4HM8B

Naphthalene 1,2-dioxygenase bound to thioanisole
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to thioanisole
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm8B00
4N3VA 5IG4A 2YFIB 5CK6A 1Q40B 4X2HA 2GBXB 2R4IA 4I4KA 5AI1A 1E97A 4WYKA 4CDLA 1GY5A 1BUQA 1ULIB 2B24B 2Z77A 3FSDA 1OCVA 4H3UA 1ASKA 2JQ5A 1OHSA 3NV0B 1GY7A 2XR8B 4J9AA 2F99A 5IEOA 3GZRA 3EN1B 3MSOA 4HM4B 2XSHB 3FF0A 4FCJA 5AEWB 1JKGA 3FH1A 3GWRA 2YFLB 3RGRA 2GEXA 3F8HA 1UUVB 4L8OA 4HKVB 1QJGA 5DREA 3NHXA 1OHOA 3B4PA 1GS3A 5IG0A 3I0YA 4HZBB 5TGNA 1QMAA 2GBWB 3OV4A 2A15A 4WWUC 4HM8B 4FCMA 3S5CA 7STDA 1OPYA 3HK4A 2GEYA 1DMNA 4HM3B 1HKXA 3K0ZA 3ER7A 4XBTA 2HMJB 3BLZA 1O7GB 1C7HA 3F9SA 5JPUA 3FKAA 5AIHA 4XBYA 1W6YA 2K54A 3B7CA 5KP3A 2B1XB 4R9KA 2XRXB 1W01A 3WMDA 3DMCA 3KE7A 5STDA 3NXJA 1JN5B 3EX9A 2OWPA 1EA2A 5BVBA 2PZVA 1O7HB 1Q40A 3NUVA 3BB9A 2Z7AA 1DMMA 3G0KA 3G8ZA 2RGQA 5D83A 4MJDA 3MG1A 4HM7B 1DMQA 1O7PB 3A76A 3DXOA 1O7MB 2Z76A 3NV0A 3M8CA 2STDA 5IENA 3VSYA 2HMNB 3NBRA 2HMMB 2BMRB 3OXAA 3F8XA 4R1KA 1E3VA 1K41A 5DRVA 3B4OA 3EJVA 3FF2A 1A2KA 3F7XA 1O7NB 3F40A 4X2OA 2W2CA 1ZO2A 5KP4A 1IDPA 4OUQA 3KSPA 5AEUB 3OX9A 1E3RA 3EQQB 1OUNA 3MHEA 5IG3A 5HGRA 3HX8A 1GY6A 3F14A 4STDA 3LZAA 2F98A 3LYGA 1OF5A 2I9WA 1OF5B 1W00A 3VGNA 3JUPA 4OVMA 3SOYA 2UX0A 4XDVA 5D82A 3CU3A 2RFRA 3OWSA 5BXQA 4J8TA 3HZPA 1VZZA 5IEPA 5CF1A 4WP5A 1S5AA 3NM2A 5JPPA 4GB5A 3MG2A 5IG5A 4K1VA 3STDA 3F7SA 1OH0A 5KP1A 6STDA 3EC9A 3KZTA 3RGAA 3MKIA 5FW5A 3GZXB 2BMQB 3SOAA 2HMKB 3MG3A 1OGZA 1JN5A 1ZX2A 3OWYA 4R9LA 3G16A 4ORLA 1WQLB 1JB2A 2HMLB 5CXOA 2QIYA 4RZMA 1ULJB 4XB5A 3IPTA 5G2GA 3EHCA 2RCDA 2XSOB 4XM4A 5IERA 1Z1SA 1JB4A 1ISKA 1OHPA 2GXFA 3UNLA 5D81A 4K1UA 2QGUA 4IIAA 4WYKB 3T8UA 1GYBA 1TUHA 1OGXA 1TP6A 4L7KA 3CPOA 4HM0B 4HVNA 2YFJB 3DZLA 1NWWA 1UUWB 3UJMA 3JUOA 4LGQA 3SEDA 8CHOA 2BMOB 5EVHA 4HM5B 3GZBA 4HM6B 3DUKA 4PEJA 4HM2B 3B8LA 3EBTA 3JUMA 3EBYA 3KKGA 1EG9B 1JKGB 1O7WB 5CLKA 3D9RA 1NU3A 4LEHA 3OWUA 1CQSA 3ROBA 2CHCA 1W02A 2HMOB 4U13A 3ECFA 3FLJA 3GZYB 4HJLB 3CNXA 1SJWA 4HM1B 4Q53A 1AR0A 2CKFB 5AIGA 3H51A 5AIIA 2INXA 3GRDA 3Q90A 3EF8A 4XBXA 2IMJA 3JUQA 1NDOB 3E99A 3MYTA 3T8NA 3FZWA 4HZ9B 4XDWA 5IF6A 3DM8A 5CF2A 3EN8A 1Q42A 4KVHA 1U5OA 3K7CA 2F86B 5AIFA 1JB5A 1STDA 3FGYA 4LMIA 3JUNA 2BNGA 3H3HA 4L8PA 3CNMA
chains in the Genus database with same CATH superfamily
4N3VA 2CC3A 5IG4A 2YFIB 1AQZA 1BAOA 1SIHA 1FGOA 1PYLA 5CK6A 3V92A 1Q40B 1JBSA 4X2HA 2GBXB 2R4IA 1JNQA 3LH4A 1BNJA 1DVDA 4I4KA 4RNTA 4KFDA 5AI1A 1E97A 1UDII 1BSDA 1GY5A 4QWTA 4WYKA 4CDLA 1BUQA 1ULIB 2B24B 2Z77A 3HOHA 4LZIA 4O3VA 2BIRA 4EV2A 5BU4A 1SPUA 1OCVA 3FSDA 1BVIA 4H3UA 2E2UA 1ASKA 1RMSA 2JQ5A 2SBLA 1OHSA 1IV9A 1IVUA 5ELJA 1K9M4 1W2B2 4N6TA 4FR9A 2O9UX 3LMLA 1TRQA 2QA43 2P05A 1K734 3NV0B 3MWZA 1YNVX 4HAAA 3N9HA 1GY7A 1WMNA 2XR8B 4J9AA 1YVSA 3CCQ3 2F99A 3IMAB 1LQGC 5IEOA 1B21A 1LOVA 3EE1A 1WTHA 1AV4A 3AMOB 4BTWA 3NQZA 4CCVA 2W6JH 1BSCA 2W56A 2WOHA 1W6CA 3GZRA 3S29A 1RRHA 4K90B 3EN1B 1PFPA 1I2EA 2Z6BA 3D4AA 3MSOA 4HM4B 2FXTA 2KF3A 3CCE3 1U8CB 1VQ93 1TFKA 2XSHB 1FUTA 3FF0A 4FCJA 1BNSA 1JKGA 5AEWB 5LC7A 1VQP3 3FH1A 9RNTA 3GWRA 3A5EA 1BRKA 1JBTA 2YFLB 1YGWA 3RGRA 1B2XA 2K0MA 2OOVC 4BL2A 2GEXA 2ML5A 3F8HA 1IQYA 3WODG 1UUVB 1VQ83 3CCL3 1JRQA 1BSBA 1N5PA 1UCJA 2XEPA 4HKVB 1QJGA 1NO3A 4I5QA 4L8OA 1G0TA 5DREA 7RNTA 3NHXA 1OHOA 1IT7A 1I3IA 3B4PA 1FGQA 4NREA 2BHMA 4CJNA 1BNEA 3X42A 1ROVA 1V58A 1AY7A 3CD63 1RGCA 3AGOA 1GS3A 2C10A 1A2PA 1GOYA 4MMZB 2LYXA 5IG0A 3PGBA 3I0YA 4KFEA 4HZBB 3CC23 1HYFA 1QMAA 5TGNA 2GBWB 3U1WA 1NNVA 3OV4A 3PYJA 2A15A 2ZHXB 7GSPA 1MNLA 2FNQA 4WWUC 1QAKA 3D79A 1WMOA 1RCKA 3N8BA 4HM8B 1Q814 1C54A 5EQLA 1KSIA 1MWTA 4FCMA 3S5CA 1M904 3S27A 1IVVA 3X3ZA 3K9MC 1D6YA 7STDA 1FA3A 1OPYA 2MF7A 3HK4A 2GEYA 3IJEB 1DMNA 2H0GA 2UUGC 4HM3B 1HKXA 1T3BA 3K0ZA 4GHOA 3G4S3 3ER7A 2LQVA 4XBTA 2HMJB 1CYVA 3BLZA 1O7GB 1C7HA 2P0MA 1UUGB 4EXRA 3F9SA 5JPUA 4HYZA 2OQEA 1M1K4 1A90A 3CME3 1LNHA 1IQ8A 1WNHA 1GMQA 2ZDJA 3FKAA 2IUJA 5AIHA 4XBYA 3WA3A 2F4YA 1W6YA 2PNCA 2K54A 3B7CA 3ZFZA 2H0HA 2B1XB 5KP3A 1Q7HA 4R9KA 1RGHA 1UI7A 4N6NB 2MC8A 2XRXB 1W01A 1AVKA 4FCZA 4EYCA 3WMDA 1Y4KA 3DGOA 1DE3A 5G1LA 3NQYA 2RNTA 4LSOA 4GSPA 1RNTA 3DMCA 4LYLB 2CWVA 3LT9A 3GSPA 3OW22 3KE7A 4FMAA 1YIT3 5STDA 