4HM7B

Naphthalene 1,2-dioxygenase bound to styrene
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to styrene
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm7B00
4K1VA 3SOAA 3JUQA 1JB5A 4XBTA 4XDVA 2F99A 4L8PA 5D82A 3G0KA 1E97A 2HMMB 1W6YA 5CLKA 3B4PA 5HGRA 5KP1A 3NXJA 1E3RA 3HZPA 3F7XA 5IEPA 1BUQA 2W2CA 3EHCA 3EX9A 5DREA 1K41A 1WQLB 3K7CA 5IG3A 3G16A 3F14A 2F98A 3IPTA 1HKXA 3FF2A 1JKGB 1OUNA 3CNXA 5FW5A 5TGNA 3FKAA 4L8OA 2STDA 1AR0A 2HMNB 2GXFA 3RGRA 1Q40B 4HM6B 2B24B 3JUPA 4HM7B 2YFIB 5KP4A 1ZO2A 5IF6A 4N3VA 5IEOA 1STDA 3GZXB 4MJDA 5EVHA 1W02A 1JB4A 1OHSA 4LGQA 4HKVB 3KZTA 2GBXB 4FCMA 2IMJA 2XRXB 3T8UA 1VZZA 1E3VA 4J9AA 2HMOB 3EN1B 4CDLA 3DXOA 2QIYA 3H51A 3DZLA 3I0YA 3F40A 4U13A 3T8NA 1Q42A 3CNMA 1U5OA 5AIGA 3F8XA 3VGNA 8CHOA 3SEDA 4I4KA 3JUOA 2GBWB 1NU3A 5JPPA 1OPYA 2BMOB 4HM4B 2QGUA 4HM5B 3EJVA 5AEWB 1NWWA 4OUQA 1O7PB 2OWPA 1OCVA 6STDA 3GZYB 1GS3A 3KE7A 4HVNA 1GY6A 1CQSA 5CF1A 3NUVA 1OH0A 4Q53A 5IG5A 1JN5A 3MKIA 2Z7AA 3D9RA 5AIIA 1QMAA 4J8TA 1OHPA 1OGZA 3EBYA 1W00A 3GZRA 5CF2A 3KKGA 2INXA 4HM8B 1ISKA 1GY5A 4RZMA 3MG1A 3MG2A 3LZAA 1Q40A 2BMRB 4ORLA 2Z76A 5CK6A 2RCDA 3RGAA 4XM4A 3S5CA 3MYTA 4R9LA 1OHOA 3B4OA 2RFRA 1ZX2A 2CHCA 5JPUA 1OF5A 5IG4A 1ULJB 3STDA 2HMLB 3VSYA 3EC9A 4OVMA 1TP6A 4WWUC 2GEYA 3JUNA 2BMQB 4HM1B 3CPOA 4WYKB 2BNGA 3ER7A 3OX9A 3NV0A 2YFLB 3CU3A 3NBRA 3FGYA 4XB5A 4WP5A 4FCJA 4HZBB 3DMCA 3OXAA 4XBYA 5AIHA 3B7CA 1UUWB 3GRDA 4HM0B 1UUVB 1DMQA 1ASKA 3FLJA 3OWYA 3UJMA 4IIAA 3KSPA 2B1XB 3K0ZA 3H3HA 2GEXA 3MG3A 5AEUB 3BLZA 1C7HA 2I9WA 4HZ9B 3FSDA 4XDWA 5AIFA 2HMJB 2HMKB 3BB9A 2UX0A 4LMIA 3A76A 3HX8A 1JKGA 1O7GB 3EF8A 5DRVA 3GWRA 3DUKA 3MSOA 5CXOA 2JQ5A 3M8CA 4HM3B 3UNLA 2PZVA 4HJLB 3JUMA 5STDA 3GZBA 3F7SA 2RGQA 3G8ZA 1W01A 4K1UA 1JN5B 4XBXA 1JB2A 4WYKA 4L7KA 3EBTA 3WMDA 4R9KA 5IENA 1O7NB 1TUHA 3B8LA 3NM2A 5BVBA 3Q90A 4X2OA 1GY7A 3FF0A 1S5AA 1EA2A 1A2KA 5IERA 5D83A 3LYGA 4HM2B 2XSOB 5D81A 2YFJB 3F9SA 5IG0A 4PEJA 4X2HA 5AI1A 4H3UA 1Z1SA 3OV4A 3F8HA 3SOYA 1QJGA 4R1KA 1DMMA 3OWSA 1EG9B 1OF5B 3FH1A 1OGXA 1NDOB 7STDA 1O7MB 2XR8B 5KP3A 2R4IA 3ECFA 3E99A 2Z77A 4STDA 3DM8A 3FZWA 1O7WB 3MHEA 2A15A 5BXQA 4GB5A 3EN8A 3NHXA 3NV0B 3ROBA 1O7HB 3HK4A 5G2GA 1DMNA 1ULIB 1IDPA 4LEHA 4KVHA 1SJWA 2XSHB 2CKFB 1GYBA 2F86B 3OWUA 3EQQB 2K54A
chains in the Genus database with same CATH superfamily
2KAAA 4K1VA 3SOAA 1JJ22 3JUQA 3Q3FA 1JB5A 1CH0A 1RDSA 1RRLA 3D3LA 4XBTA 4XDVA 2QEX3 2CFLA 2F99A 4L8PA 5D82A 1JBSA 4MMZB 3DGMA 1IQXA 1VQK3 1R4CA 3G0KA 1E97A 2XFTA 6RNTA 1ZS7A 4MMYB 3HIGA 1EUIC 1Q864 2H0IA 2HMMB 1W6YA 2CX1A 5CLKA 1QALA 3B4PA 1W2ZA 3NQZA 4IPBA 5HGRA 1GOUA 3CCU3 1VQ73 1LNIA 1FZUA 2F4YA 2M7OA 5KP1A 1RNBA 4ILFA 3NX0A 3O8YA 3NXJA 1BNIA 4KFEA 3PS8A 1VQ83 1E3RA 3CXC2 3HZPA 3F7XA 2OTJ3 1DVDA 3SX1A 5IEPA 2LYXA 3HOHA 1BUQA 2W2CA 1BAOA 1A2VA 1Q9EA 3EHCA 1IVWA 4I5QA 3EX9A 5DREA 1PY3A 1B27A 1K41A 1RN4A 1WQLB 1YJ93 3K7CA 1LQGC 1JZDA 2F5WA 1RN7A 5IG3A 1RCLA 1BNEA 1IVXA 3F14A 3G16A 1FW7A 2F98A 1CYVA 2W0QA 3IPTA 1HKXA 4HBRA 1FUSA 3FF2A 1JKGB 1OUNA 4WFOA 5A0OB 3CNXA 3N8BA 2W9QA 4FCZA 1AY7A 3KIIA 5FW5A 5TGNA 3PXMA 1BNRA 1BSBA 1BSCA 1YJN3 1KSIA 3PYJA 5GSPA 4FMBA 1G0TA 3FKAA 1N5PA 3V98A 3ZG5A 3LXUX 3K5TA 3JVCA 1RHLA 2P0MA 4J5KA 1YVSA 3GAXA 4L8OA 2STDA 1AR0A 1D6ZA 1NB3I 2BHMA 2HMNB 3TDGA 2GXFA 3RGRA 1Q40B 4KT3B 4HM6B 2B24B 3SYUA 2CFDA 2F56A 4DKIA 2C4BA 2L1SA 3JUPA 1M9GA 2K3DA 1ROVA 4HM7B 1B20A 2YFIB 3ALAA 3X41A 3Q1CA 5KP4A 4FMDA 1ZO2A 2C10A 1IQ8A 3UB1A 5IF6A 1JBTA 4N3VA 1W6CA 4N6V0 3CC23 5IEOA 1STDA 3WR2A 5G1LA 2ZHXB 1YHQ3 3GZXB 3I563 1RGFA 1RTUA 4MJDA 1X1UA 4RBNA 5EVHA 3WOFB 1W02A 3CD63 1JB4A 1OHSA 2GU3A 4LGQA 1IVVA 2CFWA 3KZTA 4HKVB 2GBXB 1V58A 1WMOA 3PCSA 2WGOA 4FCMA 4HAAA 1VQ53 2IMJA 1YJW3 2XRXB 1VZZA 1B2UA 3T8UA 3OW22 2OCTA 3FG4A 2KF4A 1AV4A 3LT8A 1E3VA 3VF1A 2P0XA 2CH9A 3A5EA 4EYCA 5M19A 4J9AA 1TJDA 2CG1A 2HMOB 3EN1B 4CDLA 3DXOA 2QIYA 3H51A 1K8A4 5EQLA 2RSXA 2AAEA 2ZA4A 1IV7A 3DZLA 4N6OB 3I0YA 3F40A 4U13A 3T8NA 1Q42A 3LT9A 3CNMA 1FUWA 1U5OA 2OOVC 1AQZA 1SPUA 2ZDJA 5ELJA 5AIGA 3DGYA 3F8XA 3VGNA 1TTOA 8CHOA 1RJOA 1RRHA 1UI8A 4I4KA 3SEDA 4LYLB 3Q2PA 2O9UX 3NM7A 3JUOA 1GSPA 2GBWB 3KN4A 1NU3A 2L4VA 3U97A 5JPPA 1OPYA 1GD4A 1CYUA 2K0MA 2CWTA 1D6UA 2BMOB 4HM4B 1JBRA 2QGUA 4HM5B 2SARA 