4HMPA

Crystal structure of iron uptake abc transporter substrate-binding protein piaa from streptococcus pneumoniae tigr4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
301
structure length
289
Chain Sequence
b'IVLDHAFGQTILDKKPERVATIAWGNHDVALALGIVPVGFSKANGVLPWTEEKIKELNGKANLFDDLDGLNFEAISNSKPDVILAGYSGITKEDYDTLSKIAPVAAYKSKPWQTLWRDMIKIDSKALGMEKEGDELIKNTEARISKELEKHPEIKGKIKGKKVLFTMINAADTSKFWIYTSKDPRANYLTDLGLVFPESLKDSFAKEISAEEANKINDADVIITYGDDKTLEALQKDPLLGKINAIKNGAVAVIPDNTPLAASCTPTPLSINYTIEEYLNLLGNACKNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-compound ABC transporter, iron compound-binding protein
molecule tags Transport protein
source organism Streptococcus pneumoniae
publication title Structures of Streptococcus pneumoniae PiaA and Its Complex with Ferrichrome Reveal Insights into the Substrate Binding and Release of High Affinity Iron Transporters
pubmed doi rcsb
total genus 88
structure length 289
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4hmpA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4hmpA02
1K75A 4UDOA 3MWGA 1N4AA 1N2CB 1M34B 4MO9A 5JOQA 1M1NB 4GICA 4DBLE 3MD9A 4WZBB 4HMQA 3PDIB 3AEUB 4MLZA 4TKUA 3ZTTA 2XDQB 2YNMC 4HMPA 4WN9A 4FI3F 4WNAA 2QI9F 4PAGA 4XPIB 5KHLB 5JG7A 3HXPA 3U7QA 4WESB 1KAHA 2PRSA 2PHZA 1QGUB 3AETA 1H1LB 2ETVA 4FILA 5BVHB 5I4KA 3LI2A 1L5HB 2AFIA 4TKUB 4G07A 3PDIA 4BBPA 4B8YA 3R5SA 3PSAA 3ZK7A 4XPIA 2OV1A 2M6KA 4UTOA 1FP4B 2AFHB 4WZAA 4LS3A 5JJ5A 3TLKA 2Q8PA 3TNYA 5AFSA 2XQVA 4HN9A 4TKVB 1G20B 4K3VA 1G21A 3NU1A 2OV3A 3MWFA 5B58T 2O1EA 4INOA 5CX1B 3UJPA 1PSZA 3K1AB 4G09A 2XUZA 4HMOA 4WN9B 1QH1B 1K7SN 1N2CA 5KOHB 4NNOA 5BVGA 2PS0A 1PQ4A 5BVHA 2M6LA 2PS3A 4LJSA 5FLYA 1MIOB 1QH8B 4FKMA 4UTPA 4ND8B 4FNAA 4N01A 3AEQB 3HH8A 4M7OA 5GGYA 4PM4A 5M29A 3AEUA 3EIXA 5GGXA 4OXQA 4IRMA 3MFQA 4H59A 1KAEA 4NNPA 2AFIB 1L5HA 2WHYA 3ZK8A 1TOAA 1MIOA 1QH8A 2PS9A 1K0FA 4OVKA 1ESZA 2AFHA 4WNAB 2X4LA 5BVGB 2Q8QA 5HDQA 1G20A 4WESA 2RG7A 3AERB 2XH8A 4WZBA 1M34A 4MDYA 1M1YB 3ZK9A 1FP4A 4WZAB 1XVLA 1EFDN 3PSHA 4ND8A 2R79A 1H1LA 5M2QA 1M1YA 5HX7A 5CX1A 4CL2A 2R7AA 5CR9A 5KOJB 1K2VN 3EIWA 2MINB 3BE5A 2XV1A 3MINB 3TEFA 3CX3A 3AETB 2XDQA 4MX8A 2MINA 4TKVA 3AERA 3BE6A 2OGWA 5M34A 1QH1A 1M1NA 3AESB 4UDNA 1QGUA 5KOJA 2XY4A 1KARA 3AEKA 5JPDA 3MINA 4INPA 4OXRA 1N2ZA 3LHSA 3AEKB 3GI1A 2WI8A 5KOHA 3R5TA 3AEQA 3ZKAA 3K1AA 1G21B 4H0FA 3G9QA 3HJTA 2YNMD 3U7QB 2OSVA 3AESA 5M3BA 1N4DA
chains in the Genus database with same CATH superfamily
1R5OA 3OVMA 3P7MA 5LJLA 1XN4A 4PIVA 3UZUA 3MIZA 2ZU6A 3RTDA 5BMVA 1W35A 3L8HA 2IRWA 1JQJC 5EG5A 2X3YA 1K92A 4Q1CA 1Y1KE 4W5NA 3KYIB 5ANRB 2NQ8A 4LDRA 3ZDAA 2I33A 2XGJA 4NYIQ 1KEZA 1OAKA 1JHAA 5I9TA 5BRNA 2P8SA 3UV3A 1ADJA 1PJBA 5E7MA 3JQGA 3JYNA 4TVSA 1PR5A 1O97C 2C9DA 5GINE 3SS7X 3RT9A 3CRRA 4HNAB 3ZV5A 5FQNA 4DCVA 1DKQA 4YAGA 3KKQA 1F7VA 5B7NA 4C7OA 2DAPA 2QLJA 3H0CA 2RK4A 1NE2A 1IWOA 3I6MA 4G0PA 4PN3A 1OBFO 4RHEA 1AUVA 5LQUA 1PDWA 1V45E 2VDKB 4PYOA 4NHEA 1M6WA 4ZO6A 4W5JA 1RZ3A 1VLVA 1N3LA 3S8MA 2QJTA 1OFUX 3CNNA 4GOND 2YXEA 1F38A 2Z56A 3GZNB 4UVEA 5BSHA 1F17A 4RTNA 5CPFA 4IF4A 2IITA 3F9IA 4ZIRA 4UTNA 3REFA 4DILA 1N6OA 2HRZA 2C94A 3BS4A 5J2TF 5B7PA 1TPZA 1AOXA 4GLJA 4WRRA 2OGSA 2GJ8A 1JG1A 1HYHA 3PEWA 1KPIA 1D5WA 2XF8A 4CDGA 1DUSA 1VPVA 4G5FA 4X9XA 1NY5A 1XLTC 1IWBB 3K9WA 4QYIA 4XR4A 5TQ0A 4RGYA 4YJGA 5CB6A 4HNVA 3DTVB 5FLKA 1CF2O 3KXKA 5FYQA 3ZCQA 4QE3A 4DDTA 4UXJA 3ED5A 2VP6A 3HU2A 2BPOA 4NSNA 2PUJA 1XP8A 3T1TA 1CUGA 1E9BA 3NBUA 2AG6A 4KE8A 4CG0A 3U39A 5KI6A 5SY6A 5A0TA 4QOIA 4F60A 5HGXA 3ERCA 4RKQA 3LX8A 1DI0A 5AI8A 1ZHFA 2GJAA 3N59A 1NGSA 3TQSA 4V0NA 4IIGA 4N6NA 3BERA 2C8JA 3OCCA 3L0YA 1J8DA 1EM8B 4MSUA 2WUVA 4WAUA 3GT7A 3ODGA 1XK7A 4LZNA 2F1HA 2H4YA 1U1EA 2YX1A 3NNSA 3VM6A 3WRYC 1QVZA 2P9CA 1YZKA 2V7EA 2WE7A 3CF6R 3PQ2A 4FT2A 3C1TA 2BYTA 4IP0A 5JCJA 3WJAA 4OI0A 2Q1WA 4CFZA 3EXAA 3HADA 1Q0QA 2IQIA 4GNRA 4PXAA 4EL0A 1J9GA 4YUYA 1PVDA 2GXSA 1DRWA 3DGFC 3E18A 3O5AA 3HEMA 1V5WA 3UHPA 1NI5A 3EIEA 3TMKA 2HT6A 3EFBA 4DA9A 3PEFA 2O8EA 4PTYA 2EL9A 2HL6A 2BFEB 3H8JA 1GQQA 5EXXA 3F7NA 1N1MA 3C3MA 1EUDA 3TSCA 4GGMX 1NW3A 3R3JA 3H18A 2NUTA 4D4HA 4KH0A 4F85A 4B3TB 2ZWMA 3ID6C 4COOA 4KPGA 1EYZA 1WTAA 2GRJA 2EW1A 4L8GA 4OXYA 5DEOA 2YS7A 3ZWDA 5AW3A 1AS2A 4KHPB 2P2NA 1YXMA 2P91A 2A6PA 3D1JA 5E1BA 3WZMA 4LF9B 5GVRA 1GFSA 1EU1A 5GPBA 3KQYA 1M34B 3HL4A 1JMKC 2K7FA 1Z0AA 3SY8A 2ZYAA 4DLTA 2PGIA 1ODCA 2EOAA 4YMTA 1G55A 2AUTA 5ER9A 2QN1A 1EFHA 1W1WA 4IR7A 2XKKA 3B6KA 1AQYA 4UMEA 4EPYA 1F60A 1P7CA 3AEUB 2X6RA 1OMOA 2PSSA 4WN9A 5A0FA 1V48A 3DDOA 1DJOA 4PZPA 2F1IA 4R8RA 4D4IA 3CQ9A 3KFLA 1Q17A 2YC4C 3IR7A 1D9ZA 2VBCA 3WGZA 4C5CA 2AJDA 3ZD9A 6ADHA 3CLRC 1IZZA 1PJRA 5LQMA 3LI2A 3EXFB 3AXTA 4Q3DA 3EC1A 1Z0DA 4HX9A 4P4SA 2JCXA 1YCFA 4KU4A 3AR2A 4EFNA 4FJ2A 2AK3A 3JXEA 2ZJ2A 5C34B 5IEJA 2FW9A 4CTMA 1M2NA 3ZQ4A 3HO6A 1A9QA 1GTL1 1YJAA 2Q8PA 4BNLA 4BX3A 2K7ZA 2RGNC 4UULA 4Q37A 1FBTA 1N3YA 1WPXA 2A9RA 4MW7A 2ZJ1A 1H65A 4DNXA 1W19A 1KETA 2I5PO 4BVFA 2DETA 4L57A 1XKTA 1CQXA 1J56A 3F4KA 4LSGA 5LZ9A 1E6MA 1PRYA 2P9ZA 4PQRA 3V4OA 3E8SA 2DEUA 4MHTA 4WN9B 1M8FA 2GRAA 1I2MA 