4KFFA 3NXJA 3CCM3 1J2BA 1JN5B 3KFQC 3EX9A 3AHSA 1R4CA 3SXXA 2OWPA 3KN4A 1FZUA 1EA2A 1B20A 2F5WA 2W0QA 1W7CA 1S723 3ALAA 1BRGA 4N6MA 3CC73 5BVBA 2PZVA 1O7HB 2XF3A 3WOEB 2BO9B 5M18A 1LQMB 1Q40A 3NUVA 1UCKA 3G6E3 3BB9A 2Z7AA 3BU4A 1I70A 1FYSA 1DMMA 3NBJA 3J7Yd 4BTYA 3CCR3 3G0KA 3G8ZA 3Q1CA 1X1UA 3FG1A 5A0OB 3WHOA 2RGQA 4N6UA 5D83A 2W03A 1Q864 1VQ63 4MJDA 1BGSA 5BIRA 2CK3H 4CPKA 1JBRA 3BNCA 3MG1A 2R41A 4HM7B 1DMQA 1O7PB 3A76A 3DXOA 2BT3A 1O7MB 1IVXA 1VQO3 3WA2X 4O8SA 2XFTA 2ZL8A 2Z76A 3NV0A 3DGNA 3M8CA 1BRSA 2STDA 1W2ZA 5IENA 4RNYA 3VSYA 2HMNB 3NBRA 1ROAA 2HMMB 4R80A 2CG0A 3CCV3 2HOHA 3NBBA 2BMRB 3OXAA 1CEWI 2IY2A 3AMOA 4GL6A 4HBRA 4J5KA 3F8XA 1LOWA 4R1KA 4RBNA 1E3VA 1K41A 5DRVA 2K3DA 1RHLA 2CFDA 8RNTA 3B4OA 3EJVA 3FF2A 3JVCA 1A2KA 3F7XA 4JRFA 1O7NB 3F40A 5AYRB 1YJW3 4X2OA 1IQXA 1VQ53 4WFOA 3V98A 1GOUA 2W2CA 2KCDA 2H0IA 1YJ93 1TJDA 4ZM8A 3FG3A 1ZO2A 1DETA 1IDPA 5KP4A 5LC6A 4OUQA 3KCHA 2CH9A 3KSPA 1TIJA 4FMBA 2E2VA 5AEUB 2GU3A 1FUWA 4MMXB 1RNBA 5FGOA 2D42A 4KZ1A 3OX9A 1I2GA 1T5YA 2OQEC 1IT8A 1YI23 1K28A 1CYUA 1E3RA 3EQQB 1OUNA 3DGMA 1NB3I 3MHEA 5G1KA 4AKYA 1I3FA 5IG3A 5HGRA 3HX8A 1GY6A 3F14A 4STDA 3LZAA 1RJOA 1BNIA 4ILFA 1NB5I 3DGYA 1RKYA 2CG1A 4EW5A 2GSPA 2F98A 3LYGA 1RN1A 2CFGA 2D1WA 1RSNA 2KF4A 1OF5A 1RRLA 1TFOA 1US1A 2I9WA 1PU4A 1G02A 1OF5B 1W00A 2CW9A 1PY3A 3SVAA 2J8XB 3QRDA 3VGNA 1STFI 2YX9A 3I553 1FUSA 3JUPA 4OVMA 3SOYA 3PXMA 1RGKA 1FGMA 2UX0A 4HOHA 4XDVA 5D82A 2WO0A 3CU3A 2RFRA 1KWIA 3OWSA 3PZWA 4J8TA 4BL3A 5BXQA 1YJN3 1RDSA 3WDGB 3HZPA 2ZA4A 1CH0A 1VZZA 5IEPA 1TU5A 1YIJ3 2M7OA 5CF1A 2UGIA 3HI7A 1S5AA 3NM2A 4WP5A 5JPPA 3GAXA 3X3XA 4GB5A 1NJI4 1ZGXA 3MG2A 1F8NA 2Y74A 5IG5A 1SIIA 4K1VA 3STDA 3URPA 3F7SA 1OH0A 3Q2PA 3EB8A 4IT7A 3TDGA 5KP1A 2BU4A 1LVNA 1X1YA 2Y73A 3PCRA 6STDA 2RBIA 3EC9A 3SLUA 3KZTA 1RGGA 3RGAA 3ZG0A 1G96A 3MKIA 1W5ZA 3FCSB 1I0VA 3CCJ3 2OTJ3 4EV5A 3X3YA 5FW5A 2F56A 1MWUA 2WGOA 3LOYA 3O8YA 1UCLA 1GOVA 1BU4A 3BNEA 2AAEA 3GZXB 3S67A 2BMQB 1QVF2 3SOAA 1VQQA 2CX1A 2HMKB 2RSXA 3MG3A 1OGZA 1JN5A 2W9PA 1IV7A 1ZX2A 3OWYA 4R9LA 1RCLA 1VQ73 3G16A 4ORLA 2CFKA 1N8QA 2C4BA 3QK9A 1BRNL 1MGWA 1GD3A 4JF8A 1WQLB 1IYYA 1UCIA 1RGFA 3LTAA 3K5TA 1JB2A 2HMLB 2F5MA 1N9EA 1RGAA 5CXOA 2CX0A 6GSPA 1KC84 2XGLA 2QIYA 4TX4A 1ZS7A 2FGTA 3X41A 5RNTA 3WOFB 4RZMA 1UGIA 1HZ1A 2JDIH 1BIRA 1ULJB 1A67A 4AEQA 4XB5A 1B3SA 2XGNA 4RNZA 1BRHA 3IPTA 1SARA 5EEOA 3T0UA 1DYUA 5G2GA 1QAFA 1EEJA 1BNGA 4OK0A 1N9JA 3EHCA 3PCSA 4IPBA 2KXGA 3UB1A 2RCDA 2XSOB 4XM4A 1BRIA 5IERA 5ELUA 1RGLA 1RTUA 1T2HA 3K63A 1Z1SA 3L0RA 3NX0A 3UL6A 3D5IA 3RNTA 1IK3A 1KD14 1JZOA 3D3LA 3X40A 4MEIA 3KSED 1JB4A 1B2UA 2ML6A 1Q7Y4 1ISKA 1SQWA 1OHPA 2GXFA 2CWTA 2P09A 3UNLA 3WR2A 5D81A 5AYSC 3ZG5A 4BTXA 1IVWA 3LXUX 1OACA 1GMRA 2QGUA 3Q3FA 2P38A 4IIAA 4K1UA 4R4KA 4WYKB 3T8UA 1GYBA 1TUHA 3LTDA 3S28A 4O02B 1OGXA 1LNIA 1TP6A 4L7KA 1EKMA 2KRTA 3CPOA 4HM0B 3CXC2 1IU7A 1JV2B 2YFJB 4FMCA 1YGEA 4HVNA 3DZLA 1Q9EA 1FGTA 3CCS3 1YHQ3 4N6V0 1MGRA 1BSEA 1NWWA 1UUWB 3UJMA 3JUOA 4LGQA 3SEDA 1LOYA 1R4YA 8CHOA 5JBSA 1QVG2 2BMOB 2KF6A 5EVHA 4HM5B 1I2FA 3GZBA 4HM6B 2SARA 4G1MB 2WOFA 1FGRA 4K61A 1VQN3 1BOXA 1B27A 4KT3B 4PEJA 4HM2B 2O3OA 3RDEA 2W56B 3B8LA 3G713 2IA7A 3EBTA 3JUMA 3EBYA 3KKGA 1TTOA 3I563 3LTCA 1A2VA 2CIUA 4N6OB 2P0XA 1EG9B 4AKZA 1JKGB 1DVCA 4H61A 1V74A 1BANA 4FMDA 4NPBA 1O7WB 2GU1A 5CLKA 1GMPA 2CFLA 3D9RA 2AADA 3DGLA 1NU3A 4LEHA 3OWUA 1Q824 1BUJA 1CQSA 3ROBA 1B2ZA 1WMPA 1W02A 2CHCA 1KQS2 1LRAA 2HMOB 4U13A 3ECFA 4NHFA 1N5HA 2KAAA 1UW1A 3FLJA 1RN4A 3GZYB 3PS8A 2CWUA 4HJLB 3CNXA 3MPHA 4N6LA 1I0XA 1D6UA 1UI8A 1W4NA 1VQ43 3HIGA 3BIRA 1B2SA 1GSPA 4BU4A 1SJWA 2QEX3 1VQM3 2L4VA 3V99A 5M1AA 1RN7A 4HM1B 4Q53A 1AR0A 1YVBI 2CKFB 3SYUA 4WHAA 2V1LA 2WGQA 2W04A 5AIGA 6RNTA 3H51A 5IW9A 2OTL3 3NM7A 1BSAA 5AIIA 2INXA 3GRDA 3Q90A 3EF8A 3DH2A 1M1XB 4XBXA 2IMJA 1MWRA 2IUKA 1N8R4 1BRJA 3JUQA 3VF1A 4DKIA 1RGEA 1NDOB 1VQL3 4J5GA 2OOVA 3AHWA 1T2IA 3FG4A 3E99A 4L8PA 1BNFA 3MYTA 1M9GA 1RLSA 2CFWA 2E2TA 5I97A 1L5GB 3T8NA 2Q07A 3FZWA 4HZ9B 4XDWA 1V57A 3U97A 5IF6A 3DM8A 5CF2A 1X1XA 3EN8A 3N54B 3UL5A 1K8A4 2W9QA 1X1WA 3DY5A 3KIIA 3D5GA 1EUIC 1Q42A 4KVHA 4MMYB 3CCU3 4EBGA 1U5OA 3K7CA 4EC6A 1FW7A 1HU9A 1W6GA 2F86B 1MOLA 3LTBA 4O2HA 2KF5A 2IYJA 5AIFA 1AVLA 1TRPA 1JB5A 1UGHI 1GD4A 1EQKA 1STDA 2OCTA 1D6ZA 5GSPA 3SX1A 3BNDA 3LT8A 2XH9A 1B2MA 1LXEA 5M19A 1JJ22 1I8VA 1VQK3 1MWSA 3AGNA 3HIIA 3CC43 5HOHA 3CPW2 3FGYA 1BNRA 4LMIA 1JZDA 2XFSA 1QALA 3JUNA 1LOXA 2BNGA 2L1SA 3H3HA 3CMA3 2C11A 3BNBA 3DUKA 3CNMA 4BIRA