3EJVA 2OOVA 5AEWB 2D42A 1NWWA 4OUQA 5M18A 1O7PB 3PGBA 2OWPA 1OCVA 1BIRA 6STDA 1BSAA 5JBSA 3GZYB 2HOHA 1GS3A 3KE7A 3LH4A 4HVNA 1GY6A 4GSPA 1VQP3 1IU7A 1CQSA 4LSOA 5CF1A 3NUVA 1DYUA 1OH0A 4Q53A 5HOHA 4OK0A 3URPA 2SBLA 1VQM3 5IG5A 1JN5A 3MKIA 1HYFA 2OTL3 2XFSA 2XH9A 2Z7AA 3D9RA 1NB5I 1D6YA 1I70A 2W03A 1FGTA 2CX0A 2XGNA 3BNEA 3EE1A 3T0UA 5AIIA 3WOEB 1QMAA 3NQYA 1N5HA 3LTDA 3LOYA 1SQWA 1IT7A 1WTHA 4J8TA 1OHPA 2CIUA 4K90B 1DE3A 1OGZA 1V74A 1KC84 2P09A 3BNDA 1WNHA 3DGOA 1W00A 2C11A 3EBYA 3GZRA 1HZ1A 3I553 1BRNL 4BU4A 4H61A 5CF2A 2IUKA 1US1A 1T2HA 3KKGA 3UL6A 3MWZA 1BOXA 1EKMA 1TFKA 2INXA 4HM8B 3AHSA 1ISKA 1GY5A 1X1XA 4RZMA 4AKZA 1I2GA 3MG1A 3NBBA 4FMAA 3MG2A 1W5ZA 3FG3A 1B2MA 3LZAA 1T2IA 2IA7A 1LNHA 1Q40A 2BMRB 2W6JH 2YX9A 4ORLA 1LXEA 3MPHA 2IYJA 1FA3A 2Z76A 2E2VA 1PYLA 5CK6A 1BNJA 3CCJ3 1LOXA 2RCDA 3LTAA 2RNTA 3L0RA 1RGLA 1GMQA 4N6TA 3G713 1BSEA 1IVUA 1UDII 1I2EA 4NHFA 3RGAA 4XM4A 3K63A 3S5CA 4O8SA 1YGEA 3ZG0A 3MYTA 4R9LA 1OHOA 3B4OA 2KF3A 2RFRA 1J2BA 1B21A 1ZX2A 2CHCA 1B2SA 3D5IA 2CW9A 5JPUA 1BGSA 2PNCA 3CCE3 1OF5A 1CEWI 1UCKA 5IG4A 1ULJB 3STDA 2HMLB 1T5YA 2Y74A 3LTBA 3VSYA 1RKYA 2H0HA 2WGQA 3EC9A 4OVMA 2H0GA 1N8R4 1TP6A 4WWUC 2GEYA 3JUNA 1TU5A 2BMQB 1I3IA 1WMNA 4HM1B 1BNSA 1BRSA 3S67A 4JRFA 3DGLA 3LTCA 3FG1A 1LOVA 3CPOA 2FXTA 3N54B 1I0VA 4WYKB 1ZGXA 2WOFA 4HOHA 3X3ZA 3PCRA 2CWVA 2BNGA 1TRQA 3ER7A 4BIRA 3OX9A 3NV0A 2YFLB 1STFI 3AMOA 1I3FA 3CU3A 3CCL3 1VQ43 1Q7HA 1MWUA 3S29A 3NBRA 5G1KA 3FGYA 1DETA 1N8QA 4XB5A 2GSPA 4WP5A 4FCJA 3X42A 1JRQA 4HZBB 1KQS2 1M1K4 1VQ93 3BIRA 3HIIA 3DMCA 1W4NA 3G6E3 3CCQ3 3OXAA 4XBYA 5AIHA 4CJNA 3G4S3 4O2HA 3WA2X 2W56A 1JZOA 2GU1A 3B7CA 1FGOA 1L5GB 1UUWB 3AHWA 1RGKA 4BTXA 3V92A 4MEIA 4R4KA 1B3SA 1GMPA 2F5MA 4QWTA 1W2B2 1QAFA 1QVG2 4BL3A 1YIJ3 4RNYA 3GRDA 4RNZA 1FYSA 1UUVB 4HM0B 1DMQA 4HYZA 4EW5A 1BU4A 1MWTA 1ASKA 1RMSA 3FLJA 1HU9A 3OWYA 1F8NA 1UCJA 3DGNA 1V57A 3UJMA 4IIAA 1A2PA 1UGIA 2KF5A 1Q824 4NREA 2Z6BA 3KSPA 3SLUA 2B1XB 3K0ZA 4BTWA 4EBGA 4KZ1A 3H3HA 2GEXA 4N6LA 1IYYA 1BRKA 8RNTA 2XGLA 3MG3A 6GSPA 5FGOA 1B2XA 1Q7Y4 3CCM3 2QA43 5AEUB 1VQN3 1NNVA 3BLZA 1MWRA 3K9MC 1C7HA 1Y4KA 2I9WA 4O02B 2CFGA 2KCDA 3CC73 1UW1A 2P05A 4HZ9B 3RDEA 2ML6A 1IK3A 3FSDA 4XDWA 3X40A 7RNTA 1BNFA 5M1AA 3D79A 4N6MA 1N9EA 3S27A 5AIFA 1PU4A 1N9JA 2HMJB 2HMKB 3BNCA 2CK3H 1IT8A 3BB9A 1VQ63 1SARA 2UX0A 4LMIA 3A76A 3WDGB 3HX8A 1QVF2 1JKGA 1RGHA 1M904 4K61A 1O7GB 1LVNA 1RNTA 1GD3A 1G96A 1RN1A 3D5GA 1VQO3 3EF8A 5DRVA 1M1XB 1RGGA 2XF3A 3GWRA 3RNTA 3SXXA 3DUKA 2OQEC 4GHOA 4BL2A 1MGRA 1RGEA 1NJI4 3MSOA 4CPKA 1FUTA 5CXOA 2JQ5A 3M8CA 1EEJA 4HM3B 4JF8A 3UNLA 1U8CB 2PZVA 2BO9B 2MC8A 9RNTA 2Q07A 3DY5A 2E2UA 4HJLB 5I97A 1OACA 3JUMA 4IT7A 5STDA 1BRHA 3GZBA 3F7SA 3HI7A 2IUJA 1I2FA 5AYRB 1GMRA 4O3VA 1UGHI 2CWUA 2RGQA 2OQEA 3U1WA 1VQL3 3G8ZA 2WOHA 4GL6A 1EQKA 2W04A 4LZIA 5LC7A 4AKYA 1W01A 3AGOA 4AEQA 4K1UA 3CCS3 1K734 1FGRA 1JN5B 3SVAA 4XBXA 1YIT3 1B2ZA 3BNBA 2LQVA 3PZWA 4WHAA 1BUJA 1JB2A 1W7CA 1I0XA 4WYKA 1TFOA 2ZL8A 4L7KA 5BIRA 3EBTA 3WMDA 3CCV3 4R9KA 1X1YA 2JDIH 5IENA 1PFPA 1O7NB 3KFQC 3D4AA 1TUHA 3B8LA 2BU4A 3KCHA 3NM2A 3CME3 1KD14 1A90A 5BVBA 4EC6A 1VQQA 3Q90A 4N6UA 1LQMB 4X2OA 1GY7A 3FF0A 4MMXB 2MF7A 1S5AA 2UGIA 1EA2A 1A2KA 3GSPA 2BT3A 5IERA 1S723 2CC3A 5D83A 3LYGA 4CCVA 3WA3A 1KWIA 4HM2B 4NPBA 2XSOB 1QAKA 2RBIA 5IW9A 1YI23 1MGWA 2KRTA 4EV5A 1Q814 3V99A 3CC43 5D81A 2W9PA 1NO3A 2YFJB 4EV2A 3FCSB 1GOVA 3F9SA 1WMPA 2J8XB 5IG0A 1FGMA 4PEJA 4X2HA 5AI1A 4R80A 1JNQA 1UCIA 4H3UA 3QRDA 2CFKA 1Z1SA 2BIRA 1BNGA 4RNTA 3OV4A 1BVIA 3F8HA 4EXRA 3SOYA 1QJGA 1G02A 1BSDA 1BRJA 1ROAA 1X1WA 2E2TA 4R1KA 1K9M4 1DMMA 1MNLA 2KXGA 3OWSA 1IQYA 1YGWA 3QK9A 1EG9B 1BRGA 1GOYA 1OF5B 2XEPA 3FH1A 1RLSA 1OGXA 1NDOB 2AADA 3S28A 2O3OA 5AYSC 3X3YA 1UI7A 2Y73A 1O7MB 2XR8B 7STDA 1RCKA 3NBJA 4KFDA 4TX4A 3IMAB 5KP3A 2R4IA 3LMLA 3ECFA 1W6GA 3IJEB 4J5GA 3E99A 1TRPA 2Z77A 4STDA 3WODG 3DM8A 3CCR3 1YVBI 3FZWA 1IV9A 1O7WB 5ELUA 1BANA 4BTYA 7GSPA 2KF6A 3MHEA 2FNQA 1YNVX 1FGQA 2A15A 2P38A 4GB5A 5BXQA 4ZM8A 3EN8A 1RGAA 1BRIA 3NHXA 2IY2A 3NV0B 1I8VA 4FMCA 3ROBA 3X3XA 3BU4A 3AMOB 4KFFA 3CPW2 1LRAA 1RGCA 1UUGB 2CG0A 3AGNA 3DH2A 1A67A 2R41A 1MOLA 5LC6A 1O7HB 2UUGC 2V1LA 2ML5A 3HK4A 1C54A 1R4YA 3N9HA 1DVCA 5G2GA 2FGTA 1DMNA 1JV2B 2D1WA 1ULIB 1MWSA 1IDPA 5BU4A 1LOYA 4LEHA 3J7Yd 2WO0A 1SIHA 5EEOA 4KVHA 1SJWA 4N6NB 2XSHB 3EB8A 1AVKA 1UCLA 2W56B 1RSNA 1K28A 2CKFB 3WHOA 3UL5A 1GYBA 1SIIA 1AVLA 1TIJA 5RNTA 2F86B 3KSED 4G1MB 3OWUA 3EQQB 1T3BA 2K54A 3CMA3 3ZFZA 4FR9A 1LOWA