4M7PA 2OYSA 3SQLA 4PLCA 3S1AB 2ZCUA 1XKLA 2FPSA 2OTCA 4J0HA 1I4OA 5ESWA 1KK2A 1JIUA 3FSGD 4KQCA 1VB3A 1ZHHA 2IUTA 4CWAA 4RVUA 4QSHA 5DXAA 1MIHA 4PGAA 4EAAA 5JMPA 3BTSA 1MOSA 1SY7A 2DFVA 2OV4A 3GRYA 3MT7A 4UREA 2UYCA 2VJPA 2BTQB 4BB6A 4MR7B 3EHEA 4KQ9A 1DAGA 4DS3A 1Z45A 2Z8YA 5IRCD 4WK0B 1P9OA 4Q4HB 1NOJA 1DL5A 1IONA 4MHSA 3EOAI 3WWYA 2ATEA 4K8RB 3IULA 2HU7A 3WK5A 4C20A 1AY0A 1X7ZB 2HIGA 2PX2A 3NGXA 3W04A 3K09A 1US8A 1PE0A 2WUFA 2XCOA 2HWUA 4NBWA 1UBFA 2GO7A 2X86A 3ECAA 3JQDA 4FSDA 1OE0A 1HQYE 4B3XA 1GKKA 1L5FA 2BJWA 4Q9NA 3TZBA 1AE1A 1TC1A 1S2DA 3RFFA 2I2XB 3RSZA 2J3EA 2Y77A 4L95C 3CX3A 5CFNA 1JT9A 1GDDA 1YE8A 3BXGA 3TXAA 4D3ZA 4G0OA 5GONF 2C2YA 1OUMA 2O57A 1R15A 2QTCA 4M8KA 4U0KA 2FJPA 2IPNA 3HCRA 3W5AA 1CV2A 3SHTA 3A7DA 1DTEA 5T4EA 1JYSA 1TCUA 1X1CA 1EB9A 1JLMA 1MABB 1UT6A 2EU8A 4JJGA 4R2IA 1WBJB 5H81A 4DJTA 4XZ3A 3DFMA 3BGVA 1OIXA 1WB5A 1QMPA 1QZ3A 3U7JA 5KQMA 4IDEA 3AUFA 4TVOA 4E5PA 1QAOA 2VZ9A 1ACMA 1HQCA 2FN8A 3TD9A 4BQQA 4XLZA 3GFFA 5ELLA 1CS0A 1W52X 3EFOA 3O3CA 1G8MA 5EGSA 5C9ZA 2JFWA 1R0SA 4OL0A 4X24A 5IT5A 2AQKA 3KAQA 1A3CA 1CU1A 1KS2A 3RCBA 4BLTA 3DCJA 3GXBA 3GFQA 2OHVA 1GUYA 3OTOB 3S7TA 3H4VA 1IUPA 2IIQA 2PWZA 2RK6A 4CYMA 2EFGA 4HUQA 1U94A 1ISSA 3AVUA 1JU4A 1TMYA 1XMXA 1BYIA 2NVOA 3PHIA 1X1QA 1X15A 5A71A 2QRHA 4Q7MB 2W48A 1A9YA 1E58A 3FKJA 3R6LA 3NHZA 4JP1A 1CEYA 4BNJA 3QHAA 2OGUA 2VVTA 4UHFA 3C5VA 5ALJA 5DGCA 4BE7B 2ZUWA 4CG3A 3DMNA 4CT0A 5A62A 1F3OA 3VISA 2FG6C 1NMZA 2DQ4A 1DOHA 2WJYA 2XQVA 2I91A 5HZKA 3EZLA 2ORVA 1UZMA 3PC8A 3B9RA 3WLFA 1GCOA 5JJCA 1ZA1A 3ZIUA 2J4CA 4KDFA 2CFIA 4Q1VA 1UC4B 1G21E 2H54A 4OJMX 1V11A 3E3MA 4RM3A 4Z4HA 2WYUA 3BKXA 1N8TA 1XZKA 4FDVA 4HMOA 4L0DA 1CY8A 5A05A 5CT6A 121PA 1P2TA 2GEBA 4ZARA 3W5BA 3I76A 2M6SA 1I1QB 3SF8A 4KPUA 2VQDA 4WBXC 1AUPA 1HDCA 4YROA 5HF9A 3PP8A 1ZR4A 1MZVA 4IKOA 1XEXB 4EY7A 1UC9A 4CF4A 1RXYA 1WU8A 3O4HA 2P9GA 1A2KC 1CHNA 3PU6A 2IOHA 3IKVA 4U8GA 1HE4A 2W6CX 3DMPA 3MM4A 4UTPA 3D2AA 1PNVA 1VRVA 1WA5A 1QG4A 4PM4A 5KDDA 4HGOA 4I99A 5ALIA 1MHPA 4D3XA 4YV2A 3OJWA 4AP5A 4XYGA 3OZEA 1R16A 3MMPA 4JVOA 1E0AA 4K6FA 1ORRA 2DUWA 3FLMA 1U0JA 3ITEA 5CHYA 1GEGA 1XPUA 1IN4A 4ZC8A 3I2KA 1HL7A 2B36A 1K89A 3T4PA 4A9AA 3H2ZA 2G4LA 5DF1A 3GPCA 3ZI7A 1ODIA 3UT0A 3WI7A 5KYTA 4QZVA 3T3NA 2UUAB 1F2TB 3Q15C 4XQEA 2ZI6A 1ESCA 1SBTA 4FMCF 4GWKA 4WK6A 5DP1A 2XT0A 4MI6A 1XVLA 5CDGA 4EG3A 5A3JA 3I3SR 3H9UA 3ZE7A 1FDRA 2QRVA 4PYIA 1T2VA 1VHDA 1PI3A 4HGQA 3ZOKA 3RUPA 1H23A 4DJDC 4C7OB 3PPIA 4ZOLF 1BCRA 5LMUB 5D5HA 2HMAA 2G83A 2B5WA 2Q6OA 3B60A 4J2TA 1ZWLA 4AWXA 4C4PA 5C1PA 1DXQA 1MGOA 1VJGA 3AUSA 2FN4A 1T6ZA 3DMYA 3RV4A 3QX7A 3ZZTA 4L6AA 2HXSA 2XE4A 5KWVA 5IDYA 3MYYA 1IEXA 2YXBA 3QPBA 2Q3EA 4BUZA 1F0KA 3ZJUA 2E5FA 3LECA 4PYLA 4ABYA 1JKIA 1NLMA 3BD6A 4IVPA 1F8GA 3GCDA 2FRDA 4ZOCA 3VC7A 4BU0A 5MFZA 4RZXA 2P7IA 1WTCA 1N2HA 2ZYGA 5FUBA 3H8WA 4LBVA 1OT3A 3NHSA 1JDUA 3CSUA 2ZBQA 2FWNA 4IV0A 2HRCA 1JRLA 2PVSA 4OMDA 4R7TA 3HN6A 2E85A 1QG0A 2BEVB 3B89A 2IYXA 5JOQA 2QYTA 2XNJA 2OC4A 1LLQA 1YKGA 5EMJA 3RLIA 2BZ1A 2QAGC 4CG1A 1TM3E 5GV8A 2OCIA 5KQLA 4YRZA 1NPYA 1I4TD 4GICA 1RD4A 2F4NA 1O58A 5CH8A 3UV6A 3GLFA 1ARZA 4OQQA 1TQ8A 1XZFA 1Z2NX 1ZD8A 4DIDA 1NXQA 1BWSA 1SIUA 2DPXA 3DH0A 4L5AA 3SKXA 4OLHA 2IYYA 3AR5A 2XWJI 3HB1A 5ECGC 5J2UA 2OZLB 1THZA 4J16A 4R1MA 2VQEB 1UBJS 2JAOA 3BEOA 2IH5A 1OAOC 1E2HA 1XDGA 2RGXA 1G4HA 2P69A 1VL6A 3OSUA 4BZWA 5KOIA 1GG9A 2P30A 1DDIA 3K2IA 1JYFA 4IJQA 4ZOQI 3AR6A 4DKJA 3WK6A 3PKJA 1NXOA 1BOFA 5JS8A 5DNEA 3R6WA 3Q1KA 5HRUA 3PDJA 2ZUCA 5D6NA 4R2JA 1KDOA 4RKFA 2OC9A 4XUCA 3V6LA 1C50A 2BJVA 1XZPA 2BFBB 2VZLA 4G3XA 3UPTA 2ZI7A 3GF4A 3COYA 3RG8A 1LK5A 1EHYA 4RNCA 4NBLA 5CA0B 3AV0B 3K9CA 3LNCA 3OM8A 1QFYA 2UZAA 2P4QA 4MAAA 4GE0A 4LJLA 2EBWA 3D8SA 4LUCA 3NGMA 4FIZA 5EPUA 5TX7A 1U0BB 3UAXA 4P7GA 4DG9A 2ZIXB 1M0TA 2W7TA 1SUFA 3K16A 4JH0A 4HDAA 1CETA 1USGA 4AO8A 4D44A 4GRDA 1NBAA 2R4UA 3HBJA 4Q0MA 1QRSA 1XPOA 2BKAA 5BN5A 1OPRA 2DH6A 2IJGX 1TU0A 4JJFA 1KMHB 3ZYCA 3GHYA 2IHVA 2I7DA 2YN2A 1PN3A 4QDXA 2Y1KA 5J58A 3CNQS 4QOEA 2O2EA 1EBFA 1OJ7A 3BFPA 4BGEA 2ZXUA 1O77A 2ID4A 4ZODA 2BZGA 3IV7A 1PKEA 1THTA 2GPYA 3B7PA 4GW3A 2PS9A 1R4ZA 4IYJA 4Z3OA 1XMOB 3X1DA 1N5JA 2FPPB 2OUIA 5CVDA 3U44A 4P7BA 1XLWA 1PT8A 3Q3IA 3AY0A 3F8TA 4IEIA 1TJPB 4KC0A 10MHA 3FGZA 3OOYA 4OX9Y 3RVQA 5FD8A 2ZQYA 3AF4A 4WW0A 4ZZIA 3LVFO 4I4TF 1EX1A 4OSEA 4O8CA 2IXTA 2OUKA 1NI4B 2E4WA 1KC3A 1II8B 2I3AA 3EZYA 1JQDA 3S99A 1KZYC 2LDXA 3JATA 4RMJA 3N2GA 1M2EA 4YO7A 3QIVA 3HE3A 1F9AA 2VTKA 3U40A 4ZI7B 1T3ZA 3JVIA 4Y67A 4I6JA 3S1LA 4ZOBA 2WLSA 3KEGA 3T3EA 4YR7A 3RRJA 2O7NA 1MOQA 2IA5A 4P08A 4OXXA 5TR9A 4DGSA 1W5AA 3AINA 3LL7A 4YUVA 3W78A 1IZYA 4BNWA 1XVVA 1WZEA 2FPIA 4MIOA 1FSGA 5JPIA 3RUEA 3EG5A 3VPHA 3ZDDA 1DC8A 1VXOA 1YDGA 3KALA 3P2IA 4REMA 4TKMA 2QPOA 3UJ9A 3ADOA 4GG1A 1NKSA 4LHXA 3R9XA 1XCGB 1NI4A 4FE3A 4RTPA 1N33B 3SZOA 5KEIA 2NU9B 1T5OA 1E6EA 4S04A 1PFVA 1DXYA 1FJGB 3U7QB 3WQHA 4MVXA 5ALTA 4RHCA 2H16A 1AQLA 3N05A 2PBLA 1Y1TA 1JSCA 1NP6A 4DM4A 3R1IA 1VJCA 4Z6KA 1ZNYA 2QRGA 4QA9A 1G5RA 1BXKA 1JPJA 4W5HA 1AZTA 3CZQA 3MOIA 2ZI9A 5K99A 3GLIB 2HJVA 2JGLA 2IE8A 3FGOA 5CDSA 3NBMA 3F1LA 1J8QA 4CW7A 5BSKA 