chains in the Genus database with same CATH topology
4N3VA 2CC3A 5IG4A 2YFIB 1SIHA 1FGOA 5CK6A 3V92A 1Q40B 4X2HA 2GBXB 2R4IA 1JNQA 3LH4A 1DVDA 4I4KA 4KFDA 5AI1A 1E97A 4QWTA 4WYKA 1GY5A 4CDLA 1BUQA 1ULIB 2B24B 2Z77A 4LZIA 4O3VA 4EV2A 1SPUA 1OCVA 3FSDA 4H3UA 2E2UA 1ASKA 5ELJA 2JQ5A 2SBLA 1OHSA 1IV9A 1IVUA 1K9M4 1W2B2 4N6TA 4FR9A 2O9UX 3LMLA 2QA43 2P05A 1K734 3NV0B 3MWZA 3N9HA 1GY7A 1WMNA 2XR8B 4J9AA 3CCQ3 2F99A 3IMAB 5IEOA 3EE1A 1WTHA 1AV4A 3AMOB 4BTWA 3NQZA 4CCVA 2W6JH 2W56A 2WOHA 3GZRA 1W6CA 3S29A 1RRHA 4K90B 3EN1B 1PFPA 3MSOA 2Z6BA 4HM4B 2FXTA 3CCE3 1U8CB 1VQ93 2XSHB 1TFKA 3FF0A 4FCJA 5AEWB 1JKGA 5LC7A 1VQP3 3FH1A 3GWRA 2YFLB 3RGRA 2K0MA 2OOVC 2GEXA 2ML5A 3F8HA 1IQYA 3WODG 1UUVB 1VQ83 3CCL3 1JRQA 1N5PA 2XEPA 4L8OA 4HKVB 1QJGA 1NO3A 5DREA 3NHXA 1OHOA 1IT7A 3B4PA 1FGQA 4NREA 2BHMA 3X42A 1ROVA 3CD63 1GS3A 2C10A 4MMZB 2LYXA 5IG0A 3PGBA 3I0YA 4KFEA 4HZBB 3CC23 5TGNA 1QMAA 2GBWB 3U1WA 3OV4A 3PYJA 2A15A 1MNLA 2FNQA 4WWUC 1QAKA 1WMOA 3N8BA 4HM8B 1Q814 5EQLA 1KSIA 4FCMA 3S5CA 1M904 3S27A 1IVVA 3X3ZA 3K9MC 1D6YA 7STDA 1FA3A 1OPYA 2MF7A 3HK4A 2GEYA 3IJEB 1DMNA 4R80A 3G4S3 4HM3B 1HKXA 3K0ZA 3ER7A 2LQVA 4XBTA 2HMJB 1CYVA 3BLZA 1O7GB 1C7HA 2P0MA 4EXRA 3F9SA 5JPUA 4HYZA 2OQEA 1M1K4 1A90A 3CME3 1LNHA 1IQ8A 1WNHA 2ZDJA 3FKAA 2IUJA 5AIHA 4XBYA 3WA3A 1W6YA 2PNCA 2K54A 3B7CA 2B1XB 5KP3A 4R9KA 1UI7A 4N6NB 2MC8A 2XRXB 1W01A 1AVKA 4FCZA 4EYCA 3WMDA 1Y4KA 3DGOA 3NQYA 4LSOA 3DMCA 2CWVA 3LT9A 3OW22 3KE7A 4FMAA 1YIT3 5STDA 4KFFA 3NXJA 1J2BA 1JN5B 3KFQC 3EX9A 1R4CA 3SXXA 2OWPA 3KN4A 1EA2A 2W0QA 1W7CA 1S723 3ALAA 4N6MA 3CC73 5BVBA 2PZVA 1O7HB 2XF3A 3WOEB 2BO9B 1Q40A 3NUVA 3G6E3 3BB9A 2Z7AA 1DMMA 3NBJA 3J7Yd 4BTYA 3CCR3 3G0KA 3G8ZA 3Q1CA 5A0OB 3FG1A 2RGQA 4N6UA 5D83A 2W03A 1Q864 1VQ63 4MJDA 2CK3H 3BNCA 3MG1A 4HM7B 1DMQA 1O7PB 3A76A 3DXOA 2BT3A 1O7MB 1IVXA 1VQO3 3WA2X 4O8SA 2XFTA 2ZL8A 2Z76A 3NV0A 3DGNA 3M8CA 2STDA 1W2ZA 5IENA 4RNYA 3VSYA 2HMNB 3NBRA 1ROAA 2HMMB 2CG0A 3CCV3 3NBBA 2BMRB 3OXAA 1CEWI 3AMOA 4GL6A 4HBRA 4RBNA 3F8XA 4R1KA 1E3VA 1K41A 5DRVA 2CFDA 3B4OA 3EJVA 3FF2A 3JVCA 1A2KA 3F7XA 4JRFA 1O7NB 3F40A 5AYRB 1YJW3 4X2OA 1IQXA 1VQ53 4WFOA 3V98A 2W2CA 2KCDA 1YJ93 4ZM8A 3FG3A 1ZO2A 5KP4A 1IDPA 5LC6A 4OUQA 2CH9A 3KSPA 1TIJA 4FMBA 2E2VA 5AEUB 2GU3A 1FUWA 4MMXB 5FGOA 2D42A 4KZ1A 3OX9A 2OQEC 1T5YA 1YI23 1IT8A 1K28A 1CYUA 1E3RA 3EQQB 1OUNA 3DGMA 1NB3I 3MHEA 4AKYA 5IG3A 5HGRA 3HX8A 1GY6A 3F14A 4STDA 3LZAA 1RJOA 1NB5I 1RKYA 2CG1A 2F98A 3LYGA 2CFGA 2D1WA 1PU4A 1OF5A 1RRLA 1TFOA 1US1A 2I9WA 1OF5B 1W00A 2CW9A 3SVAA 3QRDA 3VGNA 1STFI 2YX9A 3I553 3JUPA 4OVMA 3SOYA 3PXMA 2UX0A 1FGMA 4XDVA 5D82A 2WO0A 3CU3A 2RFRA 1KWIA 3OWSA 3PZWA 4J8TA 5BXQA 1YJN3 3WDGB 3HZPA 1VZZA 5IEPA 1TU5A 1YIJ3 2M7OA 5CF1A 3HI7A 1S5AA 3NM2A 4WP5A 5JPPA 3GAXA 3X3XA 4GB5A 1NJI4 3MG2A 1F8NA 2Y74A 5IG5A 1SIIA 4K1VA 3STDA 3F7SA 1OH0A 3Q2PA 3EB8A 4IT7A 3TDGA 5KP1A 1LVNA 3PCRA 2Y73A 6STDA 3EC9A 3SLUA 3KZTA 3RGAA 1G96A 3MKIA 1W5ZA 3FCSB 3CCJ3 2OTJ3 4EV5A 3X3YA 5FW5A 2WGOA 3LOYA 3O8YA 3BNEA 3GZXB 3S67A 2BMQB 1QVF2 3SOAA 2HMKB 2RSXA 3MG3A 1OGZA 1JN5A 2W9PA 1IV7A 1ZX2A 3OWYA 4R9LA 1VQ73 3G16A 4ORLA 2CFKA 1N8QA 3QK9A 1GD3A 4JF8A 1WQLB 3LTAA 3K5TA 1JB2A 2HMLB 1N9EA 5CXOA 1KC84 2XGLA 2QIYA 4TX4A 2FGTA 3X41A 3WOFB 4RZMA 2JDIH 1ULJB 1A67A 4AEQA 4XB5A 2XGNA 4RNZA 3IPTA 5EEOA 3T0UA 1DYUA 5G2GA 1QAFA 4OK0A 1N9JA 3EHCA 3PCSA 4IPBA 2KXGA 3UB1A 2RCDA 2XSOB 4XM4A 5IERA 5ELUA 3K63A 1Z1SA 3L0RA 3NX0A 3UL6A 1IK3A 1KD14 3D3LA 3X40A 4MEIA 3KSED 1JB4A 2ML6A 1ISKA 1Q7Y4 2P09A 1SQWA 1OHPA 2CWTA 2GXFA 3UNLA 3CCM3 5D81A 5AYSC 4BTXA 1IVWA 3LXUX 1OACA 4K1UA 2QGUA 4IIAA 2P38A 4R4KA 4WYKB 3T8UA 1GYBA 1TUHA 3LTDA 3S28A 4O02B 1OGXA 1TP6A 4L7KA 1EKMA 2KRTA 3CPOA 4HM0B 3CXC2 1IU7A 1JV2B 2YFJB 4FMCA 1YGEA 4HVNA 3DZLA 1FGTA 3CCS3 1YHQ3 4N6V0 1NWWA 1UUWB 3UJMA 3JUOA 4LGQA 3SEDA 8CHOA 5JBSA 1QVG2 2BMOB 5EVHA 4HM5B 3GZBA 4HM6B 1VQN3 4G1MB 2WOFA 1FGRA 4K61A 4PEJA 4HM2B 2O3OA 3RDEA 2W56B 3B8LA 3G713 2IA7A 3EBTA 3JUMA 3EBYA 3KKGA 3I563 3LTCA 1A2VA 