4HMEA

Crystal structure of cold-adapted chitinase from moritella marina with a reaction product - nag2
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmeA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmeA01
4GAFB 5J0BA 1DZBA 3WLBB 1W9DM 4Z2GA 3HG1D 3K8MA 4QCIA 5HGDB 4ELME 2YZ1A 4L3EE 1QACA 2BHYA 2WAGA 1PZ5B 3O3BA 3MROA 5TQ2H 4HGWA 4D0CA 1CLVA 2EDEA 4AD1A 2AJ3A 4N8CL 3LB6D 1ZLWH 1I7TA 2OTUA 3EYQD 5C0RH 2IGFL 5I1KH 5CUSL 1JRHI 4DAGH 1EJOL 1T5XB 4OB5L 1A02N 1IEHA 3BAJA 4HUNB 3CU1A 5E9DA 5KG9B 1XYZA 1XD0A 3NGBB 2Q7YA 4NWUH 3WCYA 5GGVH 3BLPX 2XWJA 4LGXA 1UH4A 5HVWA 1N2RB 1I1AB 3CX2A 1HXMB 3ULUE 5JUEL 1OM0A 1EEYA 5CAYB 4XHQA 2QHLA 1HSAB 3QNXB 1LQSR 2J8UB 4A6YL 2E0PA 3NCJL 3OXSB 1HH9A 1GQJA 4R0LB 1DBJH 1AQHA 5GPRA 4GJTB 3BP4A 3ULVE 4I13B 3EMQA 4EDXB 4G3YH 5JQHC 4QXUL 1Z5LA 5FOBB 2YD7A 5GSRB 2HN7B 4YFEA 2PI6A 1FGVL 4HUUB 2VN7A 2QV4A 1W0WB 1LDSA 4F9DA 2DQJL 4QAWA 3O45B 3SOBH 3QDHA 2XZAL 3CFBA 5E1AA 3UJTH 1EX0A 1WTLA 4H20L 1UH3A 1U93A 3X12B 4YK4B 4LFHG 2R0KL 1KCVL 3RNKB 3BZEA 1ZWIA 4YUEH 3W6LA 3SUSA 3EFDH 2DQXA 5CGYC 1LE9B 1UVQA 1E55A 1K3ZA 2E7BA 1TITA 3BKMH 4DGVL 2G3NA 1UG9A 4KGJA 4Z7UA 4NNXA 3HRZA 2APXA 1T1XB 4I77L 4PRAB 2BNQA 5IMKA 5KBNC 1CWVA 1G9NL 1UCTA 1YECH 4NQSB 3X11A 5BS0A 4H8HA 1G7JB 2ZUQB 4Z8FH 2YD6A 5K33A 3HAEA 1ZAGA 4ODBD 2HJFB 4U3AA 1ZTXL 4CADA 1H15A 1K8DA 2NY2B 3L5WA 1ORQA 1DBMH 4LIQH 3KYKL 4H8VA 4MAYC 4NIKB 1JPSH 3OL2A 5K9QI 1GIGH 4NJ9L 3RI5K 1A7PH 4JPIA 3QIBA 1MCOL 1GQIA 2D0HA 1UJ3C 3LKOA 4HFUH 1O0VA 5DK0A 4LSDA 5EO9A 5T1MB 7FABL 3OXSA 4UINL 2O5YH 3HZYA 4HXBH 5DD5H 5T5FL 4EJ1C 4TOYL 3QG6A 5CGYD 4TYUA 4GRLB 4MDIB 5HDQL 1UGNA 3AAZA 5IFTA 2Z8SA 2BDNH 4J3UA 5FOBA 2Z92B 1JJUA 3M17A 4M62L 4D6CA 4JFEA 3WDQA 3WE6A 5EORL 1WBYA 4ENEC 4QEGA 3T0EE 3JWDL 5TF1H 4U4BA 4YC2B 1WP6A 3MLWH 1B2YA 2YA2A 4PV8B 5BS0D 3ARFA 4FFWD 1XGQB 4FTVD 3ZHDA 2Q86B 4FOMA 5CEXB 5C8BB 3BPLC 1IFHL 4K8RC 4C4KT 3F6LA 3ARDC 5DDHA 4XPGH 1SBSH 2ARJQ 4HKXA 1FV1A 4P5TB 5DMGD 2ZX8A 2V7NB 4F3FA 1G7IA 1EGJH 3CFKA 4QT5B 4MNQA 3BPCB 4MS8C 4N5EC 2UY2A 5E99L 1CFBA 4P5MB 4AYFA 3A67H 1U91A 3ARVA 1PZ2A 3NIFF 3WUWA 1G9HA 1A0QL 3SKJH 3ZIZA 2QQLL 4MA8L 1FVCB 4JO2L 2CCRA 2PBGA 4Y19D 1RP8A 4OM0H 4JHBA 4PRNA 2IUZA 2GK1B 1FZMA 1HIML 5AY7A 1H3UA 3H9SD 4KI5D 1UA3A 1LLOA 1JPTL 5KOMC 4OZGF 3O6LL 3WHXA 5GS0D 2EEXA 5E8PA 4JB9L 3BX7C 4JFFA 3B2VH 2EO9A 3LKNB 1S9YA 2FBJL 1MQKL 5FO8A 4Y1AD 1B90A 4I5BB 4WHTB 3MMEA 3MJGX 3SO3C 1W1PA 1F4YL 5K9QG 5MP6L 4LLMB 3WO4C 5CSZA 2SEBB 3TBYB 3U7WH 4ZS7L 1OD8A 2H2PD 4I2XE 2P46B 1I8MA 1OD7A 5EZOL 3JTSB 4XPFL 4WO4B 5IB1A 2WCGA 4APQB 4NZRL 4Q74A 4RFNB 1I3RB 4RAHA 3BP6A 5HGAB 3TT3L 1BGAA 3KLAA 1YDPA 4X6CA 3B5TA 4G9FD 3RWFB 2Q76B 4F9LA 2NY4C 3GH4A 2FJGB 2VQUA 1VACB 5DHYA 1NWTA 1OTTD 4XNQB 3IVKB 4KK5D 2K7QA 3PTKA 2NZ9C 1IC5L 2C4FU 4M1DL 4JFHE 3D2UB 4RDQG 1U91B 4HJJH 4W89A 4JFDE 2YUVA 3T77A 1B0GA 1X4YA 5ITFB 3TM6A 2WQ8A 3C60D 1SM3L 3I6KB 5GZNC 4TTUA 3EOTL 4QXGL 1JVKA 2EYTB 4PB0H 1TTGA 1QQDB 1CT8B 4LLYA 1P84J 4TULH 1F90H 2HT3C 5C6PB 4PJCE 5DMKB 2W0FB 2XM2A 3FT4B 1OBAA 4CN1A 1QPPA 1OOAA 2CERA 2V2XB 4JFYA 3HG1B 3NTCL 3TVMA 5I2IB 5FKPB 5GRVK 4ZXBB 3FQWA 1RUPH 2PF0A 4POUB 5FGBA 2J2ZA 1PGRB 1JWMB 4JFSA 5FHAH 1MH5A 5HDOA 1MWAB 3BZFA 3AM8C 4S1QH 1AQKH 3HPLB 4CDGC 1L0YA 2IADB 2O61A 4KK5C 4P8UA 1BD2B 3O6ML 5HHOB 1JFXA 2FWOB 3W37A 1MCSA 2DWEB 3CHCA 5FHBH 4JM4L 3NGBC 1RZJL 5MI0B 3VE0A 3HB3C 4WO4A 1QI0A 3DOSA 2AOSA 1CFQA 3BYYA 5BZDA 4R2GC 5CKGA 4AISA 1MQRA 2RR3A 1Q9WB 3VWKD 4X7SH 2Z31B 3WFLA 3PWJA 1RZGB 4OZFH 2IFFL 5HHNB 3MGTA 2C4FT 2BRQA 2BOBA 3MRCA 4RCAA 3MO1A 4C56B 4OCXL 2OJZH 4PGBB 3PP4H 4F7MA 3MO4A 2O9OA 1DLFH 1I4FA 4QRTA 4Z5RB 5T33L 1EXUA 4NDMA 2FYYA 4YBLB 3T3PF 4JEGB 4XP5L 3GMQB 3VFPB 1T89A 2CDFB 3FTGA 2IG2H 1MFCL 4IOIA 4OZHA 5A8NA 4X98A 1ZA3B 1NCAH 2JALA 3AXLB 1EO8L 1T1YB 4BH8A 2D9QB 2WSPA 1X3DA 1DLHA 3VXRE 2P8LB 1U41A 3G9VA 4UV7L 1JD7A 2XSAA 2V2XA 2A6KB 3HR6A 1N3NA 3PQYA 2G4FA 1K6QH 1ZHLA 2VH5L 3GNOA 1LWJA 4JGMA 3MREA 4L3EB 4MA7H 5HHVH 4MXWL 5C08D 4RMVA 4LEXL 3WD2A 4G9FB 1YEGH 2O61B 2GJ6B 5CWSB 3QHMA 1OINA 5J89A 4ZXLA 3FQTA 1INEH 3O2LA 4QTHA 5I66A 4RMWA 1AIWA 1VEOA 1N0XL 4HWBA 2EE2A 4JY4B 4DTGL 2FECI 4Y5XA 2EQDA 2X5PA 4MDPA 3HA0A 4LHUB 5C70A 2XIBA 5FOJA 1MPAH 5D7JC 1JZ3A 4P2RB 4W68A 1I1AC 3MGTB 4PJ5E 2RFXB 2XFXB 4X7DC 4FFZH 4JZOB 3TZVC 4HW6A 1XSIA 3RRQA 1GZJA 1IC4L 1UWGL 2DQUH 2C7UA 5A8PA 1TNNA 2QBWA 4D9RE 2XM1A 2VIRB 2IQAA 5IJKC 4JZJB 5ACZA 3CLEL 3RVVD 1G6RL 3AREC 3D85D 4MZ2A 1A3LL 3IETA 2XZQL 1DQQA 2VL5A 3LEYL 1AQ0A 4LEOA 2W66A 1BYBA 3U0TB 3H9SB 1QHOA 4KY1L 4LSVL 1IKFH 4Z7OF 2XIIA 2X0YA 4RMRA 2RHEA 2X10A 4G7VH 5DJYB 3A6BL 1JHKL 2ENSA 1H9VA 2FX9H 4ODWA 5D96B 1BREA 4QRPB 1KENH 1T1WA 4F57L 3IU3A 4YX2L 4HUXB 3S3PA 4KU1A 4ELMB 2ATPB 4TRPH 5B8CC 1SVCP 4W4OA 2CD0A 4G7VL 4NP4L 4P8WA 5IB4A 2ZUQC 2APWA 2HLFD 3W2DL 1NFDA 1ECEA 4PREA 3TIEB 2PR4H 4W4OC 3UJJH 4CCDA 4F9PA 2VZOA 2BJMH 3SIMA 4NKMB 4MHHI 4MQ7A 3ZE1F 3V2AR 4XCNB 5GS3A 3FQTB 1A7PL 1UD2A 4FNLH 3Q6FA 4GMTL 2FLBT 3PZNA 5I18H 3GRWL 1B6UA 1CF8L 2OTPA 5F1SA 1OIFA 4L8CB 