4HMEA

Crystal structure of cold-adapted chitinase from moritella marina with a reaction product - nag2
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
b'GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmeA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmeA01
1YQ2A 2IH1A 2OYPA 3RY5A 1IM9B 4WV1C 4U1GC 4X4MA 4RAVB 3MBXH 2E7BA 3WD2A 5T3ZE 4KJYA 5IW6A 3VFNB 2A6DA 3MRDA 4G8GB 3TCXA 1EDGA 4UOW0 2X1PA 1W72L 1YQVH 2X42A 1G94A 4X6DF 3NPSC 2HYMA 2XPGB 1JD9A 5IB2B 1CLYL 2UWEF 3QO1A 4K7PY 2WCGA 3WMCA 3I3BA 1DBAL 2C4FT 4FQQA 1UENA 5CEZH 2BSRB 1NLDL 2JJSA 3AIQA 1SMAA 1A8JH 1D6VH 2UY6A 4WGWB 5JLZB 4H1LA 3CLWA 3V4VH 2W65B 1DBML 1E43A 2L4OA 2BNRE 2R2EB 5DVLA 1MCKA 4ELKA 4LVEA 5CCKH 2GUOA 4BH8B 2MQ3A 5HPMA 5EU6B 4NWUH 4QXTA 3MGTA 3GO1L 4OCXH 4P23B 1S7WA 3FO2A 4MPKA 4W8LA 4EOWL 3N1AA 2NTFA 3SBWC 3ZKNC 1RJYB 2VLLA 4P46C 1KXVA 4F7TB 3X12A 5I1EH 3GB7B 5IIEB 4WJXA 5FOJA 2OWXA 1XIWB 2J8OA 2OM5A 4HGKC 4XAKE 4OIAA 2GSGB 3C8HA 2HVKA 4ZUUB 4K2UL 4Z7VF 4M29A 3MRRB 4JAWA 4N1EA 5HDOA 3OKLB 3N15A 2IMNA 4HS8H 4R2GB 2FATH 1V7ML 1QVOA 5IOPB 3TC9A 3RZWA 4IRSA 4OB5L 1KFWA 1WJ3A 1VEPA 2CD0A 5IBLD 3KE0A 1BOGA 1BD2A 3SCMA 2YD7A 4P7OA 1W3HA 4U3CA 4I77L 1C91A 5JQ6L 2EDNA 3H0TB 3ZJ6A 4QCEA 1JNNH 2ADJB 4F7CA 4U7MA 1UC6A 1A7BA 3TTQA 5GS1B 3FTGA 3MNVA 1ODAA 2A73B 3G5VA 3LRGA 1BYAA 4M81A 5ABDE 3VXMA 4LKCA 3SJVE 3KLDA 1A7OL 3VD9A 3A4XA 2C7UB 5GNXA 4IRSD 4WNQB 3OG6B 3SKJH 1KBBA 1R3LB 3IAGC 2CPUA 1Q94B 5ADPH 4TOQA 5DRWB 1BD2D 3SCMD 4LLAA 4X8JB 4RDQG 3QB7C 4NBXB 1CFNB 4L4TE 4AIZA 4X80L 3FW6A 4PJDB 3THMH 4MNLA 2RB8A 4KUZL 4M4PA 5I30L 5E00B 4A6YB 4UTAH 3ORJA 1DQDL 5C0BA 3RU8L 2EXOA 1IM3B 3EJYD 3VXMD 1NKRA 1CE6B 3UTZA 4HGWA 1JGEA 4HG4J 1B0IA 4APQB 3CUPB 3D18A 3ZMRA 1DWJM 4P5MB 1KFAL 4G3YH 4QF1A 1QPXA 1MFBH 3OQ3B 4G9DB 5CZXD 1LEGA 1A3RH 4JANB 2H2SC 2BMKA 1T80A 3FONB 3HZVB 2VLKE 4OLXH 3SUTA 3MBEA 4Z0BL 4JY4B 3EUUA 3OB8A 5C08E 3MSGA 1V6UA 4WU5A 3PHQB 3GZKA 4JY6A 5DT1L 2HTKC 1FDLH 1MAML 1G0XA 1B0WA 4ZYKB 1B4JH 5C0BD 5T3ZH 1FL6A 3K4ZA 3RUGA 3GUTB 5EUOB 4PJXA 4G6FB 3DNKA 1OT2A 2ZOLB 1RUML 4DAGL 3WENA 1IGCH 1IM9A 2QHRL 2NXZD 3UPRA 1W0VA 2GDUA 5J6HB 3KPNA 4RAVA 5CJ5A 1U8JB 1NBZA 3EYQD 1V03A 3TONA 2HLFC 3IJ9A 3D25B 3MBED 4P2YA 4RISL 3VFNA 4FQCH 2EEBA 3M8OH 1TTGA 4KK8C 4Z6AT 1WK0A 3WQ4A 5ESAA 4HIJB 4K9EH 4E0RB 1NMBL 5CJ8A 1GGBH 3NDYA 1ZJBA 2X4SB 2VX7A 2A3EA 5FM8A 2AOSA 3OGOE 4MLIA 2R1WA 1LQ0A 4D72A 5IFJA 1Y6MR 1IM9D 1A7NH 5HYSG 1GORA 2MQCA 1QSVA 4E8DA 5D2NA 4JN1L 2BSRA 5IMKB 4M1GH 2JEQA 2V38A 4TX8A 3UYOD 5FL0A 4X7SL 1X6NA 4OCYL 4UUJB 1AGCA 4JHOA 1FCCA 2R2EA 3SQOH 2X4TA 2DSWA 2R0WL 5HD8C 2F58L 4MNQE 4N9OB 1HL8A 2VERN 4UQBA 5EU6A 1S46A 3GRWH 2CBVA 4PGDA 2R8SL 4QLKA 3EGSB 5J11B 1NCCL 1RJYA 3VMOA 3T1FB 4CN1A 2CYGA 4PBVC 5IMMB 1HP4A 4LHUG 3UBXG 1SM3L 3IF1A 1NCBL 1I7TB 2J4GA 3CUFA 5MEPA 2ZKHH 2WSPA 3LS4L 1H5BB 4RMVA 3UG5A 5EU6D 1I8LA 1WAWA 2BY3A 1JZ5A 5A6JA 2PYEB 4XMKL 1UWUA 1WB0A 4XBEL 3QDGE 5DA0B 5HI4D 4DQOH 5C0AB 1W3JA 3FQWA 1A7RH 2XWTB 1XGUB 1QNPA 1QBMH 3RPIB 1F2QA 2ADJA 1J0KA 2CMRL 4Y4FC 2DM7A 3WKML 1BEYL 3EHBC 1IC4L 5E9DB 2J88L 3PGDA 3CSPA 4UILH 5TDOA 3FZUD 5HHPB 3W24A 5L2KE 2W0FA 2CKRA 1FZKA 2C7UA 3W37A 2QSVA 1I1WA 2HTLC 1R3LA 2F53A 3V2AR 4BSVA 1Q94A 1C93A 5DRWA 2BZDA 4JFQA 3SO3C 4J27A 2NZ9C 2P8LB 2EKSA 5BVJA 3PGCB 4U1IA 4H25A 4XNZC 3G9AB 3WO4B 4NQXB 1MIML 3DVIA 3WF0A 4M7KH 2WYSA 2EC9U 5CSZA 1OB0A 4APQA 4JFDE 2GCYA 3DMMC 2O5YL 5DJ6B 1T7XA 4U7SA 2F53D 1FH9A 3SUUA 3DX9B 5I1JH 3H8NA 1DN2A 3FT4B 3L3JA 4ALAL 1QLRA 4FFWC 5ID1B 1KR1A 5LA1A 1XF4B 4NUJB 4JN2A 4LMQE 1CS6A 4RWYH 4UTBH 4ZYKA 1WC7B 4GW5B 1IFHL 3NZHL 5KS9E 2Z91A 4NZUL 5EUOA 4APQD 1CFSA 2OJZL 1AQ0A 1EOKA 1WAAF 3NFNB 1T6WA 2D03L 3LMJH 4FP8H 2NTSP 2FWOB 4NN6C 1FC2D 3OKMA 2BXYA 2J74A 3CPUA 1S9XA 1U8KB 2XWBB 4LRNL 4PJBF 4K3DL 4OZHF 2WHKA 1S7QA 3D25A 3QNZA 2ZUSA 2V7HA 3BAKA 1PQZB 3ZJKA 2VWEC 4PRPE 4HIJA 15C8L 1XV8A 4KRMB 1TJHL 4TVPE 3ARFA 3ESVF 3QZWB 5DC4B 4UQCA 4M61B 5K9KA 4H20L 2MSPA 2PW1A 1UWRA 3VFRB 3ZYIA 4KZEH 3V4UL 3KYOA 3BLPX 1MQQA 4BH7A 1QFUH 5IMKA 4S0SD 3TBTA 1FNEA 4HUUB 5HDQH 4CVUA 2ZWYA 2DLFL 4H5SA 4G6AD 4RGOH 2OYMA 1AFVH 1U8LA 4ZFGL 1BP3B 1T3FA 5FUCE 3WL1A 2HN7B 5T1KB 1GJUA 5GNZA 4JQXC 3CX5J 2X4RA 1M7IA 3ARFD 5SX5H 3EJZC 1J0JA 5CEZD 3EGSA 3MBXL 3U2SB 1I1XA 2OWCA 4N8VA 1NFDB 2A77L 3ILPA 5DQJB 4UT9H 4Y88A 3SDXA 2ZCHL 2QMKA 5DK2A 4JFXB 1WBXA 5FF6A 4GQPH 4DKAA 3KXFA 3FY1A 4LEXL 2B2XL 1R0AH 3MMEA 2ZCLH 2FZ3A 4WW1B 2E7CA 4Q6YA 2OYKA 4Z7UE 1HKMA 1LE9A 3NH7H 1T83C 4LVNB 3W11D 1HDMA 3ULVC 3NTCH 4S2SB 3K8MA 3OPZL 3F5WA 5IESH 1KC5L 1KCLA 1WT5C 4KAQH 1BIIA 1U8MB 4XBPA 5F9AC 5SV3A 3SJVB 5I15H 4C7FA 3IJHA 2QBWA 2A9MH 4PD4J 3WV0A 4ELMF 4PMXA 4XCCH 1OD9A 3JWOH 5EMYA 2LAGB 1JZ7A 1HH6B 3S88H 4KRLB 3V0AC 3BAEL 1YEIL 3KXFD 3V0VB 5CCKL 1A1OB 5ILTH 3MUIA 2NPLX 4L4TB 3GGWB 1R3JA 4NWUL 4JL1A 1K9EA 1N5YH 5HHPA 1JPST 1T89C 3ARRA 3WE6B 2YD4A 1F4XL 4U49A 3UESA 1DEEB 1PZ3A 5IB4B 4UMGA 2J79A 4PJ5E 4G9FA 5GS0H 3VGGA 4XPBH 3BSGA 5GRVK 3PABA 4EI5C 1CXIA 2AJXH 4LEOB 1V7NL 3HC0B 2DRUA 4NQXA 5C08B 4M8QA 4PGEB 