H A;  3A76 A;  1C54 A;  5G2G A;  3U1W A;  1KWI A;  1A2V A;  4R1K A;  4R80 A;  1Q40 B;  5FW5 A;  5IEN A;  4HBR A;  4K90 B;  4WFO A;  1W2Z A;  1W01 A;  3EB8 A;  3CU3 A;  5ELU A;  3CNX A;  3DH2 A;  3NV0 B;  3CC4 3;  3S5C A;  1PYL A;  4HKV B;  2Q07 A;  2C10 A;  4MJD A;  4HZ9 B;  3WA2 X;  3LOY A;  1UUV B;  2H0I A;  1M1X B;  1IT8 A;  3DGY A;  2I9W A;  3NBR A;  2CWU A;  3NHX A;  1QAL A;  2GBW B;  1Q7Y 4;  1IVX A;  3SXX A;  4HYZ A;  2ZL8 A;  3S29 A;  3BNB A;  1QAF A;  3F8H A;  4XDW A;  2RSX A;  5AIG A;  1BRS A;  1JB2 A;  4N6O B;  4L8O A;  7GSP A;  2BHM A;  1M1K 4;  2XEP A;  2GU3 A;  1W6Y A;  3G6E 3;  2W0Q A;  5CXO A;  1BVI A;  3F14 A;  1B20 A;  2BMQ B;  3EE1 A;  3BU4 A;  3JUM A;  4LGQ A;  3G4S 3;  1VQK 3;  2BO9 B;  2L1S A;  3PCS A;  3STD A;  4LZI A;  4LEH A;  4IT7 A;  2BU4 A;  1Y4K A;  2BNG A;  1AVL A;  3OX9 A;  4XBY A;  2QA4 3;  1B2S A;  4N3V A;  2CX1 A;  2OOV A;  3AGN A;  2R4I A;  1RRL A;  2CH9 A;  3DXO A;  1ISK A;  3X3Y A;  3PS8 A;  2W2C A;  4EXR A;  4MMX B;  3TDG A;  4JRF A;  1B21 A;  1X1U A;  3NUV A;  4LYL B;  1K73 4;  1T5Y A;  4HM4 B;  2A15 A;  1YI2 3;  2CFK A;  3SX1 A;  2CG0 A;  1OHS A;  2O3O A;  1BNG A;  4EV2 A;  3QK9 A;  4MEI A;  1BNE A;  3GSP A;  1BRG A;  2Z77 A;  1E3V A;  3CPO A;  4HM3 B;  5KP3 A;  1DYU A;  1W00 A;  2F56 A;  4TX4 A;  5EQL A;  2GXF A;  3EBY A;  1FYS A;  2RNT A;  3UL5 A;  3DM8 A;  1BUJ A;  1OCV A;  3HOH A;  3KII A;  1LNI A;  2GU1 A;  1GMP A;  2B24 B;  3RDE A;  4BTX A;  1IVW A;  1BNF A;  2KCD A;  3LTB A;  1FUW A;  1IV7 A;  1FUT A;  3O8Y A;  5BU4 A;  1FGT A;  1NWW A;  3T8U A;  2HMM B;  2HMK B;  4RBN A;  8CHO A;  4J9A A;  3J7Y d;  1FGQ A;  3S28 A;  4EC6 A;  1S72 3;  2GEY A;  1JBT A;  1N5P A;  1VQM 3;  3S67 A;  1VQ4 3;  1EG9 B;  1D6U A;  4WHA A;  1ZS7 A;  3X3X A;  1FZU A;  3ZG0 A;  1RMS A;  1W5Z A;  2BIR A;  3GRD A;  3HZP A;  3I0Y A;  4ILF A;  4O02 B;  3UNL A;  2LYX A;  2ZA4 A;  4DKI A;  1VQP 3;  3CCQ 3;  1BSB A;  2CFD A;  3SVA A;  4ORL A;  5IW9 A;  1GOY A;  1BNI A;  1MWR A;  1EA2 A;  4HM6 B;  4FCZ A;  1YJN 3;  3PYJ A;  1EQK A;  2KF5 A;  