1D9KD 1ESWA 4TVSa 3B9EA 5F9DC 3ILPB 1NLDL 4L4JA 3SDDC 3CUGA 4TQEL 1HE7A 3DMMA 2NT0A 5CPQA 3GSXA 5FDYA 3GO1L 5D2NB 2VLMD 1Q72L 2QSCH 4HP5A 1KJMB 1E6ZA 5D1QB 5C3TA 1I8IA 5C0DB 3GRWH 3LN4A 5FUCC 2DQDH 3O2DA 4XBGA 1S7RB 4F9JA 3TCLA 2VCAA 5EIQA 4I2XB 1UKTA 1ISVA 2XY2A 4KHTL 1U8OA 2X4TB 1S5IL 4OD1H 1ZLSH 4AZ6A 1CXEA 2FNBA 4PJAB 2DLHA 3MRIB 4WFFD 1YNTA 3L3HA 4L8SC 2A0LC 3B9KB 3KJ6H 1HQ4A 4M93C 1DTUA 4BFGA 3KLHC 3LS4L 1K4CA 3QP3A 4E9LA 5TD4A 3QCVH 5ERWA 1BWWA 2WK2A 4OFVA 1K6QL 3IKCB 2Q6WB 4C83B 3HE7C 3EOAA 2OJEA 3S6TA 3C6LC 4J27A 3PZ9A 1IM3B 1SHMA 1QZ1A 1YC8A 2D7OA 4O5LH 3VTRA 1DWFM 3WFBH 3LIZL 5IB4B 1NMAL 1D5BB 4QRUA 2W91A 4P0DA 1RJYA 4GXUM 2JIWA 5IG7B 2X40A 3S4SB 2DI8A 4XCNA 3I3EA 2ZCLH 4BQ8A 3HRPA 2VI0A 4HHAB 1BGXH 3ZJ7A 4XCFL 2VX6A 5ID0A 1CICB 1OAKL 2LE9A 3QFJA 5I1CL 4PJ9B 2GITA 4AEHH 1HHKB 4HH9A 3UYPA 4YUEL 5FUOL 5E6ID 2XACC 1C5BH 3BD3A 4N0CC 4AEEA 2LAAA 1IGJA 4EN3D 2BVYA 1E73M 3QRGH 4UV4L 3L3JA 3SDCB 2EBNA 4S3JA 3V7AG 2H8PA 1VJSA 1ED3A 1RURL 4O00A 1CFSA 4M8QA 2ZCHL 4WFGD 1TUXA 4TOQA 5LQBL 3DGGB 1CL7H 4UQ3A 1C5BL 5ANMB 3RPIA 4YXLL 2OWWA 3ARWA 2FDBP 5CLTA 3VXPA 2CBUA 1VEMA 3MCLH 4YWGH 3RUGF 1UWUA 4HIXH 4PJAA 5AWNH 1MHCA 2X4UA 1YNTB 3L3HB 4AH2B 5EOTB 2Y7QA 3FO1A 4PJDF 4MAYD 4JE4B 4P2QE 1KWKA 4YXKH 1YN7A 1I8KB 4KMTH 1IT9H 3VI3E 4NN7B 1ACYL 1T7YA 3NCCB 2R23A 3ZT5A 1US3A 4DGIH 1KPRB 3C6SA 2VAJA 4U1HA 1E4LA 2GT9B 4Y8AA 1HXMA 1RUMH 4DQOL 3L4ZA 1D6VH 4XCEB 2IPUK 4NQCE 2HJLA 4XB8A 3BAEH 1A6WH 5J12C 4N5UA 4WIQA 4E41A 1GGIH 4JFEE 4OGAC 3D6GA 4G80B 2BVTA 4NO0A 3G5YA 1YY9C 4RMTA 5SX4I 4OJFL 3P77B 1RUKH 3ZKXC 1T89C 1QNQA 2WIIA 4OLWH 1QSEE 2AABH 1N4XL 5ID0B 3IFPB 3ZYJA 3LEXB 2GITB 5T1LD 1H5BA 4XVTH 5E2VH 4EN3A 3K0WA 4PJFF 2JJTC 3RGVB 1FN4B 2EDRA 1MCOH 5E1AB 3SJVA 2A3BA 3C9NB 4KH2A 5IUSA 1UFUA 3TO4A 1NCNA 1ZJBA 2J7EA 3W6MA 1XGPB 4Y4KD 4JFFD 5ESQA 5EBLA 3DI3B 5GSVB 2MTPA 2GJXA 1KIQA 2PW2A 1CGWA 3TFKD 3KEHA 3WUEA 4PV9A 5F72S 5E6IA 4DVRL 2X4UB 2BNQB 3CFCH 3K80A 3DXAE 4Y4HC 5CJQH 5KJRH 1QRNB 3TO4C 1YN7B 1P4BL 2DM3A 2P5WD 2Q8AL 2VC9A 3GJEB 5KVGH 3T4YA 3EO0A 4OCXH 2RBLA 3T8XB 3GM0A 4CW1A 3IJ8A 4XC1H 1U8NB 3BZ4A 2CDEB 1UA6L 3BUTA 4B3KA 3BQUB 4U1HB 2XTJE 1VERA 3NIGF 3OKLB 4X4XA 5L2JA 3D18B 5CSGA 5MENB 2QLVB 4FS0A 3E8UH 2AJUH 4YDKH 4FABH 2NY6C 1WC7B 5JXED 1EVTC 2EO7A 4JR9L 5I30L 2IWGA 2XIDA 5TDPA 1MI5D 2H9GA 4ISVB 4JCLA 3QDJA 4PB9L 1D5IH 1E0WA 4XUYA 4PGCA 1TNMA 4FQJH 4YBQC 3ZDYF 3VGEA 2Z92A 1E1EA 1F6AA 2UWEA 5FL0A 4NNPH 1YN6A 1GGBH 2VLRD 3GUTA 1NWSA 1AP2B 2LTQC 5HBBA 1MCFA 4QRRD 2CKBH 3OV6A 4HH8A 3QUKA 4MQXD 4P8VA 1A2YB 3UZEA 1KIPA 3GMMA 1JNHB 1Y0LA 1DLFL 1K6AA 2X4QB 3GXFA 3IXTB 3TO4B 4P2OA 2GJPA 1ZT7A 3VW3L 2ZPKH 2R4SL 4WI9A 3V6BR 1XGQA 3IFOB 5C7XH 1KXHA 1D5MB 3PZQA 2EYSB 4IPNB 5CEXA 3RJXA 3ECBA 1AGBB 1HILB 4IJ3B 5LGKA 3WUGA 3C5ZC 1J12A 5GSVA 3T3MF 5CKAA 1E4XH 1KIQB 1ZHBA 2PW2B 2CJUL 4WFGE 4IHOA 3CVIL 1HHJB 1MFBL 3FO2A 2UWFA 5F7MC 1FGNL 5A8OA 5BV7C 2X9XA 1A3RL 3HI5H 4OD3L 3KPOB 1J9YA 4HZ6A 1G7IB 4LHUD 2CSPA 5IB5B 3BUYA 4NRRA 4K7FA 3WIFA 3OHXA 4QF1B 4YHLL 3T4YB 3T8XA 1BQCA 5D8JL 1U8QA 1NLBH 1S8DA 5HD8C 3QG7H 1NGYA 1ODUA 3NIYA 4OCNC 4Y88A 3VFUA 5HYJE 3O4LE 2XN9A 4X4XB 2AJXL 5KVMC 5L2JB 4Z7VA 3VWJC 1RUPL 1VGKA 2E9WA 4JN2B 4TUJA 4I18B 3RZCA 3PWPD 1NSNH 4MSWA 1J0IA 4O2EA 4PLJD 4W7WA 3QDJB 3N9GL 1ZHNA 1SJVA 4OLWL 4JDTH 3CXHK 1HL9A 1XIWB 2HMID 1CE6A 4HFWB 4EK7A 3KYNA 4H04A 5C6TH 3X13B 3TYFA 3LS5H 2WM0A 2M1KA 4OIAA 1B1YA 2SEBA 1WBZA 3DJ9A 4NI3A 1KTDB 2A0LD 3QUKB 3FQUB 3BKML 1I8MB 3HZVB 1KCRL 2E6PA 3BO8B 3HUJE 4MWFB 3SGKC 3TNMB 1G7MA 4TVDA 1FG9C 3BJ91 3LEVH 4RWHA 3IDMA 4R6UA 2C3XA 1BG9A 1L7IL 1IKNC 3CZEA 1T0MB 2OM5A 4HIEA 3MMWA 2BNQD 3LQZB 2ZG3A 1HILA 3RWFA 3QO0B 4RQQA 2WWMC 2PWEA 1J9CT 1QBBA 3TIDB 4P57A 5IGXH 1RJZB 4JFDB 4XNQA 3X3FL 1MCQA 1BLNA 3KPOA 4JQIH 4HDIB 4PY8I 3SDDD 2R1WB 3Q1SH 2C8NA 5I6XC 3L4TA 1MAMH 1J0ZA 1PG7L 1OSEA 3BVNB 3PWNB 5FO7A 4ELKA 1Q9LA 5F3BA 3S88L 3P11L 4L5FL 4LVNB 4LL9A 3RGVD 4PSPA 3SCMA 1CZ8L 3ULSB 5HI5D 4AJ0A 2OYMA 3MLVL 4NYLB 3E2HB 3A4AA 1CT8A 2GUOB 3MV8D 4EUPA 4LCWA 4OGXL 2I26N 2HT4C 1S7WA 3AISA 4ZXBD 3IXAA 4JFYB 5ITBH 4XZUB 5I2IA 1PY4A 2BVPA 3MUJA 1GAFL 1NGZB 5C0RL 3HG1E 1WIUA 5D6DA 4WUUD 2TAAA 3V6FA 5IEKA 1ZVSB 5DQJB 5IB2B 4NOFA 1M7XA 2DBJA 4NWUL 2QQNH 5DRNA 4YHKH 1JUFA 1RMFL 4UFHA 4WHCA 3TNMA 1E6RA 1CD1A 4GXVL 1BIHA 1BMGA 5ENWA 4P9ML 4YHPA 5K9OB 5C3LD 3UPRA 4YHNB 1CYGA 3CCHB 2CKBA 4LSUH 3VX0A 4U6XA 1JG9A 2EPKX 2ZE0A 4WO4C 4AIZA 3HI5L 3ILQC 4M4PA 4UIMA 3C5ZB 1MXDA 4OFYD 4J4PC 3VJ6A 3QDME 3UG5A 4JM2C 1TENA 4HUKB 4WJ5B 2XWTA 4F37F 4Q9CA 1N0XH 4LAJH 2VXQL 1EJOH 3DVIA 3ZOAA 1KF9B 1E27A 3QEQE 4HC1A 5F3HA 3GMQA 5HYJA 1QKZH 2VC2L 3FTGB 3QZWB 4Z7UE 3GB7A 5EU6E 1HWGB 4NJAL 4NT6A 3RGVC 3FHAA 4HCRH 3ZL4L 5IVZB 4F2MB 4CRPA 1A1NA 1Z2KA 4WKAA 1A7RH 3MRGA 3TZVD 1OPGH 4X9BA 4PRPB 3O9NA 4Y1AB 1JDAA 5CINH 3QI9C 1KXQE 4HIXL 5GGSA 4ZUVB 5F6IC 5E8EA 3UJJL 5C0GB 1ZS2A 1U8HB 4GAGH 5F9WB 4X4YB 3WEXB 3GHBH 3GSQA 3PHOA 2DQCH 3JVGC 4LHUG 4FNLL 1NH6A 2X41A 2EPMX 3ABZA 4WFFE 1E6QM 1CQYA 4LPVA 1MVUB 1ZBWA 1U8IB 5AUMB 