4HMEA

Crystal structure of cold-adapted chitinase from moritella marina with a reaction product - nag2
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmeA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmeA01
4M6AA 4WI2A 1U8IA 1IGTA 1IT0A 1JMXA 4NRZB 3V6OC 2V5RA 4NJ9L 5ESVA 1SYTA 3T0EA 4ODHL 2VDNL 4OQTA 5JUEL 1WAWA 2Z8WC 2YD9A 3WYRA 2WBJA 2OYMA 1D9KD 5GZOD 3VA2C 5FKPB 1CENA 3MTRA 3SURA 4FMFA 3MREA 2E6JA 32C2B 4YBLB 2EZ0C 2WB5A 3MOAL 1NWSA 3K8MA 4R7DB 3D39B 3WIFA 3K1DA 1GPOL 2AXHA 5HI5D 4S1QL 1R3LB 1CDIA 4DTGH 4PTUA 1A6VH 2WNWA 3LKPB 2Z31D 1GHFH 3QHZL 4YUEL 5CSYA 1M71A 3P30H 4ETQA 1R5VA 4UUJA 5IP4A 1K8IB 2A6DB 5FYKU 4W84A 4IRZH 4Q9QH 4LSQL 2HT4C 3LKPA 4WW2C 3WH6A 4DW2H 3RZWA 2HMIC 4URTB 1OSZA 4Z2LA 2MTPA 5MEPA 4W68A 4AXNA 3RWFB 3IFPB 4CL7A 3P73A 4G7YL 1W3HA 3BJ91 3WNKA 1I7TA 4ZDHB 4MB1A 1R5WA 2DH2A 4HAFA 3F62A 3ULSB 2NTFB 3MXVH 2JK5A 3H9HA 3UCRA 3L95B 3MCKB 1OWRM 2VXUH 3I6GA 4K7PX 3X3FL 2CKBB 3AMCA 1KTLA 1ADQA 2YKKA 2XWTA 2OJEB 4RIRB 2R39A 1S7WA 4GAFB 4P2RA 1RUKL 4FXKA 4S0TD 3T2PA 1EEZB 3X12B 4H20L 3LHPH 4I0PD 4IIQA 3TBWB 4F37K 1UXSA 4CAGA 3L2MA 4UAOC 2AV1A 3QDJB 2YBTA 1E6OH 4OAWB 1BF8A 4UIMB 5EIIB 4TSBH 4WIWA 2WINB 1I85A 2F19H 2Z91A 3P11L 5DQJB 2C4FT 1OLZA 4FABL 3SKNA 4OIFA 2VTFA 2J6EL 1J01A 2FZ3A 3QIWC 1QNOA 4Z2HA 4UDUA 4YHKH 1ECEA 1BPLB 4QLRA 2AMGA 3BAEL 2ITDA 1JNEA 1WGOA 3QUZD 3AIUA 3RX8A 2QBWA 3DVNA 3RAJL 2WPGA 3VFSB 4RGOL 4NZTH 3KYOA 3EJJX 3QHZH 4OZFH 1JFXA 4RMVA 4ELKA 1MFBL 5DVKA 1AXSA 3TT3L 4Q9RL 3CDGA 3V5KA 1C5CH 3SDCC 4WUUD 4OIIL 2E0PA 4Z9KB 1H15B 1FFPA 1BYAA 1HHHB 5IVZB 3FFDA 3P0VL 1J88A 4X7SH 2WVSA 2DLHA 1QPKA 1XR9A 1HHGA 2F61A 2V3FA 5M3WA 1HH9A 1NFDA 3MANA 3FQNB 3KL0A 3QJFA 1A1MA 1VFBB 5FGBC 43C9A 4UZUA 1MEXH 1FGNL 2PR4L 1EFXB 3QP3A 4CU7A 6CGTA 2ZPKH 3HMCA 4ERSL 1MFEH 3L4WA 3KXFE 5IW1A 1DWIM 4YFEA 3R1GL 1RHFA 4PJDA 4QCIA 1QW8A 3S2CA 1JHKL 1A14H 4E42B 3BUYA 1MHEA 2G41A 1BVLA 1S7VB 3H7BA 5HTSA 1CDYA 1N64H 5IFPA 1WC7A 4RCAA 1ZT1A 2EJ1A 4JHAH 2GT9B 4PP1C 2DT0A 1QSZA 1I9JH 3AFBA 5EN2A 2V6HA 3BAXA 1KIPB 5JO5A 4R4NC 3PUCA 2QSVA 3L3IA 5KSBF 1FH7A 3K4DA 1H5BA 3BOVA 3S8WA 2DQUL 1EVUA 3BP4A 4U1IB 3FQUA 1QLRB 4F57H 3K2UH 5BOPA 4L4TD 5HHQB 3FB6A 1T7ZA 1G1CA 3WFCL 2BFVL 1V03A 3LB6C 1H5VA 4RWHA 5B4MD 5EBMB 2NY4D 1JPSH 2F15A 3GMMA 4ODVL 4XVJH 4LSSH 3VFVB 4RGNC 4OQTL 5DRWA 4BELD 2P4AB 5IM7A 1RD6A 4JE4B 1KUMA 1YDPB 1YYMH 5LGJA 4UQ2A 4N8PA 4M62L 5CKGA 2GK0A 3QJFB 1OP3H 4DN4H 4P2OD 1CG9B 2IQAA 1EO8L 5EUOB 1K4DB 2CBVA 1U33A 5CS7A 1B0RB 5DR5L 3UYOD 5I1IH 2DTSA 2CKBL 4MJ6B 5C0NC 5HVFB 4U1MB 3D0LA 1NGZA 2DM3A 1GPFA 2OBGA 3CUHA 1KBGL 3RGVC 4K7FA 4ODUA 1OM3L 5I75C 4AEEA 2UZIL 5KSAC 4NQUA 1WVZA 4Q2ZB 3FAWA 5AZ2L 3EJYC 2G60L 2DWDA 4GO6B 3UTZA 5J1TC 3APGA 3W26A 4XWOD 1JPFB 1IGCH 1ITXA 1SEQH 2G4FA 3VRLE 1ND0A 1SBSL 4JB9H 3IETB 4OM0H 1UZ8B 2AJUL 5CBEA 4UQ3B 2X70B 3HG1D 4YFLF 5D5ME 1QOXA 1A02N 1BVNP 1RIHH 2X89A 3T1WA 3H2WA 5CSZA 3AIWA 4YLQT 3R0MA 3GMLB 1CBVH 1QOKA 2YRLA 3GSUA 3CC5B 1WWAX 2XGBA 2OTPA 2NY6B 4LF3B 4R3SA 3TNMA 5JIHA 3G6AA 3L9RB 4GRLA 1U6AL 3ARUA 2VZSA 3BXNB 4YIQA 4GRLB 4KXZI 1TTUA 2H45A 3FB5A 4PRIE 2IBGA 1TPXC 4H88L 4ZAKC 3VFRB 1E27B 1I85C 4LF3A 5DJ6B 4AQ1B 4X0KB 3DGCR 3HMWL 5I16A 2DBLH 1V08A 5L0QC 3D48R 3DMMB 5KW9H 1KLGA 2BXZA 2QMJA 1N6QH 2IEPA 3G6JB 3D69B 4GIAA 5I1IL 3I6KA 5MEQB 3BYYA 5BRZB 2GCYA 1HKLL 3IDUA 4ZPVB 4CN4A 5CBEB 1F8TL 2E9WA 2A77L 1QEWB 1WT5A 5KVDL 3FN9A 1XYZA 1MCQA 1B1YA 1F02I 3GSXB 4XTRD 3UTZB 3IFPA 1QFWI 2KQNA 2DWDB 1U3ZA 3P4LA 4KK6D 2NLJA 3QIBD 3WDPP 2Y4SA 3AROA 4HWBL 1VPOH 4PJGB 4TVPH 5A8QA 5D1ZC 1UCBL 1GGYA 3BAYA 4JCLA 3TP4A 1I7ZB 1ZHNA 1NBYA 3HPJA 3TCXA 1X3DA 5KSBB 1NCTA 5DRZB 5JXEA 2WZHA 2CDFA 2Y36L 1RZ8A 4GKNA 2ZXQA 2ICEA 1VGEL 1ZLVH 4O00A 3IJ9A 1ZHLB 1BLNA 5D7KD 3VFPA 2PW1B 4NO3A 4NQCB 1DWHM 4OJYA 2YUXA 3VG9C 1KENH 2AJYH 1U91A 4XCYB 4U1KA 1BJ8A 3O11A 5EC1A 3IFLH 4GXPA 3D39A 4HCRH 1C7SA 1KT2B 1UACH 5KANG 4F58H 2VX5A 2H1PH 3ILPA 1RIUH 2H9GB 1ZT7A 4MXWH 1JVKA 3EO0B 2IG2L 4NC2B 1UWSA 3MRIA 2X1IA 1G7JB 2A9NH 5EH1A 5HVWA 1BF2A 3H9SD 4YGVB 1MLBA 3Q6FA 5KW9L 4JG0H 1QKZL 1C5BH 4KRTA 4MNQE 2IH1B 3OJDA 5JXEC 4M4PA 3OAUH 3AFLA 4AK1A 1IGTB 5BWFA 2WC7A 4F37F 1UFUA 2BNQA 1JI1A 2YLAA 4PJ7A 4X98A 3CVIL 2WKGA 2LU7A 3RNKB 3HPLA 4M7ZC 3V6OA 2OSXA 1OGSA 4JN2A 3WD3A 2EO9A 1W9BM 3U7VA 3LMJH 2MCPL 4PJ9C 3OGVA 3I50L 5B22A 1PYWB 1CXFA 3INUH 4WFFE 5E2WH 4ML4A 2VSDA 4NJAL 3T1FB 1AR1C 4YQXH 4KKCD 1N6UA 3RGVB 1BIIB 3S35X 5JMOC 1V3IA 2QSTA 4KJWC 4K8RD 5ESAB 4YO0B 1BEYH 2AKRB 4XBGA 5A1AA 4HX1B 3A6BH 5A2LH 4OFVA 2R0ZH 4FQLH 3T4YA 4JZJA 1RK0A 3CHEA 3TT1L 1JZ5A 1W0WB 5T3XD 4JZ5A 3MPCA 4FS0A 4N0YL 4GMSH 1B0IA 4OQ1A 4AL8L 4LPCA 5TH2A 2FSEB 1MFNA 5DQ9A 2YA2A 3AOFA 4MCZB 1OTTC 3WMBA 2Y1VA 5GIRA 3FB8B 3FTGB 2FBJH 4OKVB 5DD3H 3GMNA 4BKLA 4UV4H 1UOKA 5BO1H 5EO1A 1K4CA 2MHAA 2E7BA 1JXKA 3O0RL 4DGYH 3HZVA 4YHOL 4B3LA 3QI9D 4OKVA 2FEDC 3I50H 4HCRA 5HGDB 5LBSH 2P8MB 3S36H 4KQ4H 4G8GA 4MNQD 5D2NB 5GJSH 1WTLA 5C09A 2IAMC 4M02A 1UWEL 2QR0A 1KXVC 3S6TA 4U33A 1RK1B 4GOSA 4HXBL 4H8HA 1TPXB 4XPAH 4PEEA 4OGAD 