2CIUA 4N6OB 2P0XA 1EG9B 4AKZA 1JKGB 1DVCA 4H61A 1V74A 4FMDA 1O7WB 2GU1A 5CLKA 2CFLA 3D9RA 3DGLA 1NU3A 4LEHA 3OWUA 1Q824 1CQSA 3ROBA 1WMPA 1W02A 2CHCA 1KQS2 2HMOB 4U13A 3ECFA 4NHFA 1N5HA 1UW1A 3FLJA 3GZYB 3PS8A 2CWUA 4HJLB 3CNXA 3MPHA 4N6LA 1D6UA 1UI8A 1W4NA 1VQ43 3HIGA 2QEX3 1SJWA 1VQM3 2L4VA 3V99A 1RN7A 4HM1B 4Q53A 1AR0A 1YVBI 2CKFB 4WHAA 2V1LA 2WGQA 2W04A 5AIGA 3H51A 5IW9A 2OTL3 3NM7A 5AIIA 2INXA 3GRDA 3Q90A 3EF8A 1M1XB 4XBXA 2IMJA 2IUKA 1N8R4 3JUQA 3VF1A 1VQL3 1NDOB 2OOVA 3FG4A 3E99A 4L8PA 3MYTA 1M9GA 2CFWA 2E2TA 5I97A 1L5GB 3T8NA 2Q07A 3FZWA 4HZ9B 4XDWA 3U97A 5IF6A 3DM8A 5CF2A 3EN8A 1K8A4 3N54B 3UL5A 2W9QA 3DY5A 3KIIA 1Q42A 4KVHA 4MMYB 3CCU3 4EBGA 1U5OA 3K7CA 4EC6A 1HU9A 1W6GA 2F86B 1MOLA 3LTBA 4O2HA 5AIFA 1AVLA 1JB5A 1GD4A 1EQKA 1STDA 2OCTA 1D6ZA 3SX1A 3BNDA 3LT8A 2XH9A 1LXEA 1JJ22 1VQK3 3HIIA 3CC43 3CPW2 3FGYA 4LMIA 2XFSA 1QALA 3JUNA 1LOXA 2BNGA 3H3HA 3CMA3 2C11A 3BNBA 3DUKA 3CNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3V A;  5IG4 A;  2YFI B;  5CK6 A;  1Q40 B;  4X2H A;  2GBX B;  2R4I A;  4I4K A;  5AI1 A;  1E97 A;  4WYK A;  4CDL A;  1GY5 A;  1BUQ A;  1ULI B;  2B24 B;  2Z77 A;  3FSD A;  1OCV A;  4H3U A;  1ASK A;  2JQ5 A;  1OHS A;  3NV0 B;  1GY7 A;  2XR8 B;  4J9A A;  2F99 A;  5IEO A;  3GZR A;  3EN1 B;  3MSO A;  4HM4 B;  2XSH B;  3FF0 A;  4FCJ A;  5AEW B;  1JKG A;  3FH1 A;  3GWR A;  2YFL B;  3RGR A;  2GEX A;  3F8H A;  1UUV B;  4L8O A;  4HKV B;  1QJG A;  5DRE A;  3NHX A;  1OHO A;  3B4P A;  1GS3 A;  5IG0 A;  3I0Y A;  4HZB B;  5TGN A;  1QMA A;  2GBW B;  3OV4 A;  2A15 A;  4WWU C;  4HM8 B;  4FCM A;  3S5C A;  7STD A;  1OPY A;  3HK4 A;  2GEY A;  1DMN A;  4HM3 B;  1HKX A;  3K0Z A;  3ER7 A;  4XBT A;  2HMJ B;  3BLZ A;  1O7G B;  1C7H A;  3F9S A;  5JPU A;  3FKA A;  5AIH A;  4XBY A;  1W6Y A;  2K54 A;  3B7C A;  5KP3 A;  2B1X B;  4R9K A;  2XRX B;  1W01 A;  3WMD A;  3DMC A;  3KE7 A;  5STD A;  3NXJ A;  1JN5 B;  3EX9 A;  2OWP A;  1EA2 A;  5BVB A;  2PZV A;  1O7H B;  1Q40 A;  3NUV A;  3BB9 A;  2Z7A A;  1DMM A;  3G0K A;  3G8Z A;  2RGQ A;  5D83 A;  4MJD A;  3MG1 A;  4HM7 B;  1DMQ A;  1O7P B;  3A76 A;  3DXO A;  1O7M B;  2Z76 A;  3NV0 A;  3M8C A;  2STD A;  5IEN A;  3VSY A;  2HMN B;  3NBR A;  2HMM B;  2BMR B;  3OXA A;  3F8X A;  4R1K A;  1E3V A;  1K41 A;  5DRV A;  3B4O A;  3EJV A;  3FF2 A;  1A2K A;  3F7X A;  1O7N B;  3F40 A;  4X2O A;  2W2C A;  1ZO2 A;  5KP4 A;  1IDP A;  4OUQ A;  3KSP A;  5AEU B;  3OX9 A;  1E3R A;  3EQQ B;  1OUN A;  3MHE A;  5IG3 A;  5HGR A;  3HX8 A;  1GY6 A;  3F14 A;  4STD A;  3LZA A;  2F98 A;  3LYG A;  1OF5 A;  2I9W A;  1OF5 B;  1W00 A;  3VGN A;  3JUP A;  4OVM A;  3SOY A;  2UX0 A;  4XDV A;  5D82 A;  3CU3 A;  2RFR A;  3OWS A;  5BXQ A;  4J8T A;  3HZP A;  1VZZ A;  5IEP A;  5CF1 A;  4WP5 A;  1S5A A;  3NM2 A;  5JPP A;  4GB5 A;  3MG2 A;  5IG5 A;  4K1V A;  3STD A;  3F7S A;  1OH0 A;  5KP1 A;  6STD A;  3EC9 A;  3KZT A;  3RGA A;  3MKI A;  5FW5 A;  3GZX B;  2BMQ B;  3SOA A;  2HMK B;  3MG3 A;  1OGZ A;  1JN5 A;  1ZX2 A;  3OWY A;  4R9L A;  3G16 A;  4ORL A;  1WQL B;  1JB2 A;  2HML B;  5CXO A;  2QIY A;  4RZM A;  1ULJ B;  4XB5 A;  3IPT A;  5G2G A;  3EHC A;  2RCD A;  2XSO B;  4XM4 A;  5IER A;  1Z1S A;  1JB4 A;  1ISK A;  1OHP A;  2GXF A;  3UNL A;  5D81 A;  4K1U A;  2QGU A;  4IIA A;  4WYK B;  3T8U A;  1GYB A;  1TUH A;  1OGX A;  1TP6 A;  4L7K A;  3CPO A;  4HM0 B;  4HVN A;  2YFJ B;  3DZL A;  1NWW A;  1UUW B;  3UJM A;  3JUO A;  4LGQ A;  3SED A;  8CHO A;  2BMO B;  5EVH A;  4HM5 B;  3GZB A;  4HM6 B;  3DUK A;  4PEJ A;  4HM2 B;  3B8L A;  3EBT A;  3JUM A;  3EBY A;  3KKG A;  1EG9 B;  1JKG B;  1O7W B;  5CLK A;  3D9R A;  1NU3 A;  4LEH A;  3OWU A;  1CQS A;  3ROB A;  2CHC A;  1W02 A;  2HMO B;  4U13 A;  3ECF A;  3FLJ A;  3GZY B;  4HJL B;  3CNX A;  1SJW A;  4HM1 B;  4Q53 A;  1AR0 A;  2CKF B;  5AIG A;  3H51 A;  5AII A;  2INX A;  3GRD A;  3Q90 A;  3EF8 A;  4XBX A;  2IMJ A;  3JUQ A;  1NDO B;  3E99 A;  3MYT A;  3T8N A;  3FZW A;  4HZ9 B;  4XDW A;  5IF6 A;  3DM8 A;  5CF2 A;  3EN8 A;  1Q42 A;  4KVH A;  1U5O A;  3K7C A;  2F86 B;  5AIF A;  1JB5 A;  1STD A;  3FGY A;  4LMI A;  3JUN A;  2BNG A;  3H3H A;  4L8P A;  3CNM A; 
#chains in the Genus database with same CATH topology