1SIH A;  1EEJ A;  4IPB A;  1GY7 A;  1ZO2 A;  4KFD A;  4N6M A;  3SLU A;  1UUW B;  1UW1 A;  4XBT A;  4AKZ A;  3CC2 3;  5KP1 A;  3WOD G;  1TUH A;  1K8A 4;  1G0T A;  2OQE C;  4KFF A;  3BB9 A;  3HI7 A;  2HMO B;  4BL2 A;  4CDL A;  3SOY A;  4EBG A;  1ROV A;  4BTW A;  4KZ1 A;  4N6V 0;  1GY6 A;  2M7O A;  1OAC A;  1FUS A;  1VQ8 3;  5TGN A;  5AYR B;  1VQQ A;  4L7K A;  4WYK B;  1AQZ A;  5D81 A;  4BU4 A;  2HMN B;  2P05 A;  1RGL A;  2WO0 A;  4K1U A;  1TU5 A;  1B2Z A;  1ZGX A;  4I4K A;  1V58 A;  1LQM B;  3KN4 A;  4O2H A;  2FGT A;  3WA3 A;  3G0K A;  1AVK A;  4GB5 A;  2CFG A;  3T8N A;  2W9P A;  2W04 A;  1V74 A;  3CCV 3;  1JN5 B;  1LOX A;  3H51 A;  4RNT A;  3CC7 3;  4RNZ A;  3URP A;  2IMJ A;  2GEX A;  2YFL B;  1UI7 A;  2UX0 A;  1BSC A;  3JUP A;  9RNT A;  3AHW A;  3UJM A;  2E2V A;  3KCH A;  4OUQ A;  1NJI 4;  1YVB I;  2SAR A;  1QJG A;  3JVC A;  1EKM A;  1DET A;  4OK0 A;  2IY2 A;  2SBL A;  3DUK A;  5M18 A;  3MKI A;  1ULJ B;  1TP6 A;  3X3Z A;  2XFS A;  5AII A;  4GL6 A;  1O7W B;  3BNE A;  3NBJ A;  2WOF A;  3NX0 A;  1RGF A;  3K5T A;  3NM2 A;  4KFE A;  2IA7 A;  1Q86 4;  2XRX B;  3LT8 A;  3GWR A;  3G16 A;  3EN1 B;  5FGO A;  4XB5 A;  4BL3 A;  3FH1 A;  1IYY A;  5BXQ A;  1RGE A;  5JBS A;  7STD A;  3I55 3;  3BNC A;  1N9J A;  2OCT A;  1MWT A;  1NU3 A;  2F99 A;  3H3H A;  1D6Z A;  1RGG A;  2ZHX B;  3OXA A;  1KD1 4;  2FNQ A;  4NPB A;  4IIA A;  5HOH A;  5CF2 A;  2CFL A;  3LYG A;  1NB5 I;  1OF5 A;  1IQX A;  2AAD A;  1RCL A;  1BRJ A;  1V57 A;  2XGN A;  3LTD A;  4H3U A;  4KT3 B;  4N6N B;  1KQS 2;  3CPW 2;  3ECF A;  4GHO A;  2IYJ A;  1VQO 3;  1O7P B;  1GS3 A;  3AMO B;  2XF3 A;  2Z6B A;  1GMR A;  3G8Z A;  4MMY B;  1YHQ 3;  2K54 A;  3LML A;  4WP5 A;  1RGH A;  7RNT A;  2YFI B;  3F7X A;  6RNT A;  5IG5 A;  1B27 A;  3ALA A;  1HU9 A;  1I2G A;  4FMB A;  2V1L A;  3QRD A;  1I8V A;  3CD6 3;  2Z76 A;  1YGE A;  3DY5 A;  2E2U A;  4RZM A;  2WOH A;  1JZO A;  2FXT A;  2HOH A;  1VQ5 3;  1JBR A;  1TIJ A;  1ASK A;  3HK4 A;  3RNT A;  5D82 A;  1W6C A;  5M19 A;  2C4B A;  2XSO B;  1IQY A;  1MGR A;  1LNH A;  4AKY