2BF7A 4UNRA 4QVGA 4OTZA 2WHRA 2QWXA 1RJWA 3FRHA 1UBLS 1NQTA 2H6EA 1LBIA 4JIMA 4QATA 2I6QA 5KSWB 3W7VA 1R8JA 5IZCC 2PUEA 4LK3A 4A4DA 4DA4A 4WZAE 2Q2WA 2F1JA 2IYVA 2Z5GA 2IHZA 4MYUA 3UUGA 3QVGA 1J25A 2VYVA 3D43A 4B0OA 1E3QA 5CFZA 2XEXA 4GBED 1QJCA 3QBEA 1V35A 4R1QA 2CHUA 3X43A 1TQ2A 3EZNA 4KXXA 3R7FA 1RHUA 2WJ4A 1GNLA 2X0IA 3D3QA 2R8EA 3PBKA 4IDFA 4MIKA 3UC9A 1X86B 2J0UA 5TRTA 4B75A 3HXOA 2IPLA 3RABA 4HHEA 2FDRA 4Q02A 3UGTA 3JZMA 2MCFA 3P52A 4XM0A 3WMGA 5IH7A 4DYHA 1F6WA 3DF7A 5K05A 2AJBA 1Q84A 2ZRCA 3D81A 2J87A 2CNWD 2EZUA 3O38A 4J43A 4JKOA 4WKGA 4MYRA 5I7HA 3TOCA 4MV0A 2HCBA 2O8VA 3D7RA 3HUDA 4TT8A 3V2HA 5C52B 2WU1A 3DW3X 2VAMA 2YJ3A 3IRVA 3DZFA 4YALA 4N3GA 5B7GA 1Q1QA 2D00A 1FNNA 1UANA 2JA1A 1P9WA 5JDCA 1F48A 1FRQA 3TR6A 4B85A 5CFOA 3GR6A 4HYQA 1E7QA 1V6CA 3E9YA 3KT0A 1QX4A 3F6BX 3IQZA 4WWHA 4MRPA 5CLLA 5FI0B 2BFCA 5FOVA 3VU0A 1AJEA 4RDHA 5EJ4A 1JE0A 1NSFA 5BSWA 3LL4A 4KGXA 1ZINA 2EFDB 2GHQA 4IUDS 3CJQA 1MIOA 3ZY2A 1VL1A 2B82A 3JQCA 5H3HA 4DABA 2IFTA 4BNNA 2BAGA 1QU3A 4OVKA 4JROA 3TSWA 2VFAA 3ZDCA 2VL7A 4FZ5A 1W7AA 1XCLA 2XXAB 2C2XA 1TYEB 4CF5A 1P7VA 4TS1A 4ALKA 4CCYB 1DAIA 1I7LA 3FVTA 4TTQA 5JY1A 3PPVA 3DMFA 5DU2A 2EZ9A 3EIUA 3WB0A 2CFCA 1J2TA 1KH2A 1JDVA 1KH1A 1JHQA 1X1SA 2HPZA 3HJUA 3VH2A 4E51A 4M36A 2WTXA 4A1OA 4D0NA 3VUEA 1NZFA 4M0FA 5H0IA 3PUHA 3R7AA 2PUDA 3HGMA 2AJLI 3DOJA 1AUQA 3AR8A 2RI6A 4FN5A 1PBNA 2UV8A 5CXQA 1DEAA 5KHOC 1Z38A 4FDTA 3EEFA 4UCXA 1EFKA 3R8XA 1PL0A 4E13A 4F9TA 5HDBB 1N0VC 2A0YA 1BXZA 2WUGA 1MB9A 3UT5B 3AC0A 1Y5LA 1QCDA 2GKSA 2V6BA 3GJRA 1KI2A 4F71A 5A5EA 1UBHS 2IL1A 1Q11A 4KUGA 5HOQA 1R6DA 4L22A 4B4VA 5AIAA 1L9KA 1BWPA 2NSLA 2YJGA 3HXMA 1SQ6A 4IJWA 1PR2A 1OX5A 2BI4A 5TSDA 1UMCB 2CEKA 5TJ9A 1PR6A 4M6WB 3QTTA 4TXHA 821PA 4JLOA 4QT4A 3VKUA 1FCJA 2RGRA 3OQBA 4HKTA 1NVKA 2JHCA 5LZ2A 4KR9A 1XDWA 3U4HA 3QUBA 5JROA 3AP1A 3BSSA 4FHDA 3DLHA 1FZTA 3F74A 2QRPA 4PPGA 1DRJA 1I4LD 2VJNA 3ET4A 4FR2A 4MGIR 5NLLA 4BFZA 2I9PA 3OOEA 5K45A 3VR4H 1U28C 1SZJG 4MLZA 4YRBA 1DFIA 1XF9A 2OM6A 2VUSA 3CY6A 3G49A 5IXYA 4UVHA 3TRHA 2NUBA 4IDAA 4PE5B 4CE6A 1U11A 3QVKA 3JD4A 5TEVA 721PA 3URKA 3IPYA 2GCOA 1YZTA 1LV8A 2LTAA 3U7QA 4DA8A 1K1EA 1QGUB 2C9ZA 2J67A 2OBFA 3FHCB 3CRNA 3EGDB 3TDNA 1I94B 3L79A 1ZVQA 1X7WA 1FLAA 5TMBA 3VKFA 3G5MA 1PJCA 3PDIA 4X6UA 5FR2A 3DBHA 1QRDA 2EV9A 4YMWA 1Q0UA 2IEDA 5CLHA 2O5CA 2VJQA 2JG3A 1H42A 1U3FA 2AX4A 3KE8A 4Q4CA 3ILSA 4Z0TA 4FUQA 4OSPA 1NA5A 1E96A 4MQ5A 1K7CA 1X70A 3FFXA 1X7GA 3L46A 4TQGA 4NK4A 2EL7A 3QKWA 3L7OA 1CEQA 1OASA 4LGVA 3PTLA 5DLEA 3N2GB 2JGDB 5CNKA 3PPWA 2JLXA 1XNGA 2RHJA 4MWZA 4FP9A 2ZTLA 4NU5A 4DXDA 2Y1DA 4EF5A 4G01B 4PC7A 2OQIA 4JYAB 1NR1A 4WVLA 1VJ0A 1HTTA 4B44A 2YWEA 5IXSA 2F17A 1NX6A 3FY4A 4R9UC 1YJCA 5HF6A 3SVZA 1J1UA 4YO8A 1NZJA 4Y18A 2I66A 3LT4A 4ZYZA 4OUDB 4C22A 2RGYA 1SBQA 1Y4DE 3UBMA 3COSA 5LP6A 2XJ4A 5B7QA 1SWVA 2NGRA 1WG8A 2DHCA 1KAGA 1UDAA 3RTCA 5A6SB 4EA8A 3I6QA 2NYUA 2R5WA 4X85A 3SQOA 3GLFB 1MXFA 1SH7A 3PCXA 5GJWC 4QLAA 3VYTB 3U7GA 4TMXA 3R9IA 1EJ6A 1YSCA 2YZ7A 2Z58A 3RIGA 4B1FA 3G17A 4N5DA 4LX8A 1NVUQ 2QF7A 4FTWA 2R00A 1OI2A 5DP2A 4UFPA 4DR1B 1JDBB 4EW6A 1I5EA 1P9LA 5CCBA 1T2UA 5LP6B 3ICEA 4NVRA 4EHAA 3CTPA 2UVPB 2C99A 3ZHYA 3G68A 1S7GA 3SR0A 3V8VA 3M5PA 3IPAA 1FP2A 2WIBA 4WNCA 2E1PA 1T9CA 4A91A 1PDOA 2ZJ3A 4MTLA 3VQTA 1P0PA 2IDJA 4QASA 1E3WB 1KGSA 4BOYA 1P0MA 2LKDA 2GWHA 4K26A 4YXFA 1IB0A 2VRCD 3HV2A 3PUWA 5FPHA 5FPSA 2BWJA 2XB8A 4ITUA 2OV2A 1FUYB 1TPYA 3EA5A 1IAQA 3ESRA 3IOEA 4BRWA 3AP2A 2BGUA 1PWZA 4OHMA 4RKEA 1GPBA 3NVMB 1P9NA 3A32A 3IEXA 1UWKA 4B3DA 1DIBA 3OPYI 3U56A 4BO7A 1GFZA 4O4HF 1AHNA 5AM5A 5GQSA 3C7AA 2WJIA 1EFCA 5I4IA 4IXMA 3WYEA 1R6BX 4TT3A 3QHQA 4WOJA 1E5VA 4TN1A 4DRZA 4F56A 3BB1A 3CVVA 3HVUA 1H66A 3CCFA 4KAFA 2CNKA 2B6NA 5EL0A 5HWSA 1PNTA 3L77A 3SXPA 4W9NC 1JQBA 3U19A 2WTBA 2ZEJA 5TPWB 1EM6A 2DBYA 3C3JA 1LTQA 1MV8A 3WDKA 1ZGJA 4G89A 3W2EA 3SC6A 1KOLA 1QDEA 3KWMA 1NDHA 3DD5A 3VGPA 5HJ5A 2ECPA 1WQ3A 4YMHA 2VEOA 4IZHA 4D4KA 1M74A 5DX0A 2HMSA 3UCXA 2G17A 3P9CA 3PSAA 3VSCA 3TZCA 5LN1A 4ZCMA 3ROGA 4GKVA 5MN6A 2X0NA 3OTGA 1F2UB 4P93A 1XG5A 4Y9RA 2Q0XA 1D3AA 5FJJA 4IIHA 1E1YA 4JGGA 1DQRA 3DUFB 3U9TA 2HRRA 3ZHOA 2AYXA 2ZRFA 3GDGA 3UIEA 4KMSA 1ULTA 3K9NA 1N1GA 4ENRA 1U7WA 5DI9A 1T24A 4DDWA 3IV6A 5FWNA 4US1R 1Y1SA 2D1SA 3PRHA 3VH1A 4M0KA 1X8LA 4OK5A 1DLIA 3CINA 4RQUA 5IYZB 4DA7A 2A78A 1DCTA 4TGLA 4BU1A 2O4CA 3HA5A 3JQGB 1G66A 1V1MB 3D0QA 1QG2A 2QRMA 4M49A 2O23A 2MSEB 3KFXA 4ITVA 4Z3KA 3TQQA 4AI6A 1M0SA 2C9OA 3L9WA 4LF8B 5TC4A 5D86A 4X6XA 4JP5A 2E18A 3I2JA 3MJCA 4TV9B 3FOAA 4ENUA 2PVCA 3W8RA 3BDAA 3VXKA 1FYFA 1IVYA 1VBKA 5ALXA 5GGXA 5DULA 1E1RA 4AY6A 3CPSA 3DZCA 4M8NE 3ZDQA 4U6QA 1E1LA 3QPVA 5C7YA 1K0FA 2FUCA 3AJDA 2Q3FA 3I37X 5GM2A 3WRXA 5C8YF 2R0QC 4EF4A 1D4ZA 1FC0A 1LC0A 2JAUA 1NRIA 5EINA 4A6EA 4DSZA 1TCVA 5FCDA 2EHJA 4Z54A 1YZHA 1YOBA 4A2PA 3LCJA 2UUBB 4MDYA 1XPJA 2CVQA 3WVNA 3TCXB 3SMQA 1BVHA 4RFSB 4LJ4A 1R50A 3UGQA 3DBIA 4NBRA 3PB3A 4GIBA 1P4JA 1GG8A 2OAEA 2DG2A 3WP0A 1JECA 1YGYA 3QM1A 1QO0D 8ADHA 1R27A 1ZCZA 3M4YA 2H17A 1Z6ZA 3KYDB 1U7XA 2QP9X 2BH9A 1A1SA 3WGJA 3PE3A 2I4OA 1NUUA 5AKEA 1G6HA 3DBRA 2GHTA 4NJEB 4IYRA 5IABA 