4HMEA

Crystal structure of cold-adapted chitinase from moritella marina with a reaction product - nag2
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Chitinase 60
publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmeA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmeA01
4L4JA 3V7AE 5FGBA 1VIWA 4BA8A 1GORA 3WLBA 3QRFM 5ETUB 4JDTH 4K8RL 1AHWA 2V3GA 3O6KL 3CCHA 2DYPD 4OCMC 2ZJSL 4RZCB 4G9FA 2E9JA 4UV4L 4P99A 4V1DD 1GXEA 4ZEPA 3CX5J 2DSUA 3F7RA 4H88L 4D72A 5JR1H 5A16B 1MREL 3RA7H 3ULVH 4LSTH 3DGCR 3RBSA 5AWNL 4XZUB 1G1YA 4X6DE 4N8VB 4WO4D 1PLGL 1T5WA 1ZANH 2BCKA 3QXWA 1MJJA 1YEDB 5L88H 3O2LA 1H0IA 3QDHA 3AREB 5DJZB 4ODTL 4ODXA 4AEFA 3TBSB 2ZX9A 3BYYA 5AYUL 1J1OL 3MJ9L 3RVXD 4C7DA 5FGSA 1EAJA 5E7BA 1A0QL 3SPVB 1CIUA 1IKNA 2E9LA 5I16A 4ODBD 5FDYA 4IRZH 5I18L 4J12A 4G9DB 4WUUE 4HHAB 1SYSB 1T83A 3C6LD 4FQXA 3OKEB 3D18B 3T77A 3NPZB 1S7VB 5D6CB 3RWEB 3EYSL 5CSUA 3F58L 2YD4A 2HFFA 4XP5H 4ALAL 5EUOA 3KXFA 3LMYA 2IFFL 5IMLB 1HN1A 2GYSA 3NGBB 5F7UA 1OARL 2R0WH 3K1KC 4P9ML 5J06A 3VX0A 4JO3H 4C83A 4DGVH 1QBAA 1ODUA 1TJGL 4HV8B 1K9TA 1LQSR 3V0WL 2C1PA 2YC1A 3QFJA 5AYBA 2XZAH 2X1IA 4YK4B 4XXDA 4X6CE 1FVEB 5T3ZD 3FTGA 5ACZA 2AP2A 1PKQE 2VYRE 1HXJA 2NY0C 1RZFH 1A2YB 4JM4H 1B3YA 2NW3B 5D6DC 1FVCB 5D7KD 1JGUH 1P6FA 4PJ8C 5GGSY 1CE1H 3QJFA 2JLLA 2BNRB 4XC1H 5DUMH 3I6LE 5JW4R 3F5JA 5B39G 4H0HB 1HHGB 4P2OA 4E2OA 3KDMB 4OLYL 1E28A 4YPGB 5ICYB 4AZ6A 1NAKH 5EC1A 2XFYA 1OAXL 1T7WA 2VR9A 3B9KC 3DUUB 3OG2A 2MKWA 2IAMA 4H8WH 2NCMA 5D4QA 3MNVA 4FG6D 2D23A 3UCQA 5MEND 1P5VA 2QQKH 3L3KA 4QTHA 4Z8FH 1A5FH 2CO7B 3QZWA 3L3OB 4BH7A 1J8HB 1K9FA 4NO5A 1FFQA 4W88A 3LS4L 4UV7H 5D1XA 1UZ4A 3O3UN 4U6XB 2LFGA 2PWGA 1E4JA 1M7IB 2V2TA 4BZ1L 3T4AA 4KKAD 4JFFB 1KJMB 1UWSA 3QFDB 4CD6A 3SO3B 2W59A 4LKXB 3FN9A 5HDOA 4FA8A 3BGAA 1KWGA 1WQVT 5GHWH 1T80A 4IMKA 2C9AA 5DFWH 3MMEA 5F1IA 3AIUA 4HKBB 2JTDA 4H1LH 2AI0H 3ABZA 2X5PA 3H9SE 4JB9H 4P2RB 3T3PF 2NW2B 4FLSA 5DLML 4PYSA 3LKRB 2EE6A 3WMCA 4PTTA 3OGVA 4IS6B 2V7NB 1C5BH 1RVFL 4L4TD 3MBEC 4IRJA 4LQ1A 5GRWA 4HKXA 5JUEH 4P3WA 2WZEA 2D24A 2Z31C 3RKPA 5C07E 2ZUVA 3RIFK 5LWYH 4B53A 3MLRL 5E24E 2FJHA 3LVEA 1MFAL 3V0VA 1NBVL 5F1NA 3G6JB 3T0EB 3EYQC 3QDJE 4JQXA 4XCCH 3F8UB 3HPJB 3V9FA 4JJ5A 2VLJD 1JL8A 5C6TH 3NYDA 5F72S 2PYEA 2CDFB 2BVPB 4KRPD 4MNQA 3T65B 3V8OA 5IMKB 4X9GA 1VA9A 1NL0H 5J4MA 3P77B 5I8KH 1AGFA 1FNHA 1NEZG 3DV6A 4MD4A 4X8XA 2OJZL 1OVZA 2V5SA 3GB7B 1YEJL 1GW1A 2RB8A 4PJFF 1A4JA 2OQJB 4HKZA 3OZOA 1S7QA 5ISZA 3FAWA 1QSFA 4WF7A 3BKCL 3O45B 3HZYA 4MYWB 4MJ5B 2VAJA 1N0LA 3P9LA 4OSUH 4LSRH 3CDGA 3L3GA 3KYNA 3K4ZA 3NFSH 4KTYA 3U4BL 3MODL 1RJYA 2D3NA 1BQLL 4MD0B 5JNYB 3BO8B 2WC3A 3HNVL 4Y2OA 2BNUA 5DRNB 4D6HA 5JMOC 1ZT7A 1CR9L 4DN4H 3WD2A 4U3XA 1GC1H 4TXEA 4FOMA 4UFKA 4NQTA 4MJIA 2GCYB 3C9NB 1V3LA 3ULUE 3B6SB 1YA5A 4IOIA 1INEH 3PL6A 4EQ3A 1CGUA 1Q6DA 5IESH 2D31B 3TT3H 3AMCA 5AY7A 3QHFH 1JPSL 3H3PL 4WNQB 3IF1A 1RHHB 3QXDA 4AC1X 4QNPF 4UR9A 2ZUQB 4KUZL 5E00A 2P24B 3GMRA 4N8CH 4O4YL 1MCNA 1A6AA 2AAVA 3WQ4A 3ZTNL 1IJ9A 4O2CB 4EUPB 1EV2E 4EDWL 3QRGL 4G7YH 4ZFZB 4PBXA 2GSIA 2OLDA 3OMZA 4NQEA 4CUCA 5GGTL 4RMQA 4CKVX 2D4FA 1FFPB 4HWZA 2MHAA 3SDYH 1E15A 3S6CA 1E4KA 1AY1H 1MVUA 4JN2A 2C3GA 2YD1A 1ZBWA 5HHNA 4XRCB 1G01A 4PJFA 4EI5B 5L7XH 2FGLA 6FABL 4QLRA 4AISA 3OR7B 4WJ5A 5BZDB 3J8F7 1LL6A 4ONFL 5SWZE 1MF2L 2X70A 4YHMH 2J62A 2GY7B 2P46B 2FIRT 3BGFC 2QSCL 4R2GB 2YRLA 1SHMA 1S5HB 3R8BB 1MCSA 1Y18A 2Y06L 1R5IB 2HLFC 3KR3L 4QCIA 3WUEA 5BRZA 5F88B 1R0AH 4URIA 1OP3H 4L1HA 4DQOL 1WCQA 1P4IH 3N18A 5FD0A 4BH8B 4NPYA 5DQ9B 3QDMA 1FHLA 3ZE0F 3TJEL 1JPTL 3QR2A 3QPXL 2NY5C 4U5KA 5E6IB 4NRZA 4XVTL 3WEXA 3SE8L 5L0QC 1UM5H 1GQIA 3EJJX 2P5WB 4PP2A 3CFCH 3TYFB 2D1ZA 5A8MA 5MEQB 2W60A 2OSXA 4M6OL 5HI3D 2FECL 3KPSA 1S7WB 1F4XL 1TTGA 4HAFA 5J1AA 1ACYL 5D7IE 5JPMA 4X7FC 3DVFA 3W39B 4FMKA 4M43H 3WN5B 2J4WL 25C8L 4CMMB 1B2YA 5BVPH 1Y6NR 2OCFD 1PDKA 1RIHH 4WO4A 1MCWM 3PDOA 2R2EB 4GQPH 1ZLWH 5C7XL 5I1AB 4WUKH 5JW4Q 1JYNA 1GYAA 5I1KL 1SYTA 3C09B 1ND0A 4BQ3A 3C8KA 3VMNA 1JIBA 3GMNB 1A14H 3RU8H 3QEQD 3U0WH 2CSPA 3HS0B 1A7QH 1SR0A 2OJEB 4WV1A 1IGIL 5JLZB 2NY6B 2NTSP 1U8KA 3OHXA 4RGNC 1I8KA 1I4FB 3CNKA 4Q97A 4FLRA 4PJXF 2WMHA 3TBYA 1RURL 2QKIA 1TJHH 4X6BB 3EYOA 4KV5F 5DJXB 3NACL 3L3DA 3UJTL 3TVMB 1OTUD 4N0RA 4KVNH 4PJ9D 4YBQC 3MV8E 5GZND 3FQRA 4G43A 3GDBA 4H20L 2YL6A 1KNOA 2EYRA 3QUYC 1DDHB 1PD6A 4J23A 1TVPA 4OCYL 5ERWB 3WH7A 4AD3A 3WL1A 3QP3A 4HIXL 4OTXH 4CVZB 1CLYL 5D9PA 2YBUA 3GKZA 1Q9KA 2I27N 3KS0H 1Q9LB 3F4VA 2DMKA 4PRDB 1A64A 1KXVC 1UWGL 3TM6A 2C7FA 1V7MH 2PTUA 1CF8H 5C0CE 3A4AA 2GVYA 1HJSA 3RM4A 2A77L 1RIUH 1RUKL 3I75A 3KE0A 2EPMX 5FF6B 5JORA 2ICWA 4M1CC 3S88L 4X6DB 4F7PB 4HH8A 3QZWG 4NO0D 2UY7A 1EIBA 2R56L 3OAZH 2NZIA 3S3PA 5HDRA 5BRQA 1A6PA 3QNZB 5DJ2B 1CZ1A 3FOLB 4ZUTA 3BPLC 5IFHL 1NCWL 5A94A 4UQ3B 3L5JA 5MENA 1ZGLB 4EE9A 3ZKMC 1KENH 3NDYA 3IJ8A 2M8XA 3TZVD 3T8XA 4CD8A 2CDGB 2DLTA 2WMKA 4ZXBD 4X9YA 2M26A 1W0WB 1WT5C 2O61A 1KIQA 4QRTB 4PJXA 4WUUB 1M01A 3LV3A 2D22A 1OQXA 3ZE2E 5LA0A 4QEGA 2QR0A 4YDJB 3RJQB 4UFMA 