A;  4HM0 B;  1GSP A;  1SPU A;  2W03 A;  1DVD A;  3FF2 A;  3L0R A;  1EUI C;  2F5M A;  1YIT 3;  3EN8 A;  3FGY A;  2XH9 A;  3PCR A;  3VSY A;  1KC8 4;  4HJL B;  4CJN A;  1G02 A;  1MOL A;  1RGK A;  5IG4 A;  5HGR A;  2HML B;  3NBB A;  2IUJ A;  5KP4 A;  2WGO A;  1BNJ A;  5LC6 A;  4U13 A;  4EYC A;  5A0O B;  1N8R 4;  3EQQ B;  1RN4 A;  1Q9E A;  1AR0 A;  3F8X A;  3FKA A;  5G1K A;  1JB4 A;  1I3I A;  2UUG C;  2WGQ A;  1TRP A;  1BNR A;  4N6L A;  1U5O A;  1BGS A;  1B2U A;  1JRQ A;  2CC3 A;  3Q2P A;  2P38 A;  1HZ1 A;  3CNM A;  4HOH A;  3F7S A;  3DMC A;  3ROB A;  3EHC A;  3CXC 2;  3KE7 A;  3SOA A;  2RCD A;  3PGB A;  1Q42 A;  1A90 A;  3MPH A;  1ZX2 A;  4STD A;  5AYS C;  1LOV A;  3ZFZ A;  3FLJ A;  2BT3 A;  1RJO A;  3EF8 A;  2P09 A;  4HVN A;  1W4N A;  1W02 A;  1UUG B;  3KSP A;  2PNC A;  3NQY A;  2BMO B;  3NQZ A;  3BND A;  4AEQ A;  3CCL 3;  1BAN A;  1RNB A;  3UL6 A;  1NB3 I;  5BVB A;  2F98 A;  3GZX B;  1A67 A;  4FMD A;  1FGR A;  1R4Y A;  3WHO A;  5CF1 A;  3K9M C;  3D9R A;  3MYT A;  4LSO A;  2RFR A;  3MWZ A;  1BRN L;  3B7C A;  1OGZ A;  3PZW A;  2F86 B;  1Z1S A;  3LH4 A;  2C11 A;  1I0V A;  1RGC A;  1K41 A;  2OOV C;  1VZZ A;  2KXG A;  1OHP A;  1FA3 A;  1PY3 A;  4X2O A;  1FW7 A;  5IER A;  1I2E A;  5AI1 A;  1KSI A;  1E97 A;  3DGM A;  4HM7 B;  5JPP A;  1I0X A;  3CCJ 3;  4O8S A;  1DMN A;  1L5G B;  2P0X A;  3FZW A;  1MNL A;  3CCR 3;  1X1W A;  4XBX A;  5GSP A;  1C7H A;  3MHE A;  1JZD A;  3IMA B;  2CKF B;  4WWU C;  3T0U A;  3X41 A;  3A5E A;  2F5W A;  4R9L A;  5I97 A;  1M90 4;  1A2P A;  1B2X A;  1GD4 A;  2KF4 A;  1Q82 4;  1UCK A;  1OGX A;  4OVM A;  1RTU A;  1X1X A;  1WTH A;  3S27 A;  2AAE A;  6GSP A;  1K28 A;  1TRQ A;  3U97 A;  2CK3 H;  5RNT A;  1CQS A;  2CX0 A;  1Q40 A;  3OWU A;  4FCJ A;  2MF7 A;  3V92 A;  3X42 A;  1J2B A;  1IV9 A;  3MG3 A;  1BSD A;  4J5K A;  1IQ8 A;  4K61 A;  1RGA A;  5AIH A;  3KSE D;  3NV0 A;  3Q90 A;  4X2H A;  4KVH A;  2QEX 3;  4BIR A;  3B4O A;  2O9U X;  3BLZ A;  2QGU A;  3GZB A;  4HM2 B;  2JQ5 A;  1LQG C;  3GZY B;  2GSP A;  3DZL A;  1I2F A;  1LVN A;  3CCE 3;  5DRE