3DVAB 5JADA 1U9YA 4HRXA 5A7HA 3WA6A 5G2OA 4EHIA 1W4RA 4ZCIA 3T4EA 1H94A 4LY6A 2DFTA 3DE4X 1B16A 1IC6A 1ZK0A 2HADA 5FOSA 3C6KA 1JXAA 5G53C 5B1IA 1EVIA 4DV4B 2BCEA 3RNLA 1D09A 2IODA 4HXFB 3L8FA 1YB6A 1JL3A 1FDIA 1VL8A 3HZRA 2R6GA 3VSAA 4J90A 4NAUA 1JVSA 3RS2A 5B3JC 5DLPA 1OXVA 3A6EA 2IHKA 1VRWA 4KW7A 4F3CA 1NMEA 3KJIA 3KQQA 5CPBA 1C7FA 4G65A 1KDYA 2AUNA 4MQUA 4EENA 1A1VA 1TEZA 4NXNB 2FFJA 2ILVA 4N48A 1B2LA 3VPAA 2DHRA 4EJSB 1L7QA 1TM1E 3UBTA 4DBLE 4GL4A 5I6DA 2IYLD 4GD3Q 1VYHA 3CJTA 1WPRA 3AXSA 3ZWCA 1ZVJA 2YIVX 4TRJA 4KJXA 3RJZA 5AI9A 2PL3A 1JR3E 2OGZA 2Q7XA 3TLXA 1LW6E 4QT0A 2V8BA 4TWBA 1T5HX 4JJ8A 4WESB 4B6OA 2ZSKA 3F8SA 1EP9A 2A2ZA 3AI3A 2W42A 1W44A 2X2FA 3EBLA 4BQPA 3G13A 3IDZA 2AV6A 4CU5A 1VQ1A 1D5CA 4IOMA 1X1EA 3WMXA 2CL0X 3JZIA 4CKCB 1NUSA 1P60A 4ZVRA 3OPXA 3L6OO 4KDCA 1QE3A 4RDCA 1UKZA 4JEHA 1Y8CA 2Z3WA 3IXQA 2GWRA 3EBOA 2LCFA 3N28A 4FKZA 4ZO7A 3STYA 2BR4A 3SZGA 3EGVA 4KNYA 5BRJA 4JQOA 1D2CA 2R6CA 1U0LA 5JAPA 1OWNA 3BMCA 3KYCA 2C1EA 3BYZA 4YRLA 3UK0A 1BTOA 1WEHA 3KVVA 5LQSA 1SHJA 4LXUA 2K87A 4UU0A 3W5HA 2AJTA 2MYNA 3D3JA 3SE0A 1BW9B 1MB4A 2YMQA 4M9SA 2C29D 2YOFA 3EQZA 5CTAA 2AXQA 3HV0A 5H68A 3NWOA 2EC5A 1J99A 2BGRA 1GVNB 4DBLC 1HDOA 2FF7A 4UTVA 4ZOEA 5E0KB 4DTCA 1P3JA 1SU6A 2REQB 1YR2A 2CVZA 1T0UA 4Q15A 4AZ0A 4ROSA 2DPGA 3ZJTA 1Q1GA 3DMTC 3CUYA 3N2LA 5IWCA 3THXB 2H1IA 5ICMA 4B33A 4WFKA 1CJTC 5BMVB 5AK4A 1SQ5A 1OLOA 4KXFB 2B4QA 4MZDA 4V24A 3EVTA 3TWOA 3GWZA 1M1UA 2RB5A 4I50F 1EGQA 1J2EA 1UJ5A 2J5KA 4RENA 3KB1A 1PX2A 3HCFA 3V7WA 5KVAA 3FROA 1UQTA 2VS1A 2RI0A 3VKHA 1ZWKA 3L7KA 3O8LA 3CVJA 1U1GA 2OXCA 3M49A 3O1JC 1LK7A 1JG2A 5JXHA 1VSUA 2PKWA 3W9SA 4CNBA 1G17A 1WCIB 1YZQA 2B61A 3KJHA 3PXDA 4IDHA 2IXFA 1PS9A 2VUHB 1R7RA 4P4LA 4PAWA 4CKXA 4DAOA 3TTXA 3DVQX 5K0ZA 1PVVA 3ND7A 4JXZA 1BWRA 1YC5A 4PONA 5K0JA 3I4LA 4HY3A 1ND5A 3FG9A 5JQGF 1VYVA 5L40A 1DZ3A 5CTJA 2FCRA 2CJPA 4UUPA 1FJHA 4GOXA 4CHGA 3L0SA 2C8KA 4A1FA 4FB4A 4C76A 1JBQA 2GD0A 1NF9A 4XE5A 2WP0A 3GT4A 5G0UA 4EMSA 1LLDA 1HWYA 3D7KA 3HMKA 2IV3A 3BORA 2HEGA 2JJMA 3MJVA 1D0VA 5T57A 3VTAA 1Y98A 1JSRA 3KL4A 3NJ8A 3SBXA 3VC2A 3LUBA 4JP8A 2APJA 1VYUA 2JFBA 3AP3A 1JQ3A 3K0FB 2YN0A 1DX9A 2XYRA 2PLFA 3QPWA 3R09A 1IUNA 1ZM9A 4JOBA 5DGDA 3PDCA 1OH8A 4K81B 3ZWBA 1UINA 1U3VA 3WBBA 1UZAA 1DKNA 4P53A 2Q0HA 4KGVA 5CLQA 2Q2QA 1O97D 1CW2B 1W0JD 2M9MA 1N5MA 3LPCA 4OYYA 2YOHA 4MS4B 4R83A 3DFIA 5HIIA 4LY0A 1N5OX 1MHTA 4B4KA 4B3IA 1X0VA 2D59A 1YB7A 3I45A 1EKXA 1HC7A 1MQ8B 1Q14A 2WJVA 1YJ8A 4OJQA 3VFDA 5T67A 4YRCA 2O1XA 3ZWPA 2G76A 2GPSA 4ZEVA 1EESA 3KPYA 1C1YA 3ON5A 2IUSA 5JBIA 5B55A 3KCQA 2NWQA 3LG2A 3OQMA 3MTDA 1GGHA 2PA0A 3M34A 2C7VA 4B82A 4J7XA 4JLDA 3OOSA 3FJ1A 3FCYA 1H6BA 1AM4D 1TB4A 3D6FA 3GZ4A 4N65A 3V4PB 4DV7B 3LQRA 3RRZA 3EVDA 4TTVA 2YCLA 2QS9A 2QN7A 3EIHA 2HSJA 3PNYA 3SLGA 3K53A 2CWWA 3OLZA 2IYUA 2ZTMA 3TO5A 4IH1A 1G8PA 2Y2UA 1PNRA 1P1BA 2W6PA 4LYAA 3MWFA 3QKSA 2BGJA 3UT6A 5AKIA 1UPCA 3NHJA 2PE5A 2HXYA 2YRFA 3GZNA 1RJ9B 1UZUA 4XQGA 1C0LA 1I6LA 2C83A 3NIWA 3P2JA 4QPNA 1BJTA 4TMZA 5DHFA 1H5UA 2FZ5A 1BCSB 1MAVA 4FDUA 2ZAGA 2X3FA 2BLLA 2VK4A 3FMPB 4ADSG 4Y6OA 4YTEA 4O08A 5DHQA 1IBSA 4BZPA 4PN7A 4FFDA 1S6YA 4LG1A 4MKHA 5TVGA 2PS3A 2E4AA 1B15A 2W2QA 3H5IA 5AD1A 3WJ2A 2IF2A 1Z56C 3NX4A 3K0AA 1XQ6A 1MO3A 5DTRA 5F7XA 3COZA 1MOPA 4MVYA 2VJMB 3FYUA 4BO0A 1KZ9A 2Z8ZA 2DFLA 4KI0A 1PNOA 2R97A 2WLTA 1DEOA 2NM0A 2P2CA 3RSGA 3FH0A 4UMVA 1ZUHA 2R8OA 3IQHX 4DT1A 3LDUA 5JAUA 3X44A 1T34A 4X7BA 3W6OA 5I7EA 5CH5A 1IDOA 3QKRA 3RIHA 4TQUS 2X8BA 1M0EA 4CPDA 5DSTA 4RIGA 5MHTA 1KDTA 2ZE8A 3ORFA 4G86A 3AFNA 5JLAA 4RIHA 2ZM6B 1JR3A 1ZC3A 2N47A 1T0PA 3FCOA 1W36D 4X00A 5CR9A 1HBJA 1I01A 2PZEA 2O2JA 3GDWA 4OXNA 5KREA 1AC5A 2C5HA 3E58A 1CQJB 3ZCVA 4QUHA 4MMYB 2HUNA 1CUEA 4NK5A 2W37A 5CW1A 3KLPX 4LGCA 3AB3A 1QS0A 4G5GA 4CIBA 4JLBA 3M1IA 1E5LA 1QO7A 4XASA 2ZJYA 2BH2A 1LQ2A 1TK9A 3O2SB 3GUCA 4HXYA 1AXEA 4KIJA 3BHNA 4N3CA 3LVQE 1A8PA 2J46A 2RC6A 3TI7A 4DT1B 2QZ9A 3IQIX 5IJ9A 1YMVA 3MT9A 1TTTA 1BKDR 2RBEA 3QEOA 4R5HA 5DGHA 3JRWA 2FR0A 1G8KA 5TVKA 5KTSA 3K15A 5BR7A 4Y2HA 1G63A 1KBOA 1OBOA 3S0JA 3R5JA 4AO7A 5A3QA 1H4SA 4BGUA 2FXIA 1EDBA 3HHEA 1BW9A 3R41A 3VV2A 3LSTA 1ID1A 1VBMA 2Q2NA 2Q99A 2PAFA 2PZGA 3K0BA 5F98A 3O03A 1JQ5A 1PLKA 1UJMA 2WFLB 4L76A 5LBIA 4M0UA 4AUKA 3BMCB 2GCPA 2Z5FA 3IAFA 1IM8A 1BKYA 3DLIA 1ZEMA 1ENOA 2G63A 3CLRD 3H5AA 4PZCA 1AB6A 4W9RA 5ALQA 2WV7A 4DQ0A 5IULC 3JQAA 3BXHA 2GHRA 2RHCA 3STWA 2QY6A 4U5QA 4Y2RA 2WSSA 4DIFA 9LDBA 2NU8B 4XD7D 1NVDA 3OH8A 4O3FA 5DWVA 2M1ZA 3E9NA 3HRIA 3TRDA 4EBFA 1U99A 2AFIA 3D64A 1A95A 4XVQA 1BGVA 1SVIA 1QLJA 3RKRA 2VCYA 3B6JA 2XRYA 4JVSB 2D1TA 2P65A 3CT4A 2VNJA 4GO1A 1PG2A 1V9SA 1CY1A 1IN7A 2VHQA 1L8XA 5K3FB 4LN1A 4JR2A 3SVLA 4NKRA 5TY0A 3C15C 3FZQA 1RVV1 1TVMA 2IP1A 2PT6A 2DR2A 3T1QA 2OXIA 5SV2A 1PHRA 4H7DA 3VJKA 3TG2A 4HPXB 2GLUA 4HAIA 4DLAA 3BZUA 2IZ0A 3GLHE 3MCUA 4EOGA 1P31A 1GR1A 4C6SA 5J5CA 2R5NA 4YJ2B 2AA3A 1K08A 3BILA 2DFDA 3WMFA 4J1TC 4RMHA 4EG8A 5JECA 2YMPA 4YXWA 1R0RE 1SO8A 3FFWA 1R9GA 2V65A 1XD9A 4Z49A 2QTHA 4D0RA 2D0OB 4YMLA 4M8IA 2O7QA 4LDAA 5SZIA 3QOFA 3VR2A 4U9IS 1R6XA 1X7DA 1RYEA 3GEEA 3Q87B 5MN4A 4E5NA 4EB8A 4IRMA 4MI3A 