chains in the Genus database with same CATH topology
4K1VA 3SOAA 1JJ22 3JUQA 1JB5A 1RRLA 3D3LA 4XBTA 4XDVA 2QEX3 2CFLA 2F99A 4L8PA 5D82A 4MMZB 3DGMA 1IQXA 1VQK3 1R4CA 3G0KA 1E97A 2XFTA 4MMYB 3HIGA 1Q864 2HMMB 1W6YA 5CLKA 1QALA 3B4PA 1W2ZA 3NQZA 4IPBA 5HGRA 3CCU3 1VQ73 2M7OA 5KP1A 3NX0A 3O8YA 3NXJA 4KFEA 3PS8A 1VQ83 1E3RA 3CXC2 3HZPA 3F7XA 2OTJ3 1DVDA 3SX1A 5IEPA 2LYXA 1BUQA 2W2CA 1A2VA 3EHCA 1IVWA 3EX9A 5DREA 1K41A 1WQLB 1YJ93 3K7CA 1RN7A 5IG3A 1IVXA 3F14A 3G16A 2F98A 1CYVA 2W0QA 3IPTA 1HKXA 4HBRA 3FF2A 1JKGB 1OUNA 4WFOA 5A0OB 3CNXA 3N8BA 2W9QA 4FCZA 3KIIA 5FW5A 5TGNA 3PXMA 1YJN3 1KSIA 3PYJA 4FMBA 3FKAA 1N5PA 3V98A 3LXUX 3K5TA 3JVCA 2P0MA 3GAXA 4L8OA 2STDA 1AR0A 1D6ZA 1NB3I 2BHMA 2HMNB 3TDGA 2GXFA 3RGRA 1Q40B 4HM6B 2B24B 2CFDA 3JUPA 1M9GA 1ROVA 4HM7B 2YFIB 3ALAA 3X41A 3Q1CA 5KP4A 4FMDA 1ZO2A 2C10A 1IQ8A 3UB1A 5IF6A 4N3VA 1W6CA 4N6V0 3CC23 5IEOA 1STDA 1YHQ3 3GZXB 3I563 4MJDA 3WOFB 4RBNA 5EVHA 1W02A 3CD63 1JB4A 1OHSA 2GU3A 4LGQA 1IVVA 2CFWA 3KZTA 4HKVB 2GBXB 1WMOA 3PCSA 2WGOA 4FCMA 1VQ53 2IMJA 1YJW3 2XRXB 1VZZA 3T8UA 3OW22 2OCTA 3FG4A 1AV4A 3LT8A 1E3VA 3VF1A 2P0XA 2CH9A 4EYCA 4J9AA 2CG1A 2HMOB 3EN1B 4CDLA 3DXOA 2QIYA 3H51A 1K8A4 5EQLA 2RSXA 1IV7A 3DZLA 4N6OB 3I0YA 3F40A 4U13A 3T8NA 1Q42A 3LT9A 3CNMA 1FUWA 1U5OA 2OOVC 5ELJA 1SPUA 2ZDJA 5AIGA 3F8XA 3VGNA 8CHOA 1RJOA 1RRHA 1UI8A 4I4KA 3SEDA 3Q2PA 2O9UX 3NM7A 3JUOA 2GBWB 3KN4A 1NU3A 2L4VA 3U97A 5JPPA 1OPYA 1GD4A 1CYUA 2K0MA 2CWTA 1D6UA 2BMOB 4HM4B 2QGUA 4HM5B 3EJVA 2OOVA 5AEWB 2D42A 1NWWA 4OUQA 1O7PB 3PGBA 2OWPA 1OCVA 6STDA 5JBSA 3GZYB 3LH4A 1GS3A 3KE7A 4HVNA 1GY6A 1VQP3 1IU7A 1CQSA 4LSOA 5CF1A 3NUVA 1DYUA 1OH0A 4Q53A 4OK0A 2SBLA 1VQM3 5IG5A 1JN5A 3MKIA 2OTL3 2XFSA 2XH9A 2Z7AA 3D9RA 1NB5I 1D6YA 3EE1A 2W03A 1FGTA 2XGNA 3T0UA 3BNEA 3WOEB 5AIIA 1QMAA 3NQYA 1N5HA 3LTDA 3LOYA 1SQWA 1IT7A 1WTHA 4J8TA 1OHPA 2CIUA 4K90B 1OGZA 1V74A 1KC84 2P09A 3BNDA 1WNHA 3DGOA 1W00A 2C11A 3EBYA 3GZRA 3I553 4H61A 5CF2A 2IUKA 1US1A 3KKGA 3UL6A 3MWZA 2INXA 1EKMA 1TFKA 4HM8B 1ISKA 1GY5A 4RZMA 4AKZA 3MG1A 3NBBA 4FMAA 3MG2A 1W5ZA 3FG3A 3LZAA 2IA7A 1LNHA 1Q40A 2BMRB 2W6JH 2YX9A 4ORLA 1LXEA 3MPHA 1FA3A 2Z76A 2E2VA 5CK6A 3CCJ3 1LOXA 2RCDA 3LTAA 3G713 3L0RA 4N6TA 1IVUA 4NHFA 3RGAA 4XM4A 3K63A 3S5CA 4O8SA 1YGEA 3MYTA 4R9LA 1OHOA 3B4OA 2RFRA 1J2BA 1ZX2A 2CHCA 2CW9A 5JPUA 2PNCA 3CCE3 1OF5A 1CEWI 5IG4A 1ULJB 3STDA 2HMLB 1T5YA 2Y74A 3LTBA 3VSYA 1RKYA 2WGQA 3EC9A 4OVMA 1N8R4 1TP6A 4WWUC 2GEYA 3JUNA 1TU5A 2BMQB 1WMNA 4HM1B 3S67A 4JRFA 3DGLA 3LTCA 3FG1A 3CPOA 2FXTA 3N54B 4WYKB 2WOFA 3X3ZA 3PCRA 2CWVA 2BNGA 3ER7A 3OX9A 3NV0A 2YFLB 1STFI 3AMOA 3CU3A 3CCL3 1VQ43 3S29A 3NBRA 3FGYA 1N8QA 4XB5A 4WP5A 4FCJA 3X42A 1JRQA 4HZBB 1KQS2 1M1K4 1VQ93 3HIIA 3DMCA 1W4NA 3G6E3 3CCQ3 3OXAA 4XBYA 5AIHA 3G4S3 4O2HA 3WA2X 2W56A 2GU1A 3B7CA 1FGOA 1L5GB 1UUWB 4BTXA 3V92A 4MEIA 4R4KA 4QWTA 1W2B2 1QAFA 1QVG2 1YIJ3 4RNYA 3GRDA 4RNZA 4HM0B 1UUVB 4HYZA 1DMQA 1ASKA 3FLJA 1HU9A 3OWYA 1F8NA 3DGNA 3UJMA 4IIAA 1Q824 4NREA 2Z6BA 3KSPA 3SLUA 2B1XB 3K0ZA 4BTWA 4EBGA 4KZ1A 3H3HA 2GEXA 4N6LA 2XGLA 3MG3A 5FGOA 1Q7Y4 3CCM3 2QA43 5AEUB 1VQN3 3BLZA 3K9MC 1C7HA 1Y4KA 2I9WA 4O02B 2CFGA 2KCDA 3CC73 1UW1A 2P05A 4HZ9B 3RDEA 2ML6A 1IK3A 3FSDA 4XDWA 3X40A 4N6MA 1N9EA 3S27A 5AIFA 1PU4A 1N9JA 2HMJB 2HMKB 3BNCA 2CK3H 1IT8A 3BB9A 1VQ63 2UX0A 4LMIA 3A76A 3WDGB 3HX8A 1JKGA 1M904 4K61A 1O7GB 1LVNA 1GD3A 1G96A 1VQO3 3EF8A 5DRVA 1M1XB 2XF3A 3GWRA 3SXXA 3DUKA 2OQEC 1NJI4 3MSOA 5CXOA 2JQ5A 3M8CA 4HM3B 3UNLA 4JF8A 1U8CB 2PZVA 2BO9B 2MC8A 2Q07A 3DY5A 2E2UA 4HJLB 5I97A 1OACA 3JUMA 4IT7A 5STDA 3GZBA 2IUJA 3F7SA 3HI7A 5AYRB 4O3VA 2CWUA 2RGQA 2OQEA 3U1WA 1VQL3 3G8ZA 2WOHA 4GL6A 1EQKA 2W04A 4LZIA 5LC7A 4AKYA 1W01A 4AEQA 4K1UA 3CCS3 1K734 1FGRA 1JN5B 3SVAA 4XBXA 1YIT3 3BNBA 2LQVA 3PZWA 4WHAA 1JB2A 1W7CA 4WYKA 1TFOA 2ZL8A 4L7KA 3EBTA 3WMDA 3CCV3 4R9KA 2JDIH 5IENA 1PFPA 1O7NB 3KFQC 1TUHA 3B8LA 3NM2A 3CME3 1KD14 1A90A 5BVBA 4EC6A 3Q90A 4N6UA 4X2OA 1GY7A 3FF0A 4MMXB 2MF7A 1S5AA 1EA2A 1A2KA 1S723 2BT3A 5IERA 