A;  3CMA 3;  1YNV X;  1N8Q A;  4J5G A;  1I3F A;  5IEO A;  4HZB B;  1DE3 A;  1WQL B;  1BAO A;  1W6G A;  1OH0 A;  1VQ9 3;  1BUQ A;  2XSH B;  4EW5 A;  1UCI A;  1GY5 A;  1NDO B;  2CWT A;  1F8N A;  1YJW 3;  3GAX A;  1K9M 4;  1HYF A;  1M9G A;  4L8P A;  5G1L A;  1MGW A;  3MG1 A;  3K0Z A;  2W56 A;  1STD A;  2JDI H;  3V98 A;  2J8X B;  1RLS A;  5IF6 A;  3D5I A;  5IEP A;  1JV2 B;  2CHC A;  1IT7 A;  1VQ7 3;  2UGI A;  1FGM A;  2P0M A;  4MMZ B;  4XM4 A;  1BNS A;  1STF I;  1O7G B;  2KRT A;  2ZDJ A;  3FG4 A;  3MG2 A;  2F4Y A;  3D3L A;  2HMJ B;  3E99 A;  1GD3 A;  2R41 A;  3EJV A;  3WOE B;  2XR8 B;  3F40 A;  5CLK A;  3B8L A;  3WDG B;  4CCV A;  4LMI A;  1QVG 2;  2YFJ B;  5JPU A;  2Z7A A;  4O3V A;  4BTY A;  5BIR A;  1IVU A;  1O7H B;  2QIY A;  5IG3 A;  1PU4 A;  1WMO A;  3JUO A;  1S5A A;  3MSO A;  3LT9 A;  3LXU X;  2OTJ 3;  4EV5 A;  4HM8 B;  5AIF A;  2H0G A;  1VQ6 3;  1SJW A;  4ZM8 A;  1JNQ A;  1IDP A;  1DMM A;  3CME 3;  2K3D A;  1BSE A;  2YX9 A;  1O7M B;  1AV4 A;  1JKG A;  1BRH A;  1OF5 B;  3OWY A;  4K1V A;  3DGO A;  3HX8 A;  3N54 B;  3CCU 3;  3IJE B;  1WMN A;  4CPK A;  5EVH A;  3FSD A;  2W56 B;  1E3R A;  1UGH I;  1N5H A;  2CWV A;  3Q3F A;  3LZA A;  4FR9 A;  2OQE A;  2CW9 A;  4NRE A;  3WOF B;  1RNT A;  1RCK A;  1QMA A;  1BOX A;  3PXM A;  3GZR A;  1X1Y A;  2PZV A;  3D79 A;  1JJ2 2;  1CYU A;  3SYU A;  1LOY A;  1QVF 2;  2XGL A;  1TJD A;  3KKG A;  4Q53 A;  3F9S A;  1HKX A;  4HM1 B;  1LRA A;  3HIG A;  3Q1C A;  4R9K A;  3JUN A;  3V99 A;  1IK3 A;  2ML5 A;  1FGO A;  5EEO A;  3ER7 A;  1BRI A;  3N8B A;  1MWS A;  4QWT A;  3M8C A;  1TTO A;  3CCM 3;  1VQL 3;  1QAK A;  1YGW A;  5CK6 A;  1W2B 2;  3HII A;  1UCL A;  2STD A;  1MWU A;  6STD A;  1GOV A;  2IUK A;  2K0M A;  1VQN 3;  3VGN A;  3OV4 A;  3WMD A;  5AEU B;  2RBI A;  1G96 A;  3AHS A;  4PEJ A;  2D1W A;  3EC9 A;  2OTL 3;  1A2K A;  5IG0 A;  1JKG B;  2B1X B;  3IPT A;  2D42 A;  3I56 3;  1SQW A;  3X40 A;  1GOU A;  1ULI B;  1CYV A;  2KAA A;  4WYK A;  1T2I A;  3OWS A;  1RKY A;  1JBS A;  1BU4 A;  1O7N B;  1NO3 A;  3RGA A;  2E2T A;  3B4P A;  