4HXAH 5DR5H 1B1YA 4HULB 5DJ6A 3RIAF 3EO0B 4PSPA 4XB8A 1HH9A 3WIIL 4DTGL 4G9FD 5IFAH 3OLGA 1GOMA 1LO4L 2XKNA 3HLAB 3FT4A 5ID1A 4H0IA 4P8VA 3L5WA 4NUJA 3D2UA 2VDML 1FNAA 4OFVA 3VM7A 2IANE 4IM4A 1WC7A 3WIHH 4XZWA 3X13A 1T2JA 1NAMH 2D31A 5I1CH 4YHMH 2CLRB 4HX1A 5ADPL 1BQUA 2NY3C 1BF2A 2FWOA 2QLVB 5DS8A 3OKKB 4MCZB 3VI3F 4OQTL 2VXTH 3BD4A 1U8IA 3ZE1E 5BZDB 4TVPH 1E1FA 3THML 4NKDA 4H88L 3DGGB 3CXDL 3RY4A 2EECA 3REVB 5T3ZD 2VABA 4UTAL 3D2UD 1MI5A 1E4KC 1E6RA 8A3HA 2AKRB 2BNRA 4H8WH 1UWSA 3QZWA 2J75A 4OI8A 2BJMH 3O45B 4G3YL 3ROOB 3RWCB 4J12A 1MFBL 4MNQB 5AYQA 1W1YA 4GLRI 1NWRA 1NBQA 5AYBA 3K1KC 5DFVC 3VFRA 3VFTA 1EJOH 3KEHA 1T6VN 1YZZA 2FR4B 1RIHL 4HIXL 1CU4H 4TX6A 2BVOB 2X1XR 4R97B 2FL5A 3V7AE 2BSTA 4X4XA 2XVNA 4YEEA 4ENEC 1VACB 1RMFL 2HN7A 4O2CB 1I1YB 2BNRD 3V5HB 4U33A 1XEDA 1MJUL 3EYSH 2NR6C 5D93C 1HJWA 4F8TA 3BIKA 4XBGB 1ORSB 2VYRE 5L0QB 4Z7WE 1J12A 4TTDD 4JFXA 3L3KA 2XY2A 6TAAA 4J1UA 4MQXC 2FB4L 5AZ2L 2VX6A 1BQLH 4K9EL 2I9LA 4HF5H 3VH8G 1CFTA 3UDWA 3DUUA 4IRJC 5T1KD 4XAKD 3OKDA 4JQIH 2NY7H 4HJ0C 5FAAA 3MFGB 2MKLC 4LSUH 2VXVH 5HGGS 4GXVL 5CGYD 4HA1A 1S9VA 2Z8VC 3OKEA 3MANA 5L2KB 3SUWA 3SJVA 2Q3AA 4C7DA 4RNRA 1CLOL 2ZZUT 4AD2A 4S1RL 2Z1KA 3AMLA 2UYLB 5GGSY 3T4YA 4ODTL 4PJ8A 3PDOB 2PWHA 1S3KL 3SQOL 3DVNA 2J1KA 3BP5A 5E8OA 1OTTD 1R3IH 3GGWA 1CG9A 1A7QL 4OGXH 3UJIH 1ZB5A 2UZIL 1HHGA 2VL4A 4KFZC 3VI4E 1ETZB 4M03A 3EOAA 1E4LA 4IPNB 1C08B 4WW2A 2NY1C 5IB3B 5GGRA 3SJVD 2CDFA 2FEDD 3OB0H 3OAUL 4JFDB 5IB4A 4BFIA 3CO4A 1FC1A 2BNUA 1MFEL 4PJ8D 4PMUA 1DUZB 2DEPA 2CIPA 2PXYC 4AXNA 1HJSA 2IPKA 3I6GA 3OAYH 2ZKHL 2VLKA 2CK0H 2O61B 1A47A 3HC0A 4QTHB 1ZHLB 4TQEH 4F15C 5T5NG 1CFQA 2FBJH 1W91A 3HTLX 4OT1L 1WBZA 3NCFB 1JHLL 1B0RA 3F7YB 2NY5C 1AD9A 4ZUWA 5HDBE 4W8AA 4W6XB 1T03L 1A7RL 5F7DA 1NCAH 1QBML 3QPQC 5EZJB 2EBNA 1Y7VA 2WXDM 3HLAA 3A6OA 4F8QA 1HSBA 1YEGH 5IVXE 3QQ3B 5IQ9A 2DGAA 2VLKD 1UA6L 4WEBH 4CRPA 4G7YH 3T2NL 1BAFH 1AQKH 5C08D 4NM8H 4GH7B 1FV1B 5DF0A 4TVDA 1W1PA 1D5MB 4HXBH 3U4EA 4PRPB 3TEUA 2HJFA 2Z35B 1UR8A 1FZJA 3OKKA 5D9PA 2ZOKA 1HINH 3GMPA 4ESKA 5BZDA 2GVYA 1WEJH 3L95A 1UG9A 2DLTA 3DGGA 2JB6B 3W9EB 1CL7H 1F3RB 3KNBB 2DQCH 4K55A 4LCYB 1RIUL 2OJEA 2E6QA 4UNVA 3WF1A 2VX5A 4JHZA 4BUGA 4LDEB 5IVZB 5HYQB 2XTKA 1G0CA 3ARTA 3SE4A 5HHME 4JR9H 3HC3L 4M1DH 5D1ZA 4QCIB 3H7BB 1UH2A 4IDJH 5F6IB 4Q7NA 4GFTB 2V3EA 5D5ME 3OR6B 2H26B 1GIGH 4P4KA 1N5AA 5FA3A 4HPGA 3NSNA 2X6MA 4PREA 2EZ0D 3V6OC 2ADIA 1ZMYA 1N59A 2CUHA 3EJJX 4XH2B 3JUYA 1I1YA 4OFYA 3WD5H 5C9JA 1WUNT 4FP8L 4UCFA 3RY6A 3DO7B 3X11A 1BLNA 1D6EB 4Z7UB 5DTFA 3UTTE 3D9AH 1DBKH 5D8JH 4MB1A 2QQKL 2OCFD 3L7FB 5IFHL 2GTZB 1PY9A 3GIVB 4RQQA 3A4AA 3NIFE 2G8ZA 5DDHB 1P84K 3QDGA 5C3TA 4PS4H 4P4KD 5A43C 4LCUA 5SWSE 4MD0B 1T4KB 3G04A 5MEOA 3LB6C 3LQAC 3NN8A 3V5KB 4FMVA 3MLSL 4WI5A 1MFCH 5INDB 4D9QD 2AQ3A 2CETA 5B22A 4MA1C 3CFBB 1IEBA 5L2KA 2YPVL 2O9TA 3KLSA 2WUBL 1N2RB 4Y16C 3AHYA 4YXHL 5F70A 3IAPA 4JFHD 1FQ9C 3QDGD 1DQLL 3PUCA 4OCNC 1YNKH 3B9EA 5F44A 4JCMA 3OV6A 3SDDC 3EOTH 2AQ1A 5HBFA 5FKAA 2BSSA 4ODVH 2YSSA 1ETZA 2VDRH 3W27A 3T2QA 4JKPL 4PJEF 4AL8L 2FJFB 5L2KD 4RIRA 3RWJB 4JO3L 4FLQA 4G5ZH 5E1AB 1WE5A 5A3ID 2A6IB 1R0AL 1DUZA 1Z9SA 2ZCLL 3IETA 3HG1A 3TM6A 4GAYB 3ZHKA 3NH7L 4UZSA 1KGXA 4QTHA 3NTCL 4PJ7E 1IKNC 5IESL 1UKTA 5IQ7H 1C8YA 3ARUA 4XHQA 3QUXA 4YX2H 5JXEC 3MR9B 5FD0A 3BN9D 3VXTA 2XYLA 5AUMB 1ZS2A 2A9ML 5KS9A 2SEBB 3ECBB 4XCCL 1U3JA 3SY0B 2VLRE 5HGAB 3WELA 4EUPB 4NSKA 3VNZA 1HKFA 4JZOB 1MCWM 2IUZA 5IP4A 1KYOJ 4CVXB 3U36B 1MCFA 3HG1D 3WIHA 3BSZH 1NAMA 2CXGA 5M03A 4Q97A 3TN0A 2DQGH 1KG0A 1RZKH 1EX0A 2H2PC 1F58L 4TXEA 3QUXD 1VF8A 1JNEA 2DJUA 1WZAA 4QY8A 4N0UB 5LGJB 2YC1B 2CBUA 3EYUL 1LF1A 1CXHA 1UXWB 4QHNB 4XPBL 4XNYL 2X4UB 3QDJE 5FM4A 5EU3B 3W9EA 2F8VA 4YFEA 5C09E 5MERA 5IMOB 4HWZB 2R2HB 3I85A 4HQQH 3HUJA 3TN0D 2JJVA 2Y36L 2CRYA 1ZLWK 5HYEA 5EBAA 3RWDA 1WFUA 5EZLA 2EC9T 2QADB 3C60A 4TVPD 4QRTB 2WKLA 3U7WL 3CLEL 1PEWA 3HNSH 5FGBA 1GVYA 1QHZA 3GMQA 3IFOA 1RHHB 4HKJB 5ID0A 1SYSA 2ZSWB 4WLCA 2RGMA 2H26A 3KGRA 3V8CA 4Z7WB 4TNVK 3T0DA 5KEZA 4QAWA 1XGYL 2BOCA 4JFVA 1C12B 3G6JE 4XNXL 5FA4B 1LEKA 4YHML 1B3YA 1LG1A 2YD9A 4Z95L 4X7TB 3B2UC 3BD5A 3HNTH 4PGZA 5EZIH 4LPYA 3C60D 4X9HA 3BC9A 4Z7UA 4ODSH 5I19H 3O2DH 5HY9A 1HEZA 3EMZA 3W53A 1G9ML 5F7EH 3L7FA 4BYHA 3GBEA 3BOVA 3Q3GA 2KDGA 4KHTH 3LH2H 3WNKA 2Q76A 2O9OA 5DD6B 4MNHA 4OM1L 2CERA 4KGLA 1T4KA 1RJZB 5DO2D 4KK5D 2ZX6A 1B90A 1CN4A 4MD5B 1UR2A 1RPQA 3RQ3A 4RBPH 3NCYP 4NN5B 2ERJC 3K81A 3O2WH 5AYUH 4OF7A 1HHHB 4MYWB 4P9ML 5I8KH 2VRKA 4MAVA 3TZVC 1UR1A 1N2RA 3U0WL 4OLZH 2H8PA 3QFJA 1OGTA 3AOFA 3QNXB 5A8OA 3N50A 4PJ5A 5KVDH 3L3IB 1H3PL 3QUZC 3ZT6A 4TVUA 5ECJE 3SE3A 1SJVA 1LO0H 2GAZA 1PAMA 1DBJH 1TTFA 3VIFA 5I1HH 3QJHA 4LARH 2IFFL 1NBVH 3JTTA 5HGHA 4OCLC 4LFHD 4ONGL 5J6GA 3G6DH 1U9KA 4B15A 1PBYA 1T5WB 3QFJD 3H3PL 4HF5L 1LWRA 1BWWA 4PJ5D 5SWQB 2VLME 4JQIL 2FHBA 3LY6A 2QSTA 4LSUL 3PV6A 2VXVL 4I13B 2CESA 3PIQB 3QAZB 4WY7H 1FNSL 2IANA 3B9VA 2K3TA 4OZGF 5I2IA 2AJVL 5T1LB 4L3EE 3LIZH 1C1EH 1YY9C 2VH5L 4C7GA 1UM4H 1FP5A 4GXUM 4HH8A 4JZOA 3VFGH 