2WF7A 4KVFA 1BOOA 3PF8A 5CURA 3TIGA 4ZTZB 2YHIA 4PSCA 2OVFA 3ZK8A 5CT5A 1QVAA 4YRSA 3EDCA 2IYSA 3GRFA 3F90A 3QBJA 3FNGA 3G5LA 3C85A 3I2FA 3VPBA 2XZOA 4DCTA 3SYTA 1GPJA 1N75A 4E5DA 1QXSA 3C16C 4IG9A 4TT3D 2JGEA 4M22A 1UOOA 2V6FA 3CZCA 3N2YA 5H02A 4E4RA 2ODTX 1E59A 1ZGAA 2FKAA 3G2PA 1M1YE 1V2HE 4NYMR 2ZREA 2YZKA 1YQWA 5KNDH 3HPQA 3F4BA 4QQRA 2B0CA 1AQIA 1ZH4A 3MBIA 3CWQA 4BV3A 3DAFA 2VNHA 1LNQA 4UNSA 1ACLA 5I7FA 5EIHA 4DC9A 1OHHA 1M7HA 1ZZGA 1BXGA 1SCBA 1XQ9A 2BGLA 2PQ6A 2XOXA 1OLUB 2H1LA 2R4TA 4KUEA 3RVLA 1FSSA 2AFRA 3JSXA 4E09A 3ZLJA 3L02A 4S2EA 4CR7A 3DLAA 3N87A 3OM1A 1IOLA 1UCFA 4K0KB 2CBZA 2IYTA 1G64A 1J49A 2O2SA 4NENA 5A4JA 1YULA 4RYLA 1MC1A 1ZD5A 1WHTB 2H4FA 3D5EA 4XJXA 1Y7LA 2Y9MB 1E7RA 1KNXA 2P9HA 1GYRA 3MGCA 5CNIA 2FSIA 2DWQA 3EY4A 1PEDA 3IE0A 2QN2A 2EX4A 3FTNA 4ZGWA 4NIMA 4CU2A 2HD4A 1KBQA 3DOUA 3E0XA 4YCSA 1XC7A 1YRBA 2IVFA 3AF1A 3RK4A 4HAOA 4LMBA 3W2TA 1RWOA 5AI4A 4EA6A 1PKXA 1T13A 2OQ2A 1SD5A 4MVJG 3WHKA 2VDWA 3DJFA 4R9RA 5KTYA 3KT3A 1N0WA 2P5YA 3JQ6A 1WR8A 2VF4X 2EG5A 2XQFA 3TTUA 5I7RA 2W0SA 4JOCA 3MOGA 2C9BA 4ENTA 4ZYXA 2EEPA 1CERA 4GX0A 1YF3A 3RU7A 4D82A 3JYPA 4MB0A 5FHRA 5IASA 4K6MA 1R9MA 4GI3A 4F3YA 3FRJA 1O4WA 1PEAA 3FLBA 4XAQA 4G4GA 1FDWA 2D5LA 3JSAA 3CW9A 4GS5A 2R4QA 4C4TA 4PZ0A 4REQB 1E1RD 1G0OA 2F3UA 3EVCA 2JASA 3D7LA 1P29A 2FPLA 5DIZA 4FSHA 4NE7A 3H2SA 2XECA 3DYVA 1MQSA 2SKEA 3ZZNA 5ARCA 1E3TA 2A7XA 2AZ4A 2V7UA 1OKKD 3U3OA 4CQMA 3M83A 3D6MA 4GQBA 4L5IA 4ZRMA 1EQUA 1M10A 2PEZA 1SXJD 1U65A 1GPNA 3A6HA 3CR8A 1FDOA 1WB6A 3R5SA 2C5FA 3ZDXB 4BKMA 3KP1A 3ELUA 3U31A 4AG3A 2IIVA 1T3TA 4XSGA 2GFHA 5KJEA 3ZCXA 3MWEA 1TIBA 4BB9A 1ZRSA 3QFFA 4RELA 3ZV4A 3B78A 3C8MA 2I1VB 1AGPA 1JYEA 3PXBA 4FDLA 3T7RA 1Q0RA 3C3PA 2DWOA 2X8WA 5AI0A 3ZR4B 5I7VA 3A6LA 4BN0A 1NVAA 3AYZB 3CZAA 3HZZA 4ARSA 1Z35A 2B3TA 4PZ9A 1E63A 4B2IA 1V11B 1NL3A 2ZK7A 4H6VA 2ZRKA 3SHFA 1KIMA 2ZJZA 5EJ8A 2YN4A 3VYWA 1A2QA 4MS1A 5DTJA 5K6RA 2P2LA 1OREA 3OTQA 1RM3A 4XW2A 1YQDA 2H9AA 2H1RA 2VHCA 3OP4A 1FDVA 1SK9A 5I7AA 2W2TA 2GEJA 4CLRB 2JFFA 4OBXA 2QMYA 3PQ3A 4LA4A 4LVUA 1JMYA 4Z7OB 2YRWA 3NRBA 4HWOA 3TI9A 4MUFA 3I72A 4EKIA 2Q3DA 1DV2A 5ALGA 1E3DA 4G4SP 4EJ6A 1K7XB 2V45A 2YZGA 3JQFA 2RGWA 5K3SA 2RIRA 4BGDA 1L7OA 1WHSB 1SD1A 3Q1LA 4II7A 4XFDA 1MH9A 2PQ0A 2SBTA 2GBIA 1M73E 3FF1A 1H93A 3FHOA 4GI7A 1C1XB 1ML3A 4R7ZA 3EEOA 3BZWA 5DASA 1I14A 2WYWA 4EPWA 3BIFA 4L51A 2VDJA 3EHDA 3W3AH 3FX2A 4QEZA 1KFCB 4A8TA 1SUSA 2KHZA 1TJNA 2C4HA 1V39A 1ZMXA 2GQ0A 4ND2A 5K0LA 2AT1A 1KYIA 2AUMA 1BN6A 2FYTA 2D7CA 2QLTA 1XROA 1AA9A 3HB7A 3ZWMA 2QROA 1ICEA 3PFGA 1BS9A 1K5GA 5H80A 1LDEA 1P4RA 4ARZA 1XDUA 4JMLA 2H2GA 1GTSA 5EUQB 2O8DB 3GRVA 4ONEA 1DUIA 3MUNA 4DCNA 1KYWA 1DEXA 2XMSA 4BFYA 1ZL0A 3S2GA 1KWGA 2VT6A 1MFPA 2YW9A 2Y71A 1FX0A 1IY0A 1Q3KA 1XXHE 3LA6A 5HG0A 4BJ5A 4F2WA 5HKKD 3S81A 9MHTA 3FIJA 4WJKB 1VGRA 3AYXB 2CYAA 2OBNA 5B2EA 5DWQA 3V8BA 2VPXA 1Y8AA 4FEEA 4LHSA 2VDPB 3G9QA 5DDIP 3SIPA 4AZ0B 2B30A 4GC9A 4YRTA 3A9VA 4JVLA 4C0WA 4PYQA 4GZ5A 4WKCA 4B3FX 2B1JA 2GK7A 4IIEA 5CIWA 2BW0A 3WBFA 5FTJA 1D03A 4G1FA 2QXYA 3ZHCA 2Q21A 1K75A 3O4IA 3HCBA 5I5GA 4CT5A 1N4AA 1CRLA 3A1DA 4U39A 3VBCA 4TL9A 1DC4A 5CVCA 2I3GA 2RHRA 4NZMA 2FU5C 4FK8A 3RYHB 3JD2A 4TKUA 1P4SA 2O59A 2QVYX 1US8B 3NTUA 2A8YA 2ORED 1KAQA 2Q4BA 3LU1A 1U8TA 4LRSB 3R6GA 2FZ4A 5CD1A 4PG7A 2FH5B 2XNDA 4EG4A 2VYND 2XQKA 1LGYA 2EKDA 3FPJA 4MKIA 4D45A 5GJBA 1MX3A 2M2IA 1GRVA 2WT8A 4YCAA 1KXJA 3FPAA 2WDPA 4BVLA 3QFCA 2ZLBA 1V8DA 4N9WA 4N40A 3KOWA 4DUZB 4TUYF 3RVRA 4RPLA 1Z0IA 3HFJA 3QQ5A 2G28A 3VR6D 4LY9A 2ZROA 1PWXA 3WR5A 4MLCA 3UB2A 1TKRA 4M9CA 4X95A 1SIOA 4M60A 1R10A 2EYUA 4FFPA 3I52A 3HC7A 1WWKA 2CMGA 3EMKA 1DDGA 1NVMB 2UUPA 1RBMA 1P8JA 3BRQA 3IP1A 5HCNA 4DIBA 3VR5A 2ZYTX 4ZKDA 5HE9A 4Z9AA 1MCZA 1T9GS 3CH6A 2C1XA 4UM5A 3ZU2A 3B9QA 3NETA 3PJEA 1RRCA 2QXUA 3AMVA 5K3AA 4EPTA 4TSKA 2VK2A 3CC8A 2VJBA 3GDFA 4JJEA 5ILOA 2BFFA 4D6YA 1N3IA 3ZU4A 1AHPA 3KQKA 1XTRA 4AJEA 2Q8NA 2X77A 3USES 1S01A 2VJMA 3FYUB 1YRHA 4KAJA 5DHAA 1JHRA 2AE1A 2ACEA 3AEQB 2HREA 4JBIA 4DJEC 3KCNA 3L8CA 3JQEA 4RK1A 1TM5E 3AJRA 4ND3A 1UPTA 1TE2A 4OF4A 1R00A 4PFJA 4UTXA 4URVR 4HNRA 4DMHA 2G0AA 1KF0A 2Y0CA 1MB3A 5A7GA 5DNYB 4E6EA 2II6A 3IT0A 3IR5A 4FN4A 4RK4A 5JDIC 3C3EA 2J6CA 3L7LA 4FFBA 2EGUA 2INGX 3CUVA 4EY5A 3V00A 3LLVA 4HQKA 4BTEA 1M2JA 3FDZB 3UM9A 5IBCA 2PPVA 2JGFA 5BOSB 4N18A 4GPAA 3EF1A 2PSFA 2AX3A 1SC3A 2VPZA 1Y8RA 1ZI6A 3MXOA 3DBRB 4CMKA 3UG7A 3KHUA 2D0IA 1R6UA 4DCCA 3S5JA 1Y7IA 3OPNA 2V3WA 4DR5B 1SBHA 2I3BA 1W76A 1Z8DA 1GCAA 3HP7A 3M0EA 4L73A 2CCKA 2JKYA 1J97A 3PNVA 4OHUA 5KTTA 5THKA 1DC5A 3USCS 1QF9A 3O1LA 3I2HA 2BHNA 2ZRLA 2PGXA 3O84A 3OFND 4BX0A 4OA5A 2R1TA 1KJ8A 2A9KA 3OCYA 4Q3BA 4BECA 1CJCA 3RVOA 4DLBA 5LUBA 1H1TA 5JFGA 1KARA 2IGTA 4V3BA 1VCIA 1C41A 2FPKA 4CZ2A 5DE3A 1LVUA 4OIMA 5H3LA 3WZLA 2ZJ4A 5FUXA 1MUUA 2GM4A 2NPIA 2EWVA 4F21A 1JEDA 4FKBA 3NPMA 3IAS1 3TUJC 4AX4A 2HMVA 2KLHA 3IA7A 4CI0B 5IKPA 4B8ZA 2CVHA 3BPSA 3UUEA 3FF4A 1K5PA 2IEIA 3PD1A 4KE6A 1U9IA 1C9NA 2G25A 2I1QA 2VA8A 2ZRPA 2ZUSA 3JQAB 3NOOA 4M7RA 3DWEX 1ZH6A 2IELA 3OQ6A 4P3NA 3R6DA 1LJ8A 3A0UA 2Z2IA 3LM8A 4O4LF 4P5DA 4RXTA 5AKLA 3V8EA 2OCXA 3F6CA 