3OW2 2;  1RSN A;  3JUQ A;  1RDS A;  4H61 A;  1SAR A;  1WNH A;  2BMR B;  3D5G A;  3LTA A;  5STD A;  3UB1 A;  2CFW A;  4FMA A;  3G71 3;  1JN5 A;  1D6Y A;  1I70 A;  2XFT A;  1RHL A;  1N9E A;  3NXJ A;  4HAA A;  5AEW B;  1LOW A;  1JB5 A;  1GMQ A;  2KF6 A;  4JF8 A;  2W9Q A;  1UDI I;  2RGQ A;  1TFK A;  2Y73 A;  2LQV A;  2MC8 A;  1DMQ A;  3KZT A;  1YIJ 3;  4I5Q A;  3EBT A;  4XDV A;  1US1 A;  3ZG5 A;  1GYB A;  3LTC A;  4RNY A;  1RN1 A;  1B2M A;  2GBX B;  2CIU A;  3FCS B;  3K63 A;  1OUN A;  2INX A;  3DGN A;  1OPY A;  3AGO A;  1CEW I;  1Q81 4;  4HM5 B;  3FG1 A;  4R4K A;  3WR2 A;  5M1A A;  3EX9 A;  2H0H A;  3SED A;  1Q7H A;  1ROA A;  5ELJ A;  1U8C B;  2KF3 A;  1YJ9 3;  1RN7 A;  1RRH A;  1NNV A;  4NHF A;  1BSA A;  1BRK A;  1CH0 A;  2L4V A;  3D4A A;  3VF1 A;  4FCM A;  2OWP A;  3RGR A;  4N6T A;  1B3S A;  4J8T A;  2ML6 A;  1OHO A;  3NM7 A;  1UCJ A;  3FG3 A;  1IVV A; 
#chains in the Genus database with same CATH homology
 3FF0 A;  1UI8 A;  3AMO A;  2W6J H;  1DVC A;  1SII A;  5LC7 A;  1WMP A;  5DRV A;  1LXE A;  5D83 A;  4G1M B;  1R4C A;  1W7C A;  3N9H A;  2Y74 A;  1IU7 A;  3K7C A;  4FMC A;  3KFQ C;  3CCS 3;  1TFO A;  3DGL A;  4N6U A;  1PFP A;  2CG1 A;  3A76 A;  5G2G A;  3U1W A;  1KWI A;  1A2V A;  4R1K A;  4R80 A;  1Q40 B;  5FW5 A;  5IEN A;  4HBR A;  4K90 B;  4WFO A;  1W2Z A;  1W01 A;  3EB8 A;  3CU3 A;  5ELU A;  3CNX A;  3NV0 B;  3CC4 3;  3S5C A;  4HKV B;  2Q07 A;  2C10 A;  4MJD A;  4HZ9 B;  3WA2 X;  3LOY A;  1UUV B;  1M1X B;  1IT8 A;  2I9W A;  3NBR A;  2CWU A;  3NHX A;  1QAL A;  2GBW B;  1Q7Y 4;  1IVX A;  3SXX A;  4HYZ A;  2ZL8 A;  3S29 A;  3BNB A;  1QAF A;  3F8H A;  4XDW A;  2RSX A;  5AIG A;  1JB2 A;  4N6O B;  1M1K 4;  4L8O A;  2BHM A;  2XEP A;  2GU3 A;  1W6Y A;  3G6E 3;  2W0Q A;  3JUM A;  3F14 A;  2BMQ B;  3EE1 A;  4LGQ A;  3G4S 3;  2BO9 B;  3PCS A;  3STD A;  4LZI A;  4LEH A;  4IT7 A;  1Y4K A;  2BNG A;  1AVL A;  3OX9 A;  4XBY A;  2QA4 3;  4N3V A;  2OOV A;  2R4I A;  1RRL A;  2CH9 A;  3DXO A;  1ISK A;  3X3Y A;  3PS8 A;  2W2C A;  4EXR A;  4MMX B;  3TDG A;  4JRF A;  3NUV