4MJIE 5LWYL 4AIEA 4PRBB 5HI5C 1B0GB 1AC6A 4HUVB 3T0EE 4WEMB 2J62A 4MSWA 3UJIL 1A1NB 4JFSA 4R90H 3MUJA 2YUZA 1LP9F 3KPRB 4Y5XA 1DQTA 1U2YA 2IAND 3ZL4H 3QG6B 4HK0A 4OZHB 3ZTJH 5LGJA 1G7JB 1CXKA 4Q0XH 5HHMB 2VZSA 2CITA 4IEFB 1Z6JT 1FG9C 43CAA 2CLVA 5TE4L 3GNOA 1LEIA 4G8EB 3VDCA 4R4BA 2X4UA 2H3NB 2FGWH 4MWFA 5H94A 1N64L 2JJSC 3BESR 4MB3A 4YEFA 1RPKA 1CF8L 3IDJA 5F96H 25C8H 4HDIB 5IMOA 3VIPA 4M6OL 2FBJL 2R2HA 3BP4B 3TYGH 3QWRA 1QACA 4NO5A 3GMMB 4XMLH 5I8OL 2WSKA 4D3CH 2PYFA 3BUYB 1SYVB 3OKOB 2IBBA 3O3AB 4QRTA 4TSAL 3KJ4B 3WS3B 1FYTE 3BGMA 1RHHA 2G41A 4PTUB 1KXVC 5DD1L 3BXWA 3UTTB 3TGXA 2ZSWA 5IBLC 2UUDK 5BS0E 4BM7A 1UZ8A 5C0GB 1V6YA 1E6OH 1EHLH 2OMBA 1HYRC 5GRXG 3SKOB 1GQIA 2A1WH 2UY4A 2ITCA 4HXBL 4ZOBA 1NCNA 4KU1A 2XICA 5JOFA 3C9NA 4YDLC 4R3SA 3GSVB 4FLOA 1CQYA 1HINL 4KRTA 3CMOL 2HH0H 1WEJL 4JRXE 3CZGA 1P7KA 2RAMA 2A9NL 1ZT7A 4XP4H 3KPOA 3ULUF 4Y7EA 1CL7L 3C08H 3M45A 4AJ0A 1X5GA 3KJ6L 4ZPVB 1EHAA 4Y4HA 2WWDA 1NOUA 4EKXA 2VKXA 1N26A 3H7LA 4MD5A 4GMTH 4XNMB 4OZOA 2WUCH 5AWNH 4KKBD 2WWMD 1NDMA 4JR9L 4M1DL 1KJ2H 2HWZH 5E09A 1IV8A 3PWUB 2OYLA 3CC5B 1QTYT 5IHLB 4GI6A 1JFXA 2F19H 4JFEB 4LX4A 2VLJB 1S8DB 2BDNH 5CZXC 3UTQB 1JDAA 1J18A 5H37G 3QNXA 1D2KA 4Y4HD 4XCYB 4D6CA 4ETQB 4U1JA 4V2XA 3W0WA 1HYSD 2OBGA 4YJZL 3MGOA 1GC1H 4UQ9A 4BFEA 1TA3A 3D9AL 3IT8D 3M17B 1KPRA 3KR3H 5D8JL 3EO1B 5J13C 4TRPL 3T0BA 4X5XB 1ZLUK 5F9JB 1MPAL 2NXZC 3QCTH 4QYOB 4Z7QE 4XCFL 3GSWA 4P2RA 4PSRA 1G84A 4R6UA 5DRXA 5D8ZA 2VLRB 3EYQC 1FLRH 3FJTA 2WQ8A 3GK8H 3MBEC 5SWQA 3W0WD 2OSXA 3V6FA 1RZFL 1MFCL 2ZCKL 5IVXA 4CU6A 2VX4A 3G5YB 4G8FA 2DQDL 2DB8A 5GS2H 2BK8A 3L3HA 4X6CE 5T1LA 2NNAA 1VIWA 1NWSA 4KTYA 2DTSA 3BIBX 4ZPTB 5DHXB 4P2RD 2Y8KA 1A22B 2APTA 3H9SA 2XFXB 4H0GA 3SURA 3VJ6B 1BECA 1QRNE 3GSOB 5C86A 3QDJB 3QRFM 4ODVL 4XNQA 3LS5H 3OF6A 4KVCH 3L1OH 3WS6A 5E4IA 4KTEL 3T3PF 4J28A 4J6RH 2APXA 3FQUB 1R5VA 5T1LD 1A2YA 2XFYA 3SDCB 1BGXH 3MNZA 3UR7A 4NO3B 4CMHB 4GG6F 4B16A 3H9SD 3T0WA 1F8TH 2XNAA 1BQHG 2UY2A 4HDIA 12E8H 2DD8L 1RURH 4OUUB 5D5MA 3BW9A 5ICYB 3BP4A 3OF6D 4MVBC 4W70A 5IQ7L 2WMFA 4YX2L 5DK0A 1UYQA 3UCQA 1QFWH 3BZ4A 2Z31A 4CCCA 1G9EA 3G6JB 4MQTB 3WDQA 1OP5K 4OIFA 4HK3J 3WS3A 5HHMD 1FVCA 2E0PA 5DRNA 3AHVA 3UTTA 3CFIC 4P5KA 5HI4C 3U7YL 1RZJH 2QV2A 1KLGB 1CD8A 3SKMB 4DK3A 4BQ3A 5F1IA 1W9VA 5LQBH 5SWSA 2LE9A 4Z8FL 3NJ3A 4AMKL 3HHRB 3O2DA 4OD3H 3AAZB 1TVBB 4JDTH 3QDHA 2QSCH 3FZUC 2NXYD 1CR9L 4PMNA 3KPQB 1T7WA 2FEEL 3UTTD 5DJAB 1O0VA 5D2LF 3TJHD 1KCSL 3S2CA 3TPUB 1FO0H 2YIHA 4X5WA 3RP1A 3D39E 5SWSD 3FQTA 5EC2B 5GGQL 5DEFA 5GS1C 4UFIA 4XRCB 4LPWA 1KLUA 1MCHA 2EPMX 2B20A 2XACC 5JTWA 3F5LA 3ET9F 4R7DB 1R8LA 1F90L 3GJFB 4UQ2A 3GBNH 4JFOB 2WWKT 3WH5A 4XP9L 3LN4A 1EV2E 1CD1A 4RCAA 1ZSDA 1U8QB 1HN1A 4OAWA 3CDGA 3W2DL 3STZB 4U1SB 4ETQA 4I8DA 2QQLH 3LKOA 1E5NA 3MV7E 5D7LA 1AKJA 5EZIL 1ZJAA 1NFKA 4HD9A 5I19L 2CIKA 3O2DL 3IKCA 3EO1A 3D85A 3QEGH 4WFGE 4XAWH 4APQC 5HYJE 4NRZB 4PJ7A 4RGMB 3LH2L 1DTUA 4X5XA 1MLBA 3B5HA 4MLSA 4XX1G 1BFVH 4L3EB 2C7FA 9CGTA 3L6FA 5HHVL 5BV7B 3QO0A 5IM7B 4BK4A 1GOQA 2MHAB 4H26B 4MJIB 5D7LD 1FP9A 1AKJD 1K4DB 1U92A 4XMPH 1QHPA 1TITA 4FQHB 3WJLC 5AYUL 4JO2L 3GBLA 5T1MA 2W0PA 5F1NA 1BVKA 1U8HB 3D85D 4LF3B 3RM9A 1G7PB 4OLZL 5DHYA 4ZNEE 3RM4A 4QDMA 2E9IA 1QNSA 3IFPA 2J2ZA 3MLTB 5KVDL 1U8PA 1P6AB 1XF5B 4MDJB 4Q9RL 4ISVA 2XJ7A 1V3KA 1PKQB 3MRLB 3QDJA 4DZ8B 4HOWA 1VFAB 3N1QC 4G6AC 1LO0L 4HIHA 5C09A 5BVPH 1DBJL 4OZ4B 4AEIL 4WF7A 3ARFC 4UB0H 3S5LG 3TO4B 1I7UB 1WPCA 5DD5H 3OMZA 1NOWA 3K46A 4MA8H 1UB5B 4KHXH 3EDJA 1QBBA 3F65A 1GGIH 5A8NA 4UAOB 4P5TA 2Z92B 1XGTB 1FYTB 2V2XA 3AXLB 1ZHNB 2P48B 3I50H 5H35B 3QDJD 3VO0A 4KKLD 5EU7E 4K23H 5C09D 3Q5YA 4BQBA 3VRIB 4HOXA 4QHKI 4BA0A 2GITA 1HXYA 1OOAA 3D69A 4EQ2A 3LIZL 3CLFL 3PP3H 3W11C 4NC1C 1KNOB 3TLRA 1FL3A 5J11C 2NZIA 2YL8A 5GIRB 4FQLH 3HAEB 3QPXL 1XH3B 4ZTPH 3IJ8A 4JRXB 3PWVB 4POUB 4CD7A 4GLRH 4R90L 3SO5A 4JPVH 2TAAA 1KLGA 3SKMA 1MHCB 4M1CD 4XCNB 4XWGH 4MDOA 2HFEA 2NW3B 2V5MA 2JCCF 1UACH 3ZL4L 4YH6A 2FO4A 4M3KB 4L4PA 2Z0BA 4BZ1L 3AAZA 1TVBA 1UWQA 1ZVSB 2ZWLT 2WBJA 4ZQKA 3WHE1 2XSBA 4IS6B 1QQDB 1L0PA 3GSRA 4N0RA 1AR1D 5HHNB 5BRZE 1LNUA 4K7FB 4HS6B 4BJLA 4EXPX 4D0CB 5F96L 5I66A 1JAEA 4EJ1C 4AG4H 1N8ZA 1WWCA 3CUHA 1HHIB 1KJ2A 5JDSB 5CINL 1I4FB 5EC2A 2V5SA 1IMHC 2VMFA 4PJCF 4WU7A 4ACZB 4QRUB 5IF0B 3TA3A 1UWIA 3UCRA 4L3CB 3LMYA 3MOAH 3QCVH 2WBJD 3IYLW 4ONHB 3UTSE 2NLJB 1B3JA 2GKIA 5BXTA 4KTDH 1SJHB 5DGQA 5DO8A 1C5BH 2VSCA 1GUVA 1E4WL 3RVXD 2F8OA 3MCLH 1CECA 4U1SA 2XN9E 5F9DC 3CDFA 5FYJU 1HE7A 1MVUB 2PR4L 3WO4C 2HH0L 4RFOH 4P2CG 4UU9B 3UZQA 1QO3B 1A14H 2R39A 1OVZA 1MFAL 5E5RB 3MLVH 4L3EA 4UQ3A 5DRZB 4NKQB 1CVRA 4ETYA 4XPGL 1WSST 5J12B 5AWNL 2MHAA 3LRSA 4K94H 1L0QA 1AVAA 3CZLA 2VAAB 3T0EA 1QRNB 5E6ZA 1IZKA 4PB9L 1LO3H 3VNYA 5ENWA 2P8PA 2VDPH 1U8HA 3CVIH 4L9LA 4PRHB 4D8PB 2AJUH 1ZANH 2GT9B 2VR4A 2NY2D 4L3ED 4ACPA 4GRWE 4MA3B 4YHIB 5DVOA 3MO1B 4PTMA 5FYJL 4IOFD 4RMUA 1XF5A 5C07B 1FFPA 3MRLA 1FG2B 1A4JB 4DZ8A 4K9EC 1KB5H 5GS2D 3T0ED 3O4LE 1XCTB 3CH1B 3HS0A 4OZ4A 1YEJL 2HMID 1EQCA 1FBIH 2W4XA 5I1IL 