3TO4C 2IBZY 3T4YB 3E2HC 1E71M 4L4TB 4K68A 2VJXA 4UFKA 1UB6A 4Y5XC 1CICB 1ISZA 1OGTA 3MRCA 1BIIA 4OGYL 3GB7B 1OWWA 4JPVH 4J28A 3QEUB 2W61A 3WKMH 2DD8L 2C4XA 3V5DA 4LSRH 3CVHH 2D23A 5D1ZB 4NQSA 4JHAL 2CESA 5FYJD 2OL3A 5GS1A 3QZWA 3VFMB 1F58H 3KDMA 4HIIB 3CK0H 3DX9B 5JW4Q 4KJYA 5IFHL 3SGKC 5C0JB 1RFDL 5D2NE 4HEPG 4JQIH 3LKOB 5DVNA 4W7UA 1L7TH 2YDQA 1JFHA 4PLNC 2CLZA 5FUZL 2ZIDA 2CUMA 5CD5D 1MNUL 2I07A 1YC7A 3TZVC 3L6FB 1ROWA 3OKEB 3MACL 4ZNEE 5AG9A 5E8EA 2ZCLL 3VG9B 1F4WL 3M1BA 5I30H 4QRTB 2H9GA 4X9FA 4GZEA 1H3UA 3QEQB 4K94C 4E41A 5KJRL 4M29A 1A7QL 3LQAC 3QB7C 1T22B 1S7XB 1XCTB 1EAPB 5CUSL 2OSYA 3VIKA 3I2CH 2AK4E 3HZKB 3LKQB 1SQ2N 4P2CG 5D1XA 2J47A 3G6MA 1XGUB 2YD7A 3QNYA 2XZQH 2W9EH 1MREH 1FNAA 1Q1JL 3BKYH 3BT2L 3OKNA 3Q3GA 2FX9H 5ISZD 1G7PA 3G5VA 4G3YL 2DQEL 4CNIA 3E6HA 2J7HA 3LOWA 3RWGA 5BXRA 1R3KA 5J6HA 3SQOL 1FQ9C 4JRYB 3NABL 4HJ0D 3TBSB 4H88H 1ZMYA 3VRJA 3AIVA 2WMFA 4J6RH 2PI6A 2DYPA 1IGIL 5TDNB 2CMRL 3IAPA 5AUMA 5JR1H 3DO7A 1U6AH 3ZQ9A 3MRFA 1TJIH 1XFPA 5EDXA 1F90H 5F1SA 2XSBA 3D39D 3MRDA 4K3HA 1NLDL 3TV3L 4PTXA 3OGOE 5TFSL 1U8JA 3W5NA 3D2UA 4D2NA 3RY5A 4GS7B 4BQ8A 2XYLA 4ZXBA 2CDGA 4WTWA 5EOQH 1BFNA 4FABH 2HFFB 5MEQA 3WSQL 2BNQD 4W6WB 3WD0A 3C5ZD 5M5DA 1B88A 5B38A 4XAWL 2XOTA 3WJJA 2BFGA 2DQJH 1QVBA 5IFJA 3N9GH 1QA9B 5D1XC 1E27A 3DHMA 2DQGH 2FLRT 4F3FB 2A83A 1FORL 4U7KA 5EA0L 4ZOCA 4DEPB 3SGJA 4MAYA 5EU5A 4XNQA 5GGUB 4U2YA 3OKKB 3U7AA 5GS0D 5DUML 4WW2F 3FFCD 1KR0A 5ICZB 1FZKA 4ETYA 1HIML 1U2CA 5I0DA 3L4XA 2WXDM 3O3EA 2PYFA 4GW1B 1JTTA 4U0RB 2H1PL 3CDYA 4ZXBC 5KSBE 3SQOH 5J9PA 4HEME 3DOSA 3EFFA 5IMKA 4PV9B 4N1CA 4X6DE 5LCVH 1WCBB 1I8KA 1RURL 1I9RH 3RVVD 3P0YH 4OCXL 3EIFA 5EUOF 3CFEA 1N7MH 4LDLB 1H11A 3BH9B 4HCRL 5JNYA 4ZODA 5CUSH 2XKSA 2IANA 3RJQB 1M7XA 3FNDA 1F6AB 4XP9H 5HPCA 2VLKD 1U3HA 3Q48A 2P48B 3DIFA 3SKJH 4TSAH 4AG4L 1WFTA 1JYNA 3ZO0A 5JORA 4OLXH 5JW5B 3MCLL 2EPLX 3LY6A 2ZG3A 1Q72L 1T80A 1LO5A 1Y6MR 3MGTB 1V7NH 1F5WA 1UH4A 1JZ7A 1RZKL 1TZIA 5LQBH 1DWJM 1K6QL 2R2BB 1ZS8B 1JRHI 1E6PA 1PIGA 2BNQE 3G6DH 2BVTA 4YXHL 1R3KB 3RA7H 5J6HB 3C6LD 3WFBH 3VVGA 2BSTB 2DIJA 3O2WL 3GK8L 1I3GH 4TUOB 5I2IB 1NFIB 5M94B 4D9LH 3RM4A 2LAGB 1AGDA 1UM4L 3F7QA 1AQDA 3HZMA 4LCUB 3TTQA 3OLEA 3BP4B 4BM7A 2YPLA 3GBMH 2VRAA 3MRRA 1R7AA 4YDIL 2FGWL 3R4DA 2CDEB 4TRPL 4FFYH 2JLLA 4NN6C 3QBTB 2Q8XA 2ZUQC 4Y19E 2E27H 4PJ8B 4I3SH 1U3JA 4O58H 2QADC 1N2RA 4U0QB 1HP5A 1IQWL 5CLTA 2YSSB 4HIEA 3LMJL 2NY2D 5HHMD 5L7XL 1BVLB 5K9OA 1V3KA 5EOTB 5BZDA 1R87A 3JVGA 1SEQL 3ZL4L 4WHTA 5HDBF 3B5TA 4W6XB 3UC0L 4AZGA 4KK5C 2ZUMA 4X80H 3RWDA 5D1ZA 5KSVB 4POZC 5B39G 5I73B 1DBBL 2UZIH 4YDJA 3K8KA 1ZS8A 1H49A 5GGSA 3BPNC 1MH5B 1BFVH 4KKBD 4A6YH 3M45A 1NFDB 1JAEA 4ELMA 4QAWA 3K80A 4XGZA 4WSKA 5IR1B 1LE5A 5IBUG 3T2NL 3WIJA 1MOEA 1Z3GH 3SKOA 1AVAA 1NMAH 2AV7A 1E0VA 3PP3K 5IWLA 4G80B 5IBUB 3CZ8A 1RK1A 5ACLA 3WQ6A 2FJHB 4ZS6D 1NBVH 3LN4A 1M7IA 4L8SA 4OGXH 4GI6A 3GSVA 3OF6D 3HNTH 1YMHB 3WUBA 1MELA 4D3CH 5IV2A 1UC6A 3TBTA 4AT6A 4JM2D 1OARH 5AD0A 1GOMA 2BVQA 3ORJA 2B2XH 5EFIA 1KJVB 5E4EB 1LO3L 1KF9B 5E08L 2PF0A 5JLZA 2PTVA 2ZX9A 5I79A 4H8WL 4HLZH 2UVFA 3P4OA 2X40A 4JKPH 2A3CA 1T2QH 2HG5A 3P4MA 3DNKA 1VKXA 1F4YH 4N8VA 1BQHG 3DXAB 1MCBA 3HUJE 2XWBA 3S98A 2OR7A 4Y4FB 4Z78B 4ZXBD 2EEBA 2B7DT 2I24N 2JCCA 5T3ZD 1U8KB 1AHWB 3ZT5A 2G75B 4V1DE 3NN8B 4OAWA 2YA0A 4QWWD 4XP5H 5J1AB 3UG4A 3QHFL 3POCA 4JZJB 4JFUA 4UCFA 4HUUA 5BJTB 1PZ3A 4ZE4A 4G6KL 4XBGB 2UYLA 4E5XA 1NPUA 3BEVB 5MEOB 3ROLB 1LD9A 4E41E 5D72L 4JHOA 1QYGL 4WVRA 1D5XA 1LDPL 1UWXH 1CF8H 2EXWC 3R1GH 3SDDA 1CK0H 3FO2A 4GKOA 2VLRE 5DVMA 1MRCH 1MW2A 2BVPB 1G7HA 1K8DB 1L0QA 5INDA 4PY7B 3TJHC 4I0KA 4OLWH 1N64L 5C0EA 3AIEA 1AO7A 4P5MB 2JK5B 1N0XH 1CECA 1KCUL 1TVBB 5EORL 1FZJA 1YEJH 4OLUL 5EO0B 1CFQA 2CBIA 2R9HC 4Q9CA 6FABH 3QFDB 3V8OA 1HJUA 3VCLA 1G9MH 1OSPL 4LPUA 4PGBB 1CVSC 3SE4C 4U1SA 5MP6H 3S34H 5DHVB 3BZEA 1BECA 3TO4B 2IGFH 2VDKL 5LGHH 1X5XA 1JPGB 2O5ZH 3C5ZB 4NN7C 1AXTL 1CL7L 2EKJA 3MYZA 2ZP0T 3FMGL 1NC2A 4WRLA 4ACPA 5DUPH 4CD7A 3G6JE 3OG6B 2JJWA 2ZJSH 1E4LA 4ZG1A 1BM3L 3TT3H 1ORSA 5E8DH 4FTVE 4ZXLA 4P2OB 4KC3B 3MLPA 3C60B 3OR7A 4MJ5A 1XH3B 3BO8B 4TVDA 1Y0LA 4I2XB 4MZ2A 4YHNA 5JA9A 2WVUA 5F9OH 3GBEA 2WBJB 1RZ8B 4GKNB 5SWSA 3KYMB 1YNKH 2KQMA 3TT1H 3F58H 3PWNB 3UJIH 1E70M 3CMJA 1WP6A 4X5WB 4AIZB 4P59L 4NSKB 4PJCF 2E9LA 5T3ZH 1XMWA 3LCYA 4KJYB 4PJEB 3O6KH 1HE7A 2BNRD 3EOYG 4QXTA 2GK1B 3LIZL 1JWUA 2FHFA 3BDBA 1T20A 4GRLC 4I1NB 1AQKH 1V02E 5BRZA 4PY7A 1JHTB 2DIEA 3BP7A 2WIIB 3WN5A 4QXUL 4Y4KC 5GZND 3UPRB 4YR6B 5FYJE 5D7LA 3SE8L 5IB4A 5DJ6A 1KCSH 3AYSA 3BEVA 1US3A 5CMAA 3WS6A 1JUFB 4RSVA 5D96B 2WHLA 2Z4QB 3S3PA 4J3UA 4HUUB 5BJTA 2GSJA 5I1JH 4HU8A 3NGBB 1FP8A 2HVJB 4LSVH 4LPWA 1CGSH 3WBEA 2F8OA 5IMMA 2J75A 4D0BB 5IHRA 4P3CL 1QZ1A 1RZIB 1AO7D 3AY4A 4OFKA 2G3JA 4GG6E 1H8SA 1MXDA 4L4PA 1T89A 5I8KL 1A9EA 3EO1B 1QNRA 1ZHBB 1XGQB 2FO4B 1MEXL 4FQXD 2FR4B 2KKQA 1FIGH 3PGCB 1LGVA 2JEQA 1N5AA 3FKUS 1Z0MA 1KB9J 1BD2A 1FG9C 4PJBE 1OTUD 1BM3H 2AK4D 4YK4B 1ZHBA 1QBML 1G1YA 1EH9A 4HWZB 5E9DE 4PMUA 4LLYB 4QWWC 