2HQOA 3KQVA 1Q74A 3H13A 1IHPA 5C81A 5J1TB 5IDVA 2HHLA 4XOUA 1BH2A 4MARA 4Z9YA 4HMQA 1VG1A 5TGDA 2PKRA 3DAGA 5CRIA 1Y7PA 3IMGA 1TFUA 4HMPA 4FOLA 2OPHA 5IYZA 4QARA 1DAEA 1NV8A 1T4CA 1GPLA 1T5TA 1NUAA 2HK6A 2JFUA 1Z0SA 2WD9A 2ZYHA 1O57A 3GZTB 4YACA 2HA5A 2ZE5A 3VSEA 4Q9IA 1C9YA 1AO0A 4DNPA 4D26A 3GEPA 3MLAA 4S0ZA 3WB2A 3LH5A 4NBKA 4ZWNA 1CD5A 1AQ6A 1LSJA 3QTBA 2PJDA 2VP0A 5JNSA 1L1EA 4LMRA 1CY2A 3DPSA 1QKJA 1DCKA 2HZ7A 1YS2X 2IY7A 3I5AA 4MR7A 2LPMA 5ALUA 3FETA 3KSAC 1YD7A 2J9RA 4K6CA 1IQPA 2CYCA 4X6LA 3JQ8A 4A2CA 5A1TA 3FWHA 1R0WA 2V7QA 5DXJA 5K6TA 4M2LA 1IJBA 3OIFA 2B35A 2POCA 3QI7A 3JQFC 3T9CA 3GMDA 1KK1A 1W4LA 1DWUA 1CRWG 1DVRA 1HDZA 1BE1A 5HF5A 4NEHB 2IP2A 4GX5A 6YASA 1CDOA 1XQYA 1EVYA 4H1HA 3IEUA 3E23A 4Z0HO 4LZJA 4XLLA 1YBAA 4PCLA 3A6JA 5H4HA 2NZ8A 5CVUA 3WLTA 5IFKA 4CN8A 4KWEA 5JO0A 5JH7A 5I7UA 2CEAA 3E2MA 3EWSA 3R7WB 1RM0A 1TM4E 1TC2A 3UPDA 2VKQA 3HKDA 4IO1A 1H6CA 2WYIA 2AVDA 1TT5A 4TLBA 5M5BA 3R8FA 3NH9A 4QNMA 2E4XA 1NPDA 4W6ZA 5EERA 1V37A 1YZGA 2J3KA 3CA8A 3MD0A 5AJHA 2VATA 3SHQA 4ZT3A 1RAAA 3N7AA 2HA0A 2XUQA 3QNWA 1RSZA 3WGLA 5BPHA 2YRXA 3SU8A 1QYCA 3HKEA 3HZHA 3LQQA 4Y30A 2GKGA 2W8BA 5EZ5A 2RG7A 1A4IA 1T1JA 2GYUA 2RMKA 2DBVO 1OFUA 1WMBA 4BZXA 5L7TA 2NSJA 2NNWB 3SIWA 3A4NA 1O96A 3D6VA 3L84A 1WMFA 5JAMA 4OHXA 3ABQB 4RY0A 4U8HA 4XGKA 5B2ZA 1IG3A 5LOVB 3BTVA 4DDMA 1NONA 3C43A 3WIBA 2ZRNA 5JWOA 3PTAA 2WB2A 1STOA 3K70B 2F9LA 2XBLA 1GXSA 1ITZA 1NN5A 2CY0A 2FP3A 3G88A 4PPFA 3RS0A 2SECE 1E77A 4R8SA 2CNNA 3ZVKA 5IAJA 4N0MA 2G71A 1MAHA 3V1LA 4XJSA 4P5EA 4AF7A 5EE0A 4NDZA 4LXIA 3EPLA 2J9FA 4R2XA 1YTUA 4PG6A 2HM7A 1G7SA 2FWRA 1ETUA 2C4KA 2OBLA 4FGKA 5AKJA 3ZGXA 1NBIA 3OA0A 5C5EA 4P82A 1MG5A 3AG5A 3LC7O 1G18A 3EXHA 1ZXXA 3N5KA 3BTOA 3ROZA 4JC0A 3H04A 4PPQA 3E6AA 5DMHA 5EHIA 1A7JA 1RHMA 3DBLA 2QLMA 3E3OA 5BN5B 4HAUA 3O0TA 1QAQA 2UZ1A 2ZIXA 4MRAA 1P2DA 2JAHA 2ZYWX 2MR5A 1YNSA 1RC0A 3A6ZA 4R69A 5AJYA 3IVMA 2ZDQA 3FUVA 2E5WA 4JVNA 1XU9A 2FNAA 1XRMA 4FFVA 1PDVA 3AW9A 4MVJH 4AG5A 4DANA 1RU3A 4QBKA 4IUCS 4JB2A 1KMMA 4KFTA 4UDOA 3EXEA 3H1PA 2CGEA 4IIYA 3VBEA 2DT5A 7ADHA 1ZMOA 4MMXB 2H4ZA 1F8YA 4ZCLA 2VLBA 1B93A 2PO7A 4BDSA 4NZ9A 2F62A 4K8OA 4R2WA 3HLKA 4QQNA 4QQKA 1UEXC 2BFDA 4KQGA 4B31A 1QJ4A 4R8MA 1WUKS 4CIYA 3EXEB 2YYSA 3D8UA 1EFAA 1ATIA 4N41A 1IXKA 4YUAA 3WB1A 1SC1A 2COUA 4NULA 3IYLW 4JLSA 4L02A 4P2BA 3OO0A 3AB8A 2UVDA 5LQDA 3QGMA 3N6RA 3G7SA 3EZGA 3ZV7A 4CKBB 4WPGA 2VI5A 3PQCA 3HYTA 4UNNA 3I5UA 1IN8A 3NOVA 4PPNA 3RD5A 4AMBA 2CZCA 4CKZA 1W94A 1HQKA 2QRNA 4Q4HA 4NQRA 4W8HA 2DH5A 4DJFC 1ZESA 4OU5A 5TS3A 2QL9A 3SD7A 2G1JA 3CVOA 2W6ZA 4GOJA 3BJMA 1KY3A 4E21A 1DCFA 3M6IA 1U0EA 2GFQA 1Q1EA 1W0KD 2EFHB 2VXYA 2HMUA 2XUPA 3K5HA 3MA0A 1UOPA 1ISHA 3F1KA 3HI4A 3KKLA 2FUEA 4O02B 4EHNA 1FJXA 2FZKA 1ZI8A 1E2LA 1MDFA 4G36A 4J3NA 3RBZA 2LP4Y 3W2GA 4EGQA 5LP1A 3NCTA 1EUCB 4GPD1 1Z5WA 4X5OA 3LQ2A 2GEFA 2QN9A 3K71B 4AN0A 5SYMA 3FTEA 1PK7A 2AQIA 4CMAA 1NUTA 2Y05A 1QAMA 2NTNA 2YFHA 4OQNA 3IQXA 3QYPA 1Y37A 4FFOA 4M1OA 1HDEA 4GDMA 3RC2A 1UBMS 4MVCA 1JSZA 3IB6A 2CFRA 4PNZA 2RHOA 4NBTA 4CV3A 1DIHA 5KU7A 1UAGA 4XWWA 3RSLA 3P97A 2GLTA 5CUQA 4INZA 3BT7A 1Y8QA 1JWLA 5DBIA 3ELYA 2P2SA 2OYCA 2UU9B 1YV9A 5DEIA 4P36A 3VVCA 1V26A 4B47A 4WJLA 1MC4A 3I01M 1RC8A 5A0VA 1GQYA 5JI2E 3LA8A 1LI5A 2VJAA 1UODA 2OXTA 1SC9A 4OSOA 4JI0B 1I7NA 1J2RA 2QM0A 3BXFA 4F72A 2CNDA 2GM5A 4Q21A 5TF4A 3WYNA 2FMXA 1CCWA 4HWPA 4Q3KA 2J9XB 3V7NA 1S5PA 1Z6PA 3CNHA 5FV4A 5CEJA 5JS6A 3N0VA 3DL7A 2ISSD 1U9ZA 3GBSA 4O2BA 2GASA 3A2LA 1OLSB 3KWLA 1OW3B 4RGVA 3F5DA 4I46A 3H5WA 2X58A 3RROA 3I1FA 5FT9A 3TM4A 2R6AA 3MUFA 4HC4A 3BQNB 2ONKA 1FJ2A 2JEOA 2VH1A 2DFKB 4IOLA 4O33A 4UD2A 5F4ZA 3ZHTA 5BNIA 4W7HA 1KI4A 1NBMA 4A6XA 1DDOA 2WI8A 3QWAA 1RE0A 5KSPA 1E9VA 3UOGA 3QF7A 4U7FA 1EFPA 3D7MA 4H4DA 4GE3A 4LF7B 1D2GA 1PR4A 1TVKB 2RKWA 3A4TA 3DQQA 2LBPA 5F51A 3BGSA 4GYWA 2WRZA 3S44A 2W6JA 3FWPA 1PW7A 1V95A 2ODEA 4M76B 1R0LA 1XZIA 4IJVA 3PYMA 1SEPA 2P9TA 3TINA 3R3ZA 4PQGA 3WZ2A 1JVBA 3C70A 3OQVA 5DI3B 4LTNA 3F7OA 3VPGA 1E0JA 2V6JA 4G6ZA 2RGAA 4EHDA 2XE6A 2VHVA 3B1ZA 1TLLA 3EAQA 5JZVA 1P3DA 3A3OA 1P4GA 2EFJA 2BMFA 1NWCA 2C1ZA 2CJFA 4FMCB 1U7ZA 4YR9A 3F9RA 3ZY5A 1O6GA 2KBEA 1TD9A 4K40A 1NLZA 4I3GA 5HIJA 2PWAA 3U1BA 1K27A 5DT9A 4RSRA 4WLEA 4XM1A 1G38A 4ESVA 3ROXA 4MRVA 4RANA 1M8GA 1FE8A 1M66A 4FNMA 4ERNA 4YUXA 1E9RA 2HEIA 4UM9B 3E4DA 5EKDA 5LWQA 2ZZMA 5HCUA 2ZB4A 2WKWA 5K0BA 1FP4B 2QRJA 3FD8A 3L8DA 4DNOA 1E20A 1NASA 2ZIAA 1E69A 3RAJA 1G5FA 4X62B 3H42B 3X0DA 5FTLA 5KVVA 3QLTA 1HG0A 5EJ6A 1Q20A 3RC9A 2HY7A 3TRJA 1N9KA 3ZX4A 1TUBB 4MW0A 4NJMA 1AV7A 1U5AA 1U4OA 2AC2A 4L3OA 3IAHA 3DFFA 3UN1A 5EIEA 2ANCA 5KYNA 2N1MA 2AXNA 1JR4A 2I67A 3EXHB 2PYIA 1C3VA 4XX1A 3KJEA 1YHZA 4C89A 4FDAA 3OQ1A 4YJGB 2REOA 3V2GA 2XZLA 1Z37A 1RIFA 2R9VA 2P1ZA 3GJ0A 4AKEA 1HOTA 1YBMA 4N5NA 2ZVJA 2GUWA 3PGLA 1J70A 4FE4A 2J48A 3F6YA 3NEPX 4OUDA 5BNFA 1UM9A 4XSHA 1E2BA 3DPIA 4CV2A 1P73A 1SXJC 2C9MA 3E82A 2I8AA 3M6LA 4DYVA 1OC2A 2QMUA 3FYCA 5C1DA 1FUKA 3E5HA 1HMYA 3FDZA 1WOMA 4RCZA 4YLYA 3DL0A 3HJBA 4C2TA 4GX2A 3OQJA 2AMJA 2BSXA 2OV6A 2Z8YM 1XCOA 3B51X 3BSFA 2ZQ5A 1VJ1A 5DN9A 4R41A 4YJDA 1EUZA 1OOEA 4NNJA 4EJ0A 1RQLA 