3TO4A 3QCTL 1KB9K 3L5HA 7A3HA 3BO8B 3ESUF 4I3SH 3S6CA 5J9PB 4BZ2H 1FVDB 3VFWA 4BSWA 1FLRL 4KJQD 4GBXB 2H45A 4ZUSA 1TDQA 1FYTA 4TTDC 1CICA 1C16B 3UEQA 4NO2A 5BS0A 1WIOA 4AZ6A 1MCOH 2EE3A 2YKLL 1GCFA 3CZKA 4ZD3H 3VRIA 3BH8B 4NHUB 3TO4D 4OF3A 1KNOA 1MHPL 4XXDA 3QA3A 3R0MA 2Q7YB 4NIKB 4JEGB 1V3IA 2I5YL 4KJPD 3KPLB 1FYTD 1OSEA 5D7IF 4PYGA 1CICD 1NDGB 2J4WH 2JF6A 4X8XA 4JZ5A 4KVCL 5I0ZA 5BS0D 3L1OL 4XCNA 1KBGH 1S7TB 2CIIB 2XSAA 1UH3A 1OTTC 4J6RL 3EO9L 4LDLB 3UDWC 1QFWM 4N0FA 1ZVSA 3D39B 1NC2B 4H1LG 1I7ZA 5DJDA 4JFWA 5EFIA 4LP4A 1F8TL 1ND0B 2FEDC 4JDZB 4D0CA 3GSNH 1A6VH 1FO0A 3ISWA 4Y4KB 1OAKL 1WWAX 5IV2A 4PJ8C 3MUHL 2P5WE 5F7KC 1TTUA 1QFWL 3OJ2C 1I4FA 4MXVF 1OY3B 5CJXC 4U6VL 2W07A 4ACZA 5HYFA 5IF0A 5C6WH 2OZ4H 1RZ7H 5CBEB 3MV7B 3U0PA 1J0ZA 1UD4A 1VA9A 4QP0A 4JFTA 3CK0H 4AZGA 2P8MB 3JV6B 2VISA 5MENE 2PW2B 1AO7E 1RVFL 2LQRA 1CBVH 5D4YA 4TNVF 1MCCA 4XT1C 5JPMB 1RFDH 2BCKA 4LPCA 4OD3L 2W0KA 1HQ4A 2QSCL 4Z0XB 5DJZB 4WHCA 4BFBD 2RCSH 2W62A 2B0SL 2W9DL 1VHPA 1LGVA 2BVQA 2P42B 4XX6A 1FHGA 1QO3A 4L1DA 4L5FH 5INCA 3U7AA 3ZQ9A 3RZCB 5TD4A 1FFQA 2FJGA 1OINA 4G6KH 4X6CA 1AGFB 5DRZA 5IW3A 5IVNA 3S3JA 3PWLB 4FXGB 3BGFC 1T0PB 1HXJA 4NOFA 5GGVH 2BC4A 5HYSB 4AQOA 1YJDH 2ENSA 1QRNA 4LQFL 4WRLA 1MUJB 4LGXA 4ODUB 5C6TH 1E6PA 4Z78A 4ZFMA 5BZWA 2Q8BL 3ARGB 4UINH 4AD4A 1AHWB 2AERT 2JKXA 4JO1H 5ICXB 3ZE0F 1KULA 4N68A 1SJXA 1XCWA 1MCPL 4FQXA 5GJTH 4OTXH 1MFUA 5C0CE 1O7AA 3MA7B 3IDMA 3VXRE 3PXJA 4XCEB 3SCTA 1QRND 4TOYH 5I18L 2EZ0C 4RFEA 4LHUB 1BBJB 3UBXB 4D0DA 3QEGL 2VITB 1MEXH 2X5PA 5GRJH 3SE4C 5CZVH 3PZTA 2XG5A 4WTWA 5CXPA 4YBHA 3DVGA 5J9PA 1QSFB 3TH3T 1W1TA 5KVFL 2OK0L 4L8CA 3CSBA 4FQXD 2IQ9H 7CGTA 1MJJB 5JR1H 2ZXAA 2DQJH 1UR9A 2VDQH 3WSQH 4XMPL 1KIPB 4NZDA 3DTXB 2GK2A 4CJ0A 5D9SA 5FKPA 1FE8H 4NHUA 3AIEA 3CFJB 3AMDA 1W2KT 4HSQA 3FQRB 4LPVA 3U6RA 3RY6C 3GYCA 4YHOL 1MCWW 3T0XA 3N04A 1DR9A 3W81A 5EOTB 1Q4NX 1OHQA 1XF3B 5L0QC 4QWWD 5EU4B 2R0ZH 2NY4B 5JZ7D 5BVPL 4FRWA 1S7TA 1QSEE 1JGLH 3BP7B 2CIIA 1EO5A 3CZFA 3FT2B 4W86A 2CR3A 3DHUA 4P3DA 4UB0L 3E3QE 4YHYB 4U6YB 5A2CA 5DD5L 5DSCA 3AU1A 3MROB 2VDNH 4YDVB 3T3ME 1GGIL 3HI5H 4U3XA 2WLZA 3MMUA 4D6EA 3JWOC 1FAIH 2D7TL 3I50L 4IHOB 3FFCE 4GKSA 2GK0A 5FHBL 5EOCH 1LHZA 4K23L 4C4KO 5A3IC 4R26H 2HA1A 4NHCH 4KDVA 1UJ3B 1YEKH 2XN9B 4QLRA 1T0NA 1P1ZA 1JNDA 4Y2OA 4CL7A 2X4OB 1K2DA 3MV7A 1NC2D 3ARBB 3B8SA 3QXDB 1Q0YL 4ZO6A 4KMTH 4ZTPL 3BN9C 5ITFA 1Q6CA 5HYJA 2VOTA 5KSAB 4XPHH 3P11L 5ABFA 2XGBA 1RUQH 3O8XB 1UACL 4DN4L 2DLGA 2Z93B 3CFEB 1U0QA 4QTIL 2I9TB 5IHSA 1BZQK 4ZOAA 1PY4A 2ENYA 4OD2B 3NCBB 1NGYB 5GSRB 3MV7D 3VDBA 2WBKA 4K3HA 4OCSL 3WUBA 4JPKL 3KVQA 3QUXC 4V28A 2AEQH 4Z18A 4OZFH 3TNMA 3L5XH 3E6HA 4WFGD 5HYJD 4AG4L 4ZEPA 4ZNEA 3HKFA 3MV11 4C56B 2ICES 1E73M 4R4ND 1UD3A 5CD5D 1JL8A 3FOLB 4WJ5A 2Z8WC 2G75A 4GRWB 1DN0B 2FYYB 3PL6B 1T22A 5DGRA 1CD9B 3MOAL 3DLQR 5HVWA 4NT6A 2Z4QB 3ARGA 4KTDL 3O4LB 2X1QA 3L3GA 3FN0H 1TNNA 1KCKA 1C5BL 1G9MC 1A6UH 5E1HB 1G01A 3L3DA 1UWGH 1CE1L 2WC3A 1KJMA 1KB5A 4PJGF 4G7VH 3QXAB 3DHJA 1QLEL 1CLXA 1T20A 3MA7A 4FHBD 4JIEA 1GPFA 4G80A 1JZ3A 5ALBH 2GY5A 4LHUA 2XXMB 3EYVB 4JY5H 2AJYH 2O93L 1UA3A 3ARGD 3VWJB 1JN6B 5TE7H 1A3LH 1WV7T 5FUCC 4PMZA 4OLWL 4NQTA 6FABH 4DGIH 3LQZB 5FGBC 1RUKH 1ISVA 1A6TA 5F6IC 5E8NA 1MJJA 1XCQB 3MJ9H 1OT1A 3U30B 3H3BC 1N3NB 2AGJH 2DQHL 1Q0XL 5D1QA 5DO2C 3DTXA 2WM0A 4KK5C 4LHUD 4AENB 3CVIL 5FCUL 1UD6A 2HVJA 5BXFA 1XGZA 3H3KA 2AJUL 1JXKA 3B2VL 4WWKA 5FOOA 3OX8A 4P2QA 4WUKL 3AGVA 5JBEA 2YLLA 3DXAA 4X6FA 3MLZH 3NFPA 5EOTA 4BQ2A 4D71A 1XF3A 2VIRB 5BRZA 5DMGD 1V3MA 4YHKH 3O6KL 3ZSSA 4D9LL 4OLUH 2C1OA 3AY4A 5F88B 2XI9A 4U6TA 3Q5OA 4ZUVB 5DFAA 3KHOA 1AIFB 1BLIA 2P5WB 3BKMH 1QNZH 3MROA 3QHNA 3DX6B 3GHEH 4ZDHB 3ME0A 4P2QD 1MCQA 4QHMB 3DXAD 3VXQA 1E56A 1KTLB 3UTSA 4IHOA 1NMCB 5BRZD 5KTEH 1I3GL 3D3VA 4F9DA 4UQEA 4ZS7L 1II4E 3L4TA 4LLWB 1IT9L 3H6JA 5DQ9A 3PXHA 1OAZL 2OZ4A 1AO7B 4HUXB 4N8VG 5MENB 3B8YA 3LZFL 3IANA 1A6PA 1U95B 2XN9A 4WENB 4KDTA 2AXGB 1OCWH 3VGAB 5C0ND 2X4OA 3BPCA 3FHAA 3CFDA 3TO2A 2DQUL 4PGJA 4AEFA 1YEDA 3UTSD 3D48R 5GGUB 2VUYA 3D3VD 5I1AB 2EH7H 2VRAA 5E4EB 3BEVA 1T2QH 5E6IA 3VDHA 3QHZH 2KL6A 3BZEA 4NNYB 4ODHL 4G8IA 4YXLL 2XN9D 3FAWA 3KLAB 2V2TA 3L2MA 1HSAA 3CZJA 1ZGLA 2DYPB 3HJEA 2WCSA 1T1ZB 3ARBD 4P8XA 3QWOB 2APWA 4W84A 3DRQA 4YUEH 1EEUA 4HWUA 3KPSB 1U33A 1QSZA 1JV5B 2VZOA 4Q74A 5ANME 2DH2A 4WVRA 3BXNA 5E6ID 4QRRE 4HZ7A 5C70A 1DN0A 3PL6A 5FXCH 1KCUH 1QKZH 1TVDA 3RVTD 4HT1L 2WC4A 1E6NA 1WFOA 1W3LA 3VXRB 4Y5XC 3FRUA 1EBPA 3FMGH 3KWWB 4LVOB 1ZGLM 1D5IH 1KTRL 1IQDB 1V0MA 4W7UA 4HA4A 3E0GA 2V2WA 1E55A 5T1DH 2IC2A 1Q9KB 3BCDA 5I23A 4U0QB 3BFOA 3QXAA 2EIZB 3KYMA 1I3VA 2R2BB 3GNRA 3PL6D 2AEIT 2A6JA 3TPKA 3EYVA 2V9QA 4OLYH 2F5AL 3NCJH 1JP5A 4HJGA 2KUTA 1JN6A 2QADC 2FIKA 1TR1A 4LYRA 1LD9B 3CUJA 4RE3A 3KPPB 4I3RH 4OLVH 5JNYB 5GGVL 3V5DB 1YJDL 4PY8I 1QBLH 4PRIA 5DUPH 1ECEA 1I7RB 4NKIH 4P9HH 1JF1B 5C6TL 3PGFH 1ZT4B 2Y72A 3S36H 4LXFA 1FVEA 5LAXA 4KKBC 2WWMC 1QSEB 2ID5A 2FX7H 1JWSB 4P46B 2IG2L 4HUWA 2DTMH 2ZSVB 5E0QA 1NGZA 1D9KB 2RIKA 3QZWG 4U1NA 4OQ1A 