2YXFA 2I9LA 4Y4HA 5EU3B 4HXAH 1A1OA 5GGRB 3RL1A 4M02A 1HNYA 1WB0A 4ZUTA 1GW1A 1FFNA 4H20H 5C0CA 4NBYB 3EYVA 2PCPB 5ABEA 15C8L 3QNZB 3GNRA 3RZWA 2A74A 4YX2H 5C07E 2VLJE 3SJVD 5FO9B 4EI5C 4TN9A 4B53A 2AGJL 3O11A 1UCBL 5EN2A 1PD6A 3KLSA 1JWUA 5DJDB 3SHSA 4NC2B 3H3PH 2OR7A 1RPQA 2CKRA 4WUUA 3UBXG 4F33A 4AL8L 3ILQD 5I73C 1L4IA 2P1YA 3VJ6B 3NACH 1BFOB 4HWEH 3G6AA 3PABB 1MLCA 1NQBA 2NLJA 1MAML 2EIDA 3SDAA 1EPFA 3CLFL 4TTGA 3RIKA 2WUBH 5EORH 5HGBB 5DS8B 5HYJB 5E8NB 5D9OA 4LVOB 4XCYB 3S9DB 2IBZY 1FFOB 5IVZA 4GI8A 1LE5A 1A1NB 1UZ8B 1GIGL 4NRZA 4W6XB 3TBSB 4AQ1B 2R56H 3RHWF 1MCNA 2AERT 1QNZL 1EBPA 4PS4H 3WKML 4UINH 1KACB 4OFPA 3EAKA 4XX6A 4WY7H 4IBLT 5JHDD 3I75B 4FFYH 4DZ8A 4C56D 3QZWG 4RWYH 3IJHB 1BM3H 3GSOB 5D4YA 4AM0A 5ABHA 4JO3L 4NQED 5LGJA 4ODXB 3E3QC 4DWHA 4DKEH 2CKNA 1A1OB 2A38A 4O51B 5IVNA 2VWEC 3G6MA 4QRPD 4HS3B 4N8VA 4UB0H 3P4NA 2WNWA 4NCC1 5FO9A 2DQIL 3VRLE 2FGLA 3X17A 4GG6A 1FORH 4RMSA 4U1NB 1BAGA 3PN8A 4MJIA 2EDYA 4X5XB 3E0GA 3B2VL 1CE1L 4YFLI 5BO1L 2EE9A 1GGBL 4LKCA 2UY7A 4M1CD 3T65B 1UWQA 5D1QA 1KBKA 8A3HA 1NMBH 1T20A 4K68A 3EDDA 1CEOA 2JCCB 1ACZA 4GRMB 4CVZA 3BEVA 1S7RA 1T83A 4CDHA 4FQCH 4TSBL 3I02B 4NQCA 3SEPA 3PIQA 3AB0B 4JHWL 2XVNA 1QBLH 3NA9L 4GXPA 4L4OA 4KKCD 5E6YA 1CFVH 1M05A 4FQ1L 1EZVY 2R4SH 4GKNB 4NJAH 4ZPTB 3RDTA 4ZNEE 1ULVA 1GOOA 1I3VA 3BLKA 1LG1A 3FZUC 4OQTH 4BFIB 1E4XL 1I3GH 4Q2ZA 3OKKA 4D94A 5FKAB 3KPQB 4RFOL 1RUML 4DQOH 4KXZI 4LP4A 3LMYA 1VBRA 5KVEH 1EEZB 1A3RH 5C0BE 4ZOCA 3KNBB 3ZDZE 4C83A 5E7BA 2V2TB 2EYRA 2XG4A 1Q94A 2KPNA 4XPTL 1NOWA 3AS0A 1RIHL 4U6HB 5C08B 2ATKB 2OK0H 2HLAA 3QG7L 2HAZA 1WZ1H 2V9TA 3PE9A 1RV6X 1NCTA 3MV9B 3TESA 3EUUA 1Q0YL 3REWB 1F11A 3VXUD 2HTKC 3IDGA 1CDUA 5D2LA 3W0WD 5EU5A 5EOQH 4L4PA 3MV8A 4TSCL 3KXFA 5J13B 5K59F 4KKLC 2J79A 5L2KB 3OAZH 4QGTA 3UDWC 2YA1A 3U82B 1F4WH 2KUTA 2PO6A 1I1FB 3RUGA 2KKQA 4WHDA 3KYKH 1ZA6B 4JDZA 3UMTA 1FSKC 1YPZA 3TTYA 4C7GA 4HWEL 1CD8A 1UM6H 4KJWC 2JK5B 4M7JL 3WFCH 4YXHL 4U6YA 3CIQA 2JCCA 3SGJC 1MHHA 5D7IA 5DD1H 1MYRA 1MJ7H 1P7QB 1A6PA 4Z7WA 4XNXL 2W5FA 1UKPA 4RL3A 5HTSA 5GHWL 4EUPG 5LAXA 5I1AB 1R3JA 4OLUH 4DKFL 4Q2ZB 4JDVA 3GIZL 3DARA 3CBWA 1GHFL 2W61A 2KQNA 1KJ3H 3O3EA 2HJKA 4QNPE 3MX0A 3U0WL 2YPKB 3C08H 2Z4QA 3L3DA 3QQ3B 5CJ5A 1Z9SA 2V2TA 1ZVHA 2L7UA 1B31A 4M56A 2ICEA 3MRBB 4EQ3A 4PRIB 2MKLC 2HJLB 4L3CA 1R5VA 1JNLL 2R2EB 5D7IE 2HLAB 2VX4A 1ISZA 5EU6B 3O3UN 3MUY1 4A6YA 3OIHA 3ARBB 4JM2D 3IJYA 3LEVL 3VXMA 1DANU 2BXYA 3G5YB 4FTVB 4NN6B 4Y7EA 5GZND 4DWSB 4Q9BA 2G9HB 2HG5A 3FMGH 1FRGL 1FDLH 1KB5B 2UV3A 2A1WH 3Q48A 3ZHLA 3WJLA 2AQ2A 3LSOB 4U7SA 4YFDB 4H0GA 5HY9A 5CZKA 1GAFH 3RUGB 3VA6A 5J8OA 1F13A 1N7MH 1YPZB 3GEWB 1ORSB 5EFIB 5B38G 2D03H 2NW2A 2VITB 3AHTA 2DT1A 1K8IB 4XNMA 2GK0B 4OV6F 1PG7H 3UPCA 5A8MA 5LGHL 1EJ6A 3K4AA 1MF2H 5L9DH 1M03A 2G5BB 3UXFA 4IRSB 3U5UA 4TSAL 2CMRL 5JLZB 2YRLA 3PWLA 1XEDA 4P9MH 4TVPH 1LL7A 2F19L 2UYLB 4JRYD 3VM7A 1U3HC 2ESCA 1AGDA 4ZXOA 4OGXH 1XH3A 4FQXC 1BYAA 3D39B 4PYSA 1TJHH 4O5LL 3PP3K 2J4WH 1C7SA 3OJDB 4M03A 4LYQA 1I8LA 1H8SA 3ZYIA 1E0VA 5JOPD 3UC0H 1RH9A 2B0SL 3GJEA 4OZFB 3BFOA 1IJ9A 4OSUH 2BSTA 4P4KD 5D1XC 5GRJL 3MSDA 1HYSC 1DL7H 1LGVA 2GK2A 4LLQB 2Z31C 5D9MA 3GSUA 2HH0L 2O5XL 3ET9F 5I1JH 1LJYA 3HPJB 4XCFH 1ZGLA 3A3HA 5E4EC 1DBJL 5BOZG 2OYKA 5B38B 1WZ1L 3M46A 4EXKA 3VD4A 5CD5C 2H9GB 2W9LA 4EOWH 1ADQL 2B0SH 2VJXA 4EQ2A 3T2NH 2PW1A 2FHBA 1OAZH 2J8UE 1FNHA 1JGDA 4PRDA 1NEZA 5CILH 5I1KL 2W65A 3P0VH 5I71C 3AIBA 4EIZC 2MHAA 3VG0L 1F6AB 3VXUE 1YEIH 3PHQA 5E8OB 3T0ED 3NJ3A 4I1NB 4HJJL 2QPSA 1JNJA 3DBXA 4NSBA 3V7AE 5DRWB 5LQBH 1FYTA 1R5WA 3GDBA 1JNHA 4UOW0 1E6SM 3DUUA 4FXGB 3VFWB 3J7HA 4P2OB 4X9IA 2EXYD 3PZMA 4YPGB 1JTTA 2ZXDA 5JPMA 1IL1A 2XGIA 1ZBKA 1N5AB 1J05B 5IIEA 2H26B 4EI5A 2HMIC 1Q9KA 3BXWA 3OG6B 4WV1A 3MLYL 2UYLA 1AR1C 3HRZB 4F7EB 4XZWA 4X0NA 4AD5A 5IJVB 1MCPL 5CINL 3OGVA 1HZHL 2I9TB 4BJLA 1M6OB 4ETQA 3V8CA 2FBOJ 1HP5A 5BS0B 3IJSB 4K07A 3IDJB 8FABA 3WIFB 2WBJC 4LIQL 4HK3N 3SCNA 3HAEB 2BSTB 4ORZC 3MLSH 4LSSH 5GGSY 5KVDH 4WF7A 5EU7C 3TN0D 1PLGH 3MBEC 1G6VK 2WUBL 5C2BH 2OCFD 4OUEA 1HINL 5FYJE 1J86A 1OB1B 3QIBB 4J3VA 4W81A 3IFNH 4JFOA 2I5YH 5EU4B 5L7XH 1W1TA 2PYFA 3HMWL 3FONA 5HHMD 5J6HB 3SKNA 5JZ7D 1HX0A 4GRLA 2YXMA 3MV7E 5T5NG 5BROA 2HFFA 2QQQA 2MSPA 4LNRB 1GL4B 3W25A 1DVFB 5I78A 2AGJH 5C0FA 5C0BB 4KUZL 2H32B 5EIVA 4QWWD 4CCEA 1XZ0B 3BKYL 1E9LA 3V5DB 5ANME 3SQOL 4AL8H 3WQ6A 5IXEA 4PJEA 3RTQA 2R39A 1Z9LA 4TUKL 5DRWA 2EDJA 4IS6B 1R5WB 3W81A 1MRDH 4H2CA 3MYJA 2ADIA 1TE1A 4L1DA 1BD2E 5HHOE 3IDMB 1FH7A 1BOGB 5F44A 2YLLA 1GRWA 4JAMA 5I6SA 2LVCA 1YQ2A 3PV6B 2G8ZA 2ZX7A 1H3GA 3TWCL 4APQC 4QLKA 1FNGA 5BJTB 4EEEA 3QHOA 2EEDA 1G9ML 4P57B 3K8KA 1RJZA 4JFDA 4XC1L 2DPEA 2NY5L 3CZGA 3WQ8A 1B4JL 2J12B 2COQA 1ISWA 2CESA 1M71A 1ITCA 3T0VA 3U6RB 4YN5A 4UQCA 3L3OB 1V6VA 4PN2A 3AM8A 3QUXD 1GUVA 4KQ4L 5FAAA 4P99A 4D9QE 1CS6A 1TQBB 3CH1A 3JWOH 4X6BA 3GI9L 2DI7A 3QA3A 4JY6A 2XKUA 2G5RA 4XAWL 5SWSA 4JHWH 3LKQA 4KKBC 4WEBL 5IHSA 3ULVH 1JXJA 3WENA 3EHBC 2YN5A 4W8BA 1Q8MA 4M5YH 5E8PB 4XX1E 1V0MA 1RHFA 3QR2A 1NCBL 