5FXCH 2FD6H 2Y36H 1ISXA 2XYCA 1QW9A 4N9OB 1R3IL 4YUEH 3UG5A 4XI5C 3U5YA 1KFAL 2BVPA 1JMZA 3HI6L 4PJ5B 1INQA 1A3RH 2V7HB 5DMKA 3D85A 4FZ8H 5DJCB 5FO7A 1TNNA 1RP9A 3B8SA 1ES0A 5ECJE 5F8QC 3WY1A 4IOIB 3QIUB 2HFEB 4OLUH 4MDIB 4P4KB 5C0BB 4QHMA 2EXYC 3VXRD 2NZ9D 3L3KB 2F54D 1FG2B 5D7JD 4FNLL 5JOFA 1PPIA 3RDTC 3T1FA 1AIFB 4KK5D 3VFTA 2AEQL 4P2YA 5FKAA 2VDLL 3NFPB 1J9YA 5KSAD 4HXAL 1FAIH 2FWOB 3RP1A 3HPLB 4OTXL 2GIYA 5HHOE 4X9YA 4PD4K 1ED3A 4JHZA 4XNYH 4XMPL 1PKQB 3NZ8B 4HWEL 2GSIB 3AI0A 2RCSH 5BZDB 5JPMB 1U8HA 3DMMC 3N13A 1T1WB 4G6AD 3PNWB 1HHJA 4LHQB 4HAGA 4NO0A 4ZQKA 5IK3B 1ZAGA 4JFQA 4ELME 2YRZA 5E99H 1GQIA 1NBZA 5T3XE 4QXGL 3BQUD 1AJ7H 3N04A 3RGVD 4X7EC 4XC3L 3QCTL 3LHPL 1A9BA 1KIPA 1ZT7B 4HUXA 3NCYS 4U1HA 3S4SG 4PJBF 5B38G 2X4QA 2FD6L 1QSEA 3TO2B 5DO2D 4WV1C 1DUZB 2CETA 1A6ZB 4BZ1H 4PD4J 2C3GA 2WVTA 2Z9TA 4OZOA 3AXLA 1EEYB 1A3RL 4YXKL 3CZLA 4PRBB 4QRPA 2WBJC 2OQJA 5LYRA 5GGSB 2ARJB 3OX8A 4JFDA 3DO3A 4Z5RA 1QBAA 1RZGB 4I77L 1IAOB 4LMQE 1KEMH 4JQXC 5HHNA 4TNWK 5DHVA 3BZEB 1KEGH 5F88B 1NANI 4WNQA 3ARFA 4RMSA 2W60B 3P9MB 4HIJA 2CRIA 5TDOB 5DSCA 2YC1A 2OI9B 1RZJH 3QHFH 3MROB 3SEPA 2JEPA 3DVGA 2NZIA 5DEGB 1TUXA 5LAXA 4CKVX 1MLCB 3L7EB 4YE4L 2J7EA 3HFMH 4C7GA 3VXSD 5KN5A 4UZSA 1E4WL 5AZEL 4YHZH 3B4NA 1T1YA 3ULUD 3BRDA 1MQRA 3EFDH 3AZSA 1FN4B 3VFOB 2XG5A 3O6LH 1J18A 4FTVD 1A1OA 4KZEH 3LZFH 2BVEA 4O9HH 3SGEI 5MEOA 3C6SB 5HJ3A 4OOZA 1W72B 2MPAH 1UWEH 4ZTPH 3S34L 1IGJA 4AEFA 1TETL 2A6JB 2VXQL 3OA5A 4PRAB 1S7QA 4NJ9H 1JI2A 4PJ9B 4GW1A 3DUHA 4P46D 6FABL 4PJFB 3QCUL 2N1KA 2ZOLB 3BH8B 4HPYH 5ADOH 1SYSA 1YEJL 4FFWD 4JHWL 4PB0L 4Y2DC 3FQTA 2RCSL 4LLVB 5A6LA 5JZ7D 4W93A 1GIGH 1IILE 5GSRA 5C0IB 4PJFA 3EUUA 3DSFH 4GAGL 3LPGA 3ECBB 3NCBB 1YEIH 1U3HB 1HQRB 3KYNA 2VT0A 1DLHB 5F7DA 4BK4A 1KPVB 1IKNA 4DKFH 4HQQH 5J4MA 5HHVL 3REWA 4GRLD 3EDKA 4L8BB 4LKXB 5BMFH 1R8LA 4HOWA 2W9EL 4BFBD 1OL0A 2Z31C 3B2VH 4PLJD 4NQDE 3BFOA 2E7LA 4HLZG 5F1IA 5MHSD 1D5BB 1MVUB 3A6CH 3UYPA 1FL6A 3ZKMD 2HT3D 2GUOB 1TTGA 3NTCL 1WF5A 4IRSD 1H3VA 4X5XB 3STBA 4JFXA 4MLSA 3DI3B 3T0AA 2IQAB 3X17A 1F4WH 5AUMB 5JUEH 1E6XM 2WBWB 2W60A 4HIJB 5ICXA 2GK0B 4FK9A 4JY4A 4JFEA 4NQCE 4PR5A 3V6FB 1P4LB 3PWLA 3BE1H 4XNMA 1L6XA 4HLJA 3GSWA 2PN5A 5CIPH 3SDCB 3UYRL 4AZCA 1FDLH 1GRWA 3WD2A 4ZO6A 3IDYB 4BH7A 4CN6A 4RNRA 1QKZH 3ZHLA 3OJVC 3ZE0F 4Z7WE 3S96B 1PY9A 2YZ1A 1MJ7L 1B3JA 5CJQL 1NGQH 4PTUB 3C6SA 5FO8B 1PKOA 3AXLB 3PZOA 4PJ5E 2XTJE 2X0HA 4TN9A 3QNXB 1QLRA 4N90D 2J8UA 5B38B 3F7VA 4RE3A 5CD3B 1H5BB 3WH8A 1U36A 2W9DH 2OK0H 4ONHA 4LVHC 1K9DA 3GBDA 1HKIA 2OP4H 5CAYB 4KVCL 1WO2A 5IESH 1YNLH 4MX7B 3JV4A 2MPAL 4PJIB 1I1CA 4N1EA 3H7BB 2VN4A 3KYKL 3ZZ1A 4DFHA 1H9VA 1FBIL 3VDHA 1NL0H 2HT4D 3CNKA 2DYPB 4N8VG 4XPGH 1HCVA 1M03A 3EDJA 5ADPH 2MMXA 1OF2B 3KEHA 1I3VA 4JRYA 3DBXB 2J7GA 3ISWA 1IAMA 2ADGB 1EJOL 1ZLVK 3TIEB 2ADIA 3U46A 4E41D 1GQJA 3IDJA 1ZBKA 4JREC 1AKJB 1KCRH 5GS0L 5EZLA 3U9UB 4HF5H 3SBWC 1WCQA 3QO0B 3DV4A 4Z7UE 1I7RB 2VDQL 2XY2A 4XPBH 3FFCB 2WZPD 1CVRA 4JFHD 4BQ2A 1ZANL 4OJFH 4NN5C 2ITCA 3QAZC 3AHVA 2VDMH 1KYOK 1LVEA 2CJUH 1MW3A 3R8QA 1QSEB 5HDQL 5I66A 5T5FH 5T5NG 5T3XH 4Q6IB 1TENA 5DJDA 3U7BA 2V7HA 1R24A 2QQNH 1RJZA 3MLUL 3AIRA 4Q97A 4U0RC 4K8RH 1A7PH 4KK8C 1QFWM 4J3OC 1WJ3A 3QHMA 1YQVH 5JBDA 1MCOH 5J9PB 4HGWB 1N5AB 4OM1H 5DA0B 3ZE2E 1EQCA 5DC4B 1R0AH 3LEXA 1N4XL 5D4YA 2DTMH 2YJQA 1UGNA 2YD6A 3QCTH 3M8OH 1SYVA 2ORBH 4KHXL 4P2QD 2FWOA 1HNGA 2Q20A 4L4TE 4P57A 4S2SB 4XCEA 2CKSA 3ARXA 4HK3N 1OB0A 2Y06H 4QHNA 4DK3A 1W9PA 1E1EA 3IDGA 3JV5A 3NIYA 4D6GA 3GBLA 3PTQA 4PJ8D 3SE4A 2JIXD 4I3SL 4Z7OE 3AICA 3LMYA 6A3HA 4NN6B 4IOIA 2A83B 1BJMA 4X8XA 5CMAB 1YN7A 5FO7B 5HXMA 1LP9B 2X1PA 2GAZB 1E4IA 1FL5A 3NSMA 4M7LT 4HUWA 2ADFL 1CD9B 1TQCC 1KTDB 4OCSH 2CKBA 3ARPA 2P8MA 3BDYL 3LV3A 3GKWH 3QCVL 2QEJA 4ONHB 4K94H 1UVQB 4XVTH 3FOMA 4MHHI 4PJHA 3NCOA 1NCBH 4G8EB 3D5OF 5HDLA 3PGCA 3U82B 1HX0A 4FLRA 1BJ1J 1HIZA 2A3AA 2H8PB 1E4KA 3MLXL 2WMHA 3MJ7B 1O7AA 4X5WA 1ODUA 4U6XA 3QDGA 1EAJA 2JJVA 2HFTA 1IT9L 3IF1B 3QUMH 1R5IB 4JJ5A 2R0KH 3WEOA 3SDXE 4QGYA 2DQGL 1U2HA 2BDNL 4P5TC 4R2GD 1VPOL 5E00A 3V4PH 2D0HA 2VQ1A 2CGRL 3HG1E 3GMQA 1YY9D 5DK2B 4HG4J 4MJ5B 5TE6H 1WWWX 5F72S 5I75B 4OLYL 3S3SA 2AKRA 2LE9A 2A6KA 3RBGA 3GFUA 4WWKB 4NFCA 5KOVC 4YN5A 3TWCH 2ZWLT 2Q76A 4JR9H 3H3PH 3IXAB 4ATLA 4LVHB 1EXUA 2AEWA 4UV4L 1F45A 3QAZB 4P3CH 2NY1C 4ZEPA 2OTWA 2WP3O 1XZ0A 4FLSA 1RI8A 1HIMH 5FAAA 3PL6D 4QRSB 4LSVL 2PWGA 3HE7B 3T0EB 5J57B 2FNBA 5EBLB 2NW0A 2CLZB 1JNHB 5DTFB 2XZCL 4IBLT 4HG4K 1CWVA 2YUVA 4NQXB 1UM5H 3QDHA 3SE8H 5MEND 1JNNL 5EO0A 2H8PA 2AJVL 2Q86B 3SDXB 2FGZA 3X14A 3GO1H 4G8EA 1MCKA 4NNYA 2E40A 3A6OA 4X6FB 4GRWB 4KQ3H 3VXRE 4M7KH 4OF3A 2DQJL 1EGZA 2D9CA 3RTQC 5C09D 3LRHA 4A3HA 3P9LB 3O6AA 4U1JB 5FYKD 2QQKH 2IFGA 4DQOH 3UMTA 2DLGA 4M8VA 3GB7A 3VGHA 1DWAM 3V6ZB 1CLOH 3RDKA 1BBJB 5GS2D 2V3GA 4NKQB 5EU7E 1KB5B 3C9NB 1Q0YL 3NAAH 4OF7A 4PRAA 1JGEA 2VOTA 1WDPA 5TE7L 1KPRB 4NO5A 2EDKA 4H04A 4RGMB 3NN8A 2APVA 4LHUD 4EBQH 4JQIL 5C09B 1AGFB 3QO1B 5ISZE 1HF6A 3CZFA 4UB0L 1M05A 4QTIH 3BAIA 5CXPA 3JUGA 