5C0IA 3PP4L 2Q8AL 4LLQB 4FTVB 1H3GA 1EO8H 4PRID 4NNXA 2ZNXA 4LLYB 4DCQA 1HYSC 5GRJL 1AIFA 3BKYL 3PWJA 5F93C 1IGYA 2G9HB 2P5WA 1JI1A 2A74B 2KZWA 4NN5C 3R1GL 5LGKA 3V52L 1YHTA 3SCRA 1AJ7L 5IEHB 1AXIB 3UJTH 3R06B 4L4VE 2IQ9L 1EEQA 1JNLH 3MV9B 3TIDA 2VDQL 3WSQL 3INUH 4DOHE 1FGVH 3BLKA 4LLWA 3WDIA 2DBJA 2ZE0A 3MOBH 3SCOA 3JSSA 5MENA 4BQ8A 5HHOA 3E6FA 5I1LB 2UWEA 2VXSH 2P5WD 1LL4A 1F4YH 3OGSA 1JK8A 2P5EE 2P47B 4P99A 3AROA 3GSXA 3HI1B 4FZ8L 3DX8A 5E6YA 2HKFL 3BWUC 1T1WA 5CFHA 2D7NA 3L9RB 1VPOL 3WMSA 2IADA 3GMNB 1EJ6A 1UUQA 3MUAA 3STLA 3QCUH 1H0DB 4LLDA 5MEND 3BQUA 4NSBA 4LGRB 1FIGH 3BH4A 3KLAA 3SCSA 2VDNL 5HHOD 2PTVA 3SDYH 1QG3A 5I1GH 2DYPA 1HVQA 3QAZC 4OZFA 3NAAH 1IKFL 4X7CC 3TJEH 3V6ZB 3QWOA 2HT2D 1J9CT 1NSNH 3EFDH 1G7QB 1EHXA 5KAQG 4ZS6D 4F3FA 4FF5A 4DN3L 2ZUXA 3VD4A 4O58L 5GZOD 1QI2A 4Z7VA 2R23B 1J05B 5DJYB 4XPAH 4XXCA 2GI7A 1JGVL 2R4RH 2XTJE 1VKXB 3BQUD 3D0LA 4PJIF 4BA8A 1MRCH 5C0CA 1K8IA 3C6SB 3D1MC 2DYPD 5B38A 5JBFA 3WS6C 3RPMA 1PYWB 1MWAB 2VDOH 2FHCA 3WBAA 1I8IB 3MXWH 1I9JH 3NIGF 3QULB 5HHQA 5KW9H 2Q8XA 1IQDA 1UYWH 1LILA 1HJXA 1RUQL 1AGBB 5DD3H 3NBNA 1WZKA 3C5ZB 4EI6B 5D7JA 1YNTB 4PUBL 4CNIB 3JTSB 2PWEA 2EIZA 2DBLL 2GJJA 4DVRH 3K3QA 4ATWA 1EAPB 2R2BA 3FCTB 4LLVB 3ZLQC 5TF1L 4QXGL 2J6EL 5C0CD 1N82A 1AXTL 3QSKB 4JZJA 1NJ9A 2I07B 3KLHD 4O4YL 3SKNB 3L5XL 1JTPA 2NXYC 3EDFA 3KJ4C 3VRLF 5CJOL 3AXXA 1GHSA 4PRWA 2DQTL 3RBGA 4JDVA 3MJ9A 2Y7QA 1RUAH 2BRQA 5D7JD 4CVWA 5CBAA 1FFOA 3MRMA 1RAMA 1AE6H 2QKIB 4JJ5B 4M5YH 3WF2A 4Y2DA 4FQIH 1KB9J 1FORH 2Q20A 5GGTL 3TJHC 5JHDE 1HXMA 2C4XA 3PZMA 4QHUA 3BEWB 4LPTA 5T5FH 4NNPH 1QSEA 5IJVB 1A02N 3WEMA 4YBLB 1W0WB 4OF6A 4YLQT 2AEPH 5EORL 5CSBA 1CK0L 3SGDH 3PZQA 3DJ9A 3T08A 1D5ZB 4BQCA 1G7LB 3VFVB 2ICCA 3U7VA 1YC7A 2IGFL 2EXYD 4Y2DD 1C7TA 3QQ4A 1S9WB 3FFCA 2DKMA 4M24A 1OB1A 2QLYA 4DWSA 4NKMB 2BY0A 3WD0A 4WI9A 2VN4A 2AJYL 2D0GA 1IAII 1XR8A 1HCVA 1A6AB 1TE1A 5TE7L 5TPWH 1S7SB 2F8QA 5FUOH 3T65A 1NWUA 4EBQH 1QSED 2A74A 2ATPB 4QRPA 6FABL 4MXWL 3POHA 5C0JB 1OLZA 1PPIA 3R06A 5BW7A 3WL0A 3CFKA 1WKYA 1TJGH 1TZHB 1BX2A 1BZ7A 2ZJSH 1MJ7H 3MJ9L 4FZEL 5BRQA 2AGJL 4Z2JA 2DPEA 2YPKA 2W61A 5IROA 3FFCD 4OIBA 3LPOA 4DWSD 3IRPX 5E8EA 1JTTA 4OIIH 2ED9A 1GVIA 3BCFA 1OAXH 1KIQB 1IGMH 3F6LA 4QRPD 3SGKC 1YUHB 3BRFA 5E2TL 1R3KB 4U1MB 1ES0B 3SO3B 5F3HA 3SCWA 3BRDA 4HPYL 4M6NH 1CXLA 1RUPL 2W9EH 4RZCA 1M7DB 1UD2A 4HFUL 1V02E 4XNZB 4YE4L 3GH7A 1H0DA 5JPNA 5ANMB 2BFVL 3BKML 2WWCA 2FGZA 3NABH 2XV6B 4X6BB 1JMZA 4JLRA 2E27H 1DVFA 3EDDA 1KCRH 1BPVA 4PUDA 3FRPA 3GMOB 1IAOA 1UT9A 2RJMA 4OJFL 3BYTA 5GS3A 1XCXA 1JXJA 3QXWA 1Z9MA 3MRBB 4LSTH 3U9PH 1VKXA 4AYFA 2XQBL 1HHKB 4DKDC 1R7OA 3K2UH 4KKLC 4WDIA 3F7VB 4KI1A 1S7UB 5IB1B 3LPFA 1PYWA 1RK0B 5KOMC 2OLDA 1U8OB 1GHFL 1CFBA 4CD4A 5AAMA 1I8IA 3QULA 4TPRH 5F3BA 5IMLB 1H41A 3OR7A 4KGJA 2EH7L 5CPTA 4O2EA 1T2QL 1QFPA 3QHZL 3RNQA 3RM8A 5IT2H 1EIBA 5MEQA 1UQZA 3SUSA 3VXUE 1REIA 2VE6B 2XWJA 1EAPA 3M07A 4JZNB 5DUMH 2O92A 4EN3A 4M1CC 2B1AH 4S1SH 2ZUYA 1DE4B 4YUEL 4OFKA 4DGYH 3AS2A 1BPLB 4NC2B 2I07A 5DJXB 2OSLA 4YXKL 4URIA 2CKBB 1K4CA 2NY6B 1W2VA 2J12B 4L29A 3HA0A 3DVFA 5CEXB 3A6CH 1AR1C 1U42A 4WI8A 4JJ5A 4LSQH 2R69H 4XI5D 5DHVB 4A2LA 4AEHL 3OZ9H 2QL1A 3LPWA 4YIQB 4YK4B 2C3VB 3QGVA 4EN3D 3VD5A 3AIUA 5IJVA 1UCBL 2WMIA 5EZOL 1YYML 3T77A 1MWAL 3EW3B 1JYWA 4PP2A 2WBJC 4HLZH 4NZRH 1NCTA 3HR5B 1V05A 1NM9A 1G7LA 1W9BM 4L4VB 2YWZA 1CTNA 1PZ5B 4CU8A 2XGIA 4CDGC 3RVXC 1S9WA 3SCNA 3GSUB 3U82B 5F7UA 2XZQH 3MXVL 3P0VL 1PGRB 4NQUA 43C9B 4DVBB 3DBXA 4ZXBB 3ZE2E 4PLJD 5C0JA 3TT3L 4C57C 4MA7L 3MLXL 2P5EB 3LV3B 4D9RE 5FDYA 1ACYH 4U1HB 4M7ZC 3W26A 1FJ1B 5GZND 4HAGA 1DWGM 4MZ2A 2VN7A 7FABH 5DUPL 4NKIL 35C8L 3VXSA 3MJ8A 2C3XA 1UKOA 4XX1E 3MUGB 3PGFL 2EIBA 1VGKB 3S36L 1I1CA 5ERWA 2HT4D 4F9LA 5GJSL 1BOYA 5B21A 1F6AA 5C1MB 1X5HA 2DIAA 1KOAA 3IDIB 1QW8A 2OL3B 2DTML 2K9UA 1R3KA 1NEUA 2VNCA 4OBSA 1ES0A 4RGMC 3UZVB 1HKLL 1FH5L 1T04B 4GG8B 4D2NA 1EO8L 2NY2C 4HCRH 1J1PH 4EI5B 3VXSD 4P4RB 4Z7OF 4IOFC 4P8WA 5F7HA 1PVHA 5TH2B 1NEZB 2DMBA 1CFVL 3TT1L 3JBG7 3EDKA 1LE5B 2WVUA 4QRRA 3T0EC 1J10A 2DWDB 4MJ6A 2BNQE 3UJTL 5EUKA 1JNLL 2HMIC 1EFQA 3R0NA 3W0KA 5KVMC 4L9LC 4NKOA 2VDKL 1C5CH 3PNWB 3DIFA 4MD4B 4PJXF 4UI2A 5D72L 5F9WB 3EFFB 4FFZH 3AICA 3CU1A 3MOBL 4KJQC 3FQNB 4KXZI 4I4WB 4P7RA 3GI8H 3DURA 1CLVA 2VXSL 1CENA 1OGBA 1F4YL 4WUUB 4GUPA 2PTTB 4QRRD 2AJZA 5C0DB 2XZCL 1J9YA 4O5LH 3QIWA 1JGDB 3WNNA 1Q38A 1U8OA 2Q1EA 1OW0A 2GFTA 3CGTA 3TO4C 4H8VA 3ZJ7A 1LK3H 2EDBA 4N1HB 3MLYH 1Q1JL 5EU5B 3FB7A 2DT1A 4UAOC 1Z2KA 1P7QB 3QCUL 4M8VA 4W5UA 1HT6A 4XP1H 2H1PL 4YAQB 1FIGL 2VE6A 4K07A 4JZNA 3GZAA 4HKXB 1S7VA 4NQCB 2GTWB 2GJXA 4P59H 3TJEL 2AK4E 4YFLF 5JHDB 2WIIB 1X4XA 5DJXA 1NSNL 3EFDL 2GDVA 4ZENA 3LCYA 2J8UB 2BVEA 4Y0GA 5BJTA 4GMSH 1RI8A 3OKYA 4XNUH 1QI5A 5B3JE 1JCKA 5CEXA 3OJDB 1K5NB 3OB0K 3MRJA 5EB9A 4OD1H 2XQYK 1ZA6A 3G5XA 3TYFB 1TZIB 4ORGB 3WLBA 3OAYK 1FNGA 5D93B 3V9FA 1BMGA 1G9NL 1YNLH 4LCCA 5KSUA 5KW9L 1I9JL 3DGCR 1KT2A 3HMXH 1RIVH 5A6LA 1B3VA 4AD1A 1IGTA 3AZSA 1OWWA 2DAVA 2D0HA 5ECUA 3V7AG 4L4VA 4K3GA 1AP2B 1R6VA 