A;  1K73 4;  1T5Y A;  4HM4 B;  2A15 A;  1YI2 3;  2CFK A;  3SX1 A;  2CG0 A;  1OHS A;  2O3O A;  4EV2 A;  3QK9 A;  4MEI A;  2Z77 A;  1E3V A;  3CPO A;  4HM3 B;  5KP3 A;  1DYU A;  1W00 A;  4TX4 A;  5EQL A;  2GXF A;  3EBY A;  3UL5 A;  3DM8 A;  1OCV A;  3KII A;  2GU1 A;  3RDE A;  2B24 B;  4BTX A;  1IVW A;  2KCD A;  3LTB A;  1FUW A;  1IV7 A;  3O8Y A;  1FGT A;  1NWW A;  3T8U A;  2HMM B;  2HMK B;  4RBN A;  8CHO A;  4J9A A;  3J7Y d;  1FGQ A;  3S28 A;  4EC6 A;  1S72 3;  2GEY A;  1N5P A;  1VQM 3;  3S67 A;  1VQ4 3;  1D6U A;  1EG9 B;  4WHA A;  3X3X A;  1W5Z A;  3GRD A;  3HZP A;  3I0Y A;  4O02 B;  3UNL A;  2LYX A;  1VQP 3;  3CCQ 3;  2CFD A;  3SVA A;  4ORL A;  5IW9 A;  1EA2 A;  4HM6 B;  4FCZ A;  1YJN 3;  3PYJ A;  1EQK A;  1SIH A;  4N6M A;  4IPB A;  1GY7 A;  1ZO2 A;  4KFD A;  3SLU A;  1UUW B;  1UW1 A;  4XBT A;  4AKZ A;  5KP1 A;  3WOD G;  1TUH A;  1K8A 4;  2OQE C;  4KFF A;  3BB9 A;  3HI7 A;  2HMO B;  4CDL A;  4EBG A;  3SOY A;  1ROV A;  4BTW A;  4KZ1 A;  4N6V 0;  1GY6 A;  2M7O A;  1OAC A;  1VQ8 3;  5TGN A;  5AYR B;  4L7K A;  4WYK B;  5D81 A;  2HMN B;  2P05 A;  4K1U A;  2WO0 A;  1TU5 A;  4O2H A;  4I4K A;  3KN4 A;  2FGT A;  3WA3 A;  3G0K A;  1AVK A;  4GB5 A;  2CFG A;  3T8N A;  2W9P A;  2W04 A;  1V74 A;  3CCV 3;  1JN5 B;  1LOX A;  3H51 A;  3CC7 3;  1VQK 3;  4RNZ A;  2IMJ A;  2GEX A;  2YFL B;  1UI7 A;  2UX0 A;  3JUP A;  3UJM A;  2E2V A;  4OUQ A;  1NJI 4;  1YVB I;  3JVC A;  1QJG A;  1EKM A;  4OK0 A;  2SBL A;  3DUK A;  3MKI A;  1ULJ B;  1TP6 A;  3X3Z A;  2XFS A;  5AII A;  4GL6 A;  1O7W B;  3BNE A;  3NBJ A;  2WOF A;  3NX0 A;  4KFE A;  3K5T A;  3NM2 A;  2IA7 A;  1Q86 4;  2XRX B;  3LT8 A;  3GWR A;  3G16 A;  3EN1 B;  5FGO A;  4XB5 A;  3FH1 A;  5BXQ A;  5JBS A;  7STD A;  3I55 3;  3BNC A;  1N9J A;  2OCT A;  2F99 A;  1NU3 A;  3H3H A;  3OXA A;  1D6Z A;  5CXO A;  1KD1 4;  2FNQ A;  4IIA A;  5CF2 A;  2CFL A;  3LYG A;  1OF5 A;  1IQX A;  2XGN A;  3LTD A;  4H3U A;  4N6N B;  1KQS 2;  3CPW 2;  3ECF A;  1VQO 3;  1O7P B;  1GS3 A;  3AMO B;  2XF3 A;  2Z6B A;  3G8Z A;  1YHQ 3;  4MMY B;  2K54 A;  