4JPKH 3ZT6A 2DQUL 4UB0L 4Y16C 1TMCB 2CDGA 3VXRB 1T5WB 1IILE 5JO5A 4I3GA 2AXHA 1S7SB 5GGTL 4N68A 5BVPL 3I6LE 4POZC 4B9ZA 1FL3B 4HKZA 3O6FA 3HMXA 4OKVB 1A3QA 3S5LA 5F93C 1R7OA 3NZ8B 1UWTA 4G8GA 4PUBH 2BY3A 1FZJA 1L6XA 2ADIB 5DO2D 3B5HA 5CGMA 1NARA 1JZ7A 5DUBA 5KOVC 2BSSA 3WL0A 4JG0H 3CSGA 5MERB 3UPRB 4D6DA 3M6DA 1GZPB 4LDOB 1T22A 1V6WA 5DEGA 3KLAB 5JTWA 3GBLA 1UOKA 4U6XB 4X83A 5IMLA 1PZ3A 4MAZA 2Q76A 4Y0GA 5CP7A 4NFBA 3ALWA 3T09A 3WFEL 4OIIL 5E94B 32C2B 1PY9A 3BDYH 2L7JA 4FG6D 4ZO7A 2QR0B 3PWVA 2VX7A 3L4YA 1LO2L 4LCWE 4OLZH 4M5ZH 3OR7A 4LIQE 1V02E 3WMCA 4YNYB 3AXXA 3FFCA 2V3EA 4AIEA 1ZK9A 3T4AA 1YJDH 3LHPL 3ZKND 3O41B 5BXSA 5E5MB 1J1PL 3F5LA 5KS9F 3QH3B 3TJEL 4Y19B 4XNXH 3LKQB 3QFDA 1WDSA 2ORBH 4PRPA 3G6JB 3CUIA 4MLIA 2NX5A 2ZNWA 1GOIA 3WD4A 3FT4A 1I7RB 4G6FB 3HG1A 4BFEA 1P7KA 3WNMA 3WHE0 5K9JH 3MA7B 3RVUC 1WCBB 4M7KL 3L5HA 4NC0B 4GKLA 3LMJH 2XRAH 3HC3H 3GMOA 5T5FH 1YHTA 3RGHA 1BVKA 1L7IH 1RP9A 5I79A 4F58L 1P53A 4EDWH 4Y4HB 2R1YA 5CGTA 1A6TB 3EFFB 1J7VR 3U7AA 3WIHH 2D2OA 4CL7A 5E99H 4PJBA 1G9MC 1IAKB 1SY6A 4P3DB 3EYVB 3UTZA 4D0DB 1Z6JT 3MCG1 1H49A 3HJEA 4TVUA 1E4WL 4M1CC 2GCYB 5BZDB 3PXHA 5D2NE 4ACPA 1ED7A 1S78C 5DEGB 1IV8A 1FZOA 1RJLA 4NQDA 3OGOE 4PJCF 2Z8WC 3MO1B 1Y18A 4H5SA 3TO2A 1QR1A 5KSAA 4GQPH 2ICWJ 4XP5H 1AD0B 3FQNA 1HHIB 3C60C 4KZEL 3WFHB 1W3LA 4H0IA 3CH9A 1MI5E 3KPLA 2FYYB 43CAB 4HK3J 3BIKA 1CGSL 1KLUB 4KHXH 3WD5L 4JY5L 1RU9H 3KR3L 5IR1A 2QTEA 2FX8H 3D25A 3PL6A 1KV3A 2YUWA 5CZXC 1TZGL 1RZKC 4GQ9L 3S98A 4DN3L 5I73B 2HFGL 3FN3A 1WJ3A 1HL8A 5LVEA 4O2CB 2J7LA 4GW5B 3Q3GA 3OBAA 2EKSA 1X9QA 4XVJL 2B31A 3O9WC 3EYSL 1PX4A 4IRZH 1PKQB 4UQ2A 2WANA 1EIBA 1V7NH 2OZ4H 3GMOB 5ESVA 1WCGA 2ZUXA 2FO4A 2EDNA 1JZ5A 5IBLC 4ZOBA 3HLAB 2JE8A 5CWSA 1TETH 3MRDA 1DUYA 5JHLH 2J6EH 4HEME 5KSBB 3KPSD 3VI3F 1H09A 5CD3B 2D7NA 1KFAH 3UAJD 5I19H 3C5JB 1KWGA 3EYFB 4EOWL 1DQJA 4DGYH 1KQZA 4RE4A 3L6FB 2LAGB 3VCLA 3GRWA 2EIZB 4C56E 1CXKA 3WFDL 2VLME 4XPHH 1D3CA 4K94L 3IDIB 2KH2B 2D22A 3L7EA 5CZXD 4WI2A 2FH8A 5DSCB 5D1ZA 2HTLD 4PJHE 4X9FA 3K2UH 4WWKA 2J8GA 4Y2DC 3SY0B 1JF1B 2MCPL 1YEDB 3A6CH 3GNPA 4M7LL 5GRWA 3GTNA 3MLPA 4LLUB 3FQNB 3LEYH 3HR5B 2Y72A 4BZYA 3RILA 3QR3A 4CAGA 3MRLA 5IMOA 3NIDF 5CPSA 3RA7H 4M43H 3QNYA 4OKDA 1UB5B 4NO3B 3JSSA 3H9SA 1WTGT 1B2WH 1MCWW 3G04B 4H1LB 4KGLA 3WDRA 5FHBL 4S1RL 4UNUA 4ZQKB 3VXQA 5IKCA 1NC2D 1E4IA 3BW9A 4KFZC 4ODWB 2HISA 4JKMA 4LGSB 1G7HB 4GW5A 1OP3K 2PF6A 3IU3B 3WLWC 3ZJ6A 4FMKA 2WVVB 4RRPA 3W2DH 3VFMB 4JRYE 1KCLA 1LP9B 4Z76A 5AYUL 3QDJE 4KV5E 3TA3A 1Q38A 3MLZH 3S37X 1UC6A 3BN9C 1AHWA 5KVDL 1KLGA 2F58H 4M93B 4PG9A 3V5KA 3HLAA 2WMGA 5ACMA 2DLFH 5EFDA 2EKJA 3G6DL 4ZE4A 2BSRB 5C0EB 1CDJA 1EMTL 1G6RB 1UWSA 4A3YA 1EV2E 5IQ7L 4ZMAT 1I3UA 5I16A 3QEUB 3SGKA 2IXUA 1BFVH 3BJLA 1NUGA 1AH1A 2J7HA 3GSNA 1FQ9C 3BSZH 4H1LG 5B3NA 3L7EB 2CGRL 3VH8B 2IPUG 4P46B 5C8JB 1BEYL 3U1SH 2YD3A 3QUML 4NHUB 1K5NA 4JO1H 3SDDB 3LN4B 3RQ3A 1SEBA 1S5IH 2WP3T 4OD1L 4K3HA 1NBVH 3QQ9C 4OM1H 4GMTH 3BSZL 1A1MB 2BNJA 1PLGL 2A2QT 2DTML 3QQNA 4JFHD 4WDIB 2VLLB 5AYBA 4WTWA 1T2XA 1WDRA 5D4QA 5A6AA 3QUYD 2DWDB 3CVHA 4YHGA 1DEDA 5E2WH 4D6IA 2ZUVA 1UT9A 5DURD 3VXUA 2BHZA 2YPKA 5A2LH 2XQBL 2XPKA 3QQ3A 1F4HA 3C2AL 2YEZA 1DFBH 3U4BL 2ICWI 3VI4E 5JOFA 5D7JB 1IEBA 2CH8A 5I17B 3FQRB 3K3QA 4PRIA 3EJYD 3S34H 1CWYA 1HXYB 1UADC 1QHZA 2P48B 4NZDA 4PG9B 3T0EC 2EH8H 4FQXD 5IB3B 2YUXA 4ZODA 4XVUD 3QIUD 2QL1A 2DIAA 5HVFB 1ZANH 2CXKA 4WENB 1GOHA 4YLQT 5HGHB 2PBOA 1VF8A 3OZPA 3QFJB 5FV2A 5I16B 2IANB 1QSFD 4PJ9A 1DL7L 1HHGA 3EHBD 3RWJA 1BBDL 2YD1A 3CC5A 1F3JB 5LXGH 4NKQB 3GSNB 4Y16B 4WI7A 3FB5A 4QY8A 1M7IA 1P2CA 1SYSB 2R69H 3VH8A 5FECA 1DWAM 3SO3B 5GS2H 2D9CA 3S36H 1BYCA 1C16B 4U1LA 4JFXB 3ULVD 5INCB 5IK3B 3KPRD 2VDKH 3SDDA 2FL5B 2GK0A 3KLDA 1WKYA 2VE6A 3IGAA 5D7SH 1J10A 4K94C 3PZGA 1BFTA 2P42B 2VERN 1KXVC 4UQ3B 2DYPA 4I0KA 3CIVA 5FA4B 1LO5A 1X44A 2AJVL 3ARGD 1US2A 3QWOA 5IT2L 5EZLB 1P7HL 2NNAB 5SWSD 4AEHL 1YEKH 4FFWC 3T0WA 5C6TL 3H42H 2P5WE 2ZCKL 3IS1X 2AI0L 2Q8BL 5EOTA 3RVTD 4X0KA 3TEUA 2HVMA 1A7RL 4K8RD 2EPLX 1MRFH 4MX7B 5C2BL 4RX4D 5DD0L 3L7FB 3EYUH 2YLAA 1BIIA 4IIQA 5T1KA 3P0YL 4JO4H 4ORGB 2AEQL 1U0QA 3ZYZA 3AS2A 2D7TH 4E0RB 4NUGL 2R0WL 5I1LB 1GGYA 1IGCL 1E15A 2EO1A 3NOIA 4UZGA 1UWXK 3L4UA 4XCEA 4B41A 3VXME 2AI0H 2Q8BH 1IAOB 4BQCA 4UFMA 2D0GA 1GXEA 3TA3D 5I1IH 3VNYA 4PJXA 5HVHC 3D3VD 4EXPX 1RK1A 4R9HA 1NCCH 4G80A 5ILTL 4NO0B 4R96A 3DETC 4LVHC 4D9QD 2YJQA 3RZCD 1INDL 3TV3H 2ZOLB 4EBQL 3SBWC 1J1OH 5ACLA 3A47A 4I77H 4OZ4A 4Y5VA 1JK8A 2OL3H 3RWJB 4M62H 2AP2A 3OKDB 1BOYA 1W9UA 5I18L 5SV3A 1OP5K 4ZAKB 3UTPE 1FN4A 2VDRH 3FB5B 4QY8B 3QCVL 3OKNB 4NBZB 3RVUD 4D6JA 3N1MC 2XQYK 4K3DH 1F3DJ 4CD4A 4MB5A 3B4NA 3DUUB 4FXGA 4WWKC 1TA3B 2Y6SD 5DVNA 5IK3A 3VXSA 2DD8H 1B88A 2VE6B 2X2YA 5F9JB 2DQEL 1MI5A 3LAFA 3SPVB 2A73A 3CLFH 1PKOA 2ZUUA 4U31A 2ICWA 5DJ0A 4WHYG 1IGYA 1BFSA 1OM3L 4IJ3C 3OR6B 5D7KE 2AJ3B 4K3EH 4O58L 3ZM8A 3VMPA 5FD0A 1RZJH 1MRDL 1PSKH 4KXZH 5DJZA 5CBEB 5BV7B 4S1SH 3H3KA 1ZSDB 2IPKB 1TLKA 2AXJA 1TQCB 3C2AH 2DMBA 1X6NA 4JGUA 5IM7A 5IW1B 