4P8XA 3BAEH 5D2NA 4F2MA 2R8SL 1E5NA 3AHZA 4JL1A 1T0NA 4S1SL 2VKWA 4EI6B 5E08L 2AV1B 1U93B 1YJDL 1GPOH 2HH0H 3DYMA 2AXHA 1BYDA 3RVTC 1WVZA 1SY6L 4HCRL 4NDMA 3MRQB 3K4DA 2J8UE 4X6CB 1JNJA 4WEBL 3PHQA 3NFPA 3EOTL 3EKCA 1SFSA 1PEZA 5BOPA 5DC4B 3BQUD 3MRGB 2BDNH 3HZVB 4P46A 1LD9A 5ABFB 4XNQA 5T3ZH 4JM2C 2FECI 4L4TA 4QXTA 4LXFA 3WFHB 3P30H 4QF1A 5GGRB 1JN6B 1MI5D 3LKPB 2J7LA 1PG7H 4PFEA 4GI8A 2FWOB 5JXED 5EOQH 3VDCA 2MPAL 3EMQA 3QB7C 3WFBH 3X3GH 2DI9A 5F93C 5CJ5A 3LHPH 1R3KA 3AM8A 4B9ZA 3CLWA 4MJ6B 3FB5A 1EAPA 4XNXL 5E1AA 1NAMA 4NYLB 3QPQC 4NZJA 1D9KD 3V6FA 1DEDA 1XCXA 3MBXH 3MLZH 5CD5C 2HAZA 4M8QA 5C08E 2CKRA 3VD3A 2W0FA 3VFPB 3LKSB 5CSZB 2RIKA 2YK1H 3L5XL 5EO0A 3LPPA 3L5WA 3OQ3B 2PW1B 5EBLB 4FLOA 3VJ6A 5IFJA 3SQBA 3RNQA 5I77A 4MDIB 3A4WA 4Z7WE 5TH2A 1QD0A 2GK2A 1G7JB 3WDHA 1RZIA 5JO5B 4K9EL 4QYOA 2NY2C 4O2EB 3VM7A 3IKCB 4MGXA 3H9SB 3D2UA 1I7UB 3B4NA 1NH6A 5I30L 4X5XB 1AMYA 1FFNB 2CLZB 4K94H 2AXGA 4ZAKC 2X89A 3JWDC 4PRPE 1JNDA 3W25A 2DQGL 4ZPTA 3MUIA 5FHBL 1CT8A 3SKJL 1E1FA 1NLDL 4Q9CA 1NMBL 4JFZL 4R27A 3U79A 4YEFA 5LA1A 1JMZA 3UTQB 1HINL 3WS6A 2VAAB 5C07B 1MRFH 2BRRH 5E8OA 3S36H 1T2XA 1KPRA 2MQ3A 1IQDA 3GNMH 4WFGD 4S1DC 3CZLA 4QRQB 1CDUA 4U6YB 1FYTE 4DWSD 1FIGL 2XN9A 3TO4C 3D3VA 3QDJB 5J13C 3KL5A 1NDMB 1UOKA 4EN3A 1KT2B 4IRSD 5FYJE 3HMWH 1W91A 1WF5A 5DVOA 1ODAA 3MMWA 4OD3L 4OLVL 1E9LA 4WW2F 5ABHA 1LE5A 1E6RA 1NAMH 4KJQD 4HT1H 1AKJD 2WMIA 2E9WA 1MIMH 3SGEH 4FZ8L 1LK3H 2V9QA 4M8VA 1VB9A 3RDTD 3AZRA 3NCJL 1ZHNA 3KYAA 4JRXE 1Q6FA 5M3WA 1EFQA 2WCSA 1H8OA 5I8OH 5F1KC 3O9NA 3AZTA 4J4PD 2PWEA 4JQVC 4U1JB 4R0LC 1CGWA 1KACB 5KVMC 1TG7A 1HHIB 3I3EA 5IIEB 3QIWB 2EBNA 2BNQB 1JGEB 1U8HA 5F96H 3SGKA 2JF1A 4IM8A 3JUZA 3DROB 1OCQA 4U3AA 1I8LA 1P4LA 4GG8B 4I13B 5EO9A 2P5EA 1FV1B 4N0UB 3VWJD 2NY3C 2AK1L 1Z5LA 2YDSA 4XWOD 5E2JA 1TPXB 4KMTH 4QKXB 5C0RL 1UZ6E 3BVNB 4OZ4B 3MFFB 3GSWA 2XY1A 4LKCA 1DQJB 1W1YA 1E4XH 1MQ8A 5L2JB 2VDOH 4GAGH 1PBYA 2D7TH 1JHTA 3HE6A 2ZCHL 2L4OA 3DARA 3UXFA 3CHFA 5ITBH 3I6KA 2DM2A 5EIVA 3QQ3B 1JUFA 2NNAB 3MRFA 3ARRA 3BEWA 3QH3B 3UPRB 1TZIB 4D1IA 3SJVB 3BKYL 2WHKA 2GW5A 2XKNA 5BVJA 3OKMA 3BEVA 1BVLB 4WW2A 4P7QA 1BQCA 1XAUA 4JZNA 5D7JC 5IM7A 4BSVA 2HFEB 5C3TA 1H5BB 2XV6B 1OD7A 2CUMA 4R9HA 4K7FB 4ZPVA 2JCCE 5GGVL 3ZDYE 1HYSC 3CVHA 4F58H 3CHDA 5SWZB 5J3HD 1E1EA 3M8OH 4AQOA 3STLA 3N04A 3VGAB 1TVDA 5BOZG 4EKXA 4PJGF 4HA1A 2OTWB 5J12C 1N64H 3AIQA 1KN2H 4U6HA 5GZOD 3VCLB 5BMFL 4MHHI 3EO9L 3N1MC 1IKFL 4X98A 1OGAD 1AGEA 1FO0A 3U1SL 5ID1A 4XMLL 4D2NA 2GT9B 2IBZX 4M7ZC 3N9KA 4I0PD 2VL5A 4OGAD 3GHEH 2RFXA 2AJ3A 4L8SB 2WBWB 5EZJB 2Y25A 3LEXA 4Z0BH 1G9NC 4PJ9A 1MHPH 3X3FL 1UD2A 1FIEA 1GZQA 3CIVA 3OKDB 2HWZL 1QZ1A 5LCVH 1QHPA 3ROOB 1AXSB 5BV7H 4UDTB 1B30A 4MCZB 2FO4A 1GNXA 5DEFB 4IDLA 5CGMA 3P0YH 3EJYC 4FFZL 1S5IH 2ATKB 3AAZA 5CLTA 5JOPD 4XP1L 2ESVE 4R3SB 1ZT1A 4X9IA 5D7IB 4HF5L 4XAKD 1A1OA 1P2CB 3JXAA 1RP9A 1CFSB 4PYHA 4GXUM 5F1SA 2Y6SC 3MSPA 4UUJA 1F97A 2Q6WB 4X5WA 1XYZA 4ZFFB 1HQRA 5DMKB 3ARSA 2RR3A 3BSGA 3PHAA 4NO0A 2EDBA 1ZSDB 4LGXA 2J12B 1U8PA 4P2QA 4JPKH 5FECA 3IFOA 1E6OH 4HH9A 4Y8AA 1JFHA 2VLLB 1KEGL 1VENA 2NYYD 1OAUH 5H37H 5TGBA 1YQVL 3VFOB 3PGCA 3QJHB 3UYOD 4PJIF 3CGTA 2GTZB 3O0RH 3ZDXF 4O51B 3CVHH 3K3QA 4NZRL 3T2PA 1E40A 1DQLH 3JUGA 4ONHA 2OK0H 4K7PL 3BN3B 3TV3H 1OLLA 4H5SA 4DCQB 4Y19D 2VX5A 4ZXBA 2FJGA 2UYLB 2Z92B 4DVRL 4M61A 2OXHA 4FP8H 3MV8B 3EMZA 5J1TC 1PW3A 5E9DE 1SJEB 1PSKL 1LMKA 2EDRA 3HPLA 4MXQD 3P40A 5A1AA 2H3NB 4WWKD 3UTTD 2F15A 1A7PL 4PJEF 4KRTA 3AHTA 3BIBX 2LE9A 1E4MM 4J3OC 1PX8A 2JK5A 4U1IB 1EDGA 4AZ7A 3O3EA 2XKUA 4LNRA 1JGVL 2CGRH 4NJAL 1XD1A 2HA1A 1TQCC 2Q3AA 5T1KA 4GW1B 4WLCA 5ALCL 4ENEC 3N12A 1C7TA 3IXTA 3VGBA 4M62L 5DA4A 1Q6GA 4H8VA 4UDUA 5C0CB 4ORZC 3TP4A 4YXLL 3QXUA 2PO6C 2BSTB 3IDJA 4RQQA 2ZUSA 1VSCA 1GIGL 2LU4A 2GJ6A 2LAGB 2X4NB 3FO0L 4L8CB 2LTQC 4K71C 1V7NH 1BGAA 3OB0H 2VXQL 1A4KA 32C2A 4WKFA 1CGVA 2CLVA 5JXEA 3B9KA 2N7AA 4G6KH 3GO1L 2VE6A 2GITB 5JQ6L 4PGEA 4CDGC 1V05A 3N50A 5FM4A 1Q0XH 4GRWF 3HCVA 1JI2A 5DZOA 1L6XA 2XWEA 1DWIM 4NRYA 1UKPA 8FABA 5AAWA 5FYKD 5L9DH 5EU6A 2BFVH 1CD1A 2XUCA 3CHCA 1CDGA 2EH8L 4KQ3L 3I84A 2XPGB 3T2QA 5B3JE 3ULVE 4PN2A 1JZ3A 2H1PL 4L8BB 3M1BB 5D96C 3FO9B 1E71M 4TUFA 3GSUA 1XGPA 4YZFE 3H42H 1NJ9B 4ZXLA 2AV7B 1PYWB 1MY7A 2G3JA 2WAHA 3ES6A 2ERJB 1LO0H 1H15A 3V5KA 5IHZB 4AEIH 3WLWC 2WMJA 3S3JA 5E4EC 5GNYA 4CNIB 2W66A 2EXYC 1FP9A 3CIQA 5KSBE 4AH2A 2W9DH 5B8CA 3EYVB 4QRPE 2H2PD 4M1GL 1WO2A 3MBEA 3BIKA 4PLOB 1AXTH 3KLHD 4H25B 2A74B 1LO2H 1FJ1B 2DMCA 2Z31A 2KBGA 5BW7C 2YPLA 4TNVK 1VFBB 1F58L 5EZIH 1W72H 5KSAD 4N1HB 1ETZB 3DURB 2R69L 4TX8A 3QQ9D 4LGSB 2A3CA 3LS5L 4ZUWA 1QRKA 1C8QA 4Z5RB 1E0OB 4DWSA 2J78A 3N9GL 5F3HB 2OL3B 1D5IL 4ZOEA 4UCFA 3BDXA 4E41D 2VN4A 4GUPB 1G0CA 4N5ED 3QIUC 3LZFH 4PJHE 2Y9RT 3N1FC 5C08B 4KUCD 3NJ3A 4OFIA 5CINH 3I50H 1AKJA 1FZMA 2PBGA 1BFNA 2BY0A 1E6SM 4HUVB 3RDTA 3NFNA 1YMMD 1DR9A 5C1MB 2GFTA 2DMBA 3RWIB 3GIZL 5FCUL 2GFBB 1L7IH 1RHFA 4WI4A 4XNYH 4AJ0A 3L7EB 4MCYB 2XG5A 3UC0H 4RAVA 5KTEL 2WBGA 3EBAA 3RAJH 4QHKJ 2VB5A 2WSPA 1I9EA 4P23D 