4WK9A 1BYCA 3HZVB 3DXAA 1KEML 4OZ4B 5BV7H 3NCJL 2DLFH 2P5WE 3WDRA 1GONA 4GRMB 1GQLA 1KJ3L 1N0LA 1U9KA 5C0CE 3QPXH 1K8DA 1CIDA 3CIQA 1RJZB 3DTXB 1P6AB 4N0RA 1IM9B 1KC5L 1MVFA 1A6UH 3STZB 1X9QA 2VZTA 5F1NA 4G8IB 1ZA3B 4P4KC 4KTEH 2Z31B 3OBAA 3WJJC 2VL5B 3OR6A 4YNYB 3MBEA 3VGDA 1E6JL 3AYRA 1K4DA 2C3XA 5IR1A 1LE5B 2HAZA 4Q58C 1D6EA 5FM4A 4NHCL 4RGND 4W4OA 5IMOA 3SKMA 1KXHA 5JHDA 1LDSA 3BYTA 2WMGA 2J3SA 2OMBA 4WUKH 4FLQA 4G43B 3U46B 1EDTA 4PCSA 4KAQH 4EOWH 1K9EA 4JM2B 4Z0XB 3RWJA 1OF2A 3AHYA 4X8JA 3VFGH 5ETUA 4QRUA 4JN1H 2BCKB 4XMKH 3C87A 1DBAL 5B3JF 1YECL 4P8WA 4UNIA 1EUUA 4UR9A 5AC5A 2VXVH 4E9LA 4O2FA 5DK3A 1YQ2A 4KY1H 5EFIB 4LRIA 4ZUWB 1HQ4A 3BPLB 4OD2B 4PRID 4ZMAT 1NBQA 4XHJC 3N17A 2HJFB 2N7BA 2RTSA 2GITB 1A6VL 4XBPB 1KLUA 2KZWA 3OKLA 1B2WH 5SX5K 1WB0A 5GRJH 2WMIA 2J7BA 2QHAA 3PZGA 2WAHA 1VFUA 4RDQG 5C0BE 3SE3A 5MENB 3WKNA 4PN2A 5I66B 2ATPB 4HHAA 3MJ9H 4LLUB 4P3DA 2BX5A 2X4TA 4M1DL 4X7TA 2ITCB 4R4ND 1HJQA 4XBEH 3AISA 5IROA 3ARFC 4NGHH 2VO5A 5J13B 3HE6B 4PGDB 1NH6A 4KQ3L 1MH5A 1YQVL 2CBJA 1NUGA 4F7CB 2ICEB 1FIGL 5IFAL 4ZO9A 3IGAA 4BSJA 5CP3A 3KLDA 5ITFB 5EU6E 3O4LA 3MLSH 3TIDA 1YJDH 4NZTL 2XNAB 1MFUA 3CSBA 1OCWL 1OTSC 4Y8DC 1ZSDA 5L2KA 4EI6A 3QYCA 3VWJC 4JM2F 1LO5B 2DLIA 2FBJL 3A6BL 1IM3B 3G6JF 4V1DA 3HRZA 3RTQB 2YHGA 3DSFL 4GAGH 5CGYC 2F54E 5HHQA 5I1JL 4HJGB 2NY0B 4LQ1A 5F1IB 4LAJH 4HZAA 2EPNA 1FYTB 1VACA 1A1NA 1QVOB 1FJ1A 1TMCB 4JHWH 1S9VB 4PYSA 1CDUA 1T21A 4L4OA 3S37H 2WZEA 4JL2A 3REWB 2GT9A 2EE2A 2FECL 2JIXB 2Z1KA 4K55A 3WBDA 1KBBA 4YHPB 1KNOB 3F7PC 2OL3L 3QXTA 5J12B 3LEVH 4G9FD 2XN9A 2BVOA 5EU6B 5FUZH 3PZMA 1NGPL 2VL5A 3TBVB 1J8HE 1SY6A 2DT2A 3NIFF 1ZGLB 5E70A 2WHMA 3CFKB 3QQ9C 1G6RA 1JD9A 4XNMB 2VYRE 4XB7A 1A6PA 4J23A 3VFGL 2VAJA 3RJYA 1CXLA 4R4FL 1HYRC 3RVXD 4MAYB 3O3AA 5DI8A 3P9LA 4CADB 1UD4A 5GZOC 2EYTA 5D1QB 1HKLH 4ZOBA 3U4EB 3E0GA 4MMXC 5FYKE 3GSNA 4WEMB 2YXFA 1JPFA 2D0GA 1QHPA 2I27N 5IW6A 2QJDA 4MXWL 2BP3A 3WF2A 4J4PA 2HJKB 5A8MA 4ZAKD 4PREA 4PRIA 1MFEL 4DUWA 1A6WH 5DFWH 5CIPB 1BAGA 4NFBA 3I6LE 2OMNA 4KTDL 4PJ7F 1OINA 4D8PA 1FE8L 4G8FA 2XRAH 4JFYA 4EN3D 4M1CC 1ZGLP 3DVNB 4CD8A 1JFQH 3PGDA 1HXYB 1U58B 1OSPH 4ONGH 3I3DA 1OY3B 5BZWA 2PYFB 1ISWA 1YMMA 1JN6A 2EBNA 3UJJL 3MR9B 1WBZA 1W8OA 2DWEB 1QO3A 4EUPH 2IBBA 1BMGA 3DHPA 5EZJA 2UZXB 5IEHB 4OM1L 1XD0A 4YFLI 3AIQA 5HI3C 5HYJB 3S88H 1ZV5A 2XJ7A 1UKPA 3LQMA 1H0DA 2E7HA 2XM1A 2I9LB 1XGUA 4LU5L 1MI5A 4APQC 1DN2A 3UJIL 1A5FL 1DQLH 1QNSA 3OG4B 3FO0L 3G04A 3TVMD 1INDH 4F9LA 2D7PA 5FO9B 4GXUN 2DMCA 4XAKD 4OZHA 2VLJA 5IG7B 1DBMH 1KCVH 1V8HA 1NC2D 5L2JB 2ZCKH 3QFJA 3BMVA 2A3EA 4DZBA 4WLCA 4HUXB 2CRYA 4KUCF 2NQCA 4XRCB 1GGTA 1H3GA 5D7KE 4S10A 4R90H 4HDIB 4AENB 3BZ4A 4M9PA 4NJAH 4HF5L 1N59B 3D2UB 5E0QA 1MIML 1G84A 2OL3H 1CD0A 4MQ7A 3RWHA 2CHOA 3QUYB 1TMQA 2V5DA 2JCCE 3LKOA 4NSBA 1T1WA 1Q8MA 2R8SH 2P5ED 5ICYB 1ZSDB 4Z7VE 3H3KA 4UQCA 1H0IA 3HI6H 3SQBA 1FZOB 4LLMA 3ULVH 1CYGA 3HNVL 3NCEB 5DK2A 3ZOAA 1S8DB 1AD0A 4Q0XL 1JF5A 5F6HI 2IWGA 4EDWH 3CLFL 1V6UA 1OAKL 4JJ5B 4CD4A 3HLAA 1RUPL 5GGTL 7FABH 2E9MA 1EAPA 1UWQA 2R1WB 1E4MM 1XC6A 3OQ3B 1VERA 1GOHA 3CVHA 3I02B 4JRXD 5JIPA 3UBXI 1KFWA 5I8KH 3HNSL 1S7UB 1SMOA 2P8LB 3A0OA 1KCLA 3P3YA 4HPYL 3OKOA 1AGEB 4IMKA 4TOYH 1NCWL 5FV1L 2N56A 4TUKH 4AT6B 4HWBA 4M4RA 1CE1L 1CLZH 1W8NA 5DWUL 4JCMA 4BZ2H 4PYGA 4WW1B 3UJTH 5ESVB 3VI3E 3CSYA 3UDWC 4KRPC 4HUWB 4MGXA 4HWZA 4NBYB 3GMOB 3L3DA 5CJBA 5L2KD 4G80A 2JJTA 4O2FB 3IDNA 4WWKD 3QJHA 4H20H 3L1OH 3THDA 5GRZA 3HNVH 1S9WA 3I75A 2NW3A 1WUNT 3ULUL 2WCSA 3A4AA 5EMYA 5A6JA 1ED3B 4JGJA 4GZJA 4JM2A 4M43H 1W72L 1C5DB 1QTYT 4MCYB 3EMZA 4F9PC 3WDIA 3OIHA 3QG7L 5I0ZA 1HJWA 4RA3A 4R8WL 3SKNB 1RZIA 4PIRF 1LK3L 1S9YB 3ARYA 1F8TH 3ARGD 5K93A 3SDXF 2FEDD 1GGCL 2LQRA 4YHYC 4XZUB 1OTSD 2Q8BL 4R90L 3FW6A 2CUIA 4GRWF 4MAUL 3MO1A 4NC1C 2VRQA 2AXFB 3TPUA 5M03A 1B6DA 3FOLB 1CICA 4G42A 3QUXC 2IF7A 1CGYA 4YNYA 3GSOB 5DEZA 3MRJB 3EYVA 5C07E 3WLWC 2C3VA 1UWIA 3GXFA 1EEZA 2VXTL 1TE1A 4LSRL 3VXOB 5DGRA 2CK0L 2WIIA 3BQUA 3WN5B 4KDWA 4WU5A 2NY4C 3PIQA 4ODXB 3RIAK 2J4WH 3UYRH 4D1IA 4NNXA 1FVCA 4AMKL 4DTGL 3F7RA 1U2YA 3ZYIA 1CLXA 3HAEH 4LCCA 3RHWF 5D6CA 5JW4N 3MSPA 4HOZA 3NMEA 5EU3A 1V6YA 3V52H 2QF8A 4Y7MA 3TBYB 5K9QI 4HKZB 2VCBA 3BEWA 1V7NL 3FB8A 5GRYA 2IMNA 4GAYB 3ALPA 2F58L 3ZL4H 2Q1EA 1I8LA 2YMXL 2Z8VC 3WELA 4TUJA 5EZLB 2ED7A 4WSJA 1XGTA 2IMMA 3UTTD 1GHRA 1IQWH 1M71B 2BSTA 1SM3L 3LZFL 1KPRA 4NO5B 4O9HL 5C9JA 3CPUA 3VXTB 4HMDA 4PRDB 1MIEH 3MLUH 2D0FA 2IH3A 4HUMB 4PMNA 2EDXA 3W39B 4G7VH 3RFZC 4WI6A 1Y18A 3E6FB 1BOYA 4P23D 2J25A 1BAFL 4N68A 3VFPB 5SX4H 3RIFF 4KFZC 2ICWB 2XWDA 3B9DA 3AJ7A 1XSIA 3ROOA 4P4RA 5F6IB 4XVSL 1J10A 5GGVY 4H1LH 2D7TH 1RZJL 3RNKA 2X4OB 4YK4C 3L4UA 4X6FA 4YAQB 4YDLB 1LK2A 1JGLL 4EDXA 1BEYL 4JFDD 4LKXA 3O3UN 4PY8I 4D9RE 3TEUA 2XXMB 5IG7A 5IB5B 2HYMA 3W11D 5F7DB 2A6IB 1I8LC 5EZOH 2XFXA 3BN9C 2XACC 1LJYA 5IHSA 1I1AA 1VBRA 1NUFA 3WFZA 1AO7B 4P5MA 3QUML 5F97E 2EYTB 5D1QA 1CTNA 3BLPX 1Y7VA 2J4GA 3TGXA 3IFNL 4NKIH 1DL7L 1QRNE 3MMUA 1HNYA 5K9JH 4FZEH 2FDBP 4MXQC 1RMFL 3CVIH 3UPCA 