 4N3V A;  2CC3 A;  5IG4 A;  2YFI B;  1AQZ A;  1BAO A;  1SIH A;  1FGO A;  1PYL A;  5CK6 A;  3V92 A;  1Q40 B;  1JBS A;  4X2H A;  2GBX B;  2R4I A;  1JNQ A;  3LH4 A;  1BNJ A;  1DVD A;  4I4K A;  4RNT A;  4KFD A;  5AI1 A;  1E97 A;  1UDI I;  1BSD A;  1GY5 A;  4QWT A;  4WYK A;  4CDL A;  1BUQ A;  1ULI B;  2B24 B;  2Z77 A;  3HOH A;  4LZI A;  4O3V A;  2BIR A;  4EV2 A;  5BU4 A;  1SPU A;  1OCV A;  3FSD A;  1BVI A;  4H3U A;  2E2U A;  1ASK A;  1RMS A;  2JQ5 A;  2SBL A;  1OHS A;  1IV9 A;  1IVU A;  5ELJ A;  1K9M 4;  1W2B 2;  4N6T A;  4FR9 A;  2O9U X;  3LML A;  1TRQ A;  2QA4 3;  2P05 A;  1K73 4;  3NV0 B;  3MWZ A;  1YNV X;  4HAA A;  3N9H A;  1GY7 A;  1WMN A;  2XR8 B;  4J9A A;  1YVS A;  3CCQ 3;  2F99 A;  3IMA B;  1LQG C;  5IEO A;  1B21 A;  1LOV A;  3EE1 A;  1WTH A;  1AV4 A;  3AMO B;  4BTW A;  3NQZ A;  4CCV A;  2W6J H;  1BSC A;  2W56 A;  2WOH A;  1W6C A;  3GZR A;  3S29 A;  1RRH A;  4K90 B;  3EN1 B;  1PFP A;  1I2E A;  2Z6B A;  3D4A A;  3MSO A;  4HM4 B;  2FXT A;  2KF3 A;  3CCE 3;  1U8C B;  1VQ9 3;  1TFK A;  2XSH B;  1FUT A;  3FF0 A;  4FCJ A;  1BNS A;  1JKG A;  5AEW B;  5LC7 A;  1VQP 3;  3FH1 A;  9RNT A;  3GWR A;  3A5E A;  1BRK A;  1JBT A;  2YFL B;  1YGW A;  3RGR A;  1B2X A;  2K0M A;  2OOV C;  4BL2 A;  2GEX A;  2ML5 A;  3F8H A;  1IQY A;  3WOD G;  1UUV B;  1VQ8 3;  3CCL 3;  1JRQ A;  1BSB A;  1N5P A;  1UCJ A;  2XEP A;  4HKV B;  1QJG A;  1NO3 A;  4I5Q A;  4L8O A;  1G0T A;  5DRE A;  7RNT A;  3NHX A;  1OHO A;  1IT7 A;  1I3I A;  3B4P A;  1FGQ A;  4NRE A;  2BHM A;  4CJN A;  1BNE A;  3X42 A;  1ROV A;  1V58 A;  1AY7 A;  3CD6 3;  1RGC A;  3AGO A;  1GS3 A;  2C10 A;  1A2P A;  1GOY A;  4MMZ B;  2LYX A;  5IG0 A;  3PGB A;  3I0Y A;  4KFE A;  4HZB B;  3CC2 3;  1HYF A;  1QMA A;  5TGN A;  2GBW B;  3U1W A;  1NNV A;  3OV4 A;  3PYJ A;  2A15 A;  2ZHX B;  7GSP A;  1MNL A;  2FNQ A;  4WWU C;  1QAK A;  3D79 A;  1WMO A;  1RCK A;  3N8B A;  4HM8 B;  1Q81 4;  1C54 A;  5EQL A;  1KSI A;  1MWT A;  4FCM A;  3S5C A;  1M90 4;  3S27 A;  1IVV A;  3X3Z A;  3K9M C;  1D6Y A;  7STD A;  1FA3 A;  1OPY A;  2MF7 A;  3HK4 A;  2GEY A;  3IJE B;  1DMN A;  2H0G A;  2UUG C;  4HM3 B;  1HKX A;  1T3B A;  3K0Z A;  4GHO A;  3G4S 3;  3ER7 A;  2LQV A;  4XBT A;  2HMJ B;  1CYV A;  3BLZ A;  1O7G B;  1C7H A;  2P0M A;  1UUG B;  4EXR A;  3F9S A;  5JPU A;  4HYZ A;  2OQE A;  1M1K 4;  1A90 A;  3CME 3;  1LNH A;  1IQ8 A;  1WNH A;  1GMQ A;  2ZDJ A;  3FKA A;  2IUJ A;  5AIH A;  4XBY A;  3WA3 A;  2F4Y A;  1W6Y A;  2PNC A;  2K54 A;  3B7C A;  3ZFZ A;  2H0H A;  2B1X B;  5KP3 A;  1Q7H A;  4R9K A;  1RGH A;  1UI7 A;  4N6N B;  2MC8 A;  2XRX B;  1W01 A;  1AVK A;  4FCZ A;  4EYC A;  3WMD A;  1Y4K A;  3DGO A;  1DE3 A;  5G1L A;  3NQY A;  2RNT A;  4LSO A;  4GSP A;  1RNT A;  3DMC A;  4LYL B;  2CWV A;  3LT9 A;  3GSP A;  3OW2 2;  3KE7 A;  4FMA A;  1YIT 3;  5STD A;  4KFF A;  3NXJ A;  3CCM 3;  1J2B A;  1JN5 B;  3KFQ C;  3EX9 A;  3AHS A;  1R4C A;  3SXX A;  2OWP A;  3KN4 A;  1FZU A;  1EA2 A;  1B20 A;  2F5W A;  2W0Q A;  1W7C A;  1S72 3;  3ALA A;  1BRG A;  4N6M A;  3CC7 3;  5BVB A;  2PZV A;  1O7H B;  2XF3 A;  3WOE B;  2BO9 B;  5M18 A;  1LQM B;  1Q40 A;  3NUV A;  1UCK A;  3G6E 3;  3BB9 A;  2Z7A A;  3BU4 A;  1I70 A;  1FYS A;  1DMM A;  3NBJ A;  3J7Y d;  4BTY A;  3CCR 3;  3G0K A;  3G8Z A;  3Q1C A;  1X1U A;  3FG1 A;  5A0O B;  3WHO A;  2RGQ A;  4N6U A;  5D83 A;  2W03 A;  1Q86 4;  1VQ6 3;  4MJD A;  1BGS A;  5BIR A;  2CK3 H;  4CPK A;  1JBR A;  3BNC A;  3MG1 A;  2R41 A;  4HM7 B;  1DMQ A;  1O7P B;  3A76 A;  3DXO A;  2BT3 A;  1O7M B;  1IVX A;  1VQO 3;  3WA2 X;  4O8S A;  2XFT A;  2ZL8 A;  2Z76 A;  3NV0 A;  3DGN A;  3M8C A;  1BRS A;  2STD A;  1W2Z A;  5IEN A;  4RNY A;  3VSY A;  2HMN B;  3NBR A;  1ROA A;  2HMM B;  4R80 A;  2CG0 A;  3CCV 3;  2HOH A;  3NBB A;  2BMR B;  3OXA A;  1CEW I;  2IY2 A;  3AMO A;  4GL6 A;  4HBR A;  4J5K A;  3F8X A;  1LOW A;  4R1K A;  4RBN A;  1E3V A;  1K41 A;  5DRV A;  2K3D A;  1RHL A;  2CFD A;  8RNT A;  3B4O A;  3EJV A;  3FF2 A;  3JVC A;  1A2K A;  3F7X A;  4JRF A;  1O7N B;  3F40 A;  5AYR B;  1YJW 3;  4X2O A;  1IQX A;  1VQ5 3;  4WFO A;  3V98 A;  1GOU A;  2W2C A;  2KCD A;  2H0I A;  1YJ9 3;  1TJD A;  4ZM8 A;  3FG3 A;  1ZO2 A;  1DET A;  1IDP A;  5KP4 A;  5LC6 A;  4OUQ A;  3KCH A;  2CH9 A;  3KSP A;  1TIJ A;  4FMB