4PJ5A 4DKFH 1R24B 4QHLB 2GIYA 2QMJA 1S78D 2V7HA 2WP3T 2GJJA 3N1GC 3VW3H 3QAZB 2C7UB 1FDLL 1YNKL 3ZZ1A 2GJPA 5C0FA 2J6EL 5JXAH 4CJ0A 4IDJH 5DJ8B 1TNMA 3CX5K 2NY7L 4JZJB 4YR6B 3CH8A 1H3XA 1ACZA 4G8GD 3AYRA 1JWSB 1JYXA 1W3HA 1N26A 3H9HA 3MNWA 3JV6A 5D8WA 1OGBA 1EFXD 4M00A 3WDPP 1YYLH 2WUCL 4YC2C 3VFRA 4AM0B 1H3WM 1B88A 4NUGL 1C8XA 1FYTB 1TA3B 5H37G 4M6ML 3KWWA 4P2YA 3MSDA 2VXSL 2BS9A 4M3KB 1CG9A 4X83A 4PRAB 1OGTA 2LVCA 12E8H 4CVUA 5GGUB 2R39A 2WVVB 2R4RH 3GKWH 1D5BB 4EBQL 4X8JA 4HX1A 5HHQB 3LKOB 3CLFL 4PJDF 4PJBE 4PUEA 3S5LA 5K9KA 3PJSB 3QFJE 2OYPA 3N85H 5DMIL 4GRWH 4JRXB 4CU6A 4IIQC 2UUDH 1AQKL 1U8QB 2VLMD 5D8JL 4FS0A 2VDNH 1OTSC 2G60H 2HFGH 3U9UB 2XWBB 1A6ZB 4L4VE 4ZO7A 3MRPB 1LG1A 4PJ7F 1ZWIA 1LO4H 4PLKD 3KS0J 3I9GH 3R1GH 1GVYA 1UWRA 1UA6L 1GGTA 4XPFL 3BAJA 5EB8A 1A7RL 3ARUA 1OGAA 4TTDC 3SDAB 5LXGL 2DQJL 1JJUA 2BC4B 4UILH 4U7KA 1U8JB 4GQ9H 5C0DB 3QHOA 3PGFL 3C5JB 3BD5A 5J57B 3PWVB 3EIFA 4MZ3A 3HE7D 2QADB 3VDHA 5EBAA 4AZBA 2V17H 1TETL 3SCQA 3D85A 3JTTB 1UWXH 3VXQB 3C60D 3NCCB 2R23A 1K6QL 3L1OH 3PQYD 4KKBC 1LQ0A 1CU4H 1T22B 3QO1B 3ARZA 3PZOA 1XH0A 3BZFB 5GNZA 2DQTH 2BVOB 4NHUA 1ZLVK 5BRPA 5DGQA 1AGDA 1LO5B 3GBMH 4MB3A 4MA1C 4ZTPL 2IPKA 1GCFA 4OIBA 1SM3H 1YEIH 3MC0A 5DFVC 3UEQA 1EZVX 2OTPA 4D6CA 2JCCB 3ZDZF 3MGOB 4D94A 5MHSD 4CW1B 1W0VB 3C5ZD 3E3QE 3I85A 2BJML 1C12A 2ITCB 3WIIH 2ZWYA 4ZUVA 4Z7NE 2KL6A 3QUMA 1K3ZA 3O6FC 4FQJH 1TE1A 1KB9J 5A6BD 1QFUH 3GHBH 2X10A 2VISB 2VDQH 3UJJL 3SY0A 4CBPA 2IANA 1V3HA 1JK8B 4PJ7A 2YL9A 4PGDB 1RZ7H 2Q20A 4UU9B 3WKZA 1X5KA 3MUGB 5IB1A 2XGBA 4LLUA 4KK6D 2HKHH 1U9KA 4GQQA 3GGWB 1QKZL 3B2VH 1B6UA 3RGVB 2O5YH 3ARBC 1Z0NA 2NY4D 4WWKA 4FXKA 5B39B 3OV6A 1QSED 4G7VL 2ICWJ 2PYEE 1G7MB 2NY5H 4G80B 1G1CA 5LVEA 2DIEA 5JHLH 4LAJH 1FVDA 2F2HA 2ESVB 4LMQE 1T03L 5DD1H 3RTQD 5JDJA 2BSRB 1KXVA 1PY9A 5DVLA 3BX7C 4HC1L 3MV11 4Y7EA 3NCYP 2QQQA 2AEQH 2EYTB 2X4UB 5CUSH 1FZJB 4Y0GA 5I6XC 2EDOA 2ESCA 3DBXB 1RU9L 1I1YB 1BJ8A 1OF2A 3VXME 1NMCB 1KPVB 3BH9B 2WMGA 1KCRH 1OTTD 2H6PA 5IF0A 3BESR 3P4NA 4MPKA 2VIRA 5HHOE 5I78A 3BOVA 4B0MM 4D9LH 3DMMB 4WHYH 4TSCL 3WD5H 4M7JH 4C56E 4YHKL 4NQXB 1TFHA 5TPWH 1G9ML 1NCAH 1XIWC 4MJIE 1YEGL 4WFFD 5CIPA 1VRXA 2ARJA 4HUKB 3MLXL 1BFOA 3Q48A 2B1AL 3I02A 3QEHA 5DZNA 4LFHD 4WI9A 3RL1B 3V95A 1EA9C 1I9IH 1QLFA 1T2QH 3X14B 3QUMH 2EZ0C 4KUCF 4JY5H 1WT5A 5TF0A 3TBTB 2BY1A 2CITA 1VACA 4NNYB 4FQCL 1DFBH 4JHWL 5HOSA 5E9DB 1DLHB 1DE4A 1JPGA 3EO1A 5EULV 5DEGA 2G3IA 1MFEL 5DMGC 2BSED 4MQTB 3TNMA 5FK9A 2DIJA 1GZPA 3S7GA 4MNGE 1DQDH 2CQVA 3PWUB 4ACZB 2GTWA 3REVA 1TVHB 4OZHE 3VFNA 3G6LA 2IALA 2A73B 5HGBA 1EEZB 5E5MB 4KGJA 3ARED 5AC5A 1LDPL 1H0GA 4Q7DA 5DS8B 4AL8L 5A2AA 1RZJC 1WC7A 3ZKXC 1RULH 5TE7H 5FYKU 1HHJA 4FQQB 3CVIL 3GJFA 1X6LA 2XVPA 3HC0B 1CEOA 5EC2B 1QFWH 1NEZB 3DHMA 1G6RB 4UOQA 2WUBL 5I76B 2NPLX 2D2OA 5JDSB 1N7ML 4JY4A 4W6WB 4CN6A 4X0KB 1K5NA 4OD1H 1K4CA 5BRZE 3SE9L 3CD4A 1F45A 2NR6C 2WWMD 1HIZA 1HXYA 2NLJA 4NZUH 4YHLL 5MEPB 1F3JB 2VZSA 4Z0XB 3R8QA 5HD8C 4O02L 5E2TH 3T0AA 3AHVA 3DGGB 2FR4B 4GKZA 4YHIA 2YMXH 3BAIA 2BVUA 1K9EA 3KL3A 4TTGA 3ROLA 3W11D 1N59A 4X6FA 1MQRA 1MW1A 1CL7H 3ILQC 2BERA 5CIPH 3CFEB 4DK3A 4MJ2A 1C08A 4Z9KB 4E41A 5J6GA 4UNIA 1KB5H 4APQB 2UVFA 1B1YA 2MANA 1HVQA 4PG2C 1GOOA 1G7LA 1MCFA 1ZJAA 2R29H 3GH7A 2Q86A 4X7TA 5BO1H 5JR1L 1WFOA 4JJHA 4K3JH 1UA3A 3KPSE 3RA7L 4HDIA 3ULVL 3S3SA 4LSTL 4Z2KA 2YD5A 1I9RH 2BNRD 3V52H 2AQ1A 1DBAH 1IZKA 4LPXA 5FYKH 1NUFA 1O7SA 5EO1A 1ZANL 4JEGB 5K9JH 1I3VA 4BQBA 3BMWA 3OGRA 4OZFB 5AD0B 5L88L 4P23A 1MFNA 3ZO0A 2O9PA 1E43A 3H8NA 1CTNA 1I1AB 2PTVA 3GJEB 1BSIA 2J8HA 2YPKB 2NXZC 4Z7VB 5KSBB 1IEAA 5L8KB 4QRPB 3BCFA 3P4LA 4ZAKA 5E2UH 3QR3A 4L8DA 1KC5H 5I8CB 1J8HD 5AG8A 4DAGH 3B83A 5JPNB 4F37K 4G8GA 4IRZL 5KANG 2WYSA 3GJFH 1B0RB 1W9UA 3A47A 3WN6A 5IUSA 5IKCA 4B5EA 2X09A 3E0GA 4HGKC 5HJ3A 3S5LG 4XP5L 3KLSA 5LA2A 2BOCB 3AOFA 3TO4A 5BZWA 3FOMA 1NBYA 5C0AE 5CLWA 2AEWA 1PZUB 1P4BH 4JFHD 4JO3L 3W28A 3MRIB 4DGVL 3WJJC 2OBGA 4DZ8A 5CSYA 5CEZE 5D93B 5C70A 4JFXB 1BOGB 1I8IA 2XZAL 3K46A 4P2RD 4PJHB 1CXKA 4XPTH 5GRVL 5JHDD 3TOPA 3WLBB 5LAXA 1IM9B 1F4HA 2YPVH 1RZFL 1AHWB 4K3HA 4JM4L 1WB0A 3WV0A 1H09A 4G9FB 1C5DA 1JGUL 1CE1L 1GH7A 4Y16C 3TTOA 3FXYA 1X5ZA 4XC1L 4HFWB 5DUML 4XPGH 3QI9C 1FHGA 4FNLH 4JREC 2XZZA 1DLFH 5IQ9A 5I6SA 3CXHK 3AYSA 3U0PA 4P9HC 5M03A 3ZHLA 5IHRA 2FCBA 3LPOA 5DUPH 3T0ED 1SEBA 4H8WL 5AEAA 5FA4B 4L4PA 2EEXA 2QQKL 1H3GA 4ODXB 2O9OA 1FGVH 5T1LB 4Z8FL 1A5FL 1E0VA 4A3HA 5EFIB 1I1XA 2WW5A 2M2DA 6A3HA 5DC9B 1FZOA 2R9HC 4UV7L 3JWDH 3HE7A 3KHQA 3T3ME 1UHVA 1A1NB 4M7LT 3IS0X 3PWLB 4GMTH 5I16B 1FORH 5T3XD 5AZ2H 2HN7B 5LGJB 4WIQA 3DI3B 1IRAY 4NQDE 1XSJA 1KBKA 3IDUA 1J0KA 5GHWL 3U36B 1UACH 4PREA 3LH2H 4DZBA 1K8DA 3O11A 1U8OA 1IM3A 5SV3A 2AI0L 4N8PA 4JB9L 5H35A 4HUUA 1XZ0A 5ESAA 2MJWA 4LRNH 4ZUSB 4C83B 4PJBB 2CKBB 5E03A 1QNQA 3QFJB 1I3UA 1KBGH 1NCUA 3OJDA 4XXDB 2E4TA 2WKLA 4IUGA 2VTFA 1IAOA 3H6JA 3WFZA 4X0VA 5ACZB 1C5BL 1WICA 1BBDH 1MY5A 3D3AA 3C5ZA 2R2HA 5C6WH 3AXLA 3PDDA 5TJWK 1FL5B 1IAIL 4AD2A 1XR9A 4GBXC 5JUEL 3SGJC 4LOUC 1MCQA 4Y4KC 