2CC3A 5D83A 3LYGA 4CCVA 3WA3A 1KWIA 4HM2B 2XSOB 1QAKA 5IW9A 1YI23 1Q814 4EV5A 2KRTA 3V99A 3CC43 5D81A 2W9PA 1NO3A 2YFJB 4EV2A 3FCSB 3F9SA 1WMPA 5IG0A 1FGMA 4PEJA 4X2HA 5AI1A 4R80A 1JNQA 4H3UA 3QRDA 2CFKA 1Z1SA 3OV4A 3F8HA 4EXRA 3SOYA 1QJGA 1ROAA 2E2TA 4R1KA 1K9M4 1DMMA 1MNLA 2KXGA 3OWSA 1IQYA 3QK9A 1EG9B 1OF5B 2XEPA 3FH1A 1OGXA 1NDOB 3S28A 3X3YA 2O3OA 5AYSC 7STDA 1UI7A 2Y73A 1O7MB 2XR8B 1QVF2 3NBJA 4KFDA 4TX4A 3IMAB 5KP3A 2R4IA 3LMLA 3ECFA 1W6GA 3IJEB 3E99A 2Z77A 4STDA 3WODG 3DM8A 3CCR3 1YVBI 3FZWA 1IV9A 1O7WB 5ELUA 4BTYA 3MHEA 2FNQA 2A15A 1FGQA 5BXQA 2P38A 4GB5A 4ZM8A 3EN8A 3NHXA 4FMCA 3NV0B 3ROBA 3X3XA 3AMOB 4KFFA 3CPW2 2CG0A 1A67A 1MOLA 5LC6A 1O7HB 2V1LA 2ML5A 3HK4A 3N9HA 1DVCA 5G2GA 2FGTA 1DMNA 1JV2B 2D1WA 1ULIB 1IDPA 4LEHA 3J7Yd 2WO0A 1SIHA 5EEOA 4KVHA 1SJWA 4N6NB 2XSHB 3EB8A 1AVKA 2W56B 1K28A 2CKFB 3UL5A 1GYBA 1SIIA 1AVLA 1TIJA 2F86B 3KSED 4G1MB 3OWUA 3EQQB 2K54A 3CMA3 4FR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1V A;  3SOA A;  3JUQ A;  1JB5 A;  4XBT A;  4XDV A;  2F99 A;  4L8P A;  5D82 A;  3G0K A;  1E97 A;  2HMM B;  1W6Y A;  5CLK A;  3B4P A;  5HGR A;  5KP1 A;  3NXJ A;  1E3R A;  3HZP A;  3F7X A;  5IEP A;  1BUQ A;  2W2C A;  3EHC A;  3EX9 A;  5DRE A;  1K41 A;  1WQL B;  3K7C A;  5IG3 A;  3G16 A;  3F14 A;  2F98 A;  3IPT A;  1HKX A;  3FF2 A;  1JKG B;  1OUN A;  3CNX A;  5FW5 A;  5TGN A;  3FKA A;  4L8O A;  2STD A;  1AR0 A;  2HMN B;  2GXF A;  3RGR A;  1Q40 B;  4HM6 B;  2B24 B;  3JUP A;  4HM7 B;  2YFI B;  5KP4 A;  1ZO2 A;  5IF6 A;  4N3V A;  5IEO A;  1STD A;  3GZX B;  4MJD A;  5EVH A;  1W02 A;  1JB4 A;  1OHS A;  4LGQ A;  4HKV B;  3KZT A;  2GBX B;  4FCM A;  2IMJ A;  2XRX B;  3T8U A;  1VZZ A;  1E3V A;  4J9A A;  2HMO B;  3EN1 B;  4CDL A;  3DXO A;  2QIY A;  3H51 A;  3DZL A;  3I0Y A;  3F40 A;  4U13 A;  3T8N A;  1Q42 A;  3CNM A;  1U5O A;  5AIG A;  3F8X A;  3VGN A;  8CHO A;  3SED A;  4I4K A;  3JUO A;  2GBW B;  1NU3 A;  5JPP A;  1OPY A;  2BMO B;  4HM4 B;  2QGU A;  4HM5 B;  3EJV A;  5AEW B;  1NWW A;  4OUQ A;  1O7P B;  2OWP A;  1OCV A;  6STD A;  3GZY B;  1GS3 A;  3KE7 A;  4HVN A;  1GY6 A;  1CQS A;  5CF1 A;  3NUV A;  1OH0 A;  4Q53 A;  5IG5 A;  1JN5 A;  3MKI A;  2Z7A A;  3D9R A;  5AII A;  1QMA A;  4J8T A;  1OHP A;  1OGZ A;  3EBY A;  1W00 A;  3GZR A;  5CF2 A;  3KKG A;  2INX A;  4HM8 B;  1ISK A;  1GY5 A;  4RZM A;  3MG1 A;  3MG2 A;  3LZA A;  1Q40 A;  2BMR B;  4ORL A;  2Z76 A;  5CK6 A;  2RCD A;  3RGA A;  4XM4 A;  3S5C A;  3MYT A;  4R9L A;  1OHO A;  3B4O A;  2RFR A;  1ZX2 A;  2CHC A;  5JPU A;  1OF5 A;  5IG4 A;  1ULJ B;  3STD A;  2HML B;  3VSY A;  3EC9 A;  4OVM A;  1TP6 A;  4WWU C;  2GEY A;  3JUN A;  2BMQ B;  4HM1 B;  3CPO A;  4WYK B;  2BNG A;  3ER7 A;  3OX9 A;  3NV0 A;  2YFL B;  3CU3 A;  3NBR A;  3FGY A;  4XB5 A;  4WP5 A;  4FCJ A;  4HZB B;  3DMC A;  3OXA A;  4XBY A;  5AIH A;  3B7C A;  1UUW B;  3GRD A;  4HM0 B;  1UUV B;  1DMQ A;  1ASK A;  3FLJ A;  3OWY A;  3UJM A;  4IIA A;  3KSP A;  2B1X B;  3K0Z A;  3H3H A;  2GEX A;  3MG3 A;  5AEU B;  3BLZ A;  1C7H A;  2I9W A;  4HZ9 B;  3FSD A;  4XDW A;  5AIF A;  2HMJ B;  2HMK B;  3BB9 A;  2UX0 A;  4LMI A;  3A76 A;  3HX8 A;  1JKG A;  1O7G B;  3EF8 A;  5DRV A;  3GWR A;  3DUK A;  3MSO A;  5CXO A;  2JQ5 A;  3M8C A;  4HM3 B;  3UNL A;  2PZV A;  4HJL B;  3JUM A;  5STD A;  3GZB A;  3F7S A;  2RGQ A;  3G8Z A;  1W01 A;  4K1U A;  1JN5 B;  4XBX A;  1JB2 A;  4WYK A;  4L7K A;  3EBT A;  3WMD A;  4R9K A;  5IEN A;  1O7N B;  1TUH A;  3B8L A;  3NM2 A;  5BVB A;  3Q90 A;  4X2O A;  1GY7 A;  3FF0 A;  1S5A A;  1EA2 A;  1A2K A;  5IER A;  5D83 A;  3LYG A;  4HM2 B;  2XSO B;  5D81 A;  2YFJ B;  3F9S A;  5IG0 A;  4PEJ A;  4X2H A;  5AI1 A;  4H3U A;  1Z1S A;  3OV4 A;  3F8H A;  3SOY A;  1QJG A;  4R1K A;  1DMM A;  3OWS A;  1EG9 B;  1OF5 B;  3FH1 A;  1OGX A;  1NDO B;  7STD A;  1O7M B;  2XR8 B;  5KP3 A;  2R4I A;  3ECF A;  3E99 A;  2Z77 A;  4STD A;  3DM8 A;  3FZW A;  1O7W B;  3MHE A;  2A15 A;  5BXQ A;  4GB5 A;  3EN8 A;  3NHX A;  3NV0 B;  3ROB A;  1O7H B;  3HK4 A;  5G2G A;  1DMN A;  1ULI B;  1IDP A;  4LEH A;  4KVH A;  1SJW A;  2XSH B;  2CKF B;  1GYB A;  2F86 B;  3OWU A;  3EQQ B;  2K54 A; 
#chains in the Genus database with same CATH topology