2VLKA 4WFHD 1TVBA 1W0YT 2PYEE 5JR1L 2WVSA 4AXNA 2NCMA 1OB1A 4WI3A 5DMJB 3BPOB 3S36X 3IT8D 5FYLH 5FCSH 1I7RA 2F54B 2P5EB 4DK6A 5CJXA 1RK0B 2A1WL 4HPOL 2X70A 5TDPB 1QFPA 1XIWC 4KK9D 4M81A 1CFVL 2DQHL 4FQ1H 2VZSA 1JBJA 3SKNB 2XNAA 4GZIA 4PGCB 1ZOXA 1O7AA 1KG0B 4LNRA 5J11C 2PXYB 1O5DT 4H88L 1I1YB 1BSIA 4OGYL 1JK8B 5EIIA 5JXAH 3ZDYE 5AWNL 5C0BA 3T2OA 4KRPB 3GBDA 3V5DA 5A6JA 1OAKH 4PTUA 3RTQB 4LGRB 4FN0A 3TP4A 4W87A 2R29L 4UDUB 4LQFH 1ZWIB 4NZRH 3U0PB 2CLZA 3AFBA 2JEPA 1N2RA 2OK0L 3QRGL 4UV4H 3BAWA 2EYSA 3QDGE 5IHUL 3SPVA 3R4DA 2CK0L 1QA9A 4E41D 2W07A 5DJ0B 1U8JA 1HI6B 4QGYA 5AC5A 1D6EB 3W26A 3RBGA 4OTXL 1KYOK 3HTLX 5DYOB 5SX4H 5IBUG 4HQQL 5ETUA 5I1HH 3AC0A 1KGWA 4RRPG 3OA5A 4Z7NE 3CD4A 5CS7A 3NCFB 3P4LA 3WDHA 2IAMB 1ZXQA 4DM1A 1UR1A 2FHFA 4U2ZA 4E8DA 4P5KB 2VXUH 3BPNB 2A6DB 2HN7A 1EFXB 3BPLB 1KNOA 3S35X 2AJSL 4HUUA 4OTXH 3V4VH 2CNCA 1A4JA 5H35A 1IT0A 4DCQA 1UACH 3SGDI 5A40E 3QQ4B 2X7LA 1WITA 4N0RA 1LL4A 4PSRA 2EICA 4LX4A 2CK2A 4AD0A 1ZLVK 5KSBF 2X70B 1BQHG 4Q6IC 1FNSH 4E5XA 3ULUL 2QV2A 4XC3H 1IGTB 3IDYB 5D5MA 1NDGA 2D0FA 5DQDL 1UYQA 4NJ9H 1MCRA 1G84A 5IFHH 1CE6B 4HFWA 4X7FC 2X9YA 3VXTB 3UTTA 4JVPA 3AU1A 5JW5B 4BYHA 4UTBH 3WDPP 3S2CA 3WD1A 4GAJL 4FLSA 3H9YA 1CD0A 2WHKA 4CD8A 3RY4A 3FQUA 1XH2A 2FJFA 2R9HC 1ZV5A 1FZJB 1G7MB 4OGZA 2Y8KA 3O2VL 2BVOB 5D71H 1R85A 3U4AA 3LPWA 1MHEB 4OZIA 2B7DT 2IH1A 1YEJH 4WSJA 1GZPA 1T04B 3WL1A 1E3ZA 3D0LA 3JWDH 2B1HH 4HOWA 3CK0L 2ZSVB 4JPIB 3L5JA 3CFEB 1ZVYA 1C8QA 1WAAE 4PJDB 5GRYA 3DYPA 1DCLA 2VOTA 3O2VH 4UCFA 1KTLA 5KANI 4YDLC 3GGWA 3QB7C 3QG6B 5KZCB 2R1WA 3B5GA 1DWHM 1FAIL 4DFIA 1W9XA 4HUWB 3V0VB 3AMLA 5EPMA 1D5XA 1K4DA 2ZG2A 3QO1A 2DS4A 1MLBB 4HC1L 4JANB 1RJCA 3U46B 3ZO0A 1QFOA 2NXYB 1S7XB 3SCMB 4G6ML 1O6IA 3E1F1 4KZDL 2WVTA 2VXVL 2X7LB 4XAKD 3U7VA 1W8OA 2DLTA 2B1AL 2V5SA 2VUOA 4E5XB 3FNDA 4XZUA 1JYVA 3RJYA 1H2JA 1NDGB 1S9YB 2VXSH 2PWFA 1CU4L 5DMIL 1NL0L 4HT1L 4MB4A 1FV1B 4P5TA 4YGVB 4Q7DA 1UKOA 3P11H 1ETZA 1U6AH 4L5FH 2DM7A 1P1ZA 4PJCA 5IVOA 2V7NA 4F3FB 3MSGA 4W86A 5LYRA 4V1DE 5T3ZD 5BXTA 3SJVE 4DAGL 5M95B 4Z95L 4RAVA 4GBXC 5BV7L 3BRDA 3OG2A 3W0WB 2BFVL 5TPWL 3N1AA 4DFHA 2GCYA 4AZHA 4R26H 1A7QH 5L0QC 2XOTA 3C6LB 2ARJB 1VFOA 1PG7W 5INDA 4ZSOA 2CKBB 4AT6B 2GJRA 1PYWA 4X9YA 3UERA 1OAZL 4WU5B 5DVOA 4WU7A 4XMLH 3WHXB 3IVKA 5LBSL 4ZO9A 5TPWH 1KC5H 3STZB 1KXTB 3SCUA 4XMKH 3FOLA 4XP9H 5B21A 1I7UA 1E27B 5F3HB 5EPMB 3FO0L 3MMEB 3W11D 5J56B 2AJSH 3AB0C 4OIBA 1ZMYA 1A21A 1LEGB 2NY7H 3U7YL 4G6AD 1S7XA 4TUFA 3ESVF 1E0XA 1UZ1A 3O0RH 2CIIB 1JHKH 1R3KA 3ZE0F 1FIEA 3SCSA 4RGMC 1N6QL 2YUZA 5F7HA 3QDGA 4M6OL 3B9DA 4EI6B 3SE8L 4K7PX 4ERSL 4NM4H 3OPZL 3QIUA 4LOUC 3WNPA 4X6DE 3P30L 3ZE2F 3RA7L 4BH7B 3TBVB 2HRLA 3DO3A 4N90D 1UEYA 4F9PC 1U2CA 4AZ5A 4EE9A 2NY4D 3F7PC 2E7CA 5DLML 3RIAF 2F9BT 1IM9A 3BZFB 3QULA 1B0RA 5B8CB 1KJ2A 3BWAB 4KAQH 3ROLA 3ZE2E 4PJGB 4OV5A 3QXVA 5JBDA 3V6ZB 4YIQA 3C6LD 3S3SA 5DFVD 5C0CB 1AKJB 1AO7E 3N12A 1KIUA 3NSMA 3O4OB 1DR9A 2N56A 4K8RL 3NFSH 1CFQB 1H11A 2XYLA 5D7LA 3U1SL 1A6VH 5ITFA 3GM8A 3SDXF 1AGFA 2EDTA 4AT6A 3VIFA 3VI4F 1PYWB 5BW7C 3BP7A 1OF2A 1QQDA 1LO0L 1WIPA 4LLYB 3RDKA 4TNWK 2X1PA 3SY0A 4JFWA 1F2XK 5FM5O 3ULUD 3N17A 3GJFA 1N4XH 2D3VA 4N0CD 4B5EA 4C59B 1KXTA 3TVMB 1EMTH 5IHZA 1EOKA 1EXUB 4PD4K 2ORBL 5HHME 3GSVB 2FRGP 4LVOC 1DQLH 1DQML 2Y36L 4ONGL 3RWEB 1A9BA 2A6IA 3DXAB 5E8NA 1JXKA 1FFQA 3MLSL 1JYXA 4LYRA 1FDLL 1BF2A 1ZA3A 1S7UA 4CKVX 3QJHB 5F1NA 1T1YA 4BH8B 2CGRH 1TR1A 3LS4H 1HINH 5IP4A 4ZQKA 2BP3A 5A6MA 3BIBX 4WTZA 3O81A 2IG2L 4XNZB 4R7NB 1AKJD 3MBXH 3O9WD 3QQ9D 4LRIA 3FAXA 2P8PA 3VIPA 3PWPE 1OP3H 1KB9J 4MAVA 1NJ9A 3IJHA 3TA3B 1JN6A 4BK5A 4FLOA 2BOBB 5MHSD 2DQDL 4F9LC 3IDXL 3ROLB 1H0GA 3WUFA 1YYML 5DA4A 2GJZA 4EI5D 2GW5A 5D9PA 1CG9A 1P4BH 2BY0A 2WLYA 1EHAA 2V5YA 4NDMB 1EO5A 4V1DD 2QSVA 4Y5XB 5DT7A 1QLRB 3P4NB 2DLEA 2OI9C 3MS8A 5D7LB 3L9RA 2FX7L 3W0KA 4KI1A 4G8EA 4GAYB 4QXUH 3W39A 3VRIB 3WXWH 1YY9D 3V8OA 1YEHL 2ZSWB 2C3VA 3IJ9A 4FZ8L 2VKXA 1WZKA 4GSDL 3UTSD 3GMLA 1OP5H 2C7UB 4UU9A 5T3XE 3OZ9L 4I3RL 1MRCL 1DBAL 5IT2H 4GRMA 4CVZB 3G6JE 1OLLA 4JFUA 1BAFL 1T2QL 1FHDA 3MLTB 4JRXE 3GSVA 5JUEH 2J7DA 2FBJH 1DQQB 2NSXA 3RWEA 2A6IB 3MLXL 4FFVC 5I6XB 1JPGB 5GS2D 4BSVA 3ALXA 5EWIH 4G9FA 4NZJA 3G5ZB 5F1NB 1N6QH 5DXWA 3RPKA 4HIJA 4JRXA 4NZUL 4P4RB 4U1JA 1C92A 4OT1L 1XC6A 1FVEA 3SCQA 3WEOA 3L1OL 2CETA 5EOCJ 1FGVH 1IARB 4HUXA 4P23B 1JWSA 3AXIA 2FB4L 1LEIA 4JHZA 3EJZC 5HJ3A 1I1XA 5GNZA 5IOPB 2FATH 4QTIL 5DJAA 4MQTB 2OTWB 5I1DB 5MI0C 5A6KA 4FTVE 2BNUA 4F57H 4ZDHA 4RGNB 2F54E 2P5EE 1JGLL 3I3DA 2NZ9D 3Q6FB 5D6CA 1MCJA 1CLOH 2X1OA 1IC5H 1GVYA 4MLSA 1DUZA 1SYVB 4WFHE 4PTTA 4TOYH 5DD3L 3HMCA 4BUHA 1MCHA 2EJ1A 5CD5D 1C5CH 2GSIB 2ZUSA 1GJWA 1LP9F 5DMYA 1RUAH 4H8UA 4C4KO 2DTSA 4OF7A 4P3CL 2VLKD 4JFPB 2VRKA 3S8WA 1P2CB 2W9EH 1S7QA 3RVXC 1QBML 5FECB 4GI6A 5I74C 2IH3A 5ILTH 2HFEA 4JFXA 4RISL 5TDOA 2JF7A 1I8IB 1RULL 4M00A 2AAVA 5I24A 4XBGB 5KZCD 1OT2A 2VXUL 4JM2A 4U1SA 3W53A 3TV3L 4UUJA 4ELMA 3F7RA 1VCAA 1RD6A 1LO5B 3W24A 4H41A 1URLA 1H0DB 1JPGA 2DEPA 1GCFA 3HNVH 1BZ9B 5T3ZH 