3GM8A 3O3DA 3SCUA 3REWA 4NN7B 4W93A 1IBGH 5LWYL 4HJJH 3MOBH 3P2TA 2XIDA 1A6UH 4P2OB 2XVNA 1UR8A 3V6BR 3GSVB 5DK3A 4NBZB 4BFBD 5DD3H 3L6FB 4XCCL 4XWGH 1UQSB 2IAMB 3CFJB 5C6TL 3BZ4A 2ZSWA 3BPNC 3F5WB 1YNTB 3MNVB 4CDHA 1NL0L 3HMXA 1ISWA 5IHUH 5I8KL 3L3KB 4Q6IC 4BZ2H 1KQYA 3QZWB 4TVSa 4BH7B 5E2WH 3D5HA 3SGDI 1II4E 5EU5B 4EI5D 2YN5A 1Y7VA 1DWFM 4M9PA 4OSUL 4LSRL 1QQDB 1W9VA 3NFSL 1C5CH 2WBKA 5EBWB 2V2TB 1TTUA 3ZM8A 5GSRA 4AQ1B 1INQB 5CILH 1ZXQA 4R2GD 4JPVL 1G9EA 3DECA 3NN8A 4EOWH 4LLDB 5DJ0B 4NRSA 5BS0E 2JKXA 4CAGA 3JVGC 1QW9A 1EVUA 2Y5TA 4DN4L 2WVSA 5CPSA 3AS2A 4ATDA 1JNEA 5F1IB 1GC1L 5AZEH 4BK5A 2ZUMA 2Z9TA 4KH2A 5HDBF 1PX4A 3D1MC 1V3JA 3MRNA 5E0QA 3U4EA 3CC5A 3DX7A 5E6ID 3MRCA 3IXAB 5E94B 3BISA 3FZUD 3BSHA 2CK0H 1INEL 3GMLA 4PTTB 3OA5A 4B3KA 1E72M 1AQDA 5GS0L 1KPUA 4LCCB 3X12A 5IESL 3ORJA 3TT3L 2P5WD 4ORGB 1LEIA 3QCTH 3QHFL 1LLOA 4IRJB 5EN2B 3RM8A 2VDPH 4M29A 1Z32X 3BN9D 4NKIH 4HKXB 3IU3A 1HKIA 3L3HB 3NTCH 4N8CL 4U05A 1NCCH 4RZCA 2P47B 4LARH 4KGLA 4PMVA 4R5EA 2Y7QB 4G7YL 3V0VB 5F1NB 2QQLH 4EXKA 3CZFB 2XN9E 1RMFH 3D3VE 1E4WH 1QI5A 4XZUA 1KEMH 3SDYL 2PYEB 4N8VA 1OAZH 1G9NH 5TDOA 5INCB 1AY1L 3UR7A 5FKPB 1AGFB 3HMXH 3DV6B 4LCUA 4MD4B 3GMOB 1KGUA 3PE9A 1YEDA 3O2VH 5L7XL 5HHVH 5DVNA 3GI9H 5DJZA 1A4JB 5I74C 2ZX7A 4HKZB 2ZSVA 3TBSA 4NKOA 2IQAA 4PTUA 3HZYB 2F5AH 1HWHB 4YHML 3NVQA 2XWDA 3N15A 2NY6D 3P9LB 3CDGB 3L3GB 3KYNB 4LGPB 3OB8A 4QT5A 5A95A 3S98A 3ZKSD 2IF7A 1R0AL 4Q7NA 1WK0A 3MPCA 3UTPD 3B43A 3VXMB 1P4IL 3AXXA 2BNUB 4OI7A 1HEZB 3TVMD 1ZT7B 1OM0A 4PBVC 3KPRE 2P42B 3D18A 3O3AB 5D6CA 4C56B 1JNNL 4JKLA 4X9HA 3RWEA 4P7OA 2I5YH 1KULA 4MJIB 3B8YA 2H8PB 1UM5L 5IMLA 5IB5A 1QPKA 4KI5E 3IDIB 3CFCL 3N0PB 3VD4A 1PGRB 3VXRE 5LYRA 4HWBL 3ZMRA 5K9OA 3DO3A 3ZJ6A 4MVBC 2A3EA 3RKDC 2HG5A 3QXDB 4LX4A 2O93L 4R7DA 4PMZA 3KPPA 4DK6A 1KFAH 5E00B 4KZEH 3GMRB 5TF1H 4M43L 2EDKA 1AO7E 5FOOA 5F7DA 4CRPA 4PJAE 1UENA 4MNGB 1FLTX 2BNRA 4RGOH 4OZHB 5BVPL 4D6IA 1E6ZA 1HHGA 1RIHL 1QOXA 3KDMA 5DD5H 1S9WB 5ICYA 4NBXB 5ALBL 3VIPA 1Q72H 4HWZB 2MHAB 2NXYC 5C0ND 1G9HA 4WUKL 2EEBA 1QOKA 4X7SH 5EWIH 5GGVY 1MVUB 2BSSA 1UM4H 2XI9A 1ROWA 3G6JF 3B9AA 4FQ2H 5HHNB 5EMYA 3WHE0 3DUUA 2WKGA 3LQAC 3RU8L 1A14L 3U0WL 2B0SH 2J5LB 4WJ5B 1FL6B 4I3GA 3L3OA 1OQOA 5EG6C 4JE4B 1J8HA 3G08A 3AY4C 4ZTOH 3ZLQC 4WUUD 1D2KA 3CPUA 3SIMA 1TJHL 5C8BB 1Y18B 3LSOA 3KAAA 5BRZB 2FH6A 4HK3J 5EZLA 3QEUA 4U6XA 5BW7A 1RK1B 4KVNL 3F6LA 4JFFA 1XYFA 1YC8A 3QDMB 4LKXA 1T1XA 5KN5B 3BLPX 2IUZA 4NRXA 3BRFA 2FGZA 2FNBA 4KK8C 1OAYH 5DRXA 1U36A 3WEXB 2ICEB 1Y0LA 4OTXL 3IDYC 1BWMA 4HKBA 3EBVA 3HU7A 2XTJB 4YH6A 4NQCA 4S3KA 2OTUB 3WD3A 3QIUA 2EEDA 5SWSA 3U57A 4PP2B 4U0RB 3AIBA 2MWCA 2HVMA 3TLRA 1V7ML 2HJKB 3LKRA 1CF8L 1T0MA 3FL7A 4P3CH 4XXCC 5KW9H 3KPSB 1RIUL 4ESKA 4HFUH 2DWDB 4PPTA 3PV6B 4R4NC 5J1AB 3I6LD 3DRTA 4N0YH 2XG9A 3HB3D 3RQ3A 4AT6B 4ONOA 1JZ2A 2ZXQA 2EO1A 1DVFC 3GNRA 3OAYH 3PF2A 4ZODA 3LD8C 5F6HJ 2VSDA 5I19H 3G6JA 3T0EA 5DFAA 1AQMA 3LN4B 3HPJA 1KENL 1ND0B 4WEUD 3C8KB 5SX5K 2BVPA 5IMKA 4WV1B 1E4IA 4C54A 4PMUA 3S6TA 3SDCD 3OHXB 1I8KB 4WI3A 4XPBH 2HT2C 3GB7A 1BLIA 3V5DA 3NIFF 3WL9A 1T7YA 2QKIB 4E4PA 4ZFOA 1KWKA 2FATH 4JFYB 4EQ2A 3BAEL 3L3DB 4MJ5A 3KJ6H 4TSAH 1T6WA 2APFA 5CGYD 1ZJBA 4DW2H 5C0AB 4G43B 1KNOB 1GPOL 4D9RE 2HH0L 4MD0A 3BO8A 1ZAGA 3H9SD 4LIQH 3BAXA 5DRNA 5HVHC 1JHKH 3QAZC 4YDKH 4Y1AE 1M6OA 3EFFB 4MX7A 4HU0A 1Q9KB 2BDNL 4Y4HB 1FAKT 1I1RA 4KRUA 1BG4A 3AXHA 2YKKA 5HDLA 4YHYC 5T3ZL 2WZPD 2IPTH 1OLZA 4WHTA 4F33A 1I85C 2JJUA 3QG7H 2PXYB 3P30L 3CUPA 4Y4FD 5CSBA 1HF6A 5C07D 2YD7A 1W2KT 4WNQA 2VSCA 1PG7L 1RHHA 5EOQL 4KKLD 4HBCH 3WFBL 3X3GL 4NKDA 3BUTA 3PGDA 3QDJD 3LHPL 3ARQA 4AENB 2OYMA 2E9MA 4GQRA 4UB0H 4O2CA 4ZUTB 4ZFZA 4YHNA 1BD2E 3IDXH 5IK3A 1BREA 4UZSA 3MBXL 3MLZL 4X80H 4KROB 1QRNE 1FFPA 5MI0C 3ZDXE 5EOTA 3OKLA 2YK1L 4HUNB 3O4LA 5FCZA 2O61B 2FEDD 4EI5A 5GGSA 3CZEA 4PD4J 4NQDB 4F8QA 5EU6E 1OWRM 1J12A 4D9QE 5IMOB 2QR0B 3TBVA 3SHSA 5T3XH 4ODWB 1V0LA 1T0NB 3QIWD 2C3VA 1X5AA 2BNQD 4F66A 5F88A 1NLBH 2YD2A 3RY6C 3CJJA 1CD0A 4NDMB 5IFAH 4RWYH 4K94L 4BH8A 4HIIA 1Q8MA 3ULUD 3MJ8A 3PHQB 3NFPB 4WCYL 2JALA 5KZCB 3JWOC 5E8DH 3DWTA 5E6IA 4PEEA 2CK2A 2PNDA 3SO5A 5JA8B 2VX6A 4P46B 5DT5A 3MCKA 2QADC 4YGAB 3O6FA 1CVRA 1VGKA 2VZ1A 3SUSA 2ATPB 2BZDA 2P5WA 1MRFL 2BRRL 3S36L 4QXTB 3S35H 5I15H 3TYFA 5FM5O 3GNML 2ENYA 5ENWB 5MEQA 2W63A 4W8BA 2DQXA 4N8VG 4NNXB 4RE4A 5BCAA 3LY6A 2YPLE 2BVEA 1ITXA 1S7WA 1OAKH 4M6AA 2PWFA 4OGXL 1JTOA 3OF6D 4JPWH 3W39A 3VXSA 3HMWL 3SJVD 5AG9A 5EU4B 5IWLC 4X6DF 3HG1E 3VNYA 3ARBA 4LLYA 5E1AB 1NAMB 4WY7H 1NAML 4CMMA 3SCSA 4HT1L 4YHZH 3EJZD 4LL9A 3WDIA 1W8OA 3V6FB 1GJUA 1MCCA 1EXUB 4XVUC 3GBDA 1LK3L 1BGGA 5FYLE 4M8QB 4MAYD 2J79A 1QPPA 5I1AA 5I8OL 1HWGB 2UZIH 5EO0B 3U9PH 1KYOJ 3L5WB 3MFGB 3GMNA 1WWCA 5GJSH 5SX4H 3VJ6B 2CHOA 4HXAH 3RNQB 4Z2JA 5BS0B 1X44A 4Q2ZA 2W4XA 1I4FA 5F96L 4FFYH 1MLBB 1OP3K 1HL9A 3KYMB 2LAAA 4PJ5E 4WU7A 1ZLSH 4P3DB 4RBPH 4KJPC 3D2UB 4AG4H 3T0BA 4I48B 2A9NH 4U1GC 3QYCA 3EAKA 3RWFA 3IAQA 2AXGB 4K8RC 4GS7B 1P53A 1FGNH 3EHBC 1MJUH 2EC8A 3VH8A 5ERWA 4MA7H 