A;  2E2V A;  5AEU B;  2GU3 A;  1FUW A;  4MMX B;  1RNB A;  5FGO A;  2D42 A;  4KZ1 A;  3OX9 A;  1I2G A;  1T5Y A;  2OQE C;  1IT8 A;  1YI2 3;  1K28 A;  1CYU A;  1E3R A;  3EQQ B;  1OUN A;  3DGM A;  1NB3 I;  3MHE A;  5G1K A;  4AKY A;  1I3F A;  5IG3 A;  5HGR A;  3HX8 A;  1GY6 A;  3F14 A;  4STD A;  3LZA A;  1RJO A;  1BNI A;  4ILF A;  1NB5 I;  3DGY A;  1RKY A;  2CG1 A;  4EW5 A;  2GSP A;  2F98 A;  3LYG A;  1RN1 A;  2CFG A;  2D1W A;  1RSN A;  2KF4 A;  1OF5 A;  1RRL A;  1TFO A;  1US1 A;  2I9W A;  1PU4 A;  1G02 A;  1OF5 B;  1W00 A;  2CW9 A;  1PY3 A;  3SVA A;  2J8X B;  3QRD A;  3VGN A;  1STF I;  2YX9 A;  3I55 3;  1FUS A;  3JUP A;  4OVM A;  3SOY A;  3PXM A;  1RGK A;  1FGM A;  2UX0 A;  4HOH A;  4XDV A;  5D82 A;  2WO0 A;  3CU3 A;  2RFR A;  1KWI A;  3OWS A;  3PZW A;  4J8T A;  4BL3 A;  5BXQ A;  1YJN 3;  1RDS A;  3WDG B;  3HZP A;  2ZA4 A;  1CH0 A;  1VZZ A;  5IEP A;  1TU5 A;  1YIJ 3;  2M7O A;  5CF1 A;  2UGI A;  3HI7 A;  1S5A A;  3NM2 A;  4WP5 A;  5JPP A;  3GAX A;  3X3X A;  4GB5 A;  1NJI 4;  1ZGX A;  3MG2 A;  1F8N A;  2Y74 A;  5IG5 A;  1SII A;  4K1V A;  3STD A;  3URP A;  3F7S A;  1OH0 A;  3Q2P A;  3EB8 A;  4IT7 A;  3TDG A;  5KP1 A;  2BU4 A;  1LVN A;  1X1Y A;  2Y73 A;  3PCR A;  6STD A;  2RBI A;  3EC9 A;  3SLU A;  3KZT A;  1RGG A;  3RGA A;  3ZG0 A;  1G96 A;  3MKI A;  1W5Z A;  3FCS B;  1I0V A;  3CCJ 3;  2OTJ 3;  4EV5 A;  3X3Y A;  5FW5 A;  2F56 A;  1MWU A;  2WGO A;  3LOY A;  3O8Y A;  1UCL A;  1GOV A;  1BU4 A;  3BNE A;  2AAE A;  3GZX B;  3S67 A;  2BMQ B;  1QVF 2;  3SOA A;  1VQQ A;  2CX1 A;  2HMK B;  2RSX A;  3MG3 A;  1OGZ A;  1JN5 A;  2W9P A;  1IV7 A;  1ZX2 A;  3OWY A;  4R9L A;  1RCL A;  1VQ7 3;  3G16 A;  4ORL A;  2CFK A;  1N8Q A;  2C4B A;  3QK9 A;  1BRN L;  1MGW A;  1GD3 A;  4JF8 A;  1WQL B;  1IYY A;  1UCI A;  1RGF A;  3LTA A;  3K5T A;  1JB2 A;  2HML B;  2F5M A;  1N9E A;  1RGA A;  5CXO A;  2CX0 A;  6GSP A;  1KC8 4;  2XGL A;  2QIY A;  4TX4 A;  1ZS7 A;  2FGT A;  3X41 A;  5RNT A;  3WOF B;  4RZM A;  1UGI A;  1HZ1 A;  2JDI H;  1BIR A;  1ULJ B;  1A67 A;  4AEQ A;  4XB5 A;  1B3S A;  2XGN A;  4RNZ A;  1BRH A;  3IPT A;  1SAR A;  5EEO A;  3T0U A;  1DYU A;  5G2G A;  1QAF A;  1EEJ A;  1BNG A;  4OK0 A;  1N9J A;  3EHC A;  3PCS A;  4IPB A;  2KXG A;  3UB1 A;  2RCD A;  2XSO B;  4XM4 A;  1BRI A;  5IER A;  5ELU A;  1RGL A;  1RTU A;  1T2H A;  3K63 A;  1Z1S A;  3L0R A;  3NX0 A;  3UL6 A;  3D5I A;  3RNT A;  1IK3 A;  1KD1 4;  1JZO A;  3D3L A;  3X40 A;  4MEI A;  3KSE D;  1JB4 A;  1B2U A;  2ML6 A;  1Q7Y 4;  1ISK A;  1SQW A;  1OHP A;  2GXF A;  2CWT A;  2P09 A;  3UNL A;  3WR2 A;  5D81 A;  5AYS C;  3ZG5 A;  4BTX A;  1IVW A;  3LXU X;  1OAC A;  1GMR A;  2QGU A;  3Q3F A;  2P38 A;  4IIA A;  4K1U A;  4R4K A;  4WYK B;  3T8U A;  1GYB A;  1TUH A;  3LTD A;  3S28 A;  4O02 B;  1OGX A;  1LNI A;  1TP6 A;  4L7K A;  1EKM A;  2KRT A;  3CPO A;  4HM0 B;  3CXC 2;  1IU7 A;  1JV2 B;  2YFJ B;  4FMC A;  1YGE A;  4HVN A;  3DZL A;  1Q9E A;  1FGT A;  3CCS 3;  1YHQ 3;  4N6V 0;  1MGR A;  1BSE A;  1NWW A;  1UUW B;  3UJM A;  3JUO A;  4LGQ A;  3SED A;  1LOY A;  1R4Y A;  8CHO A;  5JBS A;  1QVG 2;  2BMO B;  2KF6 A;  5EVH A;  4HM5 B;  1I2F A;  3GZB A;  4HM6 B;  2SAR A;  4G1M B;  2WOF A;  1FGR A;  4K61 A;  1VQN 3;  1BOX A;  1B27 A;  4KT3 B;  4PEJ A;  4HM2 B;  2O3O A;  3RDE A;  2W56 B;  3B8L A;  3G71 3;  2IA7 A;  3EBT A;  3JUM A;  3EBY A;  3KKG A;  1TTO A;  3I56 3;  3LTC A;  1A2V A;  2CIU A;  4N6O B;  2P0X A;  1EG9 B;  4AKZ A;  1JKG B;  1DVC A;  4H61 A;  1V74 A;  1BAN A;  4FMD A;  4NPB A;  1O7W B;  2GU1 A;  5CLK A;  1GMP A;  2CFL A;  3D9R A;  2AAD A;  3DGL A;  1NU3 A;  4LEH A;  3OWU A;  1Q82 4;  1BUJ A;  1CQS A;  3ROB A;  1B2Z A;  1WMP A;  1W02 A;  2CHC A;  1KQS 2;  1LRA A;  2HMO B;  4U13 A;  3ECF A;  4NHF A;  1N5H A;  2KAA A;  1UW1 A;  3FLJ A;  1RN4 A;  3GZY B;  3PS8 A;  2CWU A;  4HJL B;  3CNX A;  3MPH A;  4N6L A;  1I0X A;  1D6U A;  1UI8 A;  1W4N A;  1VQ4 3;  3HIG A;  3BIR A;  1B2S A;  1GSP A;  4BU4 A;  1SJW A;  2QEX 3;  1VQM 3;  2L4V A;  3V99 A;  5M1A A;  1RN7 A;  4HM1 B;  4Q53 A;  1AR0 A;  1YVB I;  2CKF B;  3SYU A;  4WHA A;  2V1L A;  2WGQ A;  2W04 A;  5AIG A;  6RNT A;  3H51 A;  5IW9 A;  2OTL 3;  3NM7 A;  1BSA A;  5AII A;  2INX A;  3GRD A;  3Q90 A;  3EF8 