2VDOL 1KIRA 1GOFA 1JFQH 2J47A 3U9UA 5CBAB 1EHNA 2AABL 1W72B 4MCYB 3LN9A 1EQPA 5D8ZA 3GYCA 3KL0A 1F4WL 1KT2B 1DN0B 1X7QB 4XBPA 4RGNE 4GG6E 1M1SA 1QYGH 1T7XA 1VAHA 5DA0B 4XPBH 3WDJA 4QYOA 3T1WA 2ITCA 1JNLH 3ILPA 4LXFA 1KB5H 4JCMA 3CSPA 4CU6A 2ZXAA 5FK9B 4JG1H 1FPTH 4HWBH 3TBWA 4KZEH 1V6YA 4FFYL 3AICA 5D2NA 2UVEA 1D5BA 2VAAB 4C57C 4U1MB 1RK1B 5DGQA 1WK0A 2J7GA 2NY3B 3IJYB 3Q6GH 3VXMB 4PJ8C 1J0HA 3TCLB 4F7PB 4YQXH 2DJUA 4X6EA 4P7OA 4PTTB 1QNOA 4GKSA 3KE0A 4ODHH 5AAMA 1U58A 3CDGB 4GKOA 3N04A 4UZUA 3LSOA 4GSDH 1GGTA 2EDOA 4JM4H 1IGJB 3QAZC 2YK1H 5K59E 3MJ9H 3EW3B 1C08B 2NTFB 1FAKT 4S1DD 3N50A 2XZZA 1K8IA 4CU8A 3SE3C 2E4TA 3RAJH 4FF5A 4M3KB 2DQGH 1GPFA 3E3QE 3RPIB 4ZUWA 4O4YH 2ZUWA 1UJ3B 4G6MH 4S0TD 3TH2T 4G43B 3SKOB 2EZ0D 2Y06H 1WT5A 4UFLA 1RJYB 4K3JH 4R97C 1FCCA 5GISH 4BK4A 5D8WA 2VWEE 3NZHL 4WFEE 5EC2A 2DGAA 4I9WE 4XNZC 3ZDZF 4UQDA 4YJZL 1G94A 3ARDB 4G7YH 2E7MA 4LCUB 4OZFA 5IVXF 3OB0K 1AVAA 1R3HA 3O8XD 3VG9C 1OIMA 2ITCB 4W7UA 1J8KA 3RTQD 2C3WA 3U30C 4HA1A 4QTIH 4IMKA 1BGGA 2H6PB 1MCCA 5JQ6L 3MZTA 5BRZA 3C09B 2PXYD 5B38A 1EUTA 1OWWA 3ALGA 5A95A 3N85L 2YDRA 2BFVH 5HHPA 3NMEA 4N0YH 1RZ8A 2IQ9H 4HLJA 5EFFA 2F54D 2P5ED 3B9VA 1QHPA 4GKSB 25C8H 4LSQH 5CJOL 1V03A 4UILL 1I9IL 5E00A 3IAPA 1HVXA 1D7FA 2YDSA 4KY1H 2VZ1A 4LSVH 4PBVC 1NEUA 4RDQF 4Y16D 2IFGA 4DJMA 4HU0A 4PTUB 4EKXA 1QBMH 5FDWA 1U33A 1KCRH 3SOBL 1TCMA 2KBGA 2ZIDA 3TFKC 3MJ8B 5DQ9A 5A2KH 4C7FA 1HH6B 3N1FC 1JHTA 2WINB 4LSRH 25C8L 3OKMB 4LSQL 5CJOH 4FQXB 2NY5C 4M29A 1J05A 2YWZA 7A3HA 1MRFL 1QA9B 5A2JH 4OUUA 4LPUA 2Q20A 2ICES 1G9EA 1OWRM 4D9LH 5J7CC 3MRFA 5DRZA 4W5ZA 1P69B 5D1XD 1RZJC 1SMDA 1CVSC 2Z93B 5F7EH 2ZJSL 4X6FB 3UG4A 1KB3A 1KR0A 1VFMA 5SV4A 5DURB 3WIHL 4M6NH 3HZKA 4L9LA 5E9DD 4DKFH 4UT6H 1C12B 5L2KE 2X4OA 2LQRA 3U2SB 4MJID 4R8WH 4PRHB 3WIIL 1T7WA 2C0HA 3F4VA 3FT2B 4YBQD 4MNQE 4X5LA 1XH0A 3T0AA 2ZOKB 1JTOA 3OZOA 2VVNA 3VD5A 2GIYA 3SDXE 3I6LD 5HHPB 4S2SB 4HLZH 2CMRH 4G6FD 1FBIH 4OQTA 1KTRL 5J6GA 1MCLA 4E42A 3UJIL 5C09B 3S3JA 2FJHA 1E4XI 1FIGL 3HNTL 2DMKA 3AU1B 4JN1H 2H32A 4P3WA 4PV9B 3RU8H 2OTUB 3DPBA 3WN5C 1MVFA 5T33H 1BBJA 5A94A 1CGXA 1PVHA 4MNHB 5E9DB 4PRBB 4CW1B 5I75C 3ULUF 4OCWH 4UBDC 4TX8A 5D70H 2D3LA 4B16A 4PR5A 1PIFA 4D0BA 1XGUA 3HNSL 1UXSB 4O4YL 1V02A 3CFIC 2IF7A 4UOW1 2ZSVA 1W8NA 2OMNA 4IRZL 1GOKA 3CFEA 4AMKL 3CUJA 1LWHA 4KK6C 2FX7H 1U6AL 5JNYB 4G5ZH 1HH9B 4HX1A 2Z93A 2XWBB 4HOZA 4H25A 1KTLB 4XP4L 3L3GB 1B30A 3DUSB 1EHLH 3OB0H 3PDOB 2YC1A 4Q6IA 1JI1A 2J6EL 3U5YA 1B3JA 4WFED 3MTRA 2HKHL 5GXBB 3VGDA 1FYTD 2XWDA 1PZUB 1NFIB 5H37G 1QFWL 4FZEH 5TGBB 3VDBA 3BSHA 2R2BB 3KWWA 5BO1H 3MLRH 1OPGL 3RVXD 4JN2A 3RNKA 1HSBB 3BZEB 4JHAH 4B15A 3QXAB 4I18A 1IEAA 5DI8A 1N64H 5HDBF 4AMCA 2AJVH 5GGUB 1D5MA 5JO5B 1UVQB 3MOBL 3CH8A 5I3DA 2X44D 1F4XL 5C09A 5E8DH 4JLRA 4KV5F 1YEHH 2CLVA 3W11C 1WBXB 5GGQH 2MANA 2BXZA 2EH7L 5TJWK 2NY7L 3GI9H 1NOUA 5ICZA 1NGQH 3VD7A 3HS0A 3NZ8A 1TVHB 4G8GB 1D9KA 3HZVA 1W72L 5J3HC 4J1UA 4W84A 5E7FA 4UOZA 5TE6H 3AMKA 3UBXA 2HTLC 3W0WA 1OP9A 4HQQH 1U8QB 4ACZB 3M1BA 5MERA 5I1IL 5GGRY 5DT1L 1XGUB 1S7VA 3VFUB 3EZJB 3VDHA 3F65A 7CGTA 1HKLL 5D96C 1NLDH 3O6AA 4UFKA 4YFLF 2NR6C 5L8JB 4U5IA 5K9KA 3L3KB 4HX1B 2F8XC 1GGIL 2JEQA 3VM5A 2QR0A 3HZYB 4WRLA 1BVLA 2QSCL 2QF8A 2NXYC 5EOQL 4M6NL 3QPQC 4NKOB 5FYLD 3U9PL 3WF1A 5DC9B 4AD2A 1P4LA 1R24B 4R4FH 5FV1L 1JHLL 4Q9RH 4OFYA 4U1GC 3KYNB 4ELKB 4GO6B 3X3FH 3TYFB 4L4TD 1GYAA 1OGAD 3CDCA 3BESR 1NFDF 4NYLA 4B7IA 4OZGB 5F7NC 3HMXH 4YXKL 2CIKA 3Q1SL 2LV4A 4NKIH 4FLQA 5A1AA 1JNDA 3KJ4B 2YKLL 4MWFA 4NO2B 2DQEH 1HSBA 4QOKE 3NCOA 3QXAA 2UWEE 1E6OL 3NABL 4P4KC 3V9FA 4PPTA 5E08H 1S3KL 3IXAB 4R2GD 4UQAA 3E2HC 5DO8A 1G7QA 1RQ5A 5F89B 4MA1B 5CMAA 2JELH 1U3JA 3LQZA 3P4OA 3DIFB 4GRWH 1GCYA 4KROB 1SJEB 4UAOC 2MWCA 3QO0A 4RQQB 1IM9D 3CXDH 4IIQC 2WBJA 1LWRA 2NR6D 1N5YH 2HRPL 5E0FA 5HYEA 1L0XA 4JRWA 7FABH 5BXRA 2ILLA 1FFRA 1YEFH 1T3FA 3OSKA 3VRJB 4R2GB 5KJRL 3UTZB 4HA3A 2JCCF 2XKNA 3GIVB 1HNFA 4L4VE 3WUWB 5ENWB 5ALCL 1OSPL 2ZX5A 5ICYB 1L8NA 2J62A 4GW4A 4FG6C 3JTTB 4WEUD 2A3CA 2R56L 1SY6H 1JAKA 4WEBH 3PZUA 3ZSSA 2JIEA 1LO3L 1NANH 3WD0A 3JWDC 3GI8L 1GQLA 2AXGA 1ZB5A 1WGOA 1NMBL 2YL8A 4HIHA 5CIPB 5ABFB 5EBGA 4L8BA 4YDIH 1BVLB 1RZIA 3GJFB 4ZAKC 1B0WA 4WJ5A 4X5WA 1A7NL 2NY3C 2BRRL 3DURB 4JZJC 4U2YA 1P4LB 3V79C 1JGUH 4NF7A 4P2OD 4D6GA 2R2HA 43CAA 5FO8B 5IQ9A 2Q3ZA 2FX8L 2R0LH 5DJ6B 4H1LH 1M7DB 4X6CF 5IB2A 1E4WH 1E0OB 4LQFL 4LU5H 2F61A 1XSJA 4F8QA 4F2MA 1XF5A 2CIKB 5C0AB 1EO8H 2BRRH 3K1KC 1NGWB 3EJYC 3D48R 1BZ7B 1U8HA 2EKSB 4Z2IA 1ES0B 1BQSA 1QSEA 2RCSH 4G3YL 4IM4A 2EXWD 4YEFA 5A43C 2VRJA 3P4OB 1NAMH 2E7LC 1DDHB 4UTAH 4DEPC 1K2DA 3AZTA 3RKDC 5D7SL 1MJ8L 5F7WC 3AHXA 5D7LE 5EWIL 5ABGA 3C5ZA 4E41E 5EU3A 3MRDB 4JHOA 1A6WL 4LRIC 2CPCA 2DLIA 2DQCL 5I75B 3TPUB 4XPHL 3UTOA 3RAJL 3CUFA 3WMSA 4J3WA 3EOBB 1M4KA 1A5FH 3KPSA 3GJFH 2V5DA 3WSUA 4HGMA 5B22A 3D39D 5B3JE 2GJ6D 1JWUB 3QFJE 4AWEA 1HKLH 4L1HA 3LD8C 4P2QA 2FR4A 3DRTB 2X9WA 2APTA 3GNML 2D49A 2WQRA 2W0FA 1A6UL 2UUDK 4J28A 4P2CG 5E5RB 5EA0H 1BFOA 1KEML 5I8KL 4GMSH 3AVEA 