3LML A;  4WP5 A;  2YFI B;  3F7X A;  5IG5 A;  4FMB A;  3ALA A;  1HU9 A;  2V1L A;  3QRD A;  3CD6 3;  2Z76 A;  1YGE A;  3DY5 A;  2E2U A;  4RZM A;  2WOH A;  2FXT A;  1VQ5 3;  1TIJ A;  1ASK A;  3HK4 A;  5D82 A;  1W6C A;  2XSO B;  1IQY A;  1LNH A;  4AKY A;  4HM0 B;  1SPU A;  2W03 A;  1DVD A;  3FF2 A;  3L0R A;  1YIT 3;  3EN8 A;  3FGY A;  2XH9 A;  3PCR A;  3VSY A;  1KC8 4;  4HJL B;  1MOL A;  5IG4 A;  5HGR A;  2HML B;  3NBB A;  2IUJ A;  5KP4 A;  2WGO A;  5LC6 A;  4U13 A;  4EYC A;  5A0O B;  1N8R 4;  3EQQ B;  1AR0 A;  3F8X A;  3FKA A;  1JB4 A;  2WGQ A;  4N6L A;  1U5O A;  1JRQ A;  3Q2P A;  2CC3 A;  2P38 A;  3CNM A;  3F7S A;  3DMC A;  3ROB A;  3EHC A;  3CXC 2;  3KE7 A;  3SOA A;  2RCD A;  3PGB A;  1Q42 A;  1A90 A;  3MPH A;  1ZX2 A;  4STD A;  5AYS C;  3FLJ A;  2BT3 A;  1RJO A;  3EF8 A;  2P09 A;  4HVN A;  1W4N A;  1W02 A;  3KSP A;  2PNC A;  3NQY A;  2BMO B;  3NQZ A;  3BND A;  4AEQ A;  3CCL 3;  3UL6 A;  1NB3 I;  5BVB A;  2F98 A;  3GZX B;  1A67 A;  4FMD A;  1FGR A;  5CF1 A;  3K9M C;  3D9R A;  3MYT A;  4LSO A;  2RFR A;  3MWZ A;  3B7C A;  1OGZ A;  3PZW A;  2F86 B;  1Z1S A;  3LH4 A;  2C11 A;  2OOV C;  1K41 A;  1VZZ A;  2KXG A;  1OHP A;  1FA3 A;  4X2O A;  5IER A;  5AI1 A;  1KSI A;  1E97 A;  3DGM A;  4HM7 B;  5JPP A;  3CCJ 3;  4O8S A;  1DMN A;  1L5G B;  2P0X A;  3FZW A;  1MNL A;  3CCR 3;  4XBX A;  1C7H A;  3MHE A;  3IMA B;  4WWU C;  2CKF B;  3T0U A;  3X41 A;  4R9L A;  5I97 A;  1M90 4;  1GD4 A;  1Q82 4;  1OGX A;  4OVM A;  3S27 A;  3CC2 3;  1WTH A;  1K28 A;  3U97 A;  2CK3 H;  1CQS A;  3OWU A;  1Q40 A;  4FCJ A;  3X42 A;  2MF7 A;  3V92 A;  1J2B A;  1IV9 A;  3MG3 A;  4K61 A;  1IQ8 A;  5AIH A;  2QEX 3;  1NB5 I;  3KSE D;  3NV0 A;  3Q90 A;  4X2H A;  4KVH A;  3B4O A;  2O9U X;  3BLZ A;  2QGU A;  3GZB A;  4HM2 B;  2JQ5 A;  3GZY B;  3DZL A;  1LVN A;  3CCE 3;  5DRE A;  3CMA 3;  1N8Q A;  5IEO A;  4HZB B;  1WQL B;  1W6G A;  1OH0 A;  1VQ9 3;  1BUQ A;  2XSH B;  1GY5 A;  1NDO B;  2CWT A;  1F8N A;  1YJW 3;  3GAX A;  1K9M 4;  1M9G A;  4L8P A;  3MG1 A;  3K0Z A;  2W56 A;  1STD A;  2JDI H;  3V98 A;  