1XZ0B 3ARWA 2WINB 2FECI 2OQJB 3FHQA 4LSPH 5CGMA 1DQMH 1DHKA 4L8DA 4N42A 4FFVD 2EDLA 4JAMB 1U91B 4KV5F 1XYZA 3WFDH 2AXJA 3QOKA 4IMKC 1ZTXH 2VXUH 3CFCH 4AT6B 2P5EA 3BP6A 4U1HA 2B31A 4R96B 1Y0LB 2YN3A 2YJQA 1AE6L 3RL1A 4GRLB 4L4VD 4NN7C 2ZNWA 2QTEA 5BCAA 1SY6H 4YNYA 3PZGA 4W4NA 2P24A 4YPGA 4PTVA 5LYRA 1A7PH 3ZDZE 1UZ6F 4NNPL 1JDCA 5J1AA 4PJDF 3NSXA 4H8UA 1EAJA 5IXEA 3C2SA 4JG1H 4AIOA 4Y1AB 2AEPL 3C6LA 1EEYA 1CDJA 2OL3A 4JGMA 3HI6L 1YECH 1IAKA 1E1EA 1HILA 5E5MB 2P5ED 4DKEH 3UC0H 1RY7B 1ZLSH 1KXQE 4GG8A 3O81A 1ZBKA 1Q6GA 4NQSB 1MHHB 3ARXA 4NQEE 3EMCA 4OF8A 4QLLA 4B50A 4Q6IA 2XA3A 5J12C 5TPWL 2D4FA 4QXUL 1GQLA 4I2XE 1QYGL 2XZAH 1NEZA 5TH2A 3WNOA 4EBQL 4FK9A 3QJFB 4G43A 4NGHL 3ULVL 2DWDA 4P2OB 5IW1B 3I6LE 2X1OA 3C6LD 1BQHB 1UKSA 1J11A 1MJ7L 3ZYZA 2X7LA 5LVEA 5EUOF 3PWNB 2ZOXA 3UAJC 3LPGA 4GW1A 4I18A 1GZQB 3MRFB 2VL5A 2IQAA 4OIIL 3OAZK 4ODXA 2YWYA 4M80A 4RMQA 1YEHH 4N9GA 3MLRL 3ZYOA 5HHXH 4ZG1A 5IJKA 5I71B 4LCWA 3VXUB 2XTJD 3BT2H 5E2UH 4X4ME 2ARJB 5JMRA 3I2CH 2OL3L 4AM0A 4HZ6A 4GS7B 4DKFH 3VIKA 3IJSA 4M6NL 4JFPB 2W9EL 5KBNC 3QXUA 3VFSA 3MC0A 1MW1A 1OGAA 3T8XB 2ZG3A 1ADQH 4GBXC 1GOIA 4OI7A 4PMDA 1CNVA 4MAYB 2I26N 3QG7H 3NABL 2DM4A 1Q9WB 4QWWC 3NIDE 5FOBB 1KR0A 2E27L 3UTOA 4GXPA 5JZ7C 1RZGA 3E8UH 4LCWD 1V6VA 1CIDA 3FO0H 4HIIB 5JHDA 3T4AB 4MJ2A 1BG9A 4HIEA 3KYAA 5TQ2H 5L9DH 3MV01 2YUVA 3VWKA 4ZE4A 4NZTL 2YD6A 5CEYA 4JVWA 3U79A 4O9HL 1OGAD 1DBBH 4BELD 4H04A 2ZPKH 4MXQD 2FNBA 1W2PA 1A6ZA 1TZIA 5BMFL 1G7MB 2W67A 2BY1A 3ILQD 3H42H 1WFTA 1IBGH 5A6AA 1B2WL 5JHDD 4CUCA 4RMRA 4X98A 4K7PL 1AI1H 3VWKD 3N9GL 4V1DE 3HPLB 5KVGL 2XIDA 1UM5H 5D7SL 3SGEI 4HMEA 4ODWB 4WHTB 5DUML 3JV5A 2IPTH 1I9RH 1UOKA 3KYNA 2B1AL 2WINA 2OR9H 4S11A 4OKVA 3FKUS 1BFOB 1U91A 4BFGA 1A4KB 3AXHA 3TFKD 1MCNA 3A6CL 1YY8B 1FFRA 1FL5B 3N12A 5EA0H 5CP7A 1E27A 4R96A 1Y0LA 4IIQA 4LSQL 4Y19B 5DMKB 4IJ3B 1IGJB 4GRLA 4OFDA 1FNHA 1IEAB 4AD3A 4PJ9B 3RWGA 3VXME 1EEZA 2ICWI 2CNCA 2ZWZA 1HNFA 1V02A 1U3HB 3LDBB 3DROB 2CO6B 2BP3A 4ZTOL 3HZYA 4NZRL 1LO5A 4HCRA 5L88L 2BNQB 2FH8A 3FO9B 1E3XA 1OLLA 5EO0B 1HHJA 4EAMA 5HNNA 4GRLD 5E7FA 4NM4H 2P45B 5SWZE 5IG7B 3AREB 5C0BE 4PBWD 1JWUA 3D87B 3NSMA 3QHFH 2QMJA 2DICA 2BHYA 5FDWB 2EEAA 4PB0H 1DQQA 3ULSA 4MNGA 5IW1A 4KPHL 4KQ4L 3ARGC 1F45A 5GHWL 3P3YA 1UA7A 1AHWC 3PWNA 5GRWA 2RR3A 1UB6A 3P9MB 5IFTA 2HT3D 3BAYA 4TSCH 3AHXA 3F7RA 4Z9KB 3LOWA 1UGNA 2AABH 2B7DT 2EXWD 2C9AA 3I6KA 5A16B 1M6OA 3HMWH 5DEGB 4RBPK 1JGUH 2GSIB 5TFSH 3VVGA 4YDIH 3IRZA 5EU7C 3QHTC 2Q86B 5DMIH 1T66D 4LCIL 4WI7A 5KG9B 2F5BH 1P4IH 5CMAA 1YC8A 4HCRL 3CX5K 4C83B 3O4OB 4YBQD 5AZEH 4A4AA 3HMCA 1MSPA 2DQIH 1E71M 2I60L 3TF7C 4U5IA 3PHSA 4Z2KA 2UV3A 5DMGC 2DT2A 3MCKB 4Z5RB 2X0YA 2GJ6E 2EH8H 4F2MA 4QRSA 4AY0A 3QUYA 4KUCD 4FQ1H 4HIIA 4PJEA 1L9MA 3BH9B 5D2NE 4M7LL 1OWRM 1CT8B 5EPMB 3NFSH 1JFHA 2DSKA 3GXDA 1JI2A 4QT5B 2XRAH 3ALGA 3ZTJG 3CDYA 5GSVB 4OV5A 5K9OB 2JK5B 3GBMH 3BSHA 5EO1A 4OZIB 3RFZC 1FN4B 2X4NB 3AY4C 3OL2A 1G7MA 2NY4C 2N1KA 3B6SB 4DWHA 3QUYD 4PD4K 3HMXA 3GKWL 4E42A 2QR0B 4PJHE 1BJ8A 3H2WA 4YHYC 2R1XB 5C0NC 3MLYL 2HLAB 3ALXA 3CZ8A 4KKAD 3MRHB 4JB9L 3B9KA 4LSVH 3MYZA 4XP1L 1AGEB 1I3RB 2Y1VA 3VFOA 4WHTA 1KEMH 1LO2H 3JV4A 1R3HA 4RMSA 2PO6A 3I9GH 4JFYB 5DA4A 5IK3A 5C3LD 5DT7A 3G5ZB 2GQHA 4OSUH 2D23A 5I16A 1MLCA 2VC2H 4J3SA 1KEGH 2F54E 1BFOA 5EIIA 4WCYH 5E94B 4KDTC 2BRRH 4HV8B 3LKNB 1OM3L 2OWWA 3MSDA 1YY8A 3KPTA 3TZVB 3ARBC 3B9KD 1FGNL 3IDNB 3QIUA 4HWBH 1JDDA 3WFBL 2CDGB 4FXLA 4JG0L 4S3KA 5DMKA 3VCLA 3NZ8B 4EVNB 4D9RD 4PJ9A 3OXSA 4PRAB 2PO6D 3QUZB 3GMLA 1XGRA 2R0KH 3ROLB 5ACZB 4LAJH 3N1GC 2F53E 3HMXL 4B7IA 1RIVL 3EYOB 1ED3B 1PG7L 3FB6B 1SEQH 1IL1B 1G7IA 1FPTL 3O11A 1AGDA 2GYSA 1TZGL 3QIUD 5EBWB 3GIZL 2R29H 4LAQL 2BNQA 5ETUA 3WCYA 1K8DB 2OTPA 1UH4A 3PZIA 4HPOH 4PRDB 4LSPL 4M6AA 4PJ9D 1JPFB 2X41A 1QHOA 1YJDC 2GFBB 4YFDB 5JIIA 3VTRA 3WDRA 1QBAA 4OM0L 3VG9B 1R24B 1U3HD 5FDWA 3RWEB 3PL6C 1Q9OA 2M1KA 4RE2A 4QFUA 2YD2A 1KENL 4PG9B 4E41E 4MAZA 1JUFB 4WTZA 2IH1B 4PP1D 4OOZA 5A40E 1F02I 3GI9H 2C3HA 2BNQD 3W9DA 4BS0A 1C90A 3PTMA 4KK6C 4KJYB 4NUGL 4CN4A 5IW6B 2WCAA 1A7PL 2A6DB 5J89A 3MRDB 2VT0A 1KJ3L 3SOBL 4S3JA 5CG0A 4IMLA 4PR5A 5BQ7A 1X7QA 1MRFH 3OA5A 4NI3A 2YMXL 2VZTA 4DKEL 3UC0L 3QO1B 1ZLSL 2AK4A 5LXGH 2XYCA 1ADQA 3LD8C 5A3HA 4FQQB 1A0QH 5GISH 2DJSA 3MRGA 1ISWA 3GJFK 3FFDA 1MNUH 2XZAL 2XVKA 4AEEA 1HNGA 4ELKB 4LSSH 5HJ3A 5CEZE 5CSUA 2N4IA 2HKHL 5HPMB 4QXTB 1OPGL 3MGTB 1S7WB 3FO2B 1IILE 3HZMB 2AK4D 1CT8A 2NTFB 2VLLB 3X12B 3ZO9A 1L0YA 1RHFA 4Q9QH 1KQZA 3WEXA 2J7GA 5GSVA 4V1DB 2JK5A 3IDXH 4WFFE 1IC7L 5HHXL 2HVKB 3MLUH 1FN4A 1G0YR 1K3ZA 2EYSA 2Q3ZA 3HE7B 1E15A 4G6JL 3BT2L 1SFSA 2OXGA 1LWHA 1UR0A 5IBTL 4YDLB 4Y7MA 1MW2A 4TSBL 2MCG1 1OWQA 4PV9B 5JDJA 2G60H 4IRSB 4I48B 1MYRA 1ED7A 1PX8A 3MRHA 2VURA 1HCFX 1AXSA 4S1DC 2EDEA 3PHOA 5BO1L 5T33H 1ADQL 1BOGB 1BD2B 3SCMB 3HU7A 2IALA 3KXFE 5ADOL 1I3RA 3IU4H 1O7VA 2ILLA 4JM2B 1OCQA 3V4PL 1NMCC 5CUSL 2JJTC 4F7CB 4ZFZA 1LP9A 3E8UL 4JFFE 4XZUA 5IHRA 3BDBA 4CW1A 3FO0L 2R9HD 1B88A 3FTGB 3MNVB 4JGUA 3G5VB 4O02H 1JPTH 3Q1SH 4KVNH 4K8RL 