 2KAA A;  4K1V A;  3SOA A;  1JJ2 2;  3JUQ A;  3Q3F A;  1JB5 A;  1CH0 A;  1RDS A;  1RRL A;  3D3L A;  4XBT A;  4XDV A;  2QEX 3;  2CFL A;  2F99 A;  4L8P A;  5D82 A;  1JBS A;  4MMZ B;  3DGM A;  1IQX A;  1VQK 3;  1R4C A;  3G0K A;  1E97 A;  2XFT A;  6RNT A;  1ZS7 A;  4MMY B;  3HIG A;  1EUI C;  1Q86 4;  2H0I A;  2HMM B;  1W6Y A;  2CX1 A;  5CLK A;  1QAL A;  3B4P A;  1W2Z A;  3NQZ A;  4IPB A;  5HGR A;  1GOU A;  3CCU 3;  1VQ7 3;  1LNI A;  1FZU A;  2F4Y A;  2M7O A;  5KP1 A;  1RNB A;  4ILF A;  3NX0 A;  3O8Y A;  3NXJ A;  1BNI A;  4KFE A;  3PS8 A;  1VQ8 3;  1E3R A;  3CXC 2;  3HZP A;  3F7X A;  2OTJ 3;  1DVD A;  3SX1 A;  5IEP A;  2LYX A;  3HOH A;  1BUQ A;  2W2C A;  1BAO A;  1A2V A;  1Q9E A;  3EHC A;  1IVW A;  4I5Q A;  3EX9 A;  5DRE A;  1PY3 A;  1B27 A;  1K41 A;  1RN4 A;  1WQL B;  1YJ9 3;  3K7C A;  1LQG C;  1JZD A;  2F5W A;  1RN7 A;  5IG3 A;  1RCL A;  1BNE A;  1IVX A;  3F14 A;  3G16 A;  1FW7 A;  2F98 A;  1CYV A;  2W0Q A;  3IPT A;  1HKX A;  4HBR A;  1FUS A;  3FF2 A;  1JKG B;  1OUN A;  4WFO A;  5A0O B;  3CNX A;  3N8B A;  2W9Q A;  4FCZ A;  1AY7 A;  3KII A;  5FW5 A;  5TGN A;  3PXM A;  1BNR A;  1BSB A;  1BSC A;  1YJN 3;  1KSI A;  3PYJ A;  5GSP A;  4FMB A;  1G0T A;  3FKA A;  1N5P A;  3V98 A;  3ZG5 A;  3LXU X;  3K5T A;  3JVC A;  1RHL A;  2P0M A;  4J5K A;  1YVS A;  3GAX A;  4L8O A;  2STD A;  1AR0 A;  1D6Z A;  1NB3 I;  2BHM A;  2HMN B;  3TDG A;  2GXF A;  3RGR A;  1Q40 B;  4KT3 B;  4HM6 B;  2B24 B;  3SYU A;  2CFD A;  2F56 A;  4DKI A;  2C4B A;  2L1S A;  3JUP A;  1M9G A;  2K3D A;  1ROV A;  4HM7 B;  1B20 A;  2YFI B;  3ALA A;  3X41 A;  3Q1C A;  5KP4 A;  4FMD A;  1ZO2 A;  2C10 A;  1IQ8 A;  3UB1 A;  5IF6 A;  1JBT A;  4N3V A;  1W6C A;  4N6V 0;  3CC2 3;  5IEO A;  1STD A;  3WR2 A;  5G1L A;  2ZHX B;  1YHQ 3;  3GZX B;  3I56 3;  1RGF A;  1RTU A;  4MJD A;  1X1U A;  4RBN A;  5EVH A;  3WOF B;  1W02 A;  3CD6 3;  1JB4 A;  1OHS A;  2GU3 A;  4LGQ A;  1IVV A;  2CFW A;  3KZT A;  4HKV B;  2GBX B;  1V58 A;  1WMO A;  3PCS A;  2WGO A;  4FCM A;  4HAA A;  1VQ5 3;  2IMJ A;  1YJW 3;  2XRX B;  1VZZ A;  1B2U A;  3T8U A;  3OW2 2;  2OCT A;  3FG4 A;  2KF4 A;  1AV4 A;  3LT8 A;  1E3V A;  3VF1 A;  2P0X A;  2CH9 A;  3A5E A;  4EYC A;  5M19 A;  4J9A A;  1TJD A;  2CG1 A;  2HMO B;  3EN1 B;  4CDL A;  3DXO A;  2QIY A;  3H51 A;  1K8A 4;  5EQL A;  2RSX A;  2AAE A;  2ZA4 A;  1IV7 A;  3DZL A;  4N6O B;  3I0Y A;  3F40 A;  4U13 A;  3T8N A;  1Q42 A;  3LT9 A;  3CNM A;  1FUW A;  1U5O A;  2OOV C;  1AQZ A;  1SPU A;  2ZDJ A;  5ELJ A;  5AIG A;  3DGY A;  3F8X A;  3VGN A;  1TTO A;  8CHO A;  1RJO A;  1RRH A;  1UI8 A;  4I4K A;  3SED A;  4LYL B;  3Q2P A;  2O9U X;  3NM7 A;  3JUO A;  1GSP A;  2GBW B;  3KN4 A;  1NU3 A;  2L4V A;  3U97 A;  5JPP A;  1OPY A;  1GD4 A;  1CYU A;  2K0M A;  2CWT A;  1D6U A;  2BMO B;  4HM4 B;  1JBR A;  2QGU A;  4HM5 B;  2SAR A;  3EJV A;  2OOV A;  5AEW B;  2D42 A;  1NWW A;  4OUQ A;  5M18 A;  1O7P B;  3PGB A;  2OWP A;  1OCV A;  1BIR A;  6STD A;  1BSA A;  5JBS A;  3GZY B;  2HOH A;  1GS3 A;  3KE7 A;  3LH4 A;  4HVN A;  1GY6 A;  4GSP A;  1VQP 3;  1IU7 A;  1CQS A;  4LSO A;  5CF1 A;  3NUV A;  1DYU A;  1OH0 A;  4Q53 A;  5HOH A;  4OK0 A;  3URP A;  2SBL A;  1VQM 3;  5IG5 A;  1JN5 A;  3MKI A;  1HYF A;  2OTL 3;  2XFS A;  2XH9 A;  2Z7A A;  3D9R A;  1NB5 I;  1D6Y A;  1I70 A;  2W03 A;  1FGT A;  2CX0 A;  2XGN A;  3BNE A;  3EE1 A;  3T0U A;  5AII A;  3WOE B;  1QMA A;  3NQY A;  1N5H A;  3LTD A;  3LOY A;  1SQW A;  1IT7 A;  1WTH A;  4J8T A;  1OHP A;  2CIU A;  4K90 B;  1DE3 A;  1OGZ A;  1V74 A;  1KC8 4;  2P09 A;  3BND A;  1WNH A;  3DGO A;  1W00 A;  2C11 A;  3EBY A;  3GZR A;  1HZ1 A;  3I55 3;  1BRN L;  4BU4 A;  4H61 A;  5CF2 A;  2IUK A;  1US1 A;  1T2H A;  3KKG A;  3UL6 A;  3MWZ A;  1BOX A;  1EKM A;  1TFK A;  2INX A;  4HM8 B;  3AHS A;  1ISK A;  1GY5 A;  1X1X A;  4RZM A;  4AKZ A;  1I2G A;  3MG1 A;  3NBB A;  4FMA A;  3MG2 A;  1W5Z A;  3FG3 A;  1B2M A;  3LZA A;  1T2I A;  2IA7 A;  1LNH A;  1Q40 A;  2BMR B;  2W6J H;  2YX9 A;  4ORL A;  1LXE A;  3MPH A;  2IYJ A;  1FA3 A;  2Z76 A;  2E2V A;  1PYL A;  5CK6 A;  1BNJ A;  3CCJ 3;  1LOX A;  2RCD A;  3LTA A;  2RNT A;  3L0R A;  1RGL A;  1GMQ A;  4N6T A;  3G71 3;  1BSE A;  1IVU A;  1UDI I;  1I2E A;  4NHF A;  3RGA A;  4XM4 A;  3K63 A;  3S5C A;  4O8S A;  1YGE A;  