1CT8B 5A6MA 1E4XL 1T89A 2VDOL 4GAGL 4CVZA 2D7TL 4FQPA 4QRUB 4X6CF 3U30B 5B38A 5BJTB 5ESVA 3PTKA 4ACPA 4PRDA 2HRPH 4X4XB 2B2XH 5ITBL 3QHNA 2ICWI 1AE6H 1J0HA 1ZVHA 4BSJA 1O0VA 2XN9B 1OSPH 3D3VB 1AI1H 5FF6A 3EYPA 4BA0A 4EN3B 3S8WA 4X6DA 4F7PA 4AEHH 4GRLC 5IJKC 1P7QB 2CUHA 4GO6B 1LE5B 4M1DH 1B90A 4MNMA 4HIEA 4UOJA 1RD6A 3MZGB 4F58L 43C9B 1TUXA 2ZG2A 3MACL 1ZHNB 3FOLA 4GKNA 3M8OL 2HTLC 4KC3B 3PWPA 4UQ3A 1T66D 1FNEB 1W1PA 1N64L 1ZGLA 1VFAA 4U2YA 5I1LA 3GI8H 1ZTXH 4QXGH 3K8LA 2C1OB 3G5XA 1PIFA 5KJRL 1V3IA 1ADQA 4XTRD 4WGWB 1W0WA 4WUUA 4QRTA 5IW1A 2QHAA 1FG2B 4MS8C 1U8HB 4K3DH 3TA9A 1RI8A 3MV8D 1EEQA 5HYQB 3GHEL 4Z0BL 4YDJA 4AD1A 4H2CA 1MHPL 3I2CH 4IOFC 5LCVL 3FT2B 2P5EB 3GRWA 5FUZH 2YN3A 1TZGH 1X1NA 2EQDA 1Z5LB 2UVEA 5BV7L 2AV1A 4U5IA 3VXRB 2DWEA 3X13A 4B15A 3O8XB 2ZP0T 3ILPB 3AB0C 3BIAX 3KLDA 4MLIA 3MRQA 3P0YL 5KVFH 4X6CA 1B0GB 1S5IL 1UC6A 3DNKA 4E5XB 4PG2A 5C0CD 1PKQA 3HE6B 3BCDA 3HZVA 4CMHB 2JELH 2ZICA 1EX0A 5IV2B 3WFEH 3FO1B 3ZJ7A 4PJAB 3MRFB 1TITA 4LRIC 4UINH 5DJ6B 3BEWB 3ZT6A 4D0CA 1U8LA 2HLAB 4ZOAA 2XKNB 4NM8H 5BVJB 4JPKL 1E6OL 4NNPL 3BEVB 4JFTA 4JZNB 4KK9C 4Z2GA 1EBAA 1KCVH 3C2AH 3O41B 1OAUL 4M81A 1QUNA 3UESA 4S0SD 3SGEI 4DM2A 2VXVH 2C3WA 3O0RL 4OFKA 1NUNB 3CVHL 4MJ6A 1DQLL 1WIPA 2OK0L 4NYLA 5EA0H 5JW3L 3STLB 3UBXA 3TV3L 1JV5B 1O7AA 3ZKND 1QSZA 5EIQA 1LILA 5C0EB 1OL0A 4RGNE 2IANE 3QSKB 4DOHE 5CSZA 1AH1A 1ADQH 4FP8L 4X98B 2A3HA 1AGEB 1FO0B 1TCRA 2RJMA 4QFUA 4NQVA 5ID1B 2PW1A 3W81A 4FFVD 4U1NB 2RFXB 1IILE 3LEXB 4WI2A 3ZTJH 5HBFA 1G7JA 3DXAE 3WJJA 1D7FA 3GRWH 1NGYB 4JFVA 2EPLX 2IH3A 2CGRL 3H9SA 1I1AC 1V02A 1D6VH 2FO4B 1I7UA 1UKSA 4GKSA 2PETA 1I9JL 1E4XI 5EU7C 5TDPA 3ULUF 5HGAB 4XNZC 3AAZB 1M7DA 1PG7W 1ZT1B 5IVXA 1A1OB 3Q6FA 4Y16A 3DVGB 4IBLT 4BQ8A 4U3CA 3LQMA 1YMHB 3MSGA 2ICES 3UTQA 3FRPA 1V7NL 2VAAA 5C07A 3QUKA 4POZC 3A3HA 3M45A 3D25A 4EZMA 2Z0BA 2HVJB 5DT7A 2ZUTA 4G6KL 4UOW1 4P2QB 3IFOB 1MCHA 4HH9B 4ODHH 3RCNA 5C2UB 1KT2A 1KJ2B 5TGBB 2D4DA 5CJOH 1Q0XL 2APBA 2J7DA 5E9AA 4B41A 4YXHH 5L9DL 2BFVL 3QDGD 4Y5XC 2DSKA 3TF7C 2EIEA 3N11A 4HS3A 3U7YH 2VUYA 2X4TA 5C3LD 3H42L 3HPLB 2HP4A 2Q7YB 2ORBL 1ZOXA 1LO0L 5IIEA 1WKYA 4FZEH 4AEIL 3LN5A 1CLOH 1H49A 3PP3K 2JK5B 3DROA 2W9DL 4LNRB 2W1NA 1BAGA 3VO0A 3X11A 4GG8A 5T1KB 1FV1A 3MRKB 4UTBH 4UDUB 2NY0B 1AXTL 1OAQH 3E8UL 4F8TA 3PHOB 3SGJA 1LO2L 2CNCA 4NUJB 3RZCC 4OZ4A 5MEOB 4PJ8B 4Y4KA 1B3XA 5EZIL 1W72L 5IROC 1FYTD 4FTVA 3GTNA 5J56B 5D7IF 1ZA3B 1OT1A 4LHQB 1E70M 4LCWD 4P9HH 5CS7A 2CLVB 4KDVA 5FYJD 1A7BA 4OB5H 3B9KB 1QBLH 1FOBA 2VE6B 1BD2B 1CBVH 4KK5C 3UPRA 1TZIA 3OF6A 4HS8H 4PGEB 4PTVA 3VGGA 3LPWA 1CLXA 3LZFL 1WAWA 1QRNB 4Q6IA 1WJ3A 5CKGA 1EXPA 3VA2C 5CINL 3I50L 4YHEA 1BVLA 2CIIA 2KZ1B 3HCVB 2ADFH 5D71H 4JRXD 3IRZA 1H5BA 4B3LA 1KELH 4K7FA 2COQA 8FABB 3P11H 4OLZH 2FGWH 5EU6B 5D4YA 1L7IL 3PV7A 5I17A 3AHYA 4XNYL 5SWZA 2V5YA 1JWMB 4G3YH 5KVDH 3UC0L 1BYAA 3BDBA 3VXTB 3RAJL 3NH7H 2OSLA 4KAQH 2A6IA 1FAIH 4DKFL 1ZKAA 2OTWA 3GSUB 1PIGA 1XGPB 3SCWA 3JVGA 4CU8A 2BY3A 3VCLA 3VW3L 3VH8G 1S8DB 4GAJH 3V7AG 4PLJD 1H15B 3V5KB 2OXGA 5CPQA 3SDAD 3BXNA 3TGXA 5JXAL 2GT9A 4IDJL 1R3IH 1CFQB 4B50A 5B38G 4RFOH 1WBZB 5DHXB 5EZJA 5L2KE 1WZ1H 4ZE5A 1CZ8L 1HKJA 4KFZC 4I2XA 3AMKA 3MRDA 4RWHA 2GJZA 4LVNC 2B1HH 2JIXB 2CKNA 2OS7A 1YYLL 1AXSA 1J9CT 2O5ZH 1YY9D 3ULUH 3MBEB 1E56A 3GH5A 3BIKB 2CDEB 2I07A 2GUYA 3OX8A 2FZ3B 1C92A 4LYRA 2Z31B 5DEFA 1HNGA 3O9WB 2YPLB 4AD0A 1FHDA 2H2SD 5D7IA 2X44D 4MSWA 4NZDA 12E8L 4X99A 3HG1B 2R4RL 3GKWL 1Z6JT 4BJLA 3OGCA 2ADIA 2Q6WA 3QULA 3U7AA 2XICA 4ZFFA 1HH6A 3N85L 1FQ9C 5JW4N 4TULH 3ZSTA 2CMRH 2VDNL 2HFGL 1FH5H 3VFOA 3NFNB 3VINA 3PZTA 1U2HA 1BEYL 1DQQB 3TH3T 3ZTJG 2GTZA 4OV5B 2KH2B 2JF6A 1LO4L 5HVWA 3I9GL 2BVYA 3R1GL 3IK2A 5FOJA 4RAVB 4IMLA 4TNWK 4PJ5B 3WNNA 4DCQA 2BOBB 3ZE2F 3VD9A 1GOQA 2XM1A 2V7HB 1MCIA 5FIPA 1EMTH 4JRYA 2F54E 4OOZA 2O26U 5IG7A 4L4OA 4UILL 3RGVD 4GQ9L 1REIA 1MFBH 1SJEA 3QWRD 2HJLB 1ZVYA 2H3NA 3EFDH 4PJCA 2VC2H 3IKKA 3WL0A 4P59H 2V17L 3IDGB 3BC9A 3JTSA 3MNWB 2J8UF 2RCSH 2CJUH 2D0HA 4RAUA 4U1IA 1IGYB 2ESVD 5A8QA 3L1OL 5LGKA 1W1TA 1CU4L 3UTSE 5CJXC 5C0BE 15C8H 1QG3A 5C0CA 4CD5A 4OZIE 1CLZH 3THMH 2AOSA 3MREB 4WFHE 2DQTL 1FG9C 2XA8H 3KWWB 1OP9A 5TDNA 4OJYA 2BSTA 1PVHA 1CG9B 3GBML 2WIIA 1OGTB 4NGHH 5T5NF 2CRZA 1ZA6A 1GVIA 3HI1A 2E27H 1SM3L 1YEIL 5HPCA 3UBXG 2X4NA 3SE4C 3AFLA 1JG9A 3O2DA 3DMMD 2UY4A 3S5LB 5K9KB 1OOAA 3WIIL 1QLEH 3VWKC 5B3NA 4HZ6A 1S7XB 4NN6C 2GITA 4FQJL 1YDPB 1XT5A 2IPUG 5HHME 1QFUL 4O2FB 3GHBL 1MXDA 2VDQL 4U2ZA 3L5IA 3HC4H 3AY4A 1EO8H 3DX8A 1RZ7L 1ZWIB 4I0CC 3KEHA 2LQRA 3UG5A 1H8SA 1YJDC 4F57H 3B2VL 2VO5A 2FD6H 4CVWA 2O5YL 2XPGA 4Z7WF 4L8BA 1KXQE 2XIIA 2D7MA 4NQUA 2YD8A 3QDGE 4MXVE 2OZ4A 2NY5L 3JZ7A 3SDDC 1ZT4A 4HWNA 5L0QB 5IHZA 2V2XB 4NCC1 4XAWH 1C93A 2J8UA 2VCAA 1GGCH 3BDYH 3FRPG 5DD1L 2AKRB 1ITBB 2FJFB 3D85B 1DL7H 4ZNCD 3LQZA 1EJOH 3RIFF 2DDQH 5DJCA 2R23B 3EYVA 2AEQL 3AMDA 5CUSL 2BFGA 3PUCA 3L7FB 2FHBA 4TSBH 3RMEA 2YUZA 1GQJA 4GG6E 4M7KH 4H25A 4OZGE 1AGDB 3PXHA 5HBBA 1KCRL 3OB0K 4D9LL 3CBWA 3RUGE 4PMOA 1EGJA 3WD5L 4M7JL 3GIVA 4NWTH 