3WFEH 2F8OA 2YL6A 4LVHB 1OL0A 2JJVA 2XRAL 3AY4C 3KPNA 3H3PL 3E6FA 5DTFB 2AK4E 5IQ9B 1MJUL 1EGJA 1MH5B 1XGTA 3HFML 4OLYH 4PLKC 1FFOA 2Y5EA 5DHVA 4PG2C 1UQYA 5C0AA 4HIJB 4NRZB 4R97B 4LLWA 3DV6B 2JIXD 3LZFL 4Z0XA 3RWHB 3VE0B 2G3IA 2VSCA 1U8PA 1FOBA 4MAUH 1N8ZB 2X4SB 3OGCB 2MCPH 1GZQB 4G6KL 3MR9B 3HI1A 4PYHA 2H32H 3MXVH 5EUOA 4WSKA 2Z31A 3NSXA 1FNFA 1IC1A 1LP9A 1MCBA 4QXGH 1F97A 3GSOA 3ARUA 4PYGA 4AM0B 2FDMA 5DJAB 3MNWB 2L4OA 4KTEL 4MQSB 1N59B 4LAQH 4JVUA 5DVMA 3MLWL 4NHCL 1JRHL 2A77L 1NFKA 1IBGH 43C9B 4WWKD 1TZIB 5EBMA 1F45A 3Q5TA 1CF8H 1J8HE 1BEYH 2O26U 4P2QB 1X5ZA 1UZ6E 4MJIB 3L4VA 1OSZB 1JRHH 1P6WA 1WAWA 3W28A 5EUOE 5CHNB 3LQMA 4NHUA 4J6RL 1KGCE 2CLRA 3MBEB 3IS0X 1YUHB 2OL3A 2H2SD 1T6WA 3PIQB 5DR5L 3OKEA 4DN4L 3FQXB 2DKSA 1NGPH 3D1MC 1XGTB 3WF4A 4AY0A 4DEPB 4HJGA 5HPMA 4OGYH 4GRWE 2GJ6A 1MFBH 2KZ1B 3B3IB 4KTDL 1JPTH 2BERA 2YK1L 4QTHB 5I66B 1HKIA 4P9HC 1XAUA 4BA8A 4QCFA 1KT2A 1J0JA 3NH7H 5D9SB 4X80L 4N8VB 1EEZA 1NC2B 3VXUB 3ZKNC 3DYOA 1LO4H 3KNBA 2E9IA 2A3AA 3P4MA 3MV9D 1R8LA 1XRVA 4MDJA 4PJHA 1W0VA 3NPZB 1T21B 4KKAD 2DT0A 2WHMA 4L4TB 3D3VE 4X5XA 4P5TC 3RUGE 5FK9A 3CNKA 4JQXC 3EZ8A 2EDQA 3MNWA 1XV8A 2PYEB 4PGEB 4JZNB 5C07A 3PDDA 1QUNA 3C87A 3VW3H 1I9EA 3L95A 3AMGA 1UXWB 4KKLD 2RQ8A 1A4KA 4Z2KA 2A9NL 1UHVA 4HSQA 1JNNH 2WBGA 1WICA 3KLHD 4X6EB 5D2LB 1KULA 3N9GH 2WNGA 2QQNL 1B2WL 5I71B 2QHRH 3DX7A 1W91A 4N42A 1C91A 5EG6C 1E71M 2C1PB 4BFIA 5DWUL 1SYSA 1AE6L 3UZVB 3BZDA 1INEL 1WZLA 3KPQA 1ZA6A 4GUPB 3BIAX 1IAMA 4K94H 3OAZK 4QRQA 5TFSH 3RKPA 2OP4L 5EB8A 2BS9A 3O3AB 3VIKA 4PTWA 5FYKH 2BMKB 1Q9OA 2XA3A 2DKUA 4ZFOL 4P23C 2IBGA 1P84K 4WTXA 2ATPA 4N0UA 2O9TA 3NFPA 1W3KA 2NW0A 3VFRB 1XCTB 1HOCB 3SKMA 4NKMA 1CLYH 1QLFA 3MJ7A 3WN5A 4DGVH 1S9XA 3P9MA 1PJ9A 4HKBA 5F88B 3WQ5A 2QLYA 1B3ZA 1J8HA 3FB8A 3ZYOA 5HNNA 3WBAA 3O3EB 1T66D 5JMOC 3W82A 5I76A 4LSRL 1R3HB 1AO7D 4IRSC 3EKCA 3F6IA 3TH4T 4HPGA 4MD4A 1CLOL 3MRBA 3GIZH 4JFED 4LSPL 4F15B 5JIPA 2O9RA 3QUXC 3QCTH 3DI2B 3MRQA 1IAOA 3JUZA 4P46C 4KJYA 1U8KA 2PTUA 1C7TA 2JK5A 2IBBA 5DUPL 4A6YB 5C0DA 1WWAX 4DWSA 3MLZL 5JPNA 5FXCH 3ISWA 2NY3D 3QIWB 4QXTB 4PJBE 3PWPA 4WW2B 4UQBA 1G7PB 5HI4D 2CQVA 3RDTC 2VL4A 2XTJC 5ITBL 1PZ5A 1KB5A 1TG7A 1RSFA 3VIMA 3JV4A 2DSZA 1AXTH 3SCVA 3SCMD 5HY9B 4FQ2H 4PP2B 5ISZD 5EOCH 3IF1A 5C0AE 3UX9B 2VYRE 1QRNE 2XI9A 4PJ9C 1JD9A 4QRQB 2JJWA 3NFNB 4MCZA 1W9BM 3RBSA 3S88H 2YBRA 3SE4A 3FB6A 1I1AA 3G9AB 4N1HB 4NC1C 5IVXB 2DSUA 4BKLA 2R9HD 5CUSH 4OUUB 3NFPB 3VVGA 4TQEH 1R5VB 2Q7NA 3U79A 3I50L 2EH8L 1AGDB 1N0LA 3LKPB 5CEYA 5MHSE 1OB0A 4HHAA 3BP4B 3AOFA 1VPOH 2E7HA 1IZJA 1OAUL 2XTJD 3P9LA 5H2BB 2KL6A 1HHKA 4JHAL 3VIJA 5DJCA 5JW3L 3DX6B 1WAAA 4MD4B 2EC8A 2ZZUT 3DHUA 1XR9B 3MRQB 3KJ6L 1MCDA 1TCRB 1BAFH 1T2QH 3LDBC 4P2YA 3U4EA 4N8CH 1YYMH 3DV4A 3QUXA 3NAAH 5I30H 1VGEL 1ZU8A 3MLXH 4XNMB 5I1GH 1G7LA 1M04A 1TPXC 4TSBH 3HCVA 4RBPH 1MWAL 2FJHB 3N18A 4MZ3A 4PJFB 5HYQB 5IFJB 3CLWA 3BT2L 3FB7B 3DLQR 4K3GA 3INUL 4AH2A 1IC4H 2V17H 2JB5L 3IF1B 3EIFA 3EDFA 4J4PA 4MXQC 3PBGA 4ATDA 4D2NA 5GJSL 3Q0HA 3O0RL 4NQSA 3X11B 1A7NH 1DQTA 4NUGH 4PRBA 3U0PA 2CLZB 2R23B 2WWCA 1V3KA 3QWRA 4Y8DC 4HS6A 1E4KC 1CE1H 1B3VA 2CO7B 1U8MB 1JGLH 1U8JB 4LARL 2V17L 3IFLL 1CLYL 4E41B 2W9DL 1FGNH 2FEDD 3CDFA 4NGHL 3I9GH 1EO7A 2MKWA 3L3GA 4KDTC 5FA3B 3GH7A 4XP1L 1NCDH 3KPTA 1CR9H 5C9JB 2D20A 4NRSA 2ADGB 4NQEE 1ZL1A 2WIIB 4QLRA 1V0LA 1IQWL 2GFBB 2V6HA 5H2BA 5I8KH 1FG2B 2E5EA 3JVGA 4TSCH 3QJFB 3QDMA 5EO0B 4GG8B 3OB8A 3K2UL 2I07B 2GAZA 3MJ6A 2VABB 1WBYB 1XR9A 2CK0H 1ZLWK 1QFWI 4GH7B 3U7WL 2PYFB 4XBEL 1AIFB 3QUXB 3CX5J 4M7JH 4YO0A 3WFCL 4S10A 5DK2A 4QCIB 1IL1B 1BJ1H 4MADA 3FN0L 5D5MB 1XCQA 3F7VB 3PNWB 5TH2A 4Q9QL 2QMKA 4G42A 4RZCB 1Q9KB 2J78A 4PMYA 4FRWA 3UTTB 2WW8A 4DOHE 4MNGA 5AYQA 2UY4A 4O58H 4EDWL 1BX2B 4YE4L 4PTXA 3CVHH 5ALCH 5HD8D 3ZMRA 3C60A 2DM2A 3CFJB 1TVHA 1KOAA 3PJSA 4WJXA 1X6LA 2YD2A 1QRNA 3MYJB 4OJYA 3IU4L 3ARQA 1BOGA 2Q7YB 4Z7QE 3ZTNL 3SUVA 4ZE5A 4N9OB 3M1BB 1NUNB 5F9WC 4UNIA 4JFVA 4GT7A 3MACL 4PRPE 4PJAF 5BJTA 5DF0A 3RFZC 4O2FB 1I7ZB 3ORJA 5K9KB 3BGMB 4F7CB 5GS1B 3MNZB 1RHHA 3AI0A 3CZLA 3KS0J 2W0PA 5J6HA 2L0DA 5FA3A 3VGHA 3VMOA 4JL2A 2VCBA 3QYCA 5CEZD 4PJ7A 3LV3B 5J1AB 2WCSA 1T4KB 3FO9B 4ONHB 4WHTA 3ARYA 1FG2A 5C0FB 4MXVF 5CSBA 4AENB 3U46A 2BNRD 3GUTB 3AREB 3NBNA 2VNCA 1LL6A 1ZBCA 1NMAH 1SYTA 1U2HA 1O7VA 1Z3GL 3F62A 1B3WA 1M01A 2XUCA 1MFAH 4M6AA 3Q5YA 3JTSA 4FZ8H 5KW9L 4LCCA 3HU7A 3V52H 3BPOC 4M24A 3UR8A 2CR6A 1ZGLP 1GJIA 3QHZH 3VXOA 5C0CD 5FYLE 2HVKB 1IAIM 4JAMB 4NO0D 1YMME 1RZ7H 1MQ8A 3CSBA 1CIDA 1TVNA 3FW6A 1HHHB 1YQVL 4TXEA 5I8OH 1FL3A 1L7TH 4XMPL 1MY7A 1VACA 2PO6D 5I1HL 2VN4A 1OD0A 1SJHA 1CGSH 4MXWH 3KXFD 2JFEX 2AEWA 3VGGA 1W1VA 4LBEB 1FH8A 3PZOA 4RAVB 1CN4A 2B4CH 1RZ7L 3D2UA 3QISA 3GIVA 5T1KD 5J1SC 4QNPF 1IGMH 3BH8A 4BUGA 4G5ZL 4I9WD 2BSSB 1CLZH 1H15B 4CVXA 4FQPA 2NT1A 4C54A 3SE4C 2B5IB 4LARH 5CP7B 2CKBL 4UNTA 5E94A 1I7ZA 5DK0B 1KTKE 3WQ4A 4E4PA 1DJSA 3MNZA 4U0RC 4UT7L 5HI3C 3VKKA 3KYOB 1RZIB 4X5WB 2CDGB 1FO0H 1AGEA 3G5XA 2WB5A 5FKPA 1FYHB 1PKQE 4XPTH 5CILL 5KSAD 3D3VA 1MFVA 