3ZG0 A;  3MYT A;  4R9L A;  1OHO A;  3B4O A;  2KF3 A;  2RFR A;  1J2B A;  1B21 A;  1ZX2 A;  2CHC A;  1B2S A;  3D5I A;  2CW9 A;  5JPU A;  1BGS A;  2PNC A;  3CCE 3;  1OF5 A;  1CEW I;  1UCK A;  5IG4 A;  1ULJ B;  3STD A;  2HML B;  1T5Y A;  2Y74 A;  3LTB A;  3VSY A;  1RKY A;  2H0H A;  2WGQ A;  3EC9 A;  4OVM A;  2H0G A;  1N8R 4;  1TP6 A;  4WWU C;  2GEY A;  3JUN A;  1TU5 A;  2BMQ B;  1I3I A;  1WMN A;  4HM1 B;  1BNS A;  1BRS A;  3S67 A;  4JRF A;  3DGL A;  3LTC A;  3FG1 A;  1LOV A;  3CPO A;  2FXT A;  3N54 B;  1I0V A;  4WYK B;  1ZGX A;  2WOF A;  4HOH A;  3X3Z A;  3PCR A;  2CWV A;  2BNG A;  1TRQ A;  3ER7 A;  4BIR A;  3OX9 A;  3NV0 A;  2YFL B;  1STF I;  3AMO A;  1I3F A;  3CU3 A;  3CCL 3;  1VQ4 3;  1Q7H A;  1MWU A;  3S29 A;  3NBR A;  5G1K A;  3FGY A;  1DET A;  1N8Q A;  4XB5 A;  2GSP A;  4WP5 A;  4FCJ A;  3X42 A;  1JRQ A;  4HZB B;  1KQS 2;  1M1K 4;  1VQ9 3;  3BIR A;  3HII A;  3DMC A;  1W4N A;  3G6E 3;  3CCQ 3;  3OXA A;  4XBY A;  5AIH A;  4CJN A;  3G4S 3;  4O2H A;  3WA2 X;  2W56 A;  1JZO A;  2GU1 A;  3B7C A;  1FGO A;  1L5G B;  1UUW B;  3AHW A;  1RGK A;  4BTX A;  3V92 A;  4MEI A;  4R4K A;  1B3S A;  1GMP A;  2F5M A;  4QWT A;  1W2B 2;  1QAF A;  1QVG 2;  4BL3 A;  1YIJ 3;  4RNY A;  3GRD A;  4RNZ A;  1FYS A;  1UUV B;  4HM0 B;  1DMQ A;  4HYZ A;  4EW5 A;  1BU4 A;  1MWT A;  1ASK A;  1RMS A;  3FLJ A;  1HU9 A;  3OWY A;  1F8N A;  1UCJ A;  3DGN A;  1V57 A;  3UJM A;  4IIA A;  1A2P A;  1UGI A;  2KF5 A;  1Q82 4;  4NRE A;  2Z6B A;  3KSP A;  3SLU A;  2B1X B;  3K0Z A;  4BTW A;  4EBG A;  4KZ1 A;  3H3H A;  2GEX A;  4N6L A;  1IYY A;  1BRK A;  8RNT A;  2XGL A;  3MG3 A;  6GSP A;  5FGO A;  1B2X A;  1Q7Y 4;  3CCM 3;  2QA4 3;  5AEU B;  1VQN 3;  1NNV A;  3BLZ A;  1MWR A;  3K9M C;  1C7H A;  1Y4K A;  2I9W A;  4O02 B;  2CFG A;  2KCD A;  3CC7 3;  1UW1 A;  2P05 A;  4HZ9 B;  3RDE A;  2ML6 A;  1IK3 A;  3FSD A;  4XDW A;  3X40 A;  7RNT A;  1BNF A;  5M1A A;  3D79 A;  4N6M A;  1N9E A;  3S27 A;  5AIF A;  1PU4 A;  1N9J A;  2HMJ B;  2HMK B;  3BNC A;  2CK3 H;  1IT8 A;  3BB9 A;  1VQ6 3;  1SAR A;  2UX0 A;  4LMI A;  3A76 A;  3WDG B;  3HX8 A;  1QVF 2;  1JKG A;  1RGH A;  1M90 4;  4K61 A;  1O7G B;  1LVN A;  1RNT A;  1GD3 A;  1G96 A;  1RN1 A;  3D5G A;  1VQO 3;  3EF8 A;  5DRV A;  1M1X B;  1RGG A;  2XF3 A;  3GWR A;  3RNT A;  3SXX A;  3DUK A;  2OQE C;  4GHO A;  4BL2 A;  1MGR A;  1RGE A;  1NJI 4;  3MSO A;  4CPK A;  1FUT A;  5CXO A;  2JQ5 A;  3M8C A;  1EEJ A;  4HM3 B;  4JF8 A;  3UNL A;  1U8C B;  2PZV A;  2BO9 B;  2MC8 A;  9RNT A;  2Q07 A;  3DY5 A;  2E2U A;  4HJL B;  5I97 A;  1OAC A;  3JUM A;  4IT7 A;  5STD A;  1BRH A;  3GZB A;  3F7S A;  3HI7 A;  2IUJ A;  1I2F A;  5AYR B;  1GMR A;  4O3V A;  1UGH I;  2CWU A;  2RGQ A;  2OQE A;  3U1W A;  1VQL 3;  3G8Z A;  2WOH A;  4GL6 A;  1EQK A;  2W04 A;  4LZI A;  5LC7 A;  4AKY A;  1W01 A;  3AGO A;  4AEQ A;  4K1U A;  3CCS 3;  1K73 4;  1FGR A;  1JN5 B;  3SVA A;  4XBX A;  1YIT 3;  1B2Z A;  3BNB A;  2LQV A;  3PZW A;  4WHA A;  1BUJ A;  1JB2 A;  1W7C A;  1I0X A;  4WYK A;  1TFO A;  2ZL8 A;  4L7K A;  5BIR A;  3EBT A;  3WMD A;  3CCV 3;  4R9K A;  1X1Y A;  2JDI H;  5IEN A;  1PFP A;  1O7N B;  3KFQ C;  3D4A A;  1TUH A;  3B8L A;  2BU4 A;  3KCH A;  3NM2 A;  3CME 3;  1KD1 4;  1A90 A;  5BVB A;  4EC6 A;  1VQQ A;  3Q90 A;  4N6U A;  1LQM B;  4X2O A;  1GY7 A;  3FF0 A;  4MMX B;  2MF7 A;  1S5A A;  2UGI A;  1EA2 A;  1A2K A;  3GSP A;  2BT3 A;  5IER A;  1S72 3;  2CC3 A;  5D83 A;  3LYG A;  4CCV A;  3WA3 A;  1KWI A;  4HM2 B;  4NPB A;  2XSO B;  1QAK A;  2RBI A;  5IW9 A;  1YI2 3;  1MGW A;  2KRT A;  4EV5 A;  1Q81 4;  3V99 A;  3CC4 3;  5D81 A;  2W9P A;  1NO3 A;  2YFJ B;  4EV2 A;  3FCS B;  1GOV A;  3F9S A;  1WMP A;  2J8X B;  5IG0 A;  1FGM A;  4PEJ A;  4X2H A;  5AI1 A;  4R80 A;  1JNQ A;  1UCI A;  4H3U A;  3QRD A;  2CFK A;  1Z1S A;  2BIR A;  1BNG A;  4RNT A;  3OV4 A;  1BVI A;  3F8H A;  4EXR A;  3SOY A;  1QJG A;  1G02 A;  1BSD A;  1BRJ A;  1ROA A;  1X1W A;  2E2T A;  4R1K A;  1K9M 4;  1DMM A;  1MNL A;  2KXG A;  3OWS A;  1IQY A;  1YGW A;  3QK9 A;  1EG9 B;  1BRG A;  1GOY A;  1OF5 B;  2XEP A;  3FH1 A;  1RLS A;  1OGX A;  1NDO B;  2AAD A;  3S28 A;  2O3O A;  5AYS C;  3X3Y A;  1UI7 A;  2Y73 A;  1O7M B;  2XR8 B;  7STD A;  1RCK A;  3NBJ A;  4KFD A;  