4HMPA

Crystal structure of iron uptake abc transporter substrate-binding protein piaa from streptococcus pneumoniae tigr4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
301
structure length
289
Chain Sequence
IVLDHAFGQTILDKKPERVATIAWGNHDVALALGIVPVGFSKANGVLPWTEEKIKELNGKANLFDDLDGLNFEAISNSKPDVILAGYSGITKEDYDTLSKIAPVAAYKSKPWQTLWRDMIKIDSKALGMEKEGDELIKNTEARISKELEKHPEIKGKIKGKKVLFTMINAADTSKFWIYTSKDPRANYLTDLGLVFPESLKDSFAKEISAEEANKINDADVIITYGDDKTLEALQKDPLLGKINAIKNGAVAVIPDNTPLAASCTPTPLSINYTIEEYLNLLGNACKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Streptococcus pneumoniae PiaA and Its Complex with Ferrichrome Reveal Insights into the Substrate Binding and Release of High Affinity Iron Transporters
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords Iron-compound ABC transporter, iron compound-binding protein
total genus 88
structure length 289
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4hmpA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4hmpA02
3U7QA 4UDNA 5M2QA 3TNYA 1XVLA 3HXPA 3LI2A 1KAHA 4MDYA 3AETB 1MIOA 1H1LB 5BVGB 5CX1A 4HMPA 4IRMA 4TKVA 1M1NB 3AERB 1G20B 2M6KA 3R5TA 4WESA 5GGXA 1N4DA 1M1YA 1QGUA 2XDQA 1TOAA 1QH1B 2WI8A 2XV1A 4NNPA 2XH8A 4GICA 1FP4B 4N01A 1PQ4A 2ETVA 4HMQA 3ZTTA 1ESZA 3AEUB 5M29A 4PM4A 2AFIB 1KARA 3AETA 1N2ZA 3AEKA 4TKUB 3AEQA 4FKMA 1M34B 1G20A 3R5SA 1M1YB 3K1AA 1N2CB 4OVKA 4K3VA 4WZAB 3GI1A 4FI3F 4INPA 2AFHA 4WZBA 4ND8A 5BVGA 5JOQA 5B58T 2OGWA 5KOJB 2WHYA 3AESB 2PHZA 2OV1A 2MINA 4G07A 3UJPA 4H59A 4INOA 3BE5A 2OV3A 3MWGA 4WN9A 5CR9A 1L5HA 5JJ5A 4MO9A 5JG7A 5M34A 4WNAB 3BE6A 2Q8QA 2PS3A 5BVHB 2PS0A 5KOHB 3G9QA 4CL2A 3AEQB 2OSVA 5KOJA 4HMOA 4LJSA 4PAGA 3TLKA 3K1AB 3ZK8A 3MINB 4BBPA 4M7OA 1K7SN 4DBLE 3PSHA 4UTOA 2O1EA 4XPIB 1QH1A 3EIWA 1MIOB 3CX3A 1FP4A 2QI9F 2R79A 3MFQA 4LS3A 3HH8A 4MLZA 4NNOA 4OXQA 1EFDN 2MINB 2RG7A 3PDIA 3AEUA 1M1NA 4HN9A 5KOHA 3U7QB 2AFIA 