5HPOA 5TPWL 1NCAL 4JHBA 4Y7MA 3O2DH 1QBBA 2B20A 5ABGA 4ZUVB 2OL3A 5DVMA 1I9IL 1T2QL 3QUML 4GUPA 2XSBA 1FLRL 5ELIA 4YWGH 4YDIH 5TQ2H 4JY5L 4APQD 5CAYB 4U0RC 5C08A 3MGTB 2QHRH 4RGNB 3SY0B 2IANB 4JFOA 4DOHB 1DFBL 1I1FB 5GISH 2J25A 3CZKA 1SJHA 1B3ZA 2DJ4A 3ULVD 4HUVA 4K9EC 5D1QC 2Z35A 5ESQA 4C55A 3RWIA 2GFBA 1DQDL 43CAA 1F5WA 4Z7WA 4RSVA 3U6RA 3L7EA 4MCYA 2DGAA 5AUMB 1IAKB 3DXAB 4AD4A 3BPOC 3QUYB 1N5AB 4QHLA 1P84J 1I1AD 4YJZL 2OZ4H 3CZGA 5HHPB 5T1DH 4IOSD 4TRPH 1RUAH 1RULL 2PKDA 4QRSB 5TE7L 4QRPD 1W32A 1NANH 1FVDB 1RY7B 2XWJB 4PRPA 4NSKB 1FCCA 1HL8A 4JZJA 2OR9H 1UZ6F 2DEPA 2Y72A 1QFWL 2CD0A 3T4YA 1JWSA 5F6HI 1I85A 4XCYB 1VESA 2KQMA 1IC5H 4OD1L 1OD8A 4N9GB 5ECUA 2YLLA 2ZIDA 4JHOA 4NZUL 4U1SA 2EO7A 2DQHH 1VFOA 2QTEA 3B2UD 5KANI 1FYTA 5IF0B 5IQ7H 5E2TL 1TA3A 2PYFA 4KHXH 5HDBE 5LGHH 2DJSA 2YMXL 1EGJH 4OF6A 2DT3A 3HC3H 3NZHH 4PRAA 5GGUA 3BPLB 1JMXA 1DWAM 2YZ8A 2WVVA 4EDXB 4L5FH 4LP5A 5C0IA 1W9PA 1D5BA 1KB5L 3I02B 4ISVB 1J9YA 3E6FB 1NFKA 2OL3H 4OCWH 1QLFB 2R29L 3LKOA 1EHXA 1XGTA 2JCCF 3ARFC 3PJSA 2OWWA 1UKQA 4Z95H 5BO1L 1JYVA 2QPSA 4G9FD 4K3JL 3MV7A 4GXPA 3CPLB 3WNLA 2BV9A 5DHVB 4GFTB 1I9RL 3V52L 3S37H 1BQHA 1DBAL 1LHZA 3EO1B 1DE4B 4LSVH 5FYKL 3QIBB 4HLZH 2XWBA 1A6ZA 1P6WA 2QMKA 2QEJA 5K9JL 3THCA 5FYJU 4JZOA 1VHPA 1DQMH 3MRPA 1GZPB 3GSQB 2YL5A 4R96A 3VFMB 5HGBB 4LLVA 2IADA 3RY6A 4P8WA 4RMSA 2F9BT 1MEXH 3QCUH 4GKLA 1FH8A 5E2UL 4KZDH 2X1XR 2BC4A 5IBLD 1KC5L 5C0DA 1MXGA 2EXWD 4UTAH 1GJIA 1KLUA 1HHJB 1KLFA 3IFLH 3PWVA 1N0XH 1YY8B 2W9LA 4JM2B 3FQTA 1J0JA 5INDA 4H8UA 4C59B 3VD7A 4JY4B 3SKMA 3HI6H 3MRRB 3VXQA 1K5NB 4ZFMA 5CPTA 3WS3A 3OR6A 5FM8A 3UAJC 1L0XA 3QO1A 4K7PX 2VLJE 4HSQA 1P4BL 5EPMA 5JMRA 3KXFD 4NSBA 4JPIA 2BVOA 4AIZB 4GKZB 4MA3B 4P7RA 1HDMB 4XPTL 1LO5A 3ROLB 4YPJA 1N59B 5FYJH 3QFJD 3EDEA 4Y5VB 5J6GB 2YPVL 2NMSA 3BWAB 5D1ZB 4NQCE 5SWSE 2IFGA 1G7LB 3MGOA 3VFTB 1U91B 2EDTA 4OLUH 2ITCA 4X7TB 2Q86B 5AYQA 1YUHA 4XPGL 2R4SH 1NSNH 4YN5A 3Q0HA 4FNLL 4HDIB 2RTSA 4PBGA 3EGSB 1DLFL 3HRZB 2RAMA 2PN5A 2VISA 2Z8WC 3K8MA 3C8HA 4JVWA 4P2OD 1JK8A 4TPRH 1NBQA 4TVUA 4WEMB 3I6GA 1HKLH 2NY2B 5J8OA 2GDVA 5HPMB 2V5MA 3KPNA 3VIHA 1RZKC 1FGVL 5CWSA 2IAMD 3KYOA 5L2KB 3GGWA 1WCGA 1UKOA 3MQIA 3ET9F 3RGVA 4Q9RH 5KSVB 3QWRA 3NABH 4ZAKB 3WEMA 1A9BB 2WINB 1F90H 4NKQB 4Y2DC 1CTOA 3JWOH 4GMTL 5C2BH 1FORL 4AZHA 3RL2B 3MYJA 1Q38A 5D1XD 1OB0A 5AZ2L 4PV9A 4LCIH 5IKCB 3QBTB 2OI9C 2GJXB 4V2BA 2V2WB 4A6YB 1OSZB 1UYQA 1KGXA 1UACL 3LH2L 4HIHA 5J13B 2EYTA 5F7LB 3TO4B 3W0KA 3FOMB 5KSUB 3KPMB 3DBXA 4LRNL 3UTZA 3SDXE 1I1YA 2C26A 4DZ8B 4GRLA 5IJKA 3MJ9A 1I8IB 1KBGL 3TA3C 3BH9A 4W87A 1T3FA 5IB4A 1CL7I 2JE8A 1ITCA 1C1EH 5LAXB 1BBDL 2NT0A 5DVKA 3STZA 1E3ZA 4NQXA 2ZE0A 3NPSC 1KJ3H 1CICC 1UD8A 1C5DB 5IEKB 4TVPE 2YWZA 1J0YA 4IRJD 1IBGL 4HJJL 3MOBL 1ISVA 1A6UL 3RL1A 2WBJC 4R0LB 5D70H 3U30C 4YDLC 1XGRA 3TBTA 2PC8A 1VCAA 2AJUH 5DD3L 4M24A 4PB0H 2GY5A 4XWGL 1ZHLA 3QNXA 2CBUA 5B3JF 5ITFA 5E9DA 1SEBB 5GRXG 1P7KA 1VFMA 2BRQA 3G6DH 2FYYA 4LPUA 4YZFF 2GEEA 5IHUL 4BZ2L 2DQIH 2X4PB 2UY5A 2PYED 1X5FA 4ACZA 5IT2H 2NY3B 5A2BA 1TVHA 2XQYK 5E2WL 5E5MA 4GRMA 1MWOA 5DS8A 5KSBF 5T5NG 4BS0A 5ISZD 5C0JB 1C5CL 3O4LE 3CH1A 2EDJA 4DKAA 5C0BB 4PGJA 1TZ7A 1PAMA 3MOAH 5F70A 5CILL 4OZIB 4FQQA 4EOWL 5D7SH 3W6MA 3CLEH 4QOKE 3CU7A 4BQ4A 3VXMD 3SCMB 4D8PB 5AZEL 5I76A 3F7QA 2MTPA 4X0KA 4HUUB 1XZ0B 4C56D 3FONA 5D7JB 4MJID 3MJ9H 5B4MD 2CK0L 1UWIA 1QSVA 4Z0XA 3H0TB 3DC0A 1XR8B 1D5ZB 1IAOB 4HLZG 3BPCA 1P9MC 3PWJB 1MW3A 5HHMB 3QCTL 1A3RH 2D0GA 1M03A 1G0XA 1CXEA 4H26A 1UYWH 2VDPL 3AXLB 4OF0A 4PJHF 4KKCD 1XR9B 4NKIL 4BSWA 2FO1A 1NCBH 3O3DB 3REWB 3NBNA 5J12B 4APQA 4AIOA 4HULB 1NP2A 3NTCL 1NCCL 2PW2A 1HHKA 4LARL 3TONA 4KRMB 3KNBB 2GAZB 3POHA 3AVEA 3MRMB 5JBEA 4CMHC 2QQLL 4OFPA 4RMTA 5GS1B 1RMFL 4MQXC 1E4WL 4M7ZB 4LNVA 4Z2IA 3VTRA 4P5TB 3ZL4H 1BM3H 1KEML 3BZ4B 1NBZA 2P4AB 5DO2D 3V7MA 5J6HB 3HLAB 3MXWL 1OAZL 1G9NL 5EORH 3VXSE 3QOKA 3HMXL 4OF7A 4OZFA 4WENB 3O2VL 2ZUXA 5HHVL 3U7VA 2DYPB 3AFBA 3UG4A 3GI9L 3RX7A 1I1AA 4BQ9A 5GIRA 4J3TA 4HG4J 2YPKA 4X5LA 4OCRH 5A69A 3VRLE 2F5AL 3SBWC 4UT7H 5FV1L 3QUXC 2A3AA 1IGCH 4PP1D 1IGTB 5LBSH 4DUWA 3OXRA 3V4UH 5JPNA 4GG6B 4L3EE 4TN9A 4OZGB 5CSGA 3NN8B 4O9HH 2OM5A 5BRZD 1X5LA 3QXVA 2V3FA 4JFSA 5F7EH 2FBJH 3RUGB 1G6RH 1U2CA 5E56A 4LVOC 1OW0C 2I5YL 4HZLA 3QDMD 3TBWA 3MRNB 4F9DA 3U4EB 3CC5B 3DX7B 3CDFA 2BXYA 4P49A 1MAJA 4OCSH 3D48R 1BQHG 4RIRB 2XTJD 1V6XA 1KPUB 3FB8B 1IGFH 5FXCH 3NCMA 1LEIB 4PJHA 2NY1C 4NZTH 4PJBF 1XF2A 4LLQA 3TO2B 4PS4H 1TMQA 1IM9A 3IU3B 1KFAL 3KPSD 4KZEL 4ZUUB 5TF1L 4Y5XA 1IVLA 5HI4D 4V2XA 1JWUB 3ARTA 1MFUA 4ELMA 1NGQH 3ARGC 5IW3A 4RGOL 4HFWA 3LRHA 5DD5L 1RH9A 2J77A 4LDOB 2X42A 1Q72L 1WZAA 4QWWC 3CMOH 1I7RB 5TDOB 4X7SL 1UM4L 4FQ2L 1V0NA 4LCUB 2VWEE 3VIMA 4OZFH 3GSRB 5E6YA 2B0SL 1X6NA 3OG6B 3GSOB 4O00A 3GM0A 5FA4A 3DV4A 1TQCB 1WZLA 2HT3D 2ZSVB 1P1ZB 4HUXA 5T1LA 2FIKA 4NKOB 4XB8A 2IQAB 3PZNA 5EFIA 4PTUB 2YZ1A 4ZTOL 3PWPE 2YD9A 4QT5B 1FL3A 2EYSB 3SGDH 2PO6B 1WGOA 4YFLF 3RZCA 1MI5E 1A1NA 3PWLA 5GSVB 3WF0A 4NHCH 4ZO9A 1EDTA 4J2XA 2E8ZA 2ICCA 3N1AA 5IROA 