3MBXH 1WZ1L 2CRZA 4LCYA 4XP9L 2IPTL 4NZUL 3IXTB 1ZTXH 4JPWH 5J13C 4H8WH 4K2UL 3MR9A 4OUOA 3BH8A 5LXGL 4UIKH 1NC4D 1J8KA 3SCMD 1WZAA 2WANA 4QCFA 4AD2A 2BSSB 2GEEA 5HVHB 5F21B 1W72A 5CZKA 3T3PF 2YD3A 5E00B 1DQML 3Q2CA 4TVPE 3MRNA 3NACL 1QHZA 5IFJB 2AOSA 2JCCB 1JPTL 3AB0B 2D7TL 1JGDA 5I6SA 3TTYA 5C0RL 5IB1B 1R6VA 2WUBL 3KJ6L 4YBHA 2BNRE 3ESVF 1NARA 4ZNEA 1RJLA 1L0YA 3LPFA 3JSSA 2A2QT 2JB6B 4O5LH 4ZFZB 3PXHA 5IMLA 4ZO8A 5E8DL 3IFOA 3MUAA 3BGAA 1FFRA 4QHUA 5E6IC 4C83A 4L8SB 1MSPA 4XPHH 4XC3H 5TDOA 3WH5A 3SGDH 4JVWA 2J8UE 2D31B 4AD1A 1QFOA 2JJTC 3WLWD 1U8NB 2IALA 1LP9A 1VJZA 5F88A 3QRGH 5DHVH 3BISA 2DDQL 1A6TA 3E6HB 2QADD 3KR3H 1IAOA 5EUKB 1KFAH 5I1CH 2A6JA 3TJHD 1G9MC 3MUZ1 2IANE 2VH5H 3D6GA 3L9RA 5HGBA 3K7UA 1A4KB 3M7SA 4UNVA 1J05A 2FCBA 1P1ZA 4FXGA 2C3WA 4TVUA 3QIBC 2ZXDA 2W07A 2GTZA 5D7SH 2VDQH 3DX8B 4H1LG 1MIEL 1KIQA 1UZ8A 2EDEA 3FONA 1NEZA 3UROR 1WISA 3FO9A 1MLCA 2DQEH 2OWXA 5IDIA 5SV3A 3MYJB 2J79A 4LYQA 4Q22A 4LIQE 3TBTB 3FB6B 1FLRL 3NIDF 4EI5D 5IB5A 4HSQA 5A16A 2UY6A 3SUUA 3VTRA 2YC1B 5MP6L 3QRGL 2BOCA 4CJ1A 2SEBA 3NH7L 2NY5C 3L3IB 2HKFH 3QZWB 4LPXA 4AZ7A 1Z6JT 4IOFD 1P7HL 5DHYA 1B3XA 1GORA 4L8DB 1Q6EA 3KYKH 4BK5A 4ZFFB 2G5BA 5KJRH 4JZNA 1NCCH 5D8JH 3HCVB 3FFCA 1T2QL 4HC1L 1NJ9A 2X10A 3BWAA 4L3CA 5EUOA 3SE9L 5HGHB 1FYTD 4OCNC 1BSIA 1DLFH 4PPTA 1HKJA 4CUCA 1RPQA 1DANU 3MV8E 4KMLB 2BNUB 4K7PL 2I9TB 1A0QL 1EFXD 2CXGA 3H0TA 3FAXA 4G8IA 4AZ5A 1YDPA 1E0OB 3KWWB 3B2UC 2O26U 5GGQH 4QY8B 3VWJB 3UP1A 2XV6B 2ZUSA 4HKBB 4U1LB 5HHME 2HJFA 3AB0C 4DWHA 2BOBB 2NY5L 3MLWH 3SUSA 1U8MA 1HQ4B 4GLRI 4PJ9D 5JORB 1ZBVA 4KK6C 4ATWA 2WCGA 1BD2B 1A7BA 5IBLD 1NEZB 1AC6A 3CUPA 4Y4KD 1RULH 2DL2A 3OKMA 5GZNC 1UJ3B 3D2UD 5CWSA 2FR4A 3PWPD 1CU4L 4LCWE 4H8VA 5B39A 3RWJB 2ILLA 3ARGB 1FO0L 5C07B 4PGCB 4G43A 5EOCJ 3CZFB 4NP4H 5IUSA 1W1VA 2WV3A 1VDGA 5JHDB 1I1AC 1S7VA 3RX7A 2AXJA 4F80A 2Q87A 4BQBA 4YDVB 5LVEA 3RM8A 3W0KA 2OS7A 4P9HC 4R97C 1G7LB 4P99A 2W0PA 5ACMA 3VGEA 1BBDH 4S1DC 1UWUA 3STZA 4FQXC 3SUVA 4J4PC 4YR6A 4PJ5A 2R0LH 2WAGA 2B1HH 5I8EB 3RKDD 5D7IE 2J8HA 2D03L 5EIIA 2FEEI 2FGWH 5DUBA 4U1JA 3B83A 4M1GL 4X7DC 4I9WD 5JW5A 3ZDYE 3S88L 3BW9B 1SBBA 1S5HA 1VADA 3IFOB 3TA9A 5IWLC 4Q0XH 2PW2B 2QHRL 1MAJA 5CCKH 4PJ8C 1R3JA 3QUMA 1KXVA 2ZSVA 3CJJA 4O2EA 3X12A 2FB4L 4NCC1 3FMGH 4ELKB 1CPUA 4EDXB 4K3GA 3ULVL 4U3AA 4JY5L 1B3VA 3QO1A 1ISVA 3UO1L 5FDWB 1XR8B 1ZE3C 4GBXD 2C9AA 1UZ1A 2NT0A 3MCKA 1NANH 4P5KB 2ICWA 2R0KL 2UV3A 4KKAC 5DLML 4YGAB 3M07A 4NP4L 1B0GA 1Z9LA 3MCLH 3MXWH 1UEYA 4NHUA 5E2UH 2VISA 5ALBL 5E5MB 1MYRA 1OBAA 1A6AA 2CKRA 2C4FU 5D6DC 1EHLH 2XGIA 2HRPL 4Y5VB 1RULL 4PG2A 3WO4C 2LVEA 3BPOB 2X7LB 5DF0A 2VQ1B 2NR6D 3T0XA 3CFBA 4UIMA 2F74A 3LQZB 4YDKL 4W87A 1VIWA 1S7QB 2QL1A 5FUOL 4JFFD 5D70L 4PGBA 1UA3A 5IB3A 2M8XA 1N8ZB 4POUB 4GG6B 1JF1A 4R2GB 3O2WH 1VBUA 1RUML 3QOMA 1CLVA 4HS6A 1YEKH 4R7DA 2OWCA 4MD5A 4XB3A 1TVBA 1NGPH 3FHAA 4OLEA 4MQ7B 5E4EC 3KS0J 2V17H 4WGVB 1BGXH 3S97C 3LEVL 3LDBC 2DIAA 1T66D 3OG2A 2FJFB 3T77B 4MTVA 3I6GB 5KN5B 4GO8A 1XZ0B 1FGVL 5HDRA 2IPUK 4M43L 3VD3A 3OF6A 2AQ1A 3O2VH 3GMPA 1IGML 1N6VA 5C08A 1CXEA 2NY3B 5JIWA 3HMXA 3LIZH 1U8IB 2NTSP 2WHKA 3CU1A 4WTXA 2XIBA 5H35A 5FO9A 2VUOA 4K23H 4KMTH 3SO3C 5B8CB 4HIIA 5FGSA 1MFAH 2G9HB 5E6ID 5FIPA 1M01A 4JB9L 1KN2H 1K5NA 4ZUVA 5C08D 3OTTA 2BERA 3O8XA 1RZGA 4TUKL 1H0DB 4U1NA 5L6YH 3BPNB 2OQJB 3FCTB 1HZHH 2EO7A 2VLRA 5I73C 3GMLA 4Y5VA 4Y4FA 2IPUG 3QDGB 1EEYA 2XHYA 3G9VA 3QIUD 4QOKB 2ZX7A 2ESCA 4WI8A 3MLRH 3PGDB 2AEQH 1VFAB 3B9EA 1BOGB 2C1PA 4EUPA 3IJ7A 8CGTA 3RHWK 1LO4H 2FX8H 3CXDH 2Z8RA 4XP1H 4CVWA 1NBZB 4JKKA 2P45B 3EDFA 3KLSA 1DQQB 1GL4B 5F9JB 2VLLB 4ODUB 5DVLA 3H9ZA 4L4VB 3QQ9D 3VIHA 5T1MB 4U31A 4FZ8L 1X5JA 4U1MA 4X9HA 3ROLA 2QKIB 1VEOA 4PGZA 5J3HD 3BCFA 2OL3B 4ZTOH 3LAFA 5GS1B 1TQBC 3DRQB 4M82A 3TPUB 4OLZL 1IGMH 4LQFL 1KJ2A 2FSEA 4UQEA 2AJSH 3JWDC 1JYWA 5F7EH 5CG0A 4QOKE 3AU1A 4OLVH 3QXVA 3V0VB 1FOBA 1FV1B 1FE8H 1W0VA 4K9EL 3DETC 4LIQL 5GGTA 4HZ6A 3RPMA 3KS0H 2XWBB 1Q6CA 5A94A 2HFEA 2AI0H 1ADQH 2NXYC 4N8VB 2VQUA 2XZCH 3O81A 4NM4L 2WMKA 1L7TL 4WHTB 3MUY1 3S7GA 5K9KA 4L4VA 2P24A 1MUJB 3D85B 4KROB 4XMKL 3GMOA 3I9GH 5HPMB 2FRGP 4NKOB 4A2LA 5IW3A 3BN3B 1L8NA 1PEZA 1MCJA 3HAEG 3NIGE 3BZ4B 1A4JB 3TA3A 4LLYA 2HLAA 5C0AB 1R24B 4M5ZH 3TWCL 1LE9B 5LQBL 3ZKNC 1FYTA 1Z9OA 3O41A 2IAND 4OLYH 5CD3A 4MAYD 4GG6F 5BRZE 3EO9L 1ACYH 3BD4A 4X6CB 2PETA 1Z2KA 2J12B 2XTJD 3OXRB 1WC7B 3SCTA 1GSMA 3RNQA 2DQHH 2DKUA 2YN5A 3C08L 3HE7D 3O6FD 4HMEA 3VRLF 5C70A 4LDEB 4L1HA 4HKBA 1RP8A 1ZLSH 3SO3B 1UCBH 5B8CC 5EZIL 4LEXH 3IDJB 3TZVB 2DPEA 5BRZD 1K5NB 5JQHC 3ZE1E 3W9DA 4IRJD 5FF6A 4NRXB 4F7CA 5D6DA 4XX1E 2R2BA 1BPVA 1BQHB 4XCNA 3QDAA 1LO2H 2MQCA 3QR2A 2X89D 3UZQA 1HJXA 1GZPA 3V6BR 3HCVA 1MJ8H 5JPNB 1LL6A 4UTAL 5HYEA 1OGGA 2EC8A 1FNEA 5IVXE 3T8XA 3TV3H 4KK9D 1DBJL 2AQ3A 4M03A 2YBRB 1BD2D 3VI4E 5EWIL 4BFGA 1RZ7L 2AK1H 4B7IA 2GJ6B 3MA9L 3WNNA 2CDEA 5E8PA 1UKQA 3GRWH 3EYSH 3LS4L 5LKNA 2FL5A 4P2RD 3S35H 3GI8L 4LGRB 5AAMA 5A16B 4X80L 1R7OA 2E8YA 4GQ9L 1P6WA 1Q0YH 4QLKA 2XZQL 1E6OL 2Y8VA 4OLVL 