4TX4 A;  3IMA B;  5KP3 A;  2R4I A;  3LML A;  3ECF A;  1W6G A;  3IJE B;  4J5G A;  3E99 A;  1TRP A;  2Z77 A;  4STD A;  3WOD G;  3DM8 A;  3CCR 3;  1YVB I;  3FZW A;  1IV9 A;  1O7W B;  5ELU A;  1BAN A;  4BTY A;  7GSP A;  2KF6 A;  3MHE A;  2FNQ A;  1YNV X;  1FGQ A;  2A15 A;  2P38 A;  4GB5 A;  5BXQ A;  4ZM8 A;  3EN8 A;  1RGA A;  1BRI A;  3NHX A;  2IY2 A;  3NV0 B;  1I8V A;  4FMC A;  3ROB A;  3X3X A;  3BU4 A;  3AMO B;  4KFF A;  3CPW 2;  1LRA A;  1RGC A;  1UUG B;  2CG0 A;  3AGN A;  3DH2 A;  1A67 A;  2R41 A;  1MOL A;  5LC6 A;  1O7H B;  2UUG C;  2V1L A;  2ML5 A;  3HK4 A;  1C54 A;  1R4Y A;  3N9H A;  1DVC A;  5G2G A;  2FGT A;  1DMN A;  1JV2 B;  2D1W A;  1ULI B;  1MWS A;  1IDP A;  5BU4 A;  1LOY A;  4LEH A;  3J7Y d;  2WO0 A;  1SIH A;  5EEO A;  4KVH A;  1SJW A;  4N6N B;  2XSH B;  3EB8 A;  1AVK A;  1UCL A;  2W56 B;  1RSN A;  1K28 A;  2CKF B;  3WHO A;  3UL5 A;  1GYB A;  1SII A;  1AVL A;  1TIJ A;  5RNT A;  2F86 B;  3KSE D;  4G1M B;  3OWU A;  3EQQ B;  1T3B A;  2K54 A;  3CMA 3;  3ZFZ A;  4FR9 A;  1LOW A; 
#chains in the Genus database with same CATH homology
 4K1V A;  3SOA A;  1JJ2 2;  3JUQ A;  1JB5 A;  1RRL A;  3D3L A;  4XBT A;  4XDV A;  2QEX 3;  2CFL A;  2F99 A;  4L8P A;  5D82 A;  4MMZ B;  3DGM A;  1IQX A;  1VQK 3;  1R4C A;  3G0K A;  1E97 A;  2XFT A;  4MMY B;  3HIG A;  1Q86 4;  2HMM B;  1W6Y A;  5CLK A;  1QAL A;  3B4P A;  1W2Z A;  3NQZ A;  4IPB A;  5HGR A;  3CCU 3;  1VQ7 3;  2M7O A;  5KP1 A;  3NX0 A;  3O8Y A;  3NXJ A;  4KFE A;  3PS8 A;  1VQ8 3;  1E3R A;  3CXC 2;  3HZP A;  3F7X A;  2OTJ 3;  1DVD A;  3SX1 A;  5IEP A;  2LYX A;  1BUQ A;  2W2C A;  1A2V A;  3EHC A;  1IVW A;  3EX9 A;  5DRE A;  1K41 A;  1WQL B;  1YJ9 3;  3K7C A;  1RN7 A;  5IG3 A;  1IVX A;  3F14 A;  3G16 A;  2F98 A;  1CYV A;  2W0Q A;  3IPT A;  1HKX A;  4HBR A;  3FF2 A;  1JKG B;  1OUN A;  4WFO A;  5A0O B;  3CNX A;  3N8B A;  2W9Q A;  4FCZ A;  3KII A;  5FW5 A;  5TGN A;  3PXM A;  1YJN 3;  1KSI A;  3PYJ A;  4FMB A;  3FKA A;  1N5P A;  3V98 A;  3LXU X;  3K5T A;  3JVC A;  2P0M A;  3GAX A;  4L8O A;  2STD A;  1AR0 A;  1D6Z A;  1NB3 I;  2BHM A;  2HMN B;  3TDG A;  2GXF A;  3RGR A;  1Q40 B;  4HM6 B;  2B24 B;  2CFD A;  3JUP A;  1M9G A;  1ROV A;  4HM7 B;  2YFI B;  3ALA A;  3X41 A;  3Q1C A;  5KP4 A;  4FMD A;  1ZO2 A;  2C10 A;  1IQ8 A;  3UB1 A;  5IF6 A;  4N3V A;  1W6C A;  4N6V 0;  3CC2 3;  5IEO A;  1STD A;  1YHQ 3;  3GZX B;  3I56 3;  4MJD A;  3WOF B;  4RBN A;  5EVH A;  1W02 A;  3CD6 3;  1JB4 A;  1OHS A;  2GU3 A;  4LGQ A;  1IVV A;  2CFW A;  3KZT A;  4HKV B;  2GBX B;  1WMO A;  3PCS A;  2WGO A;  4FCM A;  1VQ5 3;  2IMJ A;  1YJW 3;  2XRX B;  1VZZ A;  3T8U A;  3OW2 2;  2OCT A;  3FG4 A;  1AV4 A;  3LT8 A;  1E3V A;  3VF1 A;  2P0X A;  2CH9 A;  4EYC A;  4J9A A;  2CG1 A;  2HMO B;  3EN1 B;  4CDL A;  3DXO A;  2QIY A;  3H51 A;  1K8A 4;  5EQL A;  2RSX A;  1IV7 A;  3DZL A;  4N6O B;  3I0Y A;  3F40 A;  4U13 A;  3T8N A;  1Q42 A;  3LT9 A;  3CNM A;  1FUW A;  1U5O A;  2OOV C;  5ELJ A;  1SPU A;  2ZDJ A;  5AIG A;  3F8X A;  3VGN A;  8CHO A;  1RJO A;  1RRH A;  1UI8 A;  4I4K A;  3SED A;  3Q2P A;  2O9U X;  3NM7 A;  3JUO A;  2GBW B;  3KN4 A;  1NU3 A;  2L4V A;  3U97 A;  5JPP A;  1OPY A;  1GD4 A;  1CYU A;  2K0M A;  2CWT A;  1D6U A;  2BMO B;  4HM4 B;  2QGU A;  4HM5 B;  3EJV A;  2OOV A;  5AEW B;  2D42 A;  1NWW A;  4OUQ A;  1O7P B;  3PGB A;  2OWP A;  1OCV A;  6STD A;  5JBS A;  3GZY B;  3LH4 A;  1GS3 A;  3KE7 A;  4HVN A;  1GY6 A;  1VQP 3;  1IU7 A;  1CQS A;  4LSO A;  5CF1 A;  3NUV A;  1DYU A;  1OH0 A;  4Q53 A;  4OK0 A;  2SBL A;  1VQM 3;  5IG5 A;  1JN5 A;  3MKI A;  2OTL 3;  2XFS A;  2XH9 A;  2Z7A A;  3D9R A;  1NB5 I;  1D6Y A;  3EE1 A;  2W03 A;  1FGT A;  2XGN A;  3T0U A;  3BNE A;  3WOE B;  5AII A;  1QMA A;  3NQY A;  1N5H A;  3LTD A;  3LOY A;  1SQW A;  1IT7 A;  1WTH A;  4J8T A;  1OHP A;  2CIU A;  4K90 B;  1OGZ A;  1V74 A;  1KC8 4;  2P09 A;  3BND A;  1WNH A;  3DGO A;  1W00 A;  2C11 A;  3EBY A;  3GZR A;  3I55 3;  4H61 A;  5CF2 A;  2IUK A;  1US1 A;  3KKG A;  3UL6 A;  3MWZ A;  2INX A;  1EKM A;  1TFK A;  4HM8 B;  1ISK A;  1GY5 A;  4RZM A;  4AKZ A;  3MG1 A;  3NBB A;  4FMA A;  3MG2 A;  1W5Z A;  3FG3 A;  3LZA A;  2IA7 A;  1LNH A;  1Q40 A;  2BMR B;  2W6J H;  2YX9 A;  4ORL A;  1LXE A;  3MPH