3VXMB 4LKCB 3WQ5A 1JHKH 1RZIA 3F58H 1GAFH 4JHBA 2G2RA 3UYRL 1JE6A 3IDNA 2V5DA 6CGTA 1IAIH 2HT2C 2AXHA 4XC1L 4ZS6C 4P8UA 4HOZA 4AIZB 4EVNA 1E0XA 3UX9B 5GZOC 4PRAA 3BE1L 1KGWA 1FH7A 2AK1L 3I02A 3Q0HA 1L7TH 4NQEA 3ROLA 3TNNB 3WNPA 5C0BB 3TBWB 3EYOA 4K3EL 4HGWB 1JGEB 3UTZB 3D18B 4I2XA 1J0HA 4PMOA 2O5ZL 3DRTA 2DT3A 5JHLL 5EBWA 2XIIA 1LEGB 3P4LA 3AZTA 1ZOXA 2BMKB 3TV3H 3MNWA 1MCSA 3RMEA 3Q6FA 1U2HA 4CADB 4PRDA 1FNLA 4WU5B 5D71H 4GQ9H 3LEVH 4NQED 3QUMH 4JY6B 4RAUA 2FBOJ 4NPYA 3RWEA 1LL6A 2DSVA 3RUGB 5HYIA 1V0KA 4EIGB 2MTPA 5JW3L 3RWFA 3QI9B 3KLHC 3UPRB 1W0VB 3I6LD 1X5ZA 4IRZH 4LVOC 5EDXA 3MRIA 3KPNB 3RWHA 4L8SA 4YHPA 3UEZA 1NBZB 2YKKA 1MQ8A 5LBSL 4PLKD 1UXSA 5D7JC 4KRUA 1H15A 5IEKA 1I1AA 3QEQE 5ESAB 4X7DC 3CXHK 1GONA 4UBDD 1FSKB 1K9FA 1TIUA 2GJ6B 1GPOH 2R1WB 5IFJB 1GYAA 5I8CA 2A3AA 1HX0A 2CPCA 4KQ3H 5D2NB 5E2VH 5D1XA 4J4PA 1MI5E 5HGDB 1AGCB 2VUOA 1CWVA 1GZPB 2EXYC 4M7JH 4O2FA 1I1AD 1PG7X 2X4TB 3WD4A 1FZOA 2Y06H 4J3TA 5I17B 1XR9B 2WZHA 1DUYA 4PGDB 1P69B 3HZMA 3U4BH 2FGLA 2NMSA 4PJHB 3E3QC 1SBBA 4J4PD 5D1XD 4Z7UF 4A3YA 3SPVA 3IF1B 4V1DA 1D9KC 4I1NB 2EPLX 1JYNA 3QHOA 3WN6A 4X4ZA 2NYYD 2YPLA 3HE7A 5TF0A 5MEPB 3LKRB 4YDIL 4F80A 1JG9A 2OTUB 1WP6A 3B9DA 4PV9A 4N90E 3CD4A 1H11A 4I48A 1ZHBA 1WLHA 3N85H 3RNKB 4EDXA 2DDQH 2EPOA 4UOW1 5AZEL 3MPCA 5GGSA 3FQWB 3MYJA 3O41A 4MADA 4HGMA 4V1DD 3AFLA 4JM2A 3AYSA 5MP6H 5KN5A 3MRKB 1WCQA 3HE7D 2XFRA 4FQ1L 2OI9B 5IROC 3ZE0E 1U58A 1KIRB 4C58B 3PGDB 2VRQA 1B6DA 5TDOB 4NZJA 2W0FB 5FUZL 1FZKB 1D5XA 4HWBA 3BDYH 3NFSL 2F53B 1H8NA 4BSVB 2XRAL 2KH2B 4JFQB 3C5JA 3TTOA 5LCVL 3EYFA 5FO7A 4JM2D 3DI3B 3QEHA 3QQ9C 2EKSB 5BVJB 4U1IB 4H25B 1OAUH 4XP5L 3BVNA 1NFIB 5SWZA 1H3UA 3TNNA 3TBWA 1N0XL 5CSZB 5JA9A 1QEWB 2GCYB 3WDJA 1KYOK 2EPKX 1EGJH 3PP3K 1IGFL 5EN2A 4F57L 4WHYH 1I8MA 4RMTA 3L3JB 2DOCA 2IAMA 5DJ0A 1QLRB 4CADA 3UETA 4OSUL 2BX5A 4UT6L 2CJUL 2WAHA 5F7NC 1EZVX 1KEGL 3CSYB 5SWZD 4JN2B 4YR6A 4P7QA 1YPZE 4M93B 4WCYL 3ZE1F 1JPGA 2Z91B 1CFSB 4XZBA 4HWBL 1AIWA 1VFOA 1KB3A 3QI9A 5FGCE 3OKMB 4S0TD 5B8CA 1S9XB 1PLGH 1MFDH 3DX7A 2WHLA 4ACYA 1S7QB 2VVNA 3QNZB 1CD0A 2DH3A 2IAMD 3C5ZC 2V7HB 1P9MC 4UDTB 4XVSH 3PBGA 2AJSL 4NCC2 2EDKA 4KJWD 4EN3C 3ARFB 2H9GB 5EULV 2GJ6A 4KXZH 5K9KB 2VQ1A 4O51A 2PW1B 5DK3A 4F58H 3QI9D 2N7BA 5F89A 3QEUA 3KYOB 4HKBA 3MGAA 4BH7B 1IC5H 3S34L 3O3EA 1OAYL 3TBTB 1D5BB 1FNEB 1U8NA 3CVHH 3NA9H 4U6HA 1TMCB 2DQEH 4H5SB 5HGDA 1WZ1H 1Z3GH 2OX5A 4E4PA 1U8LB 1GZPA 1T3FB 5I17A 1XR9A 3QDAA 4JFZH 2X4RB 1M7IB 3FT3A 4Z7WF 1MF2L 2GJ6D 3GI9L 4NYLA 4HMDA 3WFCH 4YBLC 4YGVA 2GUYA 3PZUA 2FJHA 4PJHA 4XGZA 4N8VB 3SGJA 4PLJC 3OGVA 5D96B 5T3XE 3ILPB 3SDXB 4R8WH 2N7AA 5DK2B 5GZNC 1MCLA 1WBXB 5FF6B 4FXKA 1MQKH 2X4PA 4YZFE 1A3HA 3KXFB 5IHZA 2H41A 1OD0A 1NL0H 3MMEB 3PZ9A 2A83B 1ITBB 2FZ3B 4D9QE 3LKRA 3REWA 2ESVE 1LE9B 2OTUA 1HDMB 4WIQA 2AJ3A 2F54A 3F5WB 1Y18A 4LASH 3RNKA 1A0QL 4JFHE 4XBPB 1BIIB 5GISL 3IJHB 1YEEH 5A2IH 4UV4H 3NVQA 5BOPA 3KWXA 4YFLI 1F4WH 3VXNA 2O26U 3MRKA 4N5ED 3CPLB 4GRMB 4LSSL 1XRVA 3BMWA 5E2WL 1XHGA 1KIRA 1R3JB 1XFPA 4MJ4A 1F00I 3G08A 3QH3B 5D9OA 3RHWF 1N7MH 1VGEH 3MA9L 4AIUA 2F54D 1F5WA 3EZ8A 5EB8A 1Q9LB 3MFFA 1MELA 2ZUVA 2XUCA 4M6ML 4G9FB 3IDXL 5HPCA 1ROWA 1H3VA 1YYLL 3MJ7A 1GGTA 4UFKA 4PRNA 3PABB 3GNMH 5HDBF 1NFIA 1UCTA 2HJLA 4M8QB 1E9LA 1NLBL 1U93B 5KSVA 2D3LA 5E03A 1F4AA 1CGXA 1QEWA 4Z2IA 2O5XH 5FB8B 1W9XA 2EDHA 5IHUL 5T33L 5C7XH 1HH9B 5F7YC 5IVXF 1P6FA 1OAQH 4E41A 2X09A 4NJAL 4JHWH 3HG1E 4WSJA 2XKNB 4KK9C 1G5AA 3P30H 2JCCA 3U1SH 1P4BH 3KL3A 3L5WB 5HDLA 4O02L 1CYGA 1JPTL 1U6AH 3D2UB 3CSYA 3OG2A 1F3DH 4KZDH 1NAKH 3X13B 2D31B 5DQDH 1FZMB 5EO9A 3QEQB 1G9NC 4MQSB 4HX1B 4ERSH 4W6WB 5SX4I 4XPFH 5DS8B 3AMKA 4E41D 3U5YA 1U8IB 5GRUH 1P2CA 2VCCA 4NKDB 1NCDH 4RA0C 5JXAH 5IR1A 4DUWA 2E9LA 3LVEA 2VABB 2MPAL 3VGBA 4PJCA 4UDTA 1MI5B 3S37H 5E24E 3KL5A 2FX9H 4QGTA 3VKKA 3WH8A 2BNRB 1ZEAH 2H9GA 4W8BA 1HWGB 5D5MF 3B9AA 5LG1A 4F9PA 1X3DA 3VFTB 2NY6C 5KSBE 2GK1A 1SMDA 1C8QA 1D5BA 3O6LH 2YS4A 4LKXB 1JRHH 3HUJE 1P5UA 2FL5B 2BSTB 4X4XB 3FOMB 4OGYL 1CGWA 5T3XH 4KKCD 3MRPA 4YK4C 2X70A 2H32H 5FIPA 3NIFF 4YPJA 4NO0A 4OGZA 4FFVC 1MJ8H 3BIKB 1V3LA 1E6QM 1Z32X 2DSZA 2WK2A 4YHLH 3L3KB 4J1UB 3S9DB 3EBAA 1YQVL 4IOIB 2NT1A 2I9LB 1CFTB 3ARQA 2A83A 3DUUB 4JKLA 2W0LA 3OKDB 4WFFD 3O0RH 4AQ1B 1A1MB 1GPOL 2ORBH 4JFFA 4NO0D 1E5JA 1BHGA 4NFCA 1S9VB 4PY7A 2QQQA 3OKEB 4W87A 1DLFH 5CEZL 2EDXA 4ZXBC 1E0OB 4ATLA 2D7OA 1A9EA 1D6VL 2H2SD 4RNRB 3V4VL 5DC0A 2FDBP 4YDJA 3T4YB 4PJ8B 1RJLA 4M7JL 2AVGA 3CPLA 4GRMA 3DVNB 5ALCH 3BP5B 3DPBA 5E8OB 3BAIA 2BVPA 1DANU 3R8BB 1CG9B 5JOEA 3SGEH 4FABH 3L5JA 3QH3A 4OCXL 4JFFD 4ZXOA 3S35H 1HHGB 2DSUA 3EOAB 2E6JA 4WW2B 5I1EL 3BPOB 1Q9LA 3C6LC 3BN3B 5GGRB 3QFJE 1PIGA 2CDFB 2ICEA 2FHFA 2X4QA 5FO9B 4BFIB 2VDLH 2BNUB 1IGIH 3VFPA 4PJ7F 3ARSA 3C09B 3QT2A 3OGCA 3KAAA 2IPKB 3I6GB 4KK8D 4HS8L 2FATL 2VLKB 4Q6IC 4UDUA 1W3KA 1WWBX 1ODUA 1CFQB 1U93A 1OQOA 1EGJA 3WN5B 1WBZB 1YPZB 2XTJC 5FB8A 2WHJA 4PJFE 1B0RB 1VCAA 4NQDE 2P7TA 5E8PB 1AD9B 4ZUWB 5DEZA 3UYPA 4AD5A 5D7IA 5F7DB 5MP6L 1GJIA 5CP3H 5FGCB 5F9WC 