2EDLA 3F5WB 3G04B 3WDHA 3DARA 2FJGA 1VAHA 1I4FB 1FYHB 5HBBA 4BF7A 5SWSB 2XPKA 3QDJD 3G5ZA 1QPXA 4HIXH 3TJEL 1KG0B 4TNVF 3T0WA 1LWRA 4S1SL 1FZKB 5AWNL 1SFSA 1UR8A 5ICXB 4FFZH 2DWEA 2IFFH 4NBZB 2DSUA 3LS5L 4BYHA 1H41A 3SKMB 4M93B 2IAMB 1FFOB 3UTPE 1OGBA 1VB9A 4FQ1L 4TNWF 1L9MA 5CEXB 2PYEB 2HTLC 1NC2B 3CFDA 1FCCA 5F8RC 5E7BA 3SY0A 1SEBB 2HJLB 2VXSH 4P5KA 1XGRB 1OAXL 2PO6A 1GC1L 2EE6A 1ZA3A 2BS9A 1V7MH 5FDWA 5IT2L 5IFTA 2MCG1 3LKRB 4Q74A 4R97B 3K0WA 4GW4A 2P1YA 4LRNH 1FN4A 2O5XL 2QSQA 3NZHH 3BP6A 2M2DA 4S1DD 1H4PA 1FJ1B 1JPST 1MF2L 2GYSA 2D4FA 1NCDL 5IVXF 4X4XB 3X11A 5BXTA 4IMKC 2XQYK 2VNCA 3T3ME 4XBEL 2YUWA 4YBQC 4YFDB 4MAVA 2NT1A 4CMMB 3ZHKA 4E0RB 3NIDE 4NRYA 5DT5A 3ARBD 3VOCA 4W7VA 1P5VA 4K07A 4XPFH 1RSFA 5L2KB 1B4JH 4G9DB 2W63A 4JFHE 4KI5E 1MCRA 3QFJE 3JWDH 3KPMA 2KL6A 3EYQD 4BSVB 1QR1B 3MMWA 1GC1C 4NBXB 4JFDE 4JQVA 3ZYZA 3PE9A 4R7NA 4OSUH 1IT9H 1VFMA 2CQVA 2ENYA 3MLVL 5GPRA 3HI5H 2YA1A 3FB5B 1HEZA 4B0MM 2JALA 5A8PA 2XN9B 5EU6A 5C6WH 3EMCA 1ODZA 1DEDA 4KJQD 2AS5M 5F7MC 5HYJE 1I3RB 3KLAA 4AYFA 4L4JA 4K3JH 1AHWA 2X1QA 5EBAA 4RRPG 3LKSB 2ZE0A 4HZLB 4LHJB 4UQ2B 4E41B 2X4QB 2YD8A 1UACL 4Q6YA 1BFOA 2PBGA 1NAMA 2YN3A 4OTXH 1ITCA 4YEEA 1NOUA 1A1NB 4BSWB 7FABL 5CWSB 4AEHL 3JTSB 1KLUB 2CPCA 3OKLB 3OB8A 3P4OB 5C2BH 2J8GA 4QT5B 4IRZL 3PDGA 5JLZB 4Q9QL 2OYLA 4U6YA 1CR9L 1VGEH 2VKXA 2KUTA 2Z92A 1AP2A 1CNVA 3CZGA 2H2SC 4NQXA 3PDDA 3Q6GL 4YHLH 3VRJB 1LK2B 4WNQB 4HH9A 3PABB 1IL1A 3HI1A 1MCPH 2R8SL 1RJYB 4WTZG 5FA4A 4FFZL 3EBVA 4H26B 3T3MF 3EMQA 1RZFL 2AV7B 1EFQA 1HCFX 5HDBE 3O9NA 3GNMH 3QRFM 3T8XB 3SDYH 2ID5A 5KVDH 3U0PA 1BX2A 4ZTOL 3CXDL 2X9XA 3BGMB 3D1MC 5DRNA 1N4XH 4AH2A 5DVOA 2VQTA 3MRCB 2QQNL 1WAAF 4TRPH 2XWJA 2H26B 4MNMA 3KG5A 4HTYA 1URLA 3ZDXF 1E6RA 4QRTA 5IJKA 5KSVA 4RL3A 3ZTNH 4TTUA 3GMQB 3II1A 1U3HC 4WCYH 4EBQL 3BSZH 4OUUA 3KPSE 2W62A 4LCWD 3E8UH 1D9KB 2QHRH 5KANI 3RWIA 2YEZA 2GJXB 3DI2B 2I07B 3ARSA 2PWHA 4JFOA 3NAAL 1LP9F 4LLAA 1KWKA 3VXUD 3HR5B 4X6EB 3TBYA 3QUYD 1BLIA 2H32B 4UOJA 5L0QB 1PKQA 3NZ8A 3U7WL 5D6CB 2UUDK 4MZ3A 2FIKA 4DN4L 1JF6A 3MMEA 1CDBA 5L88H 5A6SA 4L4VE 1UR2A 2E4TA 2HLAB 4YC2B 5C0AA 5DQ9B 3SCMC 3JTTA 1J05B 4ZNCD 1JFQL 4Y1AB 3TPKA 1ZT1B 4RZCA 3N85L 5SWZE 4JO3L 1IEBA 5L7XH 3SCRA 1XCQB 5CFHA 3AREA 1YN6B 3RU8L 5ILTH 1YEDB 2VERN 5KVFL 4WI3A 3GYCA 4MDIA 4NQDB 4P4KA 1A6WL 3OGCA 2BY2A 4HZ8A 1QI4A 1ACYL 4MYWB 5KS9B 1FA2A 2BVDA 2P8PB 43C9B 3GH4A 4YZFF 5DMKB 1WITA 3V6ZA 3DTXA 4OZHE 4LGSB 2DN7A 4JAMA 3CIVA 4JVUA 1PJ9A 2GY5A 3BDYH 1KJ2B 5LGKA 3H3BC 3RUGA 4GO9A 4QRRB 3VO0A 4TULH 1SYVB 5KSAB 5ERWA 3ALGA 3MV7E 3D25B 3IRPX 1HHHA 2EECA 2DB8A 2EZ0D 2Q86A 2H32A 2JE8A 4GJTB 1E4JA 4KMQA 1SY6L 4M7JH 4D9QD 2CGRH 3WUEA 4LVNB 1QACA 3IT8D 2OJEA 3CFEB 1B3WA 1Q6FA 4MJIA 4N0UE 1JGUL 4RX4A 1KC5H 5K59F 4U3XA 2XSAA 3MRQB 1NLBL 2DQHL 4EUPB 1X7QA 3B5HA 5IMKB 5DJDB 4V2XA 1XIWA 3M17B 4PRPD 2G5RA 1PGRB 4KWUA 2XVNA 4LSPH 3PV6A 4U6HA 4TQEL 4LP5A 3FQWA 1KB5A 3BLKA 4B7LA 4RFOL 2H26A 2D3VA 2C7FA 5FD0A 1DJSA 1EPFA 3RY6C 3A6CL 2W9DL 4HA1A 4LASH 3L5JA 4NO2A 4LOUD 1MF2H 5ICZA 3ECQA 1BZ7A 1NDGA 1OD7A 1N0XL 1MFBH 4XNQB 5GGUA 3TCLA 3NSNA 3FHQA 1GHSA 3Q5TA 1PBGA 1JK8B 1P7QB 2ADJB 3ZT7A 1JWUB 4GSDH 5GHWL 4DM1A 2G8ZA 2YOCA 3IDYC 4K8RC 4X7CC 3KPPA 5C8BB 4PJEA 4XNYL 3SDXA 2JIEA 3PXJA 1IVLA 4AZHA 4FG6C 1UQSB 2CIIA 3MLRL 5A40E 4AIZA 4U2ZA 5DO2C 2W38A 4UT9H 3RWHB 5FYLD 2IH1A 5D9MA 1PZ5B 3IJSB 3IJHB 4XPBL 4MNJA 3C60C 2CDGB 3A3HA 3D3AA 3MRIB 1FH9A 2ZOXA 1LK3H 4LBEA 1YEGL 3UBXB 1OT1A 4LNVA 1ZTXL 4JPWL 5DURD 5KZCB 2A3BA 3RJXA 5A2JH 4WHYG 2ICWJ 1FO0H 1W72H 5IEKB 1WPCA 3VIMA 4DN3H 1YY8B 1XGPA 4JFFA 2Y24A 5ADPL 5D2LB 1W32A 3PQYB 1MCEA 3B5GA 4K8RL 4OCRH 1DWFM 3ALWA 4YIQB 2VLME 1G7IA 2EDRA 5ALCH 4J3WA 2YPKA 4ZFOA 3F65A 1ERNA 2F74B 2X4SB 3QNYB 4NI3A 1BZ9A 3WFLA 5IBLC 2B5IC 2DQUH 1VSCA 2Z93A 5SX5H 1U8LA 4JY4B 2JIWA 5DC9B 4R6UA 5ABFA 1S7XA 5DZLA 1GVIA 4I8DA 5DFAA 5BZWB 3FY1A 2HH0L 4D6EA 3FQWB 3QEQA 1YEKL 5IHZB 1JPTH 1TFVA 1BQUA 1T1ZA 4P9HH 4H1LA 2XVKA 4G3YH 5D96C 3IKCB 4WFFD 4IOFC 4PJXF 4YX2H 2XXCB 3WNMA 1DEEB 1DQDH 3BP6B 3D69A 1CD1A 4M00A 1TIUA 3FN0H 4B15A 4HULB 1DLHA 4NQVA 4DKAA 5FIEA 3KDMB 3U4EA 3FOLA 3TVMC 2K1MA 4ZYKB 3X3FH 3O3DA 3L2LA 4XNUL 1DQTA 5IKCB 3VX1A 4KDVA 4JAMB 4U1GC 3GKWL 2KPNA 2XI9A 3FQXB 5LGJB 4EKXA 4FF5A 1OGTB 4JFZH 1C5CL 3KWXA 4OCYH 3CFKA 3RWDB 3KHQA 1KG0A 1JHLL 1G0DA 4LVOB 1KGWA 1FPTL 1DR9A 2D9QB 3IETA 1CLCA 3UTSB 3RVWC 3FRPA 3QUZA 1GXEA 3SCVA 1HJSA 4MA3B 5B4MC 1MJJA 2VRKA 1X5GA 1ZT4B 4O2CB 2NY3C 1JCKA 4OKDA 3LKNA 5CEYB 3VFOA 4GRWE 1FAIL 4X6CE 5DFVC 5FK9B 3VXRB 5J11C 4HJ0C 2GJ6A 3IJ8A 3T0VA 5C92A 2NX5E 4WFEE 1T4KB 5AWNH 3HE6D 4LOUC 4L8CB 4HJGA 4U5IA 1K6QH 5CZVL 4BKLB 4HIXL 1EGJL 3O8XC 1KJ2H 3DVGB 4HP5A 2EH8L 5CILL 1ZLWH 3R06B 3V4UL 2OZ4L 1AJ7L 4RNRB 2DS4A 2CO7B 1D9KA 5C0CD 2VDOH 3VWJA 1P84K 5FGRA 4OZFB 2A0LD 1TZGL 4GFTB 3KWWA 1E5JA 2ADGA 3GNRA 4FQQA 4LLMB 1A1MB 1KELH 4ZSOE 3EJYD 1O7SA 4OZFG 2EDDA 2X8RA 2N4IA 3L5IA 4O5LL 3OZ9L 2DQDL 1ZA6B 1DQMH 3MJ6A 2GTWB 2IG2H 2WUBH 3OXRA 4MX7A 4N0FB 1E4KC 1HKFA 4W88A 4PCTA 2DI8A 4NT6A 