2HN7A 3V6ZA 2LTQB 4K71B 5LGJA 1YNLH 3VRIA 2D3VA 2EDDA 3NCOA 3QDAA 3WF3A 1A21A 3FAXA 2AABH 3BKJH 2EPKX 1OAYL 3U36A 5F6IC 3MRLA 3T2OA 1OP5K 5CEZD 5I0DA 5IB5B 4G6AC 5SWQB 4YGVB 1KIUA 2WB5A 1IC4H 4ZUSA 4PJBA 4W89A 2CKBA 1VJSA 5K9OB 3WH6A 4Y4HD 3RWDB 2VZ3A 1HJXA 1UWUA 4P3CL 5KW9L 1ED3A 2HG5B 3IYLW 2JJWA 1AVAA 3G04B 4HFUL 3A6OA 1ZHKB 4R7DB 4Z7NF 3RDKA 3KPPB 2DICA 2PXYD 2FX9H 4N0YL 4L4VA 1ZBCA 1FL5A 3DUSA 2QV4A 2D7NA 1LG2A 5F7DB 4GW5A 5D96B 4UQEA 2P43B 1H2JA 4ETQB 4YLQT 4JKPH 1S7TA 3BXWA 3GSVA 5I19L 2JJTC 5KAQF 1T2JA 5E4EB 3L6FA 2BSSB 5SV4A 4BFIA 1D5MA 1UQSA 1NPUA 1AP2B 3CFJA 1RPKA 3F5WA 1GOGA 1YNTA 3TJHC 3MOQA 4KROD 3DX9A 4ZS7H 3V0AC 2X1OA 3PNWA 4XPBL 1YECL 2KPNA 2E7MA 3G08B 1N4XH 3LRSA 4N42A 1E6QM 2EDHA 5EU5A 3LSOB 1NFDE 2FATL 1D5XB 5F8QC 2XIBA 3KJ6L 4TSAL 5EZLB 3QEUB 3FQWA 1QQDA 1SQ2N 2OSYA 1HHHB 4GZJA 3CUGA 4GZIA 4DW2L 5EBWA 4LEXH 4XI5C 4JO1H 1INQA 2JIWA 1T1XB 4LF3A 5E7FA 5E4IA 4QLLA 4NRXB 4LLDA 5DJ0A 1S9KC 3A6CH 4LIQL 1NKOA 1OIFA 5DRXB 4PUBH 4L9DA 2DDXA 1JHKL 1Y0LB 4OV6F 4Z78B 2PR4H 5HHXH 4NQCB 2B5IC 5SWSB 3QIUB 1K8IB 1H0DA 5KZCD 4LDLB 1V02E 3G6MA 2B8OT 3UP1A 1A22B 2CKBH 3IXAA 5E94A 2CPUA 4JFDA 4P46D 3WUWA 1T0MB 2IPTL 2UZXB 3P9MB 2KQNA 3QG7L 2E6PA 3MCLH 4LCCA 4JGMA 3DETC 1DEEA 3UTOA 4ORGA 5IVXE 5EN2A 3DRTB 5JQHC 4NRRA 1US3A 2WXDM 4K23H 4MXWH 4LVHC 4HBCL 4LDEB 2ID5A 3O9WC 5GJTH 3L3HA 5A3IC 5F8RC 3IU4H 4QAWA 4UB0L 1JPFA 3VKKA 3WKMH 3SUTA 3MLTA 2Y7QA 2DBJA 3IDXL 4D0BA 3CZFA 1U6AH 4ZDHB 4X80L 4OZHF 1FSKC 4F7EA 4NBYB 1URLA 5DMJB 5GGQH 1B3WA 2XYLA 1R3LB 5INCA 3FW6A 2D49A 1OGGA 5FKPA 1WWWX 1INDH 3GMOA 1A3QA 3IB4A 3UDWC 1X4ZA 1BFSA 1HH9B 4YC2B 1MUJA 5A2FA 3V5DB 3WL9B 5H94A 4WK9A 2K9UA 2DM4A 4ZFOB 3RJDA 5T3XL 5CJXA 3IANA 2C4FU 35C8H 1HCVA 1EZVY 5BS0D 1C91A 4P5KA 3RI5K 3TIDA 5JZ7C 1W0YT 4ZNEA 1NLBL 4N0CD 3SDXB 3CH9A 1G9MC 4KJWD 4XBEH 3VXMA 2ZOLA 2D9CA 5IFAL 4RWYL 4G5ZH 5FO8A 1HEZA 2B7DT 3D2UD 4GKOA 3H2WA 4XX1E 5HHOA 3U46B 2C5DC 4HD9A 3O3AA 1M6OB 4M48H 4C56A 4MX7B 4MJ4A 4OZOA 5E8DL 2HT4C 2X89D 3VWKA 4IIQB 2H8PA 3OKNB 4JCLA 3IDIA 2E7LC 1R8LA 3PWNA 4WHTB 3S35L 4F33B 5I15L 1IC1A 1ES0B 3CUPB 1U3HC 2DM3A 2HTKC 1UD5A 4CGTA 4OZFG 3MANA 1OAKL 4JHZA 3AZSA 2MMXA 4FTVE 5DMYA 4NKDB 2XN9D 3D3VD 3PGDB 4JPWL 3CO4A 1UB6B 4HCRA 1YN6A 5IBUB 4AMCA 4EN3D 4ZENA 4NO2B 2EPOA 1L9NA 4MNGA 4WY7L 4QXUH 2DS4A 4YHZL 4YHNB 5IK3B 4OZHA 1S9WA 3HUJE 1XHGA 5EOTB 3OKLB 5JOPE 2A0LD 2UZIL 3QGVA 1J1PH 4S2SA 3U9PL 3O4LB 5D7LE 3VD5A 2WLYA 4D6FA 4CN1A 5DJDA 3W0WE 3MUZ1 3H3BC 2YSSB 5GGSB 5GJSL 4D0DB 3PN8A 1UKTA 3MJ7A 4FMFA 4RA3A 4HXAL 4U6TA 3VGHA 4ZQKB 3ALPA 1FL6A 2P8LB 3C5SA 4QOKB 3TBVB 4FFYL 1JD9A 1NCNA 2VURA 1YEFH 3VGDA 4F15C 2C3VB 1ZLSL 4XHJC 4JDZA 5I1JH 3EDFA 4LASH 4LHUG 3WNKA 4AG4L 3KZSA 3OG4B 1RK1A 2A9NL 5JOFB 4MA1B 3F6IA 4R4BB 1KTLA 2P5ED 4HIIB 5KN5A 3MJ8B 1UD4A 1FGNL 4HIJA 4KI5D 1MJUL 1R5WA 4TUKH 4FQIH 4MA7L 1UCBL 5D72H 1BF8A 3O8XD 3MCKB 4I2XE 2ICEA 5EUKB 2ZOKA 1QI4A 3O6FB 4Y19E 1UD3A 1VGKB 1NGWA 2W9EH 2OTUA 2HRPL 1PBGA 2B2XL 4HJ0C 1XH2A 3T2NH 3HE6D 3K81A 1J1XH 1AE6L 2HJKA 1FCGA 1MPAH 1CK0H 1BVKA 1OSPL 2OMNA 1AI1L 5D1QA 3UTTE 5A6LA 2DWDA 5EOCH 3PV6A 1F3DH 1YJDH 4AEHL 4A2LA 2Q76A 3VXSB 5CCKH 4GO9A 1VERA 1JF1B 3ARBB 5FKYA 4LLYB 4WTWA 4AT6A 3SQOH 1EGZA 4M1DL 5BWFA 3L4VA 3UYRH 3R4DA 4PTMA 1NGPH 3EZJB 5DC0A 4ZS6D 2BHYA 5C09E 1CS6A 1J86A 4B16A 1YPZA 3CFDB 3RVUC 3LN4A 3OPZH 1WSST 3GI8L 5I79A 4Z2LA 4QXGL 4OQ1A 3P0VH 4J28A 4L3EB 1Q94A 3T3MF 1NOFA 2W61A 4L3AA 4Q2ZB 3BE1H 5I6XB 1SVZA 3U7BA 4K3DL 1RJCA 4CJ1A 5EU3B 8A3HA 2L7UA 4PMQA 1ZV5A 2HMIC 4WU7B 4JFYA 3I2CL 4YO0A 4GI6A 4JRYE 1BZ7B 1JBJA 1R3HA 3GSNA 4IJ3C 5FUZL 4XNXH 1TZGL 3II1A 5C0AA 3Q1SH 3RWFB 1U3YA 4XMKH 1R85A 1XIWB 4BUHA 1U30A 5KBNC 2YUWA 5GRZA 4PJCE 1RZ8A 3VH8B 5KVFL 4QP0A 1OB1A 4FFWC 1I7TB 4B7IA 1A3LH 3OL2A 5C6PB 4XNMB 3EFFA 5BXFA 5B38B 1T20B 5ESVB 2DF3A 4Y4HA 2JELL 2C4FT 4Q0XH 1XGUB 3VRJA 4KDTC 3WFEL 4LPCA 2YR3A 3IJ7A 2WM0A 4UINL 5IGXH 5ANME 3WO4C 2PXYA 4K9EH 3TPKA 1SYVA 2UWFA 4NM8L 5CHNA 4H04A 2A6JB 5DEZA 3C2AL 1KCVL 4P2QD 3U7WH 1OWQA 3OJMB 4HIEB 2VXVL 4AENA 5FHAH 5F71A 2DQGH 1JYWA 3TN0C 3GBLA 2E6QA 4FABH 4P4KC 3ZKXB 1BBJB 4GKNB 5EA0L 1XH3A 2VITA 4HGWB 4UNVA 3PWPB 1HJWA 4DTGH 1JFXA 4FQXC 1VFAB 4LSQH 5I1EH 5I1LB 5SX4I 3P3YA 3QUZC 3G5XB 1UH2A 1UWQA 2AQ2A 3KJ4C 1ADQL 2X9YA 1U2YA 3TFKC 2FB4L 5IW1B 3RPKA 4CD4A 4BUGA 2XA3A 3WSUA 4NQDA 5IMOA 3QIBC 2R0LH 2XXCB 3HKFA 4D9RD 4Z7OE 4ODWA 5KVEH 5L6YH 4OKDA 3WD0A 4W5ZA 3WUWG 7FABH 2CLRB 3GRWL 3GSNH 3GXDA 4BELD 1EO7A 3RIKA 4KRLB 4AWEA 3RIAF 5A6JA 2DWEB 3X13B 3TPUA 5JIHA 1WCBA 5CEZH 2WZIA 4J3VA 1LK2A 2EEAA 5T1KD 4PRIA 2X9XA 3WIJA 4F79A 1YMME 4MMXC 1CDIA 4TYUA 3CZJA 3G6AA 1PKQB 3ESVF 2NY0D 2JJVA 2PBOA 1BHGA 5KAQG 3TCXA 3IFPA 4PJ8D 5F7NC 2ATPA 4G42B 3NUKA 4YQXH 4P48A 1NC2A 2GJ6D 5ENWA 3OXSA 1CE6B 4ZMAT 1LDSA 5E70A 4D0CB 1EBPA 1U8LB 4NNXA 3W27A 3GNOA 1WTGT 3KL0A 5HI5C 1A6WH 2HISA 4ODHL 3B9KD 3L95A 3IJHB 1JXJA 1BD2D 2NXZB 5CJOL 5C0RH 4UTFA 5EU4A 1QRND 1G7HB 4M03A 2QL1A 3RWCB 5JBFA 4F9LC 4Y2DA 4Q6YA 4YXHL 3UBXB 4Y5VC 1MJ8H 5D1ZC 1EXUA 1NFDB 3DX6B 3ALXA 