1KLFA 1JNNL 1MCEA 2IFGA 1OP9A 3RGHA 3BGFB 1HSBB 1T0MB 4R4FH 1ZK9A 4W6YB 5IQ9B 2J5LC 4XB3A 1BVZA 2DKSA 3OBAA 5IJKC 3SKJL 1FZMA 3U4EB 3QEQA 1DQJA 2HJFB 3VG0H 1ONQA 1CDYA 1K9TA 2B4CH 3W4RA 2W38A 4NZCA 1MREH 3IFNH 1FZJB 1WICA 2ZOKB 3GMPB 4J2XA 5BXRA 3SCVA 3L95B 3BZFB 4J3XA 1ZS8A 4OZFG 1NUFA 3T2OA 5JW4N 4MB5A 1W1VA 2OJEB 3I75B 3DOSA 4DM1A 2PCPA 4LLMB 3D6GA 1JHTA 1Y6NR 3GMRA 3QEQD 1JFQH 5D1ZB 5FECA 3WKNA 1BBDH 1A3RL 4NCDA 4TUOA 4OCRH 2JFEX 4OLXL 3CVHA 3G6JF 3GH4A 4ATDA 5B38G 4LKXA 1AD0A 1IZJA 4P4KB 2P44B 1N5AB 5FA3B 1AY1H 1FDLL 3D5OF 1MI5D 1B4JL 5T3ZL 4JRYE 4PREB 3FOMA 2ADIB 5CKGA 1N59B 3TBYA 3GRWA 4E8CA 2FX8H 5C9JB 1I3UA 1IGCL 1GXEA 5EBGA 5C0FB 2ESVB 3X11B 1BLNB 1HIMH 5DTFB 1PLGL 3VXOB 4GXUN 2QQNH 4R7NA 4RQQB 4I0PB 4XPTH 4X0NA 1GGUA 5KJRH 2YUWA 4FQCL 3AI0A 3PHAA 4PMRA 3QDGB 2K7QA 3M8OL 3ZDYE 4KROB 4LCUB 4IOIA 5MEOB 3G04B 5A2JH 2CXKA 3NN8B 5FYKE 1GGBL 3S4SG 1T21A 3G6AA 1A1MA 1PSKH 1T1XA 4X0VA 1A7NL 2MCPH 5E56A 1U36A 3O9NA 4MZ3A 2G5BA 1IEBB 4M1GL 3D0VA 3QXTA 1XF2A 4N90D 1B4RA 4FFYH 1TG7A 3CVHL 5DZNA 2DQEL 1WFNA 1WZ1L 2J7LA 1WNOA 4OI9A 1ERNA 3PV7A 4GRLC 2VO5A 5AYIA 4LK4A 2L7JA 2WBWB 3N06B 5FKAB 2V7NA 3GRWL 5A6BA 1EXUB 1DSFH 2BSSB 2DT0A 1H8SA 2YSSB 3EZJB 3WFCL 1UR4A 3DO3A 5TGBA 1AQDA 4RIRB 2XT1B 1JTOA 5FO9A 4BSJA 3ES6A 1MQKL 1DL7H 1YMME 3W0WE 4QEGA 3UJJH 1CLZH 3JZ7A 3IETB 3IVKB 3HG1B 1V3JA 1MCBA 4R0LA 2HT3C 3RVUD 4XC3H 1J5OH 2ZG1A 2A3BA 5A6BD 2CR6A 1Z9OA 3WN5A 1YPZA 3OKNA 3QUXB 3TESA 4WGVB 1G7HB 4P2OC 3TWCH 3VXTB 4DQOL 2OTWA 3Q2CA 1YEEL 4I3GA 5E8PA 2AEWA 3BHBA 4P2RE 5KS9B 2PC8A 5IBUB 1T66C 1ESWA 4Y5VA 4NSKB 4LBEA 2EJ1A 2IEPA 2B8OT 4YBQC 4P0DA 1B3ZA 1T0MA 5B4MD 4UILL 1NAMB 4F7EA 1WVZA 1VGEL 1INEH 2QEJA 1RP8A 3TN0B 1KG0B 5CIPH 1EFXA 1T83A 3LQAH 1WZMA 5HTSA 1PG7W 3EJZD 5I71C 4EIZC 4ORZC 5AY7A 3S98A 4LYPA 1T5XA 4QY8B 4YQXH 3H9SE 3FB8A 4GS7C 1EMTH 1YMHB 3MUY1 4QLJA 3BUTA 3BZFA 5CJQH 3GNML 3FRPG 5KSBB 2XKUA 5DURB 4N0CD 2VZ3A 5MERB 4MAYC 2CGRH 3I75A 4M7KL 3TA9A 1NGPH 3P4MB 3HUJB 4B9YA 1YEFH 3EYPA 4OUOA 4LLMA 1EFXD 1GCYA 3RWDB 5EZLB 3C60B 1TQCC 1T89A 4YO0B 3ZT7A 5DT5A 4JHWL 5I1JL 3GMQB 4XHJD 3IFOB 4KKAC 5HI3D 2C4FU 5ID0B 1SYSB 1ZWIA 3CXHJ 5IWLA 5J8OA 1CIUA 1J8HA 5JW5A 4RWYL 4UTBL 2H32A 4Z76A 3RX7A 2BOCB 2FCBA 5DQDL 2YEZA 1NPUA 4ERSL 1LEKB 3LMJL 2B1HH 3OHXA 5C0FA 1RQ5A 2ESVA 5D1ZD 2EYRA 1XSIA 4MCYA 3VXOA 5HY9B 3V0WH 1HEZB 5FYKH 4XP6H 1X5YA 3Q3GB 4I0PA 3B9KC 1E6JH 2Q76B 2AV7A 5I1KH 2G3IA 1J8HD 4MNHB 4DUVA 5T3XD 1E4XH 1WTGT 4NJ9H 3VGHA 1O5DT 1RJCA 2FD6H 1NKOA 4B3KA 3VA6A 1MH5B 5DWUH 2C0HA 4OFYD 5I75B 1E70M 4PEEA 3GJEA 4L8BB 5I76B 2J7CA 4KZEL 2DS4A 2ESVD 3HB3D 2PBOA 1QFUL 5FHAH 1XH1A 4I0PD 5ABEA 5HDQL 3QIUC 1GHRA 4PJGA 3DUSB 4NF7A 4RGOL 2H8PB 3QFJB 1AFVL 1HWHB 1OGTB 4KROD 4IJ3C 4PJ5B 5T3XL 1QPKA 4KI5C 3C2AH 2WANA 1ZU8A 4PJ9C 4TVSa 5L6YH 4HJJH 3PTKA 1QFOA 4HFWA 4HKZA 1EXUA 4LGSB 4Z7QF 1U3HC 3LDBC 2GAZB 1RK1A 3VRJB 2JF7A 8CGTA 3QJHB 1JPSH 1S9YA 4UT9L 3JTTB 1XSKA 5HGHB 4PJFB 5J6GB 4P7LA 4WKAA 2CDEA 4PJAE 5D7LE 1EGZA 3S96A 5D7KE 2BVDA 3IVKA 1ODZA 3EBVA 3AREC 2EE2A 4HS3B 1E0VA 5I6XB 4X6CF 3PV6B 1IJ9A 5HPOA 3O6FB 2PBGA 2I27N 2P1YA 3O3UN 3W5NA 1DLFL 5E99H 2IANB 4KAQL 5I15L 1G7HA 5I2IB 4FQJH 3CHDA 5CP3A 5GS0D 3JWOL 1LMKA 3S88L 1EA9C 5ILTL 3OJMB 5TQ0H 2JIXA 2MMXA 3NCYS 4MSWB 1UEMA 1GSMA 1N5YL 3HRZA 1A9BA 1BM3H 4IRJA 4Y5XB 1KN4H 5AEAA 2IMMA 3A0OA 1MIEH 5D6CB 4CJ1A 4HK0B 2NSXA 4AISA 1N0LA 1IGIL 5GS0L 43CAB 2CLVB 4FA8A 1LEIB 1YMHA 4R4BB 4MWFB 5H94B 2AJXL 4BQ9A 2JIXD 3O4OC 5KSBA 4AZ7A 3QDME 3IDJB 1VFUA 2EYTA 3B3IA 3P4MA 4HXAL 5DR5L 4LMQI 4AH2A 1URLA 4NO5B 1TVHA 5M5DA 4JRYB 5HDRA 3THCA 3KS0J 4K8RC 2PYFB 1W72H 4O00A 4YO0A 3F5KA 5IFAL 3VGFA 2YD3A 3BGMB 2APVA 4D6JA 1J1XH 1UZ8B 2JJUA 5DURD 2YXFA 3WIHL 2BS9A 4UTFA 4F7MB 1NAML 1ZAGA 3MRQA 2ITCB 1GL4B 5I1CL 3ARPA 5JBDA 2JB5H 3ALPA 2R9HC 2B4CL 1FYHB 5K59F 5JOFB 3C9NB 4R3SB 3OG4B 3R8QA 4F7PA 2VXTL 1A3QA 2NY1D 4TVPL 4RDQF 1TPXB 3HCVA 3QR2A 4PG2A 1P7KB 3GO1H 1ZT7B 4JKWA 3KPOB 4EOWH 3G6MA 2D7MA 1INQA 4Y4HB 4M48H 4H8WL 1VB9A 2BJML 4TUJA 3CHCA 1MH5A 2HJKA 1NDMB 3U9UA 3IS0X 2GW5A 4K2UH 4L8BA 5I76A 4OCRL 5I9QB 3WIFA 1EJOL 1QOKA 5F21B 1V7MH 3AQUA 1CU4L 2XZZA 4J8RB 5C0EA 3QPQD 1X5KA 5JORA 3DUSA 5FK9A 3RGVB 1JF6A 1YMMB 3MKKA 3L7EA 4U1JB 2QHLA 3W0WB 1P53A 4D6HA 4I77H 3R4DA 3MGOB 5JQ6H 2R1YA 5IKCA 2WIMA 3EYSL 4HZLA 1TA3B 2R2CA 1HIML 5BRPA 1GW1A 1KPRB 4MQ7A 4ZSOA 3VRJA 3WL9A 4ZOEA 3GSQB 4XPTL 3RJDA 5KJRL 4UIMA 1A7OH 4PJFA 4NQDA 2V5CA 3W6LA 3M1BA 2COQA 3GSWB 4P2RB 1BQLL 5DRXB 1V0NA 1BYCA 4PLKC 2NY7L 4HS3A 1PSKL 3V6FB 2MCPL 3O6FA 3VG9C 4XV0A 5IVXB 4KUZH 4DK6A 1T7ZA 5MHSE 3L4ZA 4G8FB 3VFMA 3WUEA 4UBDC 5CWSA 1MFNA 1DQDH 3L3HB 3RU8H 2NNAB 2WMHA 4NQDD 1FAKT 1I8KA 3C8DA 1G6RH 1MOEA 3H9SB 1R3IL 1BGGA 3EOBA 4B53A 4OGXL 1WITA 2E6PA 5CIPA 3MZTA 4L1HA 4XNQB 3FQXA 4XB7A 3O6FD 1I85A 1I1AC 2PWFA 4GQRA 2MFNA 5D6CA 4HUKB 4U6XA 2J7FA 2YD8A 4MDIA 1R5VB 1A2YB 3W39A 1FNFA 2Y6SD 2XG9A 3MNZB 3IXTB 4Y16A 3UJJL 1NEZG 4JKMA 3ZDXE 4PIRF 4PGBA 2A2QT 2QHRH 4PLNC 4J4PC 5FFLA 2CK0L 2XNAB 1JZ4A 2CK2A 4KV5E 3X14A 2OSYA 4TQEL 4X4YB