2R0LL 4UBDC 1F6AA 1IBGL 4U1HB 5LXGH 3AAZA 1DDHA 3LB6D 3CFJB 3RVXC 5EPMA 2SEBB 5TDPB 2BNQB 1RMFH 2J8UB 1EJOH 4H5SA 1G01A 4ZTPL 3PZIA 3G5YB 3MBED 3SOBH 4OZHB 4IRSC 1HSAB 2VWEE 4FQ2L 1AGDB 4CU6A 3EFFB 2X5PA 1GHFL 2BVUA 5CP7B 1FNGA 4QRRE 3NFSH 2BRQA 2BFVH 2YXMA 4KXZH 4JFPB 4TUOA 2FHCA 5I2IA 4XPTH 3AS2A 2Y9RT 4K71C 4W70A 2XFRA 3GIVA 4JFEB 4PR5B 4LGXA 2VB5A 3L1OL 2JB5L 3CLEH 4HKJB 3WD5H 4PRPB 4YE4H 3FT4A 3ZKMC 2YD5A 4IPLA 1A4KA 3ZYJA 1HH9B 1YNKL 1MCLA 4LMQI 3VD4A 2VR9A 2QLVB 1C8YA 2IPKA 3QDJA 4S3JA 4GLRH 4I0CC 2Z31A 4XMLH 1CGSL 3ZDZF 1XT5A 4DW2L 3WF4A 5FUOH 2PXYD 4ODSH 5CIPA 1AR2A 1C1EH 4I3GA 4YDKH 5D7SL 1KV3A 4G9DA 3V4VH 4RISL 1N5YL 3POHA 4C83B 2CIKB 3FB7A 1GAFL 4ZXBB 7CGTA 2O9PA 3C8DA 1HQRA 3KYNB 1T1ZB 3RX5A 4DAGH 5F7KC 4OZHF 4GQPH 4N0UB 1RV6X 3DXAD 4RFEA 1AFVH 2XA8L 2JF6A 1S7SA 3MRFB 1H09A 3WN6A 2YL8A 1F4XH 1I8IB 3FFCE 2EO1A 5ABFB 1CGWA 3V52L 4TUFA 4B9YA 3ARFB 2O9TA 1RZFH 3QIBB 2AJUH 3OLDA 35C8H 3FQTB 4LLVA 3WE6A 1AGFA 3SCWA 1G6RB 3L5XL 4QXGH 1J9CT 2A6DA 5FUCE 3OKNB 3Q3GB 5EU5B 3MACH 5BMFL 2VZUA 3BD5A 3LN9A 2F5AH 1MCNA 5BVJA 4EE9A 3D3VA 2BV9A 5DFVD 2MNUA 3C6LA 5D2LA 4R3SB 4AZBA 4F3FA 1G6RH 1PVHA 4D71A 1Z5LB 5I9QB 2F8XC 1QYGH 3CGTA 3I6LD 5T33H 3VXUE 4PJGE 3TO2A 4LSDA 3NPZB 3WQ8A 3ARBB 1F58L 1A7NH 1I3UA 3NPSB 3RILA 4RQQB 2Y5EA 1MCSA 1VA9A 5FYLL 5TJWK 1G9NH 2IC2A 3BKJL 3H42H 4ODSL 1NDMB 3CLEL 3MODL 4XNUH 1AR1D 1D7FA 4ZD3L 5L9DL 3X14B 4V1DB 2A6IA 4TOQA 5FB8A 1ZXQA 3W27A 4LVEA 3ZYOA 5IOPB 1UQYA 3CSGA 4CCEA 3GTNA 4FQCL 4OT1L 1UH2A 2XNAA 4QRQB 2F53B 3FO1B 4M9OA 2XN9E 5EBLA 5I17A 4UT7H 4K7PY 1BGGA 4NQSB 4FLOA 4RE4A 3UTSE 3BIKB 4WO4B 4GQQA 3LQZA 3ROOB 1R5VB 5C0AD 3MBXL 3GH7A 3E3QC 2VR5A 2ARJA 4AG4H 1YNLL 4RQQA 1QI0A 1CU4H 3OAZH 1JDDA 3IFNH 3ULUH 5D7IB 4NO2B 4HPGA 4OUEA 5FM8A 4I48B 4BA8A 4BH8A 2EQDA 2OK0L 5I1HH 2HP4A 5IXEA 4FQPA 1FNHA 4P3DB 4X7TB 1OIFA 2AEPL 1JWMA 4AIUA 3KXFA 3PJSA 4J3XA 5MENA 1QHOA 1T89C 1WBXA 1NCAL 5BVJB 1HVQA 1OAYH 4PV8A 2GUYA 5IGXL 1QRND 1S3KH 5E8EB 1FSKB 3QUXA 1EHNA 4V2CB 4PMDA 2VX6A 2VI0A 3UTTE 1IZJA 2XKNB 1EOMA 5IROC 3JWOC 4JREB 3W38A 1FO0B 1B9ZA 4W81A 2WBGA 2YL6A 4NO0B 3MLSL 1C91A 3WENA 1KGUA 3VM7A 4FFVC 1YA5A 5JPMA 3V95A 2VDRH 3BKMH 2WZIA 1KWGA 2BCKA 3GZKA 2X4UA 3HC0B 3UTPD 3L3GA 3CMOL 5D8ZA 4PTWA 3ME0A 2W1NA 1Q94A 4XVJL 3FL7A 3EOBB 4AZ6A 1MCCA 1KJMB 1MRDH 2VLRD 1G9HA 3ZJ8A 5IMOB 1MQ8A 4NPYA 1GGBH 4ZFMA 1MHEB 4I3RH 1NUNB 3HNTL 3LH2H 3QWQB 1WFNA 2LU3A 5JDJA 3O8XD 4LAQH 4W86A 1EGJH 1X44A 2BC4B 5JTWA 5BVPH 3QH3A 2FB4H 2NX5B 2XVPA 4G6AC 5J1AA 1TNMA 4UTBH 3L7FA 2EICA 3GUTB 1KIUA 2ZWYA 1BZQK 1XF1A 1Z3GL 4YHMH 4IIQC 1KOAA 3T4AB 2VX4A 1A3HA 4OZIF 4HFUL 1B0WA 1CTOA 3O2DH 1OW0A 5IVZA 5CP3H 5C0GB 3EYFB 4O4YH 4HGWA 4JRXE 4KVNH 1P9MC 1UG6A 1KTKE 1SM3H 2K7PA 1L4IA 2FIRT 4C56B 3WEXB 2VC2L 3KPSD 5IB2B 3PWNA 3PHSA 4YH6A 5EPMB 1J0HA 1AMYA 2XRAL 1G7JA 3OKOB 4YHNB 5KTEL 3BJLA 3K46A 4C57C 5DT7A 3SO5A 3KXFB 3C60A 3OR7B 4EVNA 3HJEA 1MY7A 4TVPL 1DQDL 1BREA 3SKJL 4JKMA 4IS6A 5DRXA 1AQHA 4XGZB 2NY1B 2VDRL 1XSKA 3QDMB 5C71A 3QO0A 4NOBA 3CDFA 4K94L 1BX2B 4XVTL 4RISH 1AKJA 3C8KA 3LQAL 4RBPH 1YUHA 2G5BB 4CGTA 2CDFB 3ILQC 4KKLC 6TAAA 1T20B 4YX2L 2HTKD 1IL1B 3HI1B 3C5ZC 5I18L 5I1DA 4AZ8A 1DBKL 2DMKA 1MQPA 4XMLL 4OFYD 3QFDA 2WUCL 4Y0GA 5CD5C 1UXWB 4YHKL 5IT2H 5FB8B 4JFZL 3U7YH 1MWAB 2LAAA 1CFVL 2E9JA 5ALCL 3Q6FB 1J1PH 4FHBD 4B41A 5C0EB 3DX8A 5FV2A 5KG9A 3L95A 1IQDA 3U36B 5KZ6A 5F7EL 3X13A 4NC1E 1MAML 2DEPA 3EYPA 5GGRY 5BS0D 4JL1A 4PLOB 1MFDH 3O9WB 1T0NB 3SCNA 1V0NA 3BGFC 4KJPD 3HZMB 4XPAL 1Z5LA 4X0KA 4IDLA 4MMZC 2I5YL 3VFUB 5HHOB 5J89A 4ODWA 5JDSB 1ZJAA 2W0FB 3WQ5A 1XYFA 1LL7A 3W25A 4NO3B 5L8JB 1NQBA 1XF5A 5A2CA 2Y7QB 3UDWA 5DWUH 4Z7UA 1NLDH 1HEZB 2VR4A 3G6AB 5TF1L 3ULUE 1NFIA 4ZD3H 2APXA 2B0SL 3REVB 2AGJH 5IHUL 5B21A 4JG1L 5JR1L 3AXHA 2FEEL 5EOQL 1QLEH 5DYOA 3V6FA 4AIEA 4P9MH 5C0DA 3T0ED 2DI9A 1NMBL 3MJ7A 4MXQD 3WIFB 5E5RB 2EYSB 4UQ3A 3ES6B 3PWPA 4GKLA 1ZANH 1IGIH 3W6LA 1BQLH 2CO6B 1D5BA 3D3VE 1MHCB 1U92A 5IV2B 1UR9A 1EA9C 1DVFA 5CZXD 3KL3A 3SJVD 5HYJD 1QRKA 4JM4H 4LU5H 4P46A 4ISVA 4JANA 4LCWB 4LSUH 2HJKA 2FJHA 4M6OL 3VXUA 4TQEH 1DP0A 3V9FA 5HI3D 4GUPB 1T0MA 1X5KA 1NFDF 3QPQC 2I5YH 4Y4KB 1MHPH 4XPHL 3MRPA 2PYEA 3BW9A 1A7QH 2ERJC 3D18A 3CXHK 4XX1G 4YC2C 4CADA 3H8NA 2IAMA 1CR9H 4WUUA 1CZ1A 1Q4NX 2G75A 3IDMB 1WZKA 1CG9A 3SDAC 1XIWD 4PRPA 1BGAA 3DVFA 2D1ZA 4NQEB 2DSVA 4P23A 3GNOA 2YLLA 4UV7H 5D1QC 4R96B 3OKKA 1M7DA 3DJ9A 1MRCL 4HUNB 2CLVB 1KGXA 3VFVA 1IGYB 3MV9A 3O3BA 3QDMD 4OCSL 3ULUF 2CPUA 1PG7L 3ZO9A 3WS3A 3PQYA 4ODWB 2BVQB 5JDSA 5TD4A 4YHPA 5BCAA 4M24A 1PFCA 1UT9A 3V0AC 1EVTC 1WDSA 4ONFH 4Z2KA 5BROA 3VXQB 4YZFE 3TLRA 2V2WB 3LQAH 4OB5L 3NCYP 4PGCA 5E8PB 3FZUD 4W7WA 4Q6IA 1QVOA 3D0LB 1RIVH 3BESR 3MRHB 4FZEL 2D20A 5E9AA 1AQDB 4LCUA 4PJGF 5E2UL 4MDJA 5DEGA 3RTQA 2ED8A 4AY1A 5I74C 3NTCH 3T08A 1S7RA 4WDIA 4WTZA 4XCNB 4U4BA 5AG8A 5C86A 3QT2A 1ACZA 2OR9H 1OD0A 5T3ZL 2DQTH 4NRXA 2PCPB 3F5KA 4APQB 4JRXB 3RCNA 4YHIA 3PGFL 5F7NC 4K3DL 4G9FB 4Z7WF 1DQJB 3OX8B 9CGTA 2RHEA 4TUJB 1QRNB 4XP1L 1HOCB 2A77H 5HOSA 5C3LD 2ZXAA 