5IF6 A;  5IEP A;  1JV2 B;  2CHC A;  1IT7 A;  1VQ7 3;  1FGM A;  2P0M A;  4MMZ B;  4XM4 A;  1STF I;  3MG2 A;  1O7G B;  2KRT A;  2ZDJ A;  3FG4 A;  3D3L A;  2HMJ B;  3E99 A;  1GD3 A;  3EJV A;  3WOE B;  2XR8 B;  3F40 A;  5CLK A;  3B8L A;  3WDG B;  4CCV A;  4LMI A;  1QVG 2;  2YFJ B;  5JPU A;  2Z7A A;  4O3V A;  4BTY A;  1IVU A;  1O7H B;  2QIY A;  5IG3 A;  1PU4 A;  1WMO A;  3JUO A;  1S5A A;  3MSO A;  3LT9 A;  3LXU X;  2OTJ 3;  4EV5 A;  4HM8 B;  5AIF A;  1VQ6 3;  1SJW A;  4ZM8 A;  1JNQ A;  1IDP A;  1DMM A;  3CME 3;  2YX9 A;  1O7M B;  1AV4 A;  1JKG A;  1OF5 B;  3OWY A;  4K1V A;  3DGO A;  3HX8 A;  3N54 B;  3CCU 3;  3IJE B;  1WMN A;  5EVH A;  3FSD A;  2W56 B;  1E3R A;  1N5H A;  2CWV A;  4FR9 A;  3LZA A;  2OQE A;  2CW9 A;  4NRE A;  3WOF B;  1QMA A;  3PXM A;  3GZR A;  2PZV A;  1JJ2 2;  1CYU A;  1QVF 2;  2XGL A;  3KKG A;  4Q53 A;  3F9S A;  1HKX A;  4HM1 B;  3HIG A;  3Q1C A;  4R9K A;  3JUN A;  3V99 A;  1IK3 A;  2ML5 A;  1FGO A;  5EEO A;  3ER7 A;  3N8B A;  4QWT A;  3M8C A;  3CCM 3;  1VQL 3;  1QAK A;  5CK6 A;  1W2B 2;  3HII A;  2STD A;  6STD A;  1VQN 3;  2IUK A;  2K0M A;  3VGN A;  3OV4 A;  3WMD A;  5AEU B;  4PEJ A;  1G96 A;  2D1W A;  3EC9 A;  2OTL 3;  1A2K A;  5IG0 A;  1JKG B;  2B1X B;  3IPT A;  2D42 A;  3I56 3;  1SQW A;  3X40 A;  1ULI B;  1CYV A;  4WYK A;  1RKY A;  3OWS A;  1O7N B;  1NO3 A;  3RGA A;  2E2T A;  3B4P A;  3OW2 2;  3JUQ A;  4H61 A;  1WNH A;  2BMR B;  3LTA A;  5STD A;  3UB1 A;  2CFW A;  4FMA A;  3G71 3;  1JN5 A;  1D6Y A;  2XFT A;  3NXJ A;  1N9E A;  5AEW B;  1JB5 A;  4JF8 A;  2W9Q A;  2RGQ A;  1TFK A;  2Y73 A;  2LQV A;  2MC8 A;  1DMQ A;  3KZT A;  1YIJ 3;  3EBT A;  4XDV A;  1US1 A;  1GYB A;  3LTC A;  4RNY A;  2GBX B;  2CIU A;  3FCS B;  3K63 A;  1OUN A;  2INX A;  3DGN A;  1OPY A;  1CEW I;  1Q81 4;  4HM5 B;  3FG1 A;  4R4K A;  3EX9 A;  3SED A;  1ROA A;  5ELJ A;  1U8C B;  1YJ9 3;  1RN7 A;  1RRH A;  4NHF A;  2L4V A;  3VF1 A;  4FCM A;  2OWP A;  3RGR A;  4N6T A;  4J8T A;  2ML6 A;  1OHO A;  3NM7 A;  3FG3 A;  1IVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...