A;  3DH2 A;  1M1X B;  4XBX A;  2IMJ A;  1MWR A;  2IUK A;  1N8R 4;  1BRJ A;  3JUQ A;  3VF1 A;  4DKI A;  1RGE A;  1NDO B;  1VQL 3;  4J5G A;  2OOV A;  3AHW A;  1T2I A;  3FG4 A;  3E99 A;  4L8P A;  1BNF A;  3MYT A;  1M9G A;  1RLS A;  2CFW A;  2E2T A;  5I97 A;  1L5G B;  3T8N A;  2Q07 A;  3FZW A;  4HZ9 B;  4XDW A;  1V57 A;  3U97 A;  5IF6 A;  3DM8 A;  5CF2 A;  1X1X A;  3EN8 A;  3N54 B;  3UL5 A;  1K8A 4;  2W9Q A;  1X1W A;  3DY5 A;  3KII A;  3D5G A;  1EUI C;  1Q42 A;  4KVH A;  4MMY B;  3CCU 3;  4EBG A;  1U5O A;  3K7C A;  4EC6 A;  1FW7 A;  1HU9 A;  1W6G A;  2F86 B;  1MOL A;  3LTB A;  4O2H A;  2KF5 A;  2IYJ A;  5AIF A;  1AVL A;  1TRP A;  1JB5 A;  1UGH I;  1GD4 A;  1EQK A;  1STD A;  2OCT A;  1D6Z A;  5GSP A;  3SX1 A;  3BND A;  3LT8 A;  2XH9 A;  1B2M A;  1LXE A;  5M19 A;  1JJ2 2;  1I8V A;  1VQK 3;  1MWS A;  3AGN A;  3HII A;  3CC4 3;  5HOH A;  3CPW 2;  3FGY A;  1BNR A;  4LMI A;  1JZD A;  2XFS A;  1QAL A;  3JUN A;  1LOX A;  2BNG A;  2L1S A;  3H3H A;  3CMA 3;  2C11 A;  3BNB A;  3DUK A;  3CNM A;  4BIR A; 
#chains in the Genus database with same CATH homology
 4N3V A;  2CC3 A;  5IG4 A;  2YFI B;  1SIH A;  1FGO A;  5CK6 A;  3V92 A;  1Q40 B;  4X2H A;  2GBX B;  2R4I A;  1JNQ A;  3LH4 A;  1DVD A;  4I4K A;  4KFD A;  5AI1 A;  1E97 A;  4QWT A;  4WYK A;  1GY5 A;  4CDL A;  1BUQ A;  1ULI B;  2B24 B;  2Z77 A;  4LZI A;  4O3V A;  4EV2 A;  1SPU A;  1OCV A;  3FSD A;  4H3U A;  2E2U A;  1ASK A;  5ELJ A;  2JQ5 A;  2SBL A;  1OHS A;  1IV9 A;  1IVU A;  1K9M 4;  1W2B 2;  4N6T A;  4FR9 A;  2O9U X;  3LML A;  2QA4 3;  2P05 A;  1K73 4;  3NV0 B;  3MWZ A;  3N9H A;  1GY7 A;  1WMN A;  2XR8 B;  4J9A A;  3CCQ 3;  2F99 A;  3IMA B;  5IEO A;  3EE1 A;  1WTH A;  1AV4 A;  3AMO B;  4BTW A;  3NQZ A;  4CCV A;  2W6J H;  2W56 A;  2WOH A;  3GZR A;  1W6C A;  3S29 A;  1RRH A;  4K90 B;  3EN1 B;  1PFP A;  3MSO A;  2Z6B A;  4HM4 B;  2FXT A;  3CCE 3;  1U8C B;  1VQ9 3;  2XSH B;  1TFK A;  3FF0 A;  4FCJ A;  5AEW B;  1JKG A;  5LC7 A;  1VQP 3;  3FH1 A;  3GWR A;  2YFL B;  3RGR A;  2K0M A;  2OOV C;  2GEX A;  2ML5 A;  3F8H A;  1IQY A;  3WOD G;  1UUV B;  1VQ8 3;  3CCL 3;  1JRQ A;  1N5P A;  2XEP A;  4L8O A;  4HKV B;  1QJG A;  1NO3 A;  5DRE A;  3NHX A;  1OHO A;  1IT7 A;  3B4P A;  1FGQ A;  4NRE A;  2BHM A;  3X42 A;  1ROV A;  3CD6 3;  1GS3 A;  2C10 A;  4MMZ B;  2LYX A;  5IG0 A;  3PGB A;  3I0Y A;  4KFE A;  4HZB B;  3CC2 3;  5TGN A;  1QMA A;  2GBW B;  3U1W A;  3OV4 A;  3PYJ A;  2A15 A;  1MNL A;  2FNQ A;  4WWU C;  1QAK A;  1WMO A;  3N8B A;  4HM8 B;  1Q81 4;  5EQL A;  1KSI A;  4FCM A;  3S5C A;  1M90 4;  3S27 A;  1IVV A;  3X3Z A;  3K9M C;  1D6Y A;  7STD A;  1FA3 A;  1OPY A;  2MF7 A;  3HK4 A;  2GEY A;  3IJE B;  1DMN A;  4R80 A;  3G4S 3;  4HM3 B;  1HKX A;  3K0Z A;  3ER7 A;  2LQV A;  4XBT A;  2HMJ B;  1CYV A;  3BLZ A;  1O7G B;  1C7H A;  2P0M A;  4EXR A;  3F9S A;  5JPU A;  4HYZ A;  2OQE A;  1M1K 4;  1A90 A;  3CME 3;  1LNH A;  1IQ8 A;  1WNH A;  2ZDJ A;  3FKA A;  2IUJ A;  5AIH A;  4XBY A;  3WA3 A;  1W6Y A;  2PNC A;  2K54 A;  3B7C A;  2B1X B;  5KP3 A;  4R9K A;  1UI7 A;  4N6N B;  2MC8 A;  2XRX B;  1W01 A;  1AVK A;  4FCZ A;  4EYC A;  3WMD A;  1Y4K A;  3DGO A;  3NQY A;  4LSO A;  3DMC A;  2CWV A;  3LT9 A;  3OW2 2;  3KE7 A;  4FMA A;  1YIT 3;  5STD A;  4KFF A;  3NXJ A;  1J2B A;  1JN5 B;  3KFQ C;  3EX9 A;  1R4C A;  3SXX A;  2OWP A;  3KN4 A;  1EA2 A;  2W0Q A;  1W7C A;  1S72 3;  3ALA A;  4N6M A;  3CC7 3;  5BVB A;  2PZV A;  1O7H B;  2XF3 A;  3WOE B;  2BO9 B;  1Q40 A;  3NUV A;  3G6E 3;  3BB9 A;  2Z7A A;  1DMM A;  3NBJ A;  3J7Y d;  4BTY A;  3CCR 3;  3G0K A;  3G8Z A;  3Q1C A;  5A0O B;  3FG1 A;  2RGQ A;  4N6U A;  5D83 A;  2W03 A;  1Q86 4;  1VQ6 3;  4MJD A;  2CK3 H;  3BNC A;  3MG1 A;  4HM7 B;  1DMQ A;  1O7P B;  3A76 A;  3DXO A;  2BT3 A;  1O7M B;  1IVX A;  1VQO 3;  3WA2 X;  4O8S A;  2XFT A;  2ZL8 A;  2Z76 A;  3NV0 A;  3DGN A;  3M8C A;  2STD A;  1W2Z A;  5IEN A;  4RNY A;  3VSY A;  2HMN B;  3NBR A;  1ROA A;  2HMM B;  2CG0 A;  3CCV 3;  3NBB A;  2BMR B;  3OXA A;  1CEW I;  3AMO A;  4GL6 A;  4HBR A;  4RBN A;  3F8X A;  4R1K A;  1E3V A;  1K41 A;  5DRV A;  2CFD A;  3B4O A;  3EJV A;  3FF2 A;  3JVC A;  1A2K A;  3F7X A;  4JRF A;  1O7N B;  3F40 A;  5AYR B;  1YJW 3;  4X2O A;  1IQX A;  1VQ5 