1G3UA 1Z4IA 4JT4A 5BORA 5KMGA 1BGXT 3OOWA 4DLWA 1IVNA 1ZK3A 3L6DA 4Y6GB 2I1LA 3QXCA 4V0ME 1HM5A 3K0EA 2WFAA 2FW1A 1I13A 4M0LA 4BGIA 3PGMA 4ZHQA 4AB1A 4LJ9A 2V7TA 2VDWB 1PV4A 2YY6A 3ZHQA 4C3OB 1K2VN 1YS9A 3KEMA 3AVYA 4MV5A 2QUZA 2YFYA 1AMNA 1MOZA 1E9FA 3GWGA 4E88A 4LSMA 5L3VA 4FM9A 1LVGA 4AQ7A 3UYLA 3BE6A 4LJRA 2W83A 4OH7A 3ZDZB 1U9JA 3MYRA 3SM9A 1J8YF 1E2QA 1WXGA 3UJNA 3FZEA 4P9NA 1GZ5A 2JD2A 2POQX 5E3JA 2A92A 4CM6A 4DY6A 1VM6A 2HJHA 2P68A 3H9JA 5A5DA 3PF9A 3LX6A 4JLWA 1NW8A 2WJJA 5LDHA 4YHBA 1QCZA 2OO3A 3L7DA 4LX0A 4KPEC 2W2OA 2BHTA 4LRYA 3BGOS 3QX9A 4TYPA 5M7EA 5BT9A 4M83A 4DFDA 5AVRA 1OLSA 2P9JA 2PUVA 5B37A 4R8KA 4CMIB 1CUDA 4Q1DA 2PDAA 2AG1A 5L7YA 2Z9DA 2HJ9A 3CISA 3DW1X 3N76A 3TQHA 3ULKA 2ZATA 3HXKA 4CEJA 5B53A 2P40A 4D46A 2Z6AA 1VBNA 2ZYRA 3KD2A 4HTFB 3TNJA 3MHTA 3F2VA 3KZCA 4Y9TA 1QHIA 3E9ZA 2ODAA 5B1HA 1H2WA 2BELA 2BEWB 1ENPA 1YS4A 3UKOA 2P7HA 1HE5A 5J9FA 5KYKA 5C8YB 4J4BA 3PL1A 5HM6A 3DHWC 1DX4A 1Q3TA 1VE1A 4I55A 3EIFA 4TTAA 4IH9A 1A50B 1N8KA 4OQDA 4O4IF 1HKUA 2X5OA 4JI6B 1SXGA 2C2ZA 2QL5A 2H2IA 4JL5A 3TW4A 4DLZA 4EO4A 4NESA 1I3KA 1L5YA 2C3PA 3LUGA 4BPBA 3Q3VA 5GONB 2V6IA 1GKYA 4WZAA 4NAHA 1INLA 4M4SA 3UMYA 3BHIA 1AKWA 4W5WA 3TZ6A 1JAZA 3IAXA 2OG2A 5SY4A 1ZGGA 2AOUB 3OKCA 4KQEA 5FIUA 3ZPXA 3ZXIA 3MT8A 3ZE8A 4YCNA 4AS3A 1CJKC 3QPDA 4XD7A 1N9GB 1OYYA 2H7YA 2J3DA 1D6MA 1N0UA 3D8RA 3I6YA 2DJ5A 3GL9A 3NWJA 1PUXA 4FMPA 1FDSA 1RYNA 1NQOA 2O0MA 3JQAD 3DV0B 3A1EA 3CT6A 3ZXXA 4TTRA 5JSQA 1NG9A 2JAQA 1JFRA 2GD1O 4RS4A 4ZV7A 1CS0B 3EFOB 3OHPA 5FLYA 1XA4A 4N1AA 4NU6A 1CNFA 2BLNA 1MC8A 4F4UA 2R1VA 3UAZA 1A72A 2VT7A 1GDHA 3ND9A 5JQGA 3CRW1 1GTRA 3VO8A 1XZGA 3NATA 1E1QD 1JQLB 2CDRA 4KR0A 5CA0A 3T4XA 5HHTA 2FTKE 2E4UA 3IR6A 3PNSA 4ARBA 2H07A 1G5PA 4QBGB 1KSGA 1JHYA 3AGPA 3PDWA 1Z6TA 1UWVA 2YMMA 4BYGA 3VNUA 3QI2A 1U2PA 1AGRA 3H9QA 2WMOB 4EI8A 5L45A 2IZOA 1RZRA 3LVRE 4U7JA 4MVJP 4BNHA 1P7YA 4MQBA 5DBHX 3WGUA 2NG1A 5CB0A 3CXRA 1UADA 4MRSA 3V34A 3WLMA 2OD9A 5EP1A 3RRMA 4WN3A 2VPIA 3M3PA 4F5WA 4BKPA 1RJGA 5EJGA 4DB4A 1ZAKA 5BW5A 1IJFA 5HJEA 5DLDA 2V9PA 4MWOA 5IJ0A 3UAWA 2QUIA 4DMRA 1ZK1A 3KJNA 3GNLA 4KZKA 3RYFB 4F1JA 3N1UA 2OSBA 2DKFA 2GARA 4X45A 7REQA 2R96A 2ZIGA 5K8TA 2C4TA 3NH6A 3FR7A 3SKVA 3ZNQA 1AH2A 4BFXA 1IAVA 1VMIA 1A7AA 1W5TA 4E07A 3OZWA 4RC9A 4ESHA 4CRWB 5THXA 1P81A 3N0RA 1O8BA 4BO8A 1NU8A 2E4VA 3LY8A 5DK6A 3U5TA 3OUZA 5HK8A 3A2MA 4V3CA 4YJ2F 2EZ8A 5J63A 1S02A 2XB9A 2GGSA 3L0ZA 3MGAA 1DJQA 1Z74A 2GJ4A 4I55F 3ZZMA 2VDRB 3DAPA 3EARA 3PE6A 3NIGB 1YR1A 5E2AA 2FUG1 4P2GA 4E0BA 3AVOA 3AM5A 3THYB 1SKQA 3OKAA 2F48A 2A5LA 3AHCA 2K2WA 4QQFA 4KK3A 3TK1A 3F8WA 2XA9A 5FWXA 1Q92A 2ZSIA 4EG6A 3BWXA 4C3UA 5JS1A 4DVJA 2JA2A 1KMCA 1Z5ZA 4ZD6A 3WWCA 1U8FO 4CETA 1IN5A 4AF6A 4H77A 4ETWA 2HV9A 3CNBA 5J5AA 5BWNA 1W85A 4JSTA 2PJRA 3GLKA 5AK3A 1KFEB 1VMAA 1DAHA 3P0HA 3VTFA 2C8LA 4UBOA 2GPTA 5K3EA 4NLLA 1O7JA 4AN4A 2X9NA 2ZRQA 4P4SB 2P9FA 3BMQB 1YI1A 3GD5A 3L4EA 1DJNA 1SU4A 3BICA 5MGNA 3A3PA 1QYVA 1JLKA 1EVJA 2AFHE 1JLSA 3CWZA 1RC1A 2HSZA 2Z2XA 3FI0A 4AMYA 1F5SA 1P62B 1Q0TA 1EUYA 4LJ5A 4INAA 4OHFA 3E5RA 1MO5A 1SG0A 3QKSB 3DO8A 2BONA 4IAOA 1GIAA 4GM4A 2AN4A 1JEJA 2ZYVX 2PZBA 1YAHA 1A7KA 2A9VA 2ONCA 4UVGA 3BUSA 9GPBA 1BGWA 5DMXA 1EFRA 4JSYA 3PEYA 1USVA 3NHPA 5JBQA 3VX4A 3FE2A 2P2ZA 2VUIB 4YWHA 4S1WA 2N3ZA 2PN1A 1J6UA 1U0OC 3N5CA 4FYWA 2IU6A 4D1YA 2C5SA 2ZI3A 3ROQA 2RFLA 1KIFA 4ND6A 3UENA 3OKPA 3OFKA 1PO7A 3O92A 5IC6A 1P61B 1O0SA 1E5XA 1GAQA 1PTJA 4RD4A 1SUCA 2X1LA 2Q5IA 1FFXA 4MQMA 4N7MA 1Y4AE 3V4VB 4Y3UA 2QW1A 2PKQP 4KN5A 1O9GA 4CUJA 4GPTA 3D6NB 3PGA1 1XDZA 3U4QA 2C57A 4S24A 2IY8A 2DLNA 1K8RA 2Q2OA 4NCXA 3EGOA 3L9XA 2W70A 2W2VA 4XGRA 1YQQA 1ZKDA 3BG5A 4UOQA 2GN4A 3K4QA 4UUNA 4WCVA 4TUYB 1GITA 3JPYA 2VDQB 4M21A 3MTGA 2OKGA 2PZKA 4RSGA 1YS7A 1YUMA 5CB4B 4RWZA 3UXMA 4CTJA 1LVHA 4BS9A 3RC8A 1ZZEA 5IC4A 4UJ3A 2ZJ6A 2CDNA 4BN5A 3PVZA 1JQEA 4AZ3B 4LEIA 4ZVOA 5E1OA 3EZXA 3B1WA 4JFRA 4Q1AA 1NC1A 1YR9A 2ISQA 2VF2A 1WP4A 4YJKA 3RFVA 3ISVA 2CF5A 2W6ID 1DG9A 1JAXA 3F7TA 3GLRA 4WGFA 5JCXA 1L7XA 2G0NA 4DMMA 1W6RA 4CM9A 3P2EA 5LJIA 5G1NA 1H2ZA 4ML3A 4IIDA 1E6WA 2HLDA 4PHGA 3DG9A 3U80A 1MX1A 1ZMRA 3F96A 4P4TA 5ALDA 4ZVTA 3WQQA 2IXAA 3ZCTA 3WKDA 4Z1MD 1NJGA 2D74A 3K1AA 1GG5A 4R05A 2OCGA 2W6MA 4JBYA 5KQSA 3SAJA 1ODSA 3HYSA 5BW8A 1N9GA 1NFFA 3TKLA 3N58A 3VKGA 2F4VB 2AG8A 2X4IA 4HB2A 1BXRA 5DXFA 2DPLA 2GN2A 4FGJA 5KNBD 1CB0A 4NI5A 3RVDA 2PZLA 3C39A 4CM8A 1N2CE 1ZI9A 1XZ8A 4ND4A 1Z8HA 3K4HA 3OEWA 1ZBDA 4MS4A 3SXUA 4ZOLA 3U17A 4ZIRB 2VTBB 2EFEB 1CZRA 2CMHA 4TL7A 3NUQA 5AM2A 1T8TA 4F9EA 1ZOIA 3QKTA 5EZYB 3JQ7A 2IDMA 2I80A 4WK4B 3WFJA 5BOVA 1ZOPA 3H8VA 1RWVA 2JNWA 2ZIFA 3OJCA 4YJHA 3W7AA 4BBPA 4WDQA 3INTA 2B1QA 4D5GA 4CQNA 1GEEA 3NOQA 3UF0A 2Z1DA 3B82A 1X80A 3H4IA 1QP7A 4ER6A 1IUOA 1A9RA 3TXYA 1J07A 3L0BA 4ZI2A 2QD5A 1WBBA 4HWKA 1U5BB 2OHGA 2G9VA 3KZOA 3QYAA 2IEYA 4S1PA 1SUWA 1J2JA 2B1IA 1NKVA 2CLHB 4G8BA 5DM70 3TL3A 3LBIA 2HQ1A 1YKFA 3SPXA 2AMFA 4BX2A 1I6KA 2FF5A 1ICIA 1QGAA 2C2OA 4J1SA 1K7EB 1QH1B 4HADA 3A14A 2IGBA 4PR3A 2Q28A 2UZIR 3IOMA 4TTTS 1WV0A 4G9GA 3O7WA 2BDEA 2NO1A 4G0NA 1XWIA 4WKPA 2B9EA 2NV2B 4D4LA 2EDCA 1MJGA 1PZXA 4RZ3A 4XVHA 