A;  1FA3 A;  2Z76 A;  2E2V A;  5CK6 A;  3CCJ 3;  1LOX A;  2RCD A;  3LTA A;  3G71 3;  3L0R A;  4N6T A;  1IVU A;  4NHF A;  3RGA A;  4XM4 A;  3K63 A;  3S5C A;  4O8S A;  1YGE A;  3MYT A;  4R9L A;  1OHO A;  3B4O A;  2RFR A;  1J2B A;  1ZX2 A;  2CHC A;  2CW9 A;  5JPU A;  2PNC A;  3CCE 3;  1OF5 A;  1CEW I;  5IG4 A;  1ULJ B;  3STD A;  2HML B;  1T5Y A;  2Y74 A;  3LTB A;  3VSY A;  1RKY A;  2WGQ A;  3EC9 A;  4OVM A;  1N8R 4;  1TP6 A;  4WWU C;  2GEY A;  3JUN A;  1TU5 A;  2BMQ B;  1WMN A;  4HM1 B;  3S67 A;  4JRF A;  3DGL A;  3LTC A;  3FG1 A;  3CPO A;  2FXT A;  3N54 B;  4WYK B;  2WOF A;  3X3Z A;  3PCR A;  2CWV A;  2BNG A;  3ER7 A;  3OX9 A;  3NV0 A;  2YFL B;  1STF I;  3AMO A;  3CU3 A;  3CCL 3;  1VQ4 3;  3S29 A;  3NBR A;  3FGY A;  1N8Q A;  4XB5 A;  4WP5 A;  4FCJ A;  3X42 A;  1JRQ A;  4HZB B;  1KQS 2;  1M1K 4;  1VQ9 3;  3HII A;  3DMC A;  1W4N A;  3G6E 3;  3CCQ 3;  3OXA A;  4XBY A;  5AIH A;  3G4S 3;  4O2H A;  3WA2 X;  2W56 A;  2GU1 A;  3B7C A;  1FGO A;  1L5G B;  1UUW B;  4BTX A;  3V92 A;  4MEI A;  4R4K A;  4QWT A;  1W2B 2;  1QAF A;  1QVG 2;  1YIJ 3;  4RNY A;  3GRD A;  4RNZ A;  4HM0 B;  1UUV B;  4HYZ A;  1DMQ A;  1ASK A;  3FLJ A;  1HU9 A;  3OWY A;  1F8N A;  3DGN A;  3UJM A;  4IIA A;  1Q82 4;  4NRE A;  2Z6B A;  3KSP A;  3SLU A;  2B1X B;  3K0Z A;  4BTW A;  4EBG A;  4KZ1 A;  3H3H A;  2GEX A;  4N6L A;  2XGL A;  3MG3 A;  5FGO A;  1Q7Y 4;  3CCM 3;  2QA4 3;  5AEU B;  1VQN 3;  3BLZ A;  3K9M C;  1C7H A;  1Y4K A;  2I9W A;  4O02 B;  2CFG A;  2KCD A;  3CC7 3;  1UW1 A;  2P05 A;  4HZ9 B;  3RDE A;  2ML6 A;  1IK3 A;  3FSD A;  4XDW A;  3X40 A;  4N6M A;  1N9E A;  3S27 A;  5AIF A;  1PU4 A;  1N9J A;  2HMJ B;  2HMK B;  3BNC A;  2CK3 H;  1IT8 A;  3BB9 A;  1VQ6 3;  2UX0 A;  4LMI A;  3A76 A;  3WDG B;  3HX8 A;  1JKG A;  1M90 4;  4K61 A;  1O7G B;  1LVN A;  1GD3 A;  1G96 A;  1VQO 3;  3EF8 A;  5DRV A;  1M1X B;  2XF3 A;  3GWR A;  3SXX A;  3DUK A;  2OQE C;  1NJI 4;  3MSO A;  5CXO A;  2JQ5 A;  3M8C A;  4HM3 B;  3UNL A;  4JF8 A;  1U8C B;  2PZV A;  2BO9 B;  2MC8 A;  2Q07 A;  3DY5 A;  2E2U A;  4HJL B;  5I97 A;  1OAC A;  3JUM A;  4IT7 A;  5STD A;  3GZB A;  2IUJ A;  3F7S A;  3HI7 A;  5AYR B;  4O3V A;  2CWU A;  2RGQ A;  2OQE A;  3U1W A;  1VQL 3;  3G8Z A;  2WOH A;  4GL6 A;  1EQK A;  2W04 A;  4LZI A;  5LC7 A;  4AKY A;  1W01 A;  4AEQ A;  4K1U A;  3CCS 3;  1K73 4;  1FGR A;  1JN5 B;  3SVA A;  4XBX A;  1YIT 3;  3BNB A;  2LQV A;  3PZW A;  4WHA A;  1JB2 A;  1W7C A;  4WYK A;  1TFO A;  2ZL8 A;  4L7K A;  3EBT A;  3WMD A;  3CCV 3;  4R9K A;  2JDI H;  5IEN A;  1PFP A;  1O7N B;  3KFQ C;  1TUH A;  3B8L A;  3NM2 A;  3CME 3;  1KD1 4;  1A90 A;  5BVB A;  4EC6 A;  3Q90 A;  4N6U A;  4X2O A;  1GY7 A;  3FF0 A;  4MMX B;  2MF7 A;  1S5A A;  1EA2 A;  1A2K A;  1S72 3;  2BT3 A;  5IER A;  2CC3 A;  5D83 A;  3LYG A;  4CCV A;  3WA3 A;  1KWI A;  4HM2 B;  2XSO B;  1QAK A;  5IW9 A;  1YI2 3;  1Q81 4;  4EV5 A;  2KRT A;  3V99 A;  3CC4 3;  5D81 A;  2W9P A;  1NO3 A;  2YFJ B;  4EV2 A;  3FCS B;  3F9S A;  1WMP A;  5IG0 A;  1FGM A;  4PEJ A;  4X2H A;  5AI1 A;  4R80 A;  1JNQ A;  4H3U A;  3QRD A;  2CFK A;  1Z1S A;  3OV4 A;  3F8H A;  4EXR A;  3SOY A;  1QJG A;  1ROA A;  2E2T A;  4R1K A;  1K9M 4;  1DMM A;  1MNL A;  2KXG A;  3OWS A;  1IQY A;  3QK9 A;  1EG9 B;  1OF5 B;  2XEP A;  3FH1 A;  1OGX A;  1NDO B;  3S28 A;  3X3Y A;  2O3O A;  5AYS C;  7STD A;  1UI7 A;  2Y73 A;  1O7M B;  2XR8 B;  1QVF 2;  3NBJ A;  4KFD A;  4TX4 A;  3IMA B;  5KP3 A;  2R4I A;  3LML A;  3ECF A;  1W6G A;  3IJE B;  3E99 A;  2Z77 A;  4STD A;  3WOD G;  3DM8 A;  3CCR 3;  1YVB I;  3FZW A;  1IV9 A;  1O7W B;  5ELU A;  4BTY A;  3MHE A;  2FNQ A;  2A15 A;  1FGQ A;  5BXQ A;  2P38 A;  4GB5 A;  4ZM8 A;  3EN8 A;  3NHX A;  4FMC A;  3NV0 B;  3ROB A;  3X3X A;  3AMO B;  4KFF A;  3CPW 2;  2CG0 A;  1A67 A;  1MOL A;  5LC6 A;  1O7H B;  2V1L A;  2ML5 A;  3HK4 A;  3N9H A;  1DVC A;  5G2G A;  2FGT A;  1DMN A;  1JV2 B;  2D1W A;  1ULI B;  1IDP A;  4LEH A;  3J7Y d;  2WO0 A;  1SIH A;  5EEO A;  4KVH A;  1SJW A;  4N6N B;  2XSH B;  3EB8 A;  1AVK A;  2W56 B;  1K28 A;  2CKF B;  3UL5 A;  1GYB A;  1SII A;  1AVL A;  1TIJ A;  2F86 B;  3KSE D;  4G1M B;  3OWU A;  3EQQ B;  2K54 A;  3CMA 3;  4FR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...