3;  4WFO A;  3V98 A;  2W2C A;  2KCD A;  1YJ9 3;  4ZM8 A;  3FG3 A;  1ZO2 A;  5KP4 A;  1IDP A;  5LC6 A;  4OUQ A;  2CH9 A;  3KSP A;  1TIJ A;  4FMB A;  2E2V A;  5AEU B;  2GU3 A;  1FUW A;  4MMX B;  5FGO A;  2D42 A;  4KZ1 A;  3OX9 A;  2OQE C;  1T5Y A;  1YI2 3;  1IT8 A;  1K28 A;  1CYU A;  1E3R A;  3EQQ B;  1OUN A;  3DGM A;  1NB3 I;  3MHE A;  4AKY A;  5IG3 A;  5HGR A;  3HX8 A;  1GY6 A;  3F14 A;  4STD A;  3LZA A;  1RJO A;  1NB5 I;  1RKY A;  2CG1 A;  2F98 A;  3LYG A;  2CFG A;  2D1W A;  1PU4 A;  1OF5 A;  1RRL A;  1TFO A;  1US1 A;  2I9W A;  1OF5 B;  1W00 A;  2CW9 A;  3SVA A;  3QRD A;  3VGN A;  1STF I;  2YX9 A;  3I55 3;  3JUP A;  4OVM A;  3SOY A;  3PXM A;  2UX0 A;  1FGM A;  4XDV A;  5D82 A;  2WO0 A;  3CU3 A;  2RFR A;  1KWI A;  3OWS A;  3PZW A;  4J8T A;  5BXQ A;  1YJN 3;  3WDG B;  3HZP A;  1VZZ A;  5IEP A;  1TU5 A;  1YIJ 3;  2M7O A;  5CF1 A;  3HI7 A;  1S5A A;  3NM2 A;  4WP5 A;  5JPP A;  3GAX A;  3X3X A;  4GB5 A;  1NJI 4;  3MG2 A;  1F8N A;  2Y74 A;  5IG5 A;  1SII A;  4K1V A;  3STD A;  3F7S A;  1OH0 A;  3Q2P A;  3EB8 A;  4IT7 A;  3TDG A;  5KP1 A;  1LVN A;  3PCR A;  2Y73 A;  6STD A;  3EC9 A;  3SLU A;  3KZT A;  3RGA A;  1G96 A;  3MKI A;  1W5Z A;  3FCS B;  3CCJ 3;  2OTJ 3;  4EV5 A;  3X3Y A;  5FW5 A;  2WGO A;  3LOY A;  3O8Y A;  3BNE A;  3GZX B;  3S67 A;  2BMQ B;  1QVF 2;  3SOA A;  2HMK B;  2RSX A;  3MG3 A;  1OGZ A;  1JN5 A;  2W9P A;  1IV7 A;  1ZX2 A;  3OWY A;  4R9L A;  1VQ7 3;  3G16 A;  4ORL A;  2CFK A;  1N8Q A;  3QK9 A;  1GD3 A;  4JF8 A;  1WQL B;  3LTA A;  3K5T A;  1JB2 A;  2HML B;  1N9E A;  5CXO A;  1KC8 4;  2XGL A;  2QIY A;  4TX4 A;  2FGT A;  3X41 A;  3WOF B;  4RZM A;  2JDI H;  1ULJ B;  1A67 A;  4AEQ A;  4XB5 A;  2XGN A;  4RNZ A;  3IPT A;  5EEO A;  3T0U A;  1DYU A;  5G2G A;  1QAF A;  4OK0 A;  1N9J A;  3EHC A;  3PCS A;  4IPB A;  2KXG A;  3UB1 A;  2RCD A;  2XSO B;  4XM4 A;  5IER A;  5ELU A;  3K63 A;  1Z1S A;  3L0R A;  3NX0 A;  3UL6 A;  1IK3 A;  1KD1 4;  3D3L A;  3X40 A;  4MEI A;  3KSE D;  1JB4 A;  2ML6 A;  1ISK A;  1Q7Y 4;  2P09 A;  1SQW A;  1OHP A;  2CWT A;  2GXF A;  3UNL A;  3CCM 3;  5D81 A;  5AYS C;  4BTX A;  1IVW A;  3LXU X;  1OAC A;  4K1U A;  2QGU A;  4IIA A;  2P38 A;  4R4K A;  4WYK B;  3T8U A;  1GYB A;  1TUH A;  3LTD A;  3S28 A;  4O02 B;  1OGX A;  1TP6 A;  4L7K A;  1EKM A;  2KRT A;  3CPO A;  4HM0 B;  3CXC 2;  1IU7 A;  1JV2 B;  2YFJ B;  4FMC A;  1YGE A;  4HVN A;  3DZL A;  1FGT A;  3CCS 3;  1YHQ 3;  4N6V 0;  1NWW A;  1UUW B;  3UJM A;  3JUO A;  4LGQ A;  3SED A;  8CHO A;  5JBS A;  1QVG 2;  2BMO B;  5EVH A;  4HM5 B;  3GZB A;  4HM6 B;  1VQN 3;  4G1M B;  2WOF A;  1FGR A;  4K61 A;  4PEJ A;  4HM2 B;  2O3O A;  3RDE A;  2W56 B;  3B8L A;  3G71 3;  2IA7 A;  3EBT A;  3JUM A;  3EBY A;  3KKG A;  3I56 3;  3LTC A;  1A2V A;  2CIU A;  4N6O B;  2P0X A;  1EG9 B;  4AKZ A;  1JKG B;  1DVC A;  4H61 A;  1V74 A;  4FMD A;  1O7W B;  2GU1 A;  5CLK A;  2CFL A;  3D9R A;  3DGL A;  1NU3 A;  4LEH A;  3OWU A;  1Q82 4;  1CQS A;  3ROB A;  1WMP A;  1W02 A;  2CHC A;  1KQS 2;  2HMO B;  4U13 A;  3ECF A;  4NHF A;  1N5H A;  1UW1 A;  3FLJ A;  3GZY B;  3PS8 A;  2CWU A;  4HJL B;  3CNX A;  3MPH A;  4N6L A;  1D6U A;  1UI8 A;  1W4N A;  1VQ4 3;  3HIG A;  2QEX 3;  1SJW A;  1VQM 3;  2L4V A;  3V99 A;  1RN7 A;  4HM1 B;  4Q53 A;  1AR0 A;  1YVB I;  2CKF B;  4WHA A;  2V1L A;  2WGQ A;  2W04 A;  5AIG A;  3H51 A;  5IW9 A;  2OTL 3;  3NM7 A;  5AII A;  2INX A;  3GRD A;  3Q90 A;  3EF8 A;  1M1X B;  4XBX A;  2IMJ A;  2IUK A;  1N8R 4;  3JUQ A;  3VF1 A;  1VQL 3;  1NDO B;  2OOV A;  3FG4 A;  3E99 A;  4L8P A;  3MYT A;  1M9G A;  2CFW A;  2E2T A;  5I97 A;  1L5G B;  3T8N A;  2Q07 A;  3FZW A;  4HZ9 B;  4XDW A;  3U97 A;  5IF6 A;  3DM8 A;  5CF2 A;  3EN8 A;  1K8A 4;  3N54 B;  3UL5 A;  2W9Q A;  3DY5 A;  3KII A;  1Q42 A;  4KVH A;  4MMY B;  3CCU 3;  4EBG A;  1U5O A;  3K7C A;  4EC6 A;  1HU9 A;  1W6G A;  2F86 B;  1MOL A;  3LTB A;  4O2H A;  5AIF A;  1AVL A;  1JB5 A;  1GD4 A;  1EQK A;  1STD A;  2OCT A;  1D6Z A;  3SX1 A;  3BND A;  3LT8 A;  2XH9 A;  1LXE A;  1JJ2 2;  1VQK 3;  3HII A;  3CC4 3;  3CPW 2;  3FGY A;  4LMI A;  2XFS A;  1QAL A;  3JUN A;  1LOX A;  2BNG A;  3H3H A;  3CMA 3;  2C11 A;  3BNB A;  3DUK A;  3CNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...