4UNTA 3QEHB 3E8UL 2W4XA 1EO5A 1PSKH 2WNGA 3NGBC 2X1WL 4PJIA 3RBSA 1CLYH 4HKZA 2Y25A 2YIHA 3KPRD 5L8KB 4Y2DD 5JW3H 1QSVA 3QHOA 1J11A 3CUJA 5DHYB 1ZL1A 4WI4A 2X1OA 1I1XA 2V2TA 1LQ0A 1GQKA 1QLEL 3BGFB 3VXQA 5E8NB 3L6FA 1WCGA 5DJ0A 3TC9A 3WD4A 3PIQB 2ICCA 3OMZA 1N3NA 2R23A 3H9SE 4TTDD 2O93L 3RU8H 1CL7H 1WCBA 2QQKL 3T0EE 4ZQKB 5IK3A 5FO8A 1V02A 2EDFA 2RGSA 2VDKH 1F42A 4E42A 2D49A 1U8HB 2ZCHH 4KHTH 4PJ5D 1GCFA 4I9WE 4FMKA 3U0TA 1INEH 2EEXA 4G42B 4M8QA 5DS8B 3CTTA 4XAKE 5GSVB 1S9KC 2NX5D 1LNUB 2CNCA 4JGMA 2EE9A 3RZCA 2F54A 1OM0A 4B53A 4OF6A 2J8OA 1HDMB 5BW7C 2COQA 4GINA 3AIBA 1TJIL 3VKKA 4DEPC 4ZS6C 2QKIA 1EMTL 3OGCB 2VXTH 3NABH 5J12C 3TBWA 1LWJA 3ARWA 1G7QA 3L3DB 5CJ8A 3ESUF 2NNAA 3TVMB 3P4NB 2PB1A 4MB3A 3H9YA 4ISVB 4ZUUA 3DECA 1E4NA 2HFFA 1JGIA 5DT1L 2EDHA 4WUKL 1DANT 4Y5YA 3H9HB 2OR9L 1LO2L 3MMEB 4QCEA 1FAKT 3PL6A 3VA6A 3CH1A 3ES6A 4HU0A 4OZ4A 3PGFH 5J06A 4P2RE 3MLXH 1IZKA 1M05B 2TAAA 5DJYB 3UX9B 4MA1B 2XWEA 3GHBL 3HLAB 2IADB 3WH7A 4KKBC 5I6XC 1VJSA 4PSRA 1A6UL 5FOJA 3LSOA 3UTQA 1G7PB 3G5VB 4CNIB 1CD8A 1M1SA 3ARZA 4D3CL 4YWGL 2Y7QA 3RL2B 4JY5H 5ISZB 1FLRH 2DIBA 1T5WB 2DYPD 3MV11 25C8H 2YK1H 1W3LA 3MSGA 3VW3H 2CUHA 4EOWL 5ICYA 4AQOA 1A3LH 3MZGB 4OZGB 5HD8C 1ZBWA 4HKXB 4I48A 3NCJH 3CVHL 1PLGH 4U7SA 4LCYB 2XWTB 5DT1H 5BO1L 2MSPA 1S46A 2EH7L 4CVXA 2HVMA 1JWSA 5EC2B 3WDJA 4FMVA 4HXAH 1B90A 4OGYH 1MW0A 1DUYB 4NZDA 3E1F1 3T65A 4AL8H 5GGSY 4QXTB 5LAXB 4JO1H 2VE6A 3AMDA 4S1SH 4F2MA 3TYFA 1AIWA 3QWRD 5IJKC 2X1XR 4NRZA 3UEZA 4NYLB 1AXIB 3U2SA 4AMCA 4F8XA 1RAMA 4NQCD 5MEPB 3U2SB 5F3HA 1W0YT 1SVZA 5C0JA 3OJDB 3VU2A 4E8CA 3NDZA 3P0GB 1GGIL 2X4OA 5IQ9A 1OP5H 5I71B 1HSBB 1WBYA 3DUUB 3DETD 4UUJB 1JK8A 4KQ4L 1P4IH 3RPIA 2OTWB 3HN3A 1CGTA 2XG4A 2VKWA 4CVXB 1W9DM 2EPOA 4LGPB 4LCIH 2WLZA 1VF8A 4DWSC 1ZVSA 5HSFA 5FHAL 3WFDH 3RVWD 4XVUD 2A6KB 3GO1L 5F70A 1V6XA 3VMPA 4DGVL 2ZX5A 3MREB 2AVGA 1JNNH 4PJXE 3RL2A 2CK2A 2R15A 2P5EB 3VJ6B 3MGOA 4OI8A 2APFA 3WXVL 3MA9H 3MRQA 3G6LA 3FO0H 1R5IA 1YPZE 4N42A 1CN4A 3EJZC 3DX7B 4QP0A 1YMMD 4FQ1H 3VCLB 1UA6L 2A9NL 5ACZB 5I1GL 2MJWA 4OJFL 4MB4A 3MRMA 4I18C 2W92A 5HHMB 3EYFA 2YKLL 3ZDXE 1CWYA 4LFHD 5GNYA 4OQTH 3I2CL 3DX9A 1HWHB 1KCSL 3EYOA 5I24A 3PL6B 3DHUA 4J8RA 2VLKB 3KL5A 4MCZA 2QHLA 3PWJB 4LNRA 5DUBB 1QFHA 3VXMD 3ZKQD 3IJYB 3K81A 4AM0A 2GCYB 5JXAH 3QEUA 4NNXB 3QUKB 3QEQD 4WEUD 1P4BH 1T83C 4GAJH 4WEBL 4DAGL 3QNZB 5LWYH 1RQ5A 1LEGB 4F9LC 3RVUD 3ZMRA 1G7QB 4NQED 3I84A 1FBIH 1U93B 4GW5A 4KZEL 1FRGL 1X5FA 3V5HA 2C8NA 4HX1A 1IC7H 2UYLB 4JO1L 1VFOA 4W6YB 3CFDB 4M7JL 3BXNA 1YPZB 4YHZL 4HIHA 1FNFA 2JF1A 2J8FA 1FFOA 4BZYA 5DO8A 4MLIA 2F54B 4XHJD 4KRNA 4MADA 3H42L 1M6OB 3OV6A 1CQKA 3D0VB 1W1TA 5DMGD 1QPPA 4HV8A 5FYJH 2ZUXA 2WHJA 2XFYA 2H6PB 3BUTA 5H8DA 1U42A 5FOOA 4PRHE 5I1EL 1MHHA 1IM9D 1QLFA 3GSQB 3CUPB 3KPOA 3IS1X 3QA3A 4I18A 4LSQH 1HI6A 1B6UA 3MRBB 3F5WA 4PGEB 3HR5A 2XPGA 4F9DA 2QLYA 3MXWL 4LSTH 3HRZB 3BP5B 4RMTA 3GHEH 1QI3A 2XKNA 1H8NA 1IAII 3GSVB 2FGLA 3AMGA 1P7QD 4V27A 1FORH 2DF3A 4IISA 2V5SA 5IMMB 3QXAB 4RE2A 4GAJL 4WEBH 1YMME 1PQZA 1TQCB 3Q1SH 4FXLA 4GG8B 4K7FB 4M6NL 3KLHC 4PV8B 5ABDE 3QDME 2CCRA 4ENED 3PZVA 3D9AH 5I8CA 2CITA 3S36L 1KT2A 2ARJQ 4JM4L 2E3VA 4DKFL 4DGYL 5D7LB 5EORH 5JBEA 2CRMA 4DUXA 1NJ9B 1YEHH 3BWAB 5SWSD 4RGOH 3SGDI 1R3HA 3BP7B 1BLNB 3VIJA 5CEZD 2P5WB 5GGRB 4JZNB 4Y4HC 3BKML 5KVEL 4AJ0A 3CX5K 1SJHB 2ADIB 2NW2A 5ABHA 2Y23A 3HMWH 1C08B 4QRQA 2PCPA 2F9BT 3QXAA 1IEAB 1YJDL 2BOCB 3U30B 3RAJH 2NLJB 4WCYL 5FUCC 3P11H 1LILA 4NSKA 5D5MA 4EKJA 5L6YL 3BAEH 4HIEB 4LAQL 2VDLH 5C8JB 3QA3B 3HTLX 2CSPA 1MHHB 3WHXA 2B1AH 2GY7B 3B3IB 3GBNL 3O6MH 4K2UH 5CJXA 3SDYL 3WIHA 2YL9A 4KPHH 4JRYE 4D9QE 1J86A 1TFHA 5AY7A 5JIKA 3QNXA 1BIHA 1MJJB 2EDTA 3CPLA 3VD9A 1NFDE 4M3JA 1U91B 4AEIH 2BJMH 4TX8A 2AJVH 2YDSA 2B4CC 2AK4B 4KGJA 3O6KL 2CLVA 5DJXA 1C92A 1P7KA 2CIPA 3PTKA 4R7NB 3TO4A 5CGTA 1A47A 3GSWB 3SDCA 1K85A 4M1RA 4F79A 1ZLUK 4MNHA 5MI0B 2EIZB 1U8NA 5HDQH 1FV1A 1W0VB 4P23B 1UA7A 4QTHB 3TNNA 2LU4A 4GBXC 4Y7EA 1FZJB 4Z7QF 1H3XA 3BPCB 4X4ME 1TQBB 5F9OL 4RFEB 4M81A 3WFHB 1QNZL 5I77A 4Z6AT 1OCQA 4RX4D 3WN5C 4M62H 1I1AD 1Z32X 5DZNA 1KEGL 4S1QH 2Q8AL 2ZZUT 2AABL 5ACZA 2B4CL 3G6JA 3GZAA 4PTTA 4C4KT 1TCRA 4XXDA 4JZJC 4PYHA 5DC0A 2BJML 5F7YC 2VDOL 3IKCA 4DFIA 1IKFH 4FQCH 4E5XB 5DD6B 4L3EB 2OSLB 4HS3A 4QO1A 3ECBA 4JO4H 5DJ2A 3THCA 3MUIA 4ORGA 5H94A 1MFVA 3PHOB 4NN5B 5L9DH 3WQVA 2FHBA 4YJZL 4UT7L 3IAGC 3SIMA 1F3DJ 4DM2A 4J7RA 4OB5H 3MV8B 5DYOB 3VWKB 4X7FC 4GBXA 3VFNB 5E95B 5FYLH 4CCCA 4Y16B 4P7NA 4F7MA 4Z2JA 3G5ZB 4BFIA 1OB1A 2VITA 3HR6A 2YPKB 4GH7B 3MODH 2D7QA 1XCWA 1IGJB 5IJVB 1N26A 4FQIL 3IRZA 2BNJA 4H7VA 4KRLB 2WMPA 1KNOA 4U7MA 5A3HA 4UNUA 4XCCH 3B2UD 4PP2B 4XWGH 5TDPA 1GOWA 3CFJA 3MUGB 4ACZB 2UY3A 3CU7A 1T7XA 4Y88A 3F8UB 1DUYA 2PF6A 4QRSA 2WIMA 4TSCL 4LYRA 4MJ6A 2ORBL 2JKXA 3ZKXB 1UADC 2A38A 3BD3A 2DDXA 4RFOH 5IIEB 1R3IH 3SBWA 4P49A 1CI5A 2P44B 4CN1A 1UZ4A 4HOXA 3IYLW 2APWA 3W0WA 4PBVC 1OPGL 1B30A 2HTKC 4QHKI 2Y72A 4I4WB 4FTVB 4GG6A 3P2TA 3AGVA 5LJYH 5C0ND 3ZT6A 4WENB 3VXTA 2YPLD 1E56A 1W91A