1SJXA 4PMZA 5LXGL 4MJ4A 4HZ8A 3CLEH 4YBLC 3X13A 4KPHH 1YEIL 3HPLA 4BCEA 5LCVL 3UO1L 3S5LB 1MQQA 2RIKA 5CJBA 1AY1L 1EK3A 5C0ND 1KGCD 4OLXH 2IAND 5MEPB 3G6JA 5E95B 1C3FA 4PGDB 2WCAA 3P30H 4FQLH 4ODTL 3EGSA 2EEBA 5FF6A 2EXYC 1KEMH 3CU7A 4J4PD 2VDLH 3JV6B 3EO1B 4HF5L 5IWLA 1T22B 4LASL 1W72H 3SDXA 1T0PB 4KMQA 5BRPA 2J7CA 1N6UA 3MRCB 4Y19E 3K46A 1H0IA 2EE3A 3PUCA 4ACYA 5DC0A 4GZEA 3VWKC 4YZFF 1UWGH 5AG8A 1Q1JH 3V6ZA 4ZTOL 4OLVH 3QCTL 1E4MM 1WE5A 3KPMA 4K7PL 3CZFA 3OXRB 3F58H 4QKXB 3DGCR 4MNMA 4KUCD 4NM8H 3QUZB 2JB6A 2QADC 1QYGL 5A2BA 2ADFL 4HG4J 1AGFB 1YNLH 2Y4SA 1G9NH 4NQDB 4PRNB 4Z7UF 1WVZA 1FZMB 4TPRL 5EZIH 4XGZB 5D7LD 5HDBE 1DLHB 3ZDXF 2E3VA 3CFCL 4HBCL 4X9GA 1N82A 5E0CA 3C08L 2BCKA 3V6OE 5CEZL 1UENA 3ZLQC 5JZ7C 1CTOA 1VFAB 2XV6B 3NCMA 2AK1H 5IBTL 1E3XA 2N7BA 2FZ3B 2G41A 1QPKA 1KLUA 1A9BB 2V9RA 3DXAA 4U1IB 3TJHC 3MV01 4UV7H 4IMKC 5IW6B 1ZS8B 3HC4L 4JFZL 1OGAA 2QQKL 4KHTH 2IEPA 2AS5M 1EEUA 1VFBB 2EDXA 1CFNB 4FMFA 4PGDA 1CD1B 4D0DA 5GZOD 1FNEB 1U3ZA 2YPLB 2OMBA 1HYRC 1KYOJ 4OCLC 4LF3B 4WW1A 4G8IB 1J5OL 3UC0L 1I3RA 1YEEL 3C8DA 2VVSA 3IFNL 3WMBA 5GRUH 2AXFA 4JFDD 2PNDA 4KKBD 3L4WA 1YMMD 2FO4B 2JF6A 3RX8A 4M9PA 4UAOB 4UIMB 2W60B 2ESVE 2NY5H 1P7QD 2KDGA 2VB5A 5ACZB 1L9NA 2B4CL 3KPMB 5DVLA 5L9DL 5DWUH 4QRRE 4BQ4A 4OCYL 4LCYB 4URTB 4YC2C 5C7XL 3WNKA 3E6HB 1QEWA 1BBDH 4OCWL 3U0TA 3QHFL 2NXZD 4AEIL 4CJ0A 3QRFM 4KWUA 3D25B 3NUKA 1MWAH 2VDML 4M4RA 2ZOXA 2WXDM 1OSZA 2OI9B 3MRNB 4M61B 1DFBL 2DKMA 5CHNA 2HLFC 4JO2H 4JFQB 1EQCA 4M5YL 3DHMA 3AIRA 4DWSC 2HT2D 3WEXA 3VMNA 3GSWA 3FQWB 3PHOB 2FZ3A 1MCEA 3QNYB 1KQYA 3GK8L 3SDCD 1VKXB 2OYPA 1WSST 2OYLA 5LCVH 2I9LB 3EDEA 5IW6A 1D9KC 2IADA 4N8PA 3PZTA 5JDJA 4NPYA 1Y6KR 3I6GA 4AG4L 4KQ4H 1H3XA 1AJ7H 3BAKA 1FFNB 4UTAL 5T1LA 4DUWA 2WBKA 3RWGB 4YHEA 5FUZL 2IANE 1N64L 3K81A 4WW1B 1MRCH 1QKZL 3L6FA 2WZPD 3GMNA 5I1CH 4YHIB 3BH4A 5EN2B 3GSRB 5EZOH 3VFMA 1RI8A 4PJ5A 3QBTB 4HK0B 4NQEA 3T0XA 3DMMB 4LK4A 4LPTA 2VISB 5I1DA 4Y4FB 3A4XA 2RAMA 4TNWF 3BDYL 1MCWM 1YNKL 4ZDHB 2GDVA 3UETA 1UXWA 1RIUH 4P7NA 3G6AB 1KJ2H 1A9EA 1XGYL 5A3IC 4M9OA 1DEEA 2V3DA 5A6LA 3TO4D 4PMDA 4B3LA 5IHLB 4KRNA 1W3HA 3V4VL 1NBYB 1QEWB 3STBA 1E6JH 4WVRA 4FHBD 2CYGA 4IOIB 4OZHB 4Z2JA 1HN1A 4RFEB 5HVGB 3WSQH 1QFUL 5M7QA 4PJFE 5I77A 3EYUL 3SE3A 2E8YA 2BX5A 4JFPA 3V7MA 1CTNA 3CXHJ 3B9KA 3GMRB 4AY1A 3S35L 1JDCA 5C8JA 2Y8VA 2AJZB 2IH3B 4X6DB 3RIAK 1G0DA 3O3AA 2EC9U 1IT9L 2H1PL 4UIKH 1NWRA 4HMEA 3UCQA 1YECL 3CZ8A 3AFLA 1GHSA 2AK4B 2XWEA 3F7YA 3ETBF 5EBWA 5GRZA 4J7RA 1C5CL 4QRUB 4NQDD 1F6LL 3HNTH 1G9MH 3OAUH 3I6GB 5AZEL 3REVA 1SQ2N 5FCUL 3GO1H 4ODUA 2XVLA 2BSRA 3C8KB 2W9EL 1OARH 4P4KA 3CZJA 3VXNB 4FK9A 1UH2A 4OD2B 1MVYA 3OF6D 1HWHB 1SEQL 1XYFA 1ND0A 1PFCA 4PJIB 4RGMB 2E6QA 4PJDE 3BAIA 1ZT1B 2XA8H 4YHIA 1NAMB 2NXYD 3QIUC 4LPXA 4PJGF 3FRPA 4PP1D 4QHNA 3HNSH 4X7TB 3SURA 2HWZL 4OQ1A 1C1EH 1MOEA 3CHDA 5E6ZA 1X5XA 3N1GC 3T3ME 5TQ2L 3WKMH 1K5NB 3SKJL 4MNLA 5BZWA 2OZ4A 2AJUL 3HC3L 1VPOL 1MFAL 2PUQT 3K7UA 1FLRL 1PEZA 3MFFA 3HI6L 4NCC2 4R27A 1N26A 1C8XA 1HJSA 1GC1L 1HHGB 4J6RH 3DYMA 5GGVL 1QR4A 1U3HD 3DTXA 3UTTE 5DJYA 3LIZH 2UUDH 3MV7A 3OKKB 1E6NA 1P4IL 2HVJA 2CPUA 5D1QC 3ZR5A 4E2OA 2DWDA 4X6DA 4Y2OA 4U49A 1VGEH 3H9SE 4KI5E 3MCLL 2D03L 2FL5A 3W5NA 1GC1H 2P24B 5FYLL 1U92B 2NX5E 3VIIA 4ZS7H 1MF2L 3FQRA 1W1YA 1UJ3A 1HK6A 4G43A 2GI7A 4HCRL 2ATKA 4RGOL 3DMMD 1JDDA 2ESVB 2NNAA 3FN9A 2Y2WA 5DC4B 3HC0A 4RBPK 2EH7H 4I48A 35C8H 4QP0A 1VADA 1Z0MA 3P77A 1TJHL 4S11A 1GOQA 4CUCA 1MFDH 1BIIB 4IIQB 5HGHA 2R2CA 5T1KB 4LCUA 4PJIA 4PRPD 4B7LA 3OG4B 1OTUD 3HUJF 1EGZA 3MUGB 5F7DA 1L7TL 2E8ZA 3LHPH 1A6ZA 3WUBA 5F97E 3RGVA 1RAMA 1MFUA 4XXDB 1M7IB 4OJFH 3KZSA 3TNNA 4R4ND 3U57A 1F02I 1KC5L 2EDFA 4XHJC 3WDIA 2OR9L 2D7TL 4NBXB 3U36B 4XVTL 5GJTL 1H3VA 4YPJA 3IDNA 2VUYA 1FNLA 5HGDA 2D3NA 3DVNA 4XH2A 1KELL 1CFTA 1RIVL 1VSCA 4OZ4B 4U1GB 4Y5VB 1QNPA 2V9QA 5I1AA 1MQPA 3WL9A 5FYKL 3FB7A 5MEND 1UB6B 5E6IB 4ZAKA 4RAUA 2V5RA 5FDWB 4MMZC 1Y6NR 1J1XH 4JDVB 5F8RC 1INDH 4DK3A 1K4CB 1QSFA 4PJ9D 4XWGL 3P9WB 4BQBA 3M8OL 4OLUL 1B9ZA 4YAQB 1W32A 2ED9A 3EO0B 3LRGA 4YH6A 3OKMA 5F9JA 4Q7NA 4DKAA 3ALFA 1U8MA 2JELL 3ARGA 1KUMA 2P8MB 4AEFA 3HC0B 3VFGL 4R0LA 4U7KA 4FQLL 4ODTH 1WWCA 3NFSL 3X3GL 1NP0A 5F6IB 1FAIH 4NN7C 1KPUB 2WWMD 3O6FC 3H2WA 2GFBA 5IM7B 2P43B 5GSRA 4UMGA 1VENA 3WS6C 3KHQA 1UD3A 4S1SL 1WQVT 3TNNB 4WEMB 5GNYA 2OBGA 3GMMB 4J12A 5FKYA 5D2NC 3S6CA 2H8PB 3FFDB 3VWJA 2IAMC 4NNPL 5C92A 1SBSL 4R5EA 2OX5A 1FIGH 1N7ML 3MC0A 5HYSA 3RPMA 1WF5A 1XGRA 3HI6H 3UP1A 3PNWA 1XCQB 2BVQA 5TH2B 1GVIA 3OJ2C 4XH2B 3R8QA 2EPOA 3SDCC 1NC4B 3L3IB 4ZYKA 2DICA 2D4DA 4IHOB 4MB1A 1UA6H 4F80A 3VXPB 4Z7UB 2DYPD 2QKIA 1HP4A 1A0QH 3C60B 5IGXL 2EIBA 2CRMA 1WNOA 3CFJA 3PJSB 4FABL 2F5BL 4IUGA 6A3HA 5DJZB 5CBEA 5ADPH 1BBJB 2ERJB 4JQIL 2IPKA 1AXIB 4WV1C 1JPFA 1G7JA 5JHLL 1PX3A 4XTRC 3MRPB 5EB9A 2XTLA 2XQBH 4LEXH 3FRPG 1S8DB 3AY4A 3B83A 1GORA 1FCGA 1MW0A 5L0QB 1GOGA 5DR5H 4GQ9H 3QEGL 4XP4H 3N85H 5JDSA 1RK0A 3DUHA 5MEOB 1GOMA 2BVUA 4ZS6C 1HQRA 1XIWD 3RZCB 2XWBA 5C08E 4MSWB 4O2EB 1MXGA 2HKHH 1NWUA