4OLWH 4ODVH 2DQDH 4WW1B 4M82A 5EU6D 4D9QD 2PTTB 3CSPA 4IMKC 5HYEA 2WV3A 2PI6A 1W3JA 1GC1C 3U7YL 3CU1A 3GMPA 4JKMA 1TCRB 4NQVB 3K0WA 4IRSB 4TOYH 1I8MB 1NARA 2BMKA 1MH5A 5BS0A 1F8TH 1SJXA 4FZEL 4OIAA 4M1RA 1CLOL 1MLBA 4PLNC 4HJGA 5JW5B 5FB8B 1F6LL 3KYMA 5D9SB 5CBEB 5GS0C 3IGAB 5K93A 5J89A 2IH3B 3W24A 5GGVH 5FUCE 4P3DA 3W4RA 4ODUB 4I48A 4UTBL 2WCGA 2XRAH 3RVVC 1G7QA 4GKSB 5TDPB 3BMVA 2XPKA 4KI5F 2DTMH 1OAQL 1S7SB 1M7DB 2JIXD 3D0VA 3MBED 3MLPA 5C8JA 5IVXB 3Q6FB 1AR2A 2LABA 4R90H 4Y16B 1UXSB 3QI9B 2WBJA 4JREB 4QRUA 2Z31D 1R5VA 2XQBH 2YPLD 1IARB 3O9WD 4MZ2A 4JQXC 4EXPX 5BJTA 3QUKB 3BSZH 4X4XA 4PY7A 2A1WH 1W9BM 3M46A 3D25B 4P9HL 3VWJB 3VXOB 4OB5L 1QBLL 4PJAF 3HG1D 1CBVL 3EYQD 1BJMA 1UQYA 4CKQA 4HS8L 1N5YH 3OJVC 1MCEA 1RZKH 4RE2A 4A4AA 3Q5YA 5FYLD 1TNNA 2ADFL 2FDBP 1P7QA 2HYMA 4PRHA 5D71L 4EIZC 4EVNB 3BJLA 4HGMA 3BP7B 1KELL 1TLKA 3P11L 4OLZL 2YA1A 3CUHA 2FGWL 3JV4B 43C9A 5GRUH 4G3YL 5KVDL 5DZLA 3MV7E 3NH7L 1AC6A 4KAQL 1FAIL 2XZQH 5FA3B 1A02N 1FNEA 1VFFA 3TTQA 4HS3B 2X4TB 2X4SB 4JO2H 4M02A 1IT0A 2C1OA 3FHQA 4PJ5D 5EBMA 4GAJL 4ERSL 2E9BA 4UT9H 1FG2A 3LN5B 3OKYA 3KPRA 1R3IL 2F58H 3WIHA 4RFOL 5HYQA 3PL6C 5ABEA 3MA9H 1OINA 2Q1EA 3X11B 3C6SB 2YBRB 3FT2A 2B1HL 3ULUL 2O5ZL 5TQ0H 2WVUA 1U3JA 2DM7A 3VXRA 5MERA 4PRBB 3O8XA 3ILPA 4GBXB 2H9GA 4UBDC 4OLEA 5IMMB 4C7GA 2VQ1A 2W0LA 4OT1H 1AIFB 1H5VA 3W29A 3LEVH 4Y4KB 1WLHA 1NMAH 1B0GA 1DWHM 4I0PB 3RWGB 4E5XA 4FTVB 1E73M 5DYOB 4YHGA 1AO7A 5IV2A 3FO1A 3WMSA 1E4KC 4PJAA 4TVDA 3MRBB 3QO0B 3RRQA 1QSEE 3ARPA 3SCMC 4G6MH 3EOAA 3BPNB 5DJ6A 3BD4A 1LO3H 2EH7H 3U2SA 2HLAA 3DTXA 3HUJB 4Q6IB 4TULL 4F37F 3W6LA 4X7CC 3S97C 2VH5H 2CIIB 2GJRA 3BW9A 2CMRL 2EKJA 1JHLH 1IEBB 5D7LB 4FQ1H 3O41A 3W0WB 1FH5L 1KCUH 2CBIA 2Z4QB 3SBWA 3UBXI 4AZGA 3L5HA 1EVTC 1FNSH 3QUXA 4HK3N 5CZKA 5I17B 3GMMA 2MCG1 3UZVB 3L2MA 4NIKB 1UZ8B 2G3NA 2OSLB 2A6IB 1JV5A 4AZCB 2HLFD 3W2DH 2NSXA 4XHJD 2IMNA 5C0EA 4GJTB 3W82A 1EMTL 4XCEA 2CKSA 3ECQA 1MFBL 4PMYA 4PV8A 5GS1C 3BXNB 4HOXA 4AYSA 3ARDC 3EFDL 4MAUH 3M7SA 2NZ9C 4P5TC 4U1NA 3WIHH 3AS1A 1R87A 1GGBH 2VC2L 5GNXA 1PG7X 3ZJ8A 4I2XB 4LCYA 4P59L 3MRDB 2GJZB 2RCSL 1NGYA 3UCRA 4NCC2 3FY1A 4HXBH 4PCSA 1BFVH 1AGCB 4MD5A 1WDQA 2I07B 3D85D 3PXJA 3OX8B 4X4ME 1JF5A 4UZGA 5K59E 15C8L 1RSFA 3PG2A 1CLZL 3THML 2DBLH 5HGAA 1LP9E 2XA8L 3UTTB 1E4LA 2XZCH 4MSWB 4D3CH 4WO4C 4NGHL 3HR6A 2AK4E 3ARGA 1RFDH 3DVGA 3PABA 5DD6A 5C0GB 2E27L 4X99B 1YMHA 1YC7A 2J6EA 3NIYA 1ZVSA 2DT2A 4DN3H 3OGCB 1YEEH 2ADIB 1WWAX 3QULB 3HZKA 3PP4H 3ETBF 1XMWA 3MJ6A 3DYPA 5C09B 1HH6B 2HVJA 2VXUH 1QLEL 3LKQA 3RVXC 2UY3A 4C7FA 4HTYA 3DIFA 4YHPA 5DT1H 4WHCA 3BI9X 5I74B 4UAOC 4TX6A 2WLZA 1KJ2A 1ISZA 4XNUH 3WHXB 3HC4L 2EE2A 4U6VH 1EO8L 5DA0B 1QNPA 4RGND 4U1LA 3C6LC 2IAND 1B4JH 3U0TB 5E5UB 1FBIH 3VNZA 4IMLB 1QNZH 1CQYA 4F57L 1NC4B 2FD6L 1KF9B 4JRYB 4BKLA 2QLVB 2XJ7A 4M5ZH 4YBQD 5IG7B 3S36X 3CAFA 1L0YA 2G9HB 1XCQB 3FMGH 1RUMH 1FO0H 3DXAD 3QUYD 5F9WC 2Q7YA 2NX5A 5F3BB 4PJCB 4XAWL 5ILTH 1CD9B 4L3CA 1OHQA 1GGCL 3BDYL 4UMGA 3JTSB 4Y1AA 1DL7L 4RAUB 1EJOL 3MRKA 5D2LE 4TSBL 1UR2A 2UZYB 1F11A 5ANMB 2XFRA 2EC9T 4M7KL 1HZHH 3KLAA 5D6DA 3MCG1 5TDNB 1KCKA 1GRWA 3PHOA 5I9QC 4NUJA 4M1CD 3MRHB 5MEOA 4PJ8A 3QEGH 2KUTA 2WIIB 4W70A 1ZA6B 3HI1B 2FBOJ 4WDIA 4YUEH 3ZOAA 4NWTL 4FG6C 4AEEA 2JJTA 5E2VH 2NXYB 3O2DL 1ZA3A 2VR5A 3L4UA 1MCDA 4EJ1C 1QNOA 1G0YR 4YEEA 4AK1A 1BD2A 3TNNA 1NOUA 1T5XA 4RMRA 4YWGL 5TQ2L 4YDIL 4JVUA 5IJVA 3ZKMD 1QRNA 2QHRL 1KJ2H 1CDJA 1PX3A 5GISL 4KKAC 1P6AB 5D2NC 3DX8B 3BP5B 3RVWC 1A47A 2Y24A 2VXSH 4NOFA 2WVTA 4XP6H 4LPTA 3NSXA 1JZ8A 2F53A 1RJLB 3QG6B 2X40A 1A8JH 1JWMA 1VAHA 1KLGA 3S4SG 4QGTA 4XBPB 3VXTA 1SMDA 1DBBH 4K94C 2VCCA 1UGNA 2W91A 4E0RA 5JHDE 3MV9E 2P8MB 2YEZB 2OZ4L 4MWFB 5T1DL 1UCTA 4TRPL 1RUAL 1ZT4B 1S8DA 3D69A 3RVTD 4M4PA 3IDYB 4NT6B 2J8UB 4H7VA 1CFQA 1DANT 3QCVL 1WBZA 2W38A 4KXZH 2OR9L 2R2BA 3LQZB 2J7BA 1JE6A 5DJCB 5I24A 5EU7E 1G5AA 2CIKA 2AJSH 1WDSA 2JIXA 1QW8A 4JM2D 3VFUA 1IC5L 3D9AL 2CUIA 2WCAA 2CDEA 2DQHL 4LLMA 2FZ3A 4UI2A 4D6GA 2MQCA 5IQ7L 3O9WA 3MRJA 4KHXL 2PF6A 3A4XA 3KWXA 1DVFB 5LGHL 4HG4K 1XGZA 4JG0L 1EGJL 3GIVB 1X7QA 3HC3L 3PGFH 2DQCH 3D39E 3LD8B 4KRPC 3NZHL 1UA7A 2EE9A 4FXLA 3HG1A 4BM7A 3T0DA 4L5FL 3WNMA 4V2CB 5B22A 2JF7A 2OL3L 4OCWL 3QPQD 2VL4A 5D1ZD 4KMQA 4W4OC 3BAKA 4Z95L 5CD5D 5D5ME 2DN7A 3W5NA 5A2KH 3UDWA 2GK1B 1ECEA 1LNUB 4JFOB 2QSQA 1DBKH 3OZPA 1I7ZB 3S37L 1SJHB 4PGZA 4OKVB 2Q8AH 1KJVB 4ZD3H 2Z35B 1DQQA 5ESQB 4OV5A 1DQML 4LSPH 4ELME 43CAB 3VA6A 4LLWB 4Z7WB 4F80A 3U6RB 2ZWLT 1RAMA 2DQEH 1FH9A 1VBUA 2BOBA 2NY2D 3V4PH 1MEXL 3QCUL 4X9FA 4OM0H 4O58H 4KZDL 5HVHB 1CFBA 1IT9H 5TE6H 5EOCJ 3LB6C 4CU7A 1U8IB 3AU1A 5FCSH 4UTAL 3GSXB 1DWJM 4QRRE 4XPHL 1F3DJ 4ZAKD 2HJLA 3EO0A 3WS6C 3IFLL 4PRPB 1N0XL 1QEWB 3KYKH 1AR1C 3DRQA 3EZ8A 4YHYB 1S9VA 4KY1H 3T4YB 3IDGA 3RHWK 1FN4B 1TR1A 3HI6L 1IGYA 1XF4B 3WSQH 1Q4NX 5LKNA 4S1DD 2DT1A 4H0IA 1QA9B 3HNSH 4U1SB 5BROA 3WBDA 4GOSA 3MREA 3W9DB 4H41A 3TO4D 2PYFB 2JB5H 1H1NA 3FQUB 5FYJL 4XPAH 2CRYA 5T33H 4NC0B 5C0IB 3CHEA 3HN3A 2BHUA 4MNJA 1PKOA 5MI0B 4AIEA 4LAQH 3UZEA 1XGTB