4B83A 1X87A 1OILA 1WKBA 1Z06A 3E9MA 5H83A 2ADMA 3B1FA 3VTZA 4US0R 3EVAA 1ADGA 1OXSC 1YGPA 3QXSA 4LQDA 4WLUA 5B1EA 1J23A 5B57C 4QIHA 1KMHA 3K31A 4IRUB 1ZYUA 1T3SA 1T36A 3ZXSA 1B0PA 2Q3MA 1HYQA 1SVKA 3GUZA 3TFOA 1GSHA 2QYSA 3HK2A 1EP2B 2IHTA 2WSIA 3AV3A 4PRLA 3LUJA 5DLQC 1C3EA 3UAVA 1SPXA 3F3YA 3WYDA 4CKBA 2IH4A 5REQA 5K4HA 2Q7DA 1Z7BA 3NEJA 4G5HA 3AVWA 1ULAA 2HNAA 3IFSA 3U3RA 1CY4A 5EFOA 2R25B 1EVEA 1QTIA 2AYYA 2IS4A 1R3UA 3KAPA 3OZDA 4MKXA 2Z2KA 5H5JA 3OCXA 2VNIA 4HWRA 3WS7A 5IP5A 3EMBA 2FRDC 4M37A 5ARBA 2AHRA 1UPXA 2FFBA 2J30A 1X94A 3DTTA 1ZA2A 5CFQA 3FMGA 4K46A 2OA0A 4RL4A 4B3SB 3T95A 3I9V1 3AVVA 3V7UA 4L2IB 5EI5A 1VDZA 4G26A 3AFOA 2A1UB 3ZHXA 2OOKA 4YDSA 1VA4A 3BE8A 1YA6A 4UEJA 1ODFA 4P98A 4QJ3A 1M6VB 2XDWA 1ZH2A 1I4DD 1PR1A 1FVFA 4WOPA 4I1VA 4RULA 2BEKA 4GZMA 2B8TA 2CLFB 2W4MA 1ZGBA 3TCKA 1H4QA 2CHFA 4IKEA 3RQSA 1HE3A 4H60A 1B4DA 2P6MA 4BMCA 3LY5A 1H2RS 4ITRC 2OCDA 4R1NA 3T41A 1NC3A 3PNQA 4KR2A 1AK1A 3DFZA 1EHCA 3AL2A 3U4AA 1WCYA 5J2TA 1LTHR 1RWQA 1QK4A 1U0GA 5DCLA 3C6XA 3NT2A 3OMWA 4P32A 4BNZA 1EEHA 3UA3A 4LHVA 1A97A 2AR0A 1M6VA 4ZV4A 4UM9D 2CXRA 3WGKA 6REQB 4BVGA 2XDQB 1KPGA 1HEYA 1ONBA 4L7QA 2QX4A 2RARA 4O2RA 2D3WA 5K0GA 4QSMA 4PIMA 2FJUA 2RK3A 1MG0A 4PQEA 5BWOA 1MD9A 4U6NA 1IIRA 2QR5A 2QZZA 4ZI3A 1V1RA 1BVYF 2WPDD 4BP8A 3FNRA 5BP7A 4B6QA 2C3MA 2IE0A 1IOVA 4XPIA 1PJSA 1N77A 5H9WA 3KLBA 1D6NA 2VJLA 1Q95A 2ADFA 3GDOA 1LPPA 4YFYA 2HHJA 5ESRA 3I3OA 1ZD3A 1WXWA 1H2YA 1RPTA 1T9KA 3BK7A 3ZY3A 2VJOA 4P3KA 3M1YA 4ZVNA 4KMMA 5IM5A 5K3BA 1X92A 3VI3B 2FE1A 1Z63A 1YZYA 2XUZA 4BMYA 2Z2YA 7MDHA 1NIJA 3ELBA 3N74A 3WAGA 2LIPA 1AX9A 5HQJA 4AYTA 3A9SA 3C5HA 4CEJB 1TVKA 4RFSA 1PFUA 2EBHX 2Q5FA 3EGWA 1PR3A 2XZTA 5BURA 5J3JA 1BHQ1 4TLMB 3VDMA 1RP7A 1JHZA 2C5AA 4S12A 4S2UA 4CM7A 3C2QA 5BT8A 2ZBUA 3AHGA 1ESDA 3ANYB 3BMOB 3MWYW 5C2JB 5JISA 3QA3E 4F5EA 4DUYB 4L72A 2F8TA 3ZV3A 4QXPA 3MFQA 5DM2A 4XTRA 1VG9B 3B36A 3RAFC 3DMGA 4F2DA 1DQYA 2CD7A 3VPFA 3TN7A 4ZDJA 2CFSA 1PLJA 5EZQA 4ILKA 4L0MA 5EJ7A 4BEWA 2HKIA 5CLIA 4CQJA 1NBMD 1W47A 1TJ3A 4REQA 4Y2PA 5DJ5A 4AU1A 5JPCA 3BXEA 2DM6A 1H4TA 5EHNA 2C58A 2A57A 2R47A 2HDWA 2Z3VA 5FOXA 5J43A 3TJMA 2HCRA 4HAYA 4BMVA 2YWFA 4NARA 1NNEA 3PKZA 2O5RA 3GAAA 2N9UA 5KJCA 3RAEC 4KPYA 1ID8A 1EFRD 5KTOA 1T6BY 1N78A 4BV9A 1SVUA 2ECQA 3JR7A 3D6HA 5A2QA 4EM6A 4YECA 4HDSA 2Q9AA 3L07A 4BN4A 4C7JA 5EXTA 4DCUA 3BGWA 1KGDA 2G04A 3I53A 4WT7A 1G3MA 1WRBA 2GTIA 3JQPA 4QOGA 3U7RA 1RFGE 1WMSA 1BCSA 4QEDA 4NFSA 4A0HA 4DDKA 1NPTO 4EATA 4Q6WA 1O3YA 4DLXA 3TFWA 1YQ9A 2YWHA 1BE6A 2XWBF 4ZO9A 1SU7A 1L3CA 5JW6A 3R5TA 1WHTA 3TNFA 1V5GA 2ZTVA 1NYLA 4QPPA 4L0CA 4LV8B 4QAQA 3T5DA 2R8RA 2NNLD 4Z4IA 1Q7CA 1QNFA 4NCKA 2ONYA 4K5QA 1Q0PA 1VKOA 4D8WA 2LGJA 1QGDA 1K6IA 2O2DA 2XD4A 3KEQA 1UIRA 2IVZA 5JWHA 1B0UA 1Z4KA 4B6PA 5BMVF 1HNZB 4Z2AA 4PCVA 1AZLA 2C2HA 2QV0A 4H15A 4I50B 3S4YA 4C0QC 1U8EA 1CR6A 4ALLA 5KKAA 2W6QA 5K5EA 4CLXA 1YRAA 1DADA 4PSKA 4Q7EA 1Z34A 2VPTA 4XIYA 4BFTA 3IBFA 1TIPA 2IF0A 1TQ4A 1ZOSA 3GOHA 2Z9CA 3FUCA 3O3NB 4AW9A 1C1XA 1RRVA 2UAGA 2PHZA 1L5WA 3IBTA 3UCFA 5KQRA 4F3KA 5L7WA 2Z5LA 1SUDA 1JNYA 1Y8RB 2R84A 3DXFA 2B78A 2IYZA 3G2NA 4PFKA 4ZZ2A 2O8CA 1KPHA 1BKSB 1J0AA 2F3PA 2YY7A 2Z04A 4B7XA 4DW8A 1WE2A 4IDCA 4HRAA 1DU4A 5KJFA 5JJ5A 5EHQA 2O5EA 4KRYA 1RLTA 4WFQA 1NVWQ 2XCUA 4GXNA 2OFFA 4LJAA 3T5TA 2Q6IA 2MSCB 3B38A 1MO4A 1XJ5A 3KKZA 1DWPA 4L6CA 1RAGA 2JCBA 5IVKA 4FLFA 5C4IA 1GLGA 3KPVA 3UNXA 1V7ZA 2DCMA 2RJ3A 3C74A 3JVVA 4LNHA 1JR2A 4QX6A 1KOJA 1YIAA 4FD3A 1Q7BA 2GESA 4FB5A 2WWTA 1TFRA 3EIOA 4HB4A 4RMIA 5GIOE 4HLCA 3KYDA 3AJ9A 5KKCA 4YRPA 2VRBA 3ZHRA 4O1IA 2XWSA 5LWHA 3KXLA 2J0QA 5AVTA 1K8ZB 4FXOA 1PWEA 1BMDA 5EIBC 3L8GA 1E5TA 1KBZA 2OO5C 4GMHA 3UAGA 4JJIA 1F6DA 1FS6A 4BPRA 2AFIB 2FCAA 1M8JA 3ETNA 4KUHA 4JNCA 2B69A 1LRKA 3PPXA 3JY6A 2BFMA 4HQ6A 5FP0A 1ZSVA 3WX0A 3OPYB 4PO9A 4ERXA 3AJ8A 4FMDB 3A1VA 4OFZA 4E2WA 1E1NA 2FG5A 4K3UA 1IZ7A 5IJZA 3L7MA 4JEMA 2VWGA 4KBFA 3AERB 1Y1RA 1RCFA 2WOOA 3IMFA 3ENWA 3JAWB 4Z9XA 4XCVA 1KQGA 4C2UA 2IUEA 4WZAB 3GCWA 5BY2A 3CEJA 5B3JA 1ST2A 1S2LA 2H5JA 2JIDA 1KZ1A 4WE3A 4YBRA 4P33A 4CL2A 2P67A 3W06A 3QE9Y 1FK8A 4XUDA 4Q9JA 1F1BA 1E94E 1UBCA 2UYOA 1E9AA 4J4TA 4YDQA 1RWKA 1GSOA 1HY3A 5B3AA 5A6VA 3NBAA 1CE8A 1SNYA 4ZCTA 1IM5A 2ZI5A 1GAJA 4TKLA 2R7MA 3WK8A 5IDXA 3DE6X 1MDBA 2C4NA 2WJ3A 2B0JA 3G3EA 3JTEA 1KKLA 1U7UA 1CP2A 3H11A 3RBXA 1JA9A 1ZS9A 3OJ0A 1XZNA 1PJQA 5TS2A 4LF4B 4D3FA 4RVSA 3V6MA 1QIGA 5B58C 3DUFA 3MRSA 3U16A 4FSXA 1ZM3A 3BZBA 2HB6A 4KWTA 3VSBA 3I5YA 5HQ3A 3PX3A 2HOQA 4AAYA 5HNKA 1NJ2A 1YL6A 2PLAA 1YDEA 3CZ4A 3FJOA 3IB3A 4NZNA 4ZCPA 1DBSA 3TD2A 2GZRA 4HQLA 1JTFA 2Z2JA 3PEUA 2WKQA 5LYYA 4UPDA 1JDTA 4BMNA 4BX9A 4B76A 3NDPA 3ASYA 3DR5A 3LUDA 1TDJA 4Q01A 5DIFA 3L4BC 4IXWA 5FWDA 1O94D 1H8ED 4WA8A 5GZ3A 3O8OA 1NXWA 1XKQA 3T34A 2QTWB 3ZIDA 3RPEA 5KPDA 1AZWA 2O19A 3E70C 4KOAA 5CJJA 4D43A 4E5KA 3LX4A 3LOUA 3HL0A 3SF8B 2P6UA 4X93A 5TT0A 4V1CI 1TYCA 2QMHA 2O6LA 4NFHA 4C21A 1E92A 4BBZA 5LR6A 3GY0A 4RNDB 1KEWA 4J0FA 3GIWA 4LZWA 3V46A 3DP7A 1NRJB 1NF8A 2OVBA 4YP7A 1KP3A 3UY4A 2GDJA 6LDHA 4BFCA 1UDWA 4PAOA 4RF5A 3KQTA 3R7LA 3G7UA 4EG5A 1G20B 3FUTA 2ATXA 4EKNB 4XEUA 5T64A 2EVWX