2AFHB 1G21A 1L5HB 2M6LA 2X4LA 3ZK7A 2YNMC 2PRSA 5CX1B 2XQVA 3AESA 1QH8B 1K0FA 3MINA 3AERA 5KHLB 4UDOA 1KAEA 2XUZA 4ND8B 3AEKB 5GGYA 2R7AA 1K2VN 4TKUA 1H1LA 2XY4A 5M3BA 5HX7A 4WNAA 1N4AA 5I4KA 4TKVB 5FLYA 2YNMD 1G21B 1K75A 4UTPA 1N2CA 3LHSA 4WZAA 3TEFA 4WESB 4FILA 2Q8PA 4B8YA 1QH8A 3PSAA 4H0FA 3PDIB 3NU1A 5HDQA 2PS9A 5BVHA 3ZKAA 1PSZA 5JPDA 4XPIA 4FNAA 4OXRA 4WN9B 5AFSA 1QGUB 4WZBB 3MWFA 4G09A 4MX8A 2XDQB 3EIXA 3ZK9A 3MD9A 1M34A 3HJTA
chains in the Genus database with same CATH superfamily
1S9DA 3M5CA 4Y2TA 3LU1A 3M4YA 1ZCZA 1IMOA 3R6GA 1EXNA 1OGIA 1QIDA 1DIRA 1K3UB 4HWOA 1X7GA 4B7AA 5BOSA 1IPHA 4OHFA 1IPFA 3Q8XB 3TTUA 1PV1A 3JQEA 2O07A 1GA6A 3QIVA 3ZY3A 4ZYVA 4Z4CA 3W04A 2QSZA 2P4EA 1RCUA 1KAMA 1KC1A 1U6IA 4KXMA 2IV2X 2Q9CA 3DM5A 1N2JA 1JE1A 2M1ZA 1OQAA 1FXUA 1K7FB 4YJGA 5DBFA 5HCIA 2YV5A 2B78A 1RXSA 2ODAA 3BFXA 4OQMA 3KQYA 3CNEA 2HY7A 2QP4A 1G4AE 3E2PA 3S4YA 1LNSA 2FHPA 1T25A 2Z4TA 5D51S 2NW6A 1W1UA 2NYUA 1KJYA 1EFPB 2PJDA 3ZW8A 4DBVO 5I8PA 3CCCA 7YASA 2P40A 4M1QA 4LCJA 3ORFA 1E0AA 4MVJD 3JZDA 1SZCA 3H17A 2VNIA 2YJTD 3NNSA 3KUUA 4ZT5A 4CFSA 2QGFA 2XCQA 4M9XA 3REQB 1ODSA 2IP1A 3TBFA 1DKPA 1N6KA 5C52B 4WBXC 3M6LA 2XE6A 2QUHA 4PGAA 3ZWXA 3IYLW 3W7AA 1YDGA 3G6KA 3ASVA 1TUGA 1RMYA 2IIQA 3PGKA 3RAEC 4JP8A 1ECPA 1WPXA 3N74A 1J9ZA 3WLFA 3L3BA 5KYUB 1LC3A 1KRWA 2NVWA 4ZPXA 4WK4B 1P1CA 4XQGA 4O4LF 5CPBA 2LNDA 3CRMA 3MQ2A 3ZCRA 3CVYA 4FMDF 4FFLA 1GXSA 4GOOD 1OX6A 1J8QA 1SVWA 3KXPA 5BN3B 4X9XA 4X7RA 5F4BA 2FX2A 1QRSA 2Q1UA 2ZT6A 2XBLA 4KHZA 2I6GA 3U3DA 3HUTA 4BKMA 2XE7A 3D0RA 4N6GA 4ZDWA 5ICFA 3X2EA 1P5HA 3KVNA 5IVDA 1U63A 1MB0A 2E55A 1DXHA 2Q5HA 3A6KA 4L8WB 4Q7QA 4U2CA 2ERCA 1KXJA 1EI9A 2JHCA 1EINA 3RVBA 1X86B 3M2PA 3KO8A 5FBLB 3QVGA 3O5AA 5BQFA 3MBIA 1K7CA 2YXEA 2ZSHA 1L7MA 2FN4A 3DH0A 1DAKA 3ZIUA 4ENWA 3A6GA 1PIWA 4V39A 1HNWB 3DXZA 2GNAA 4QRIA 3H3XA 3QVKA 2EJCA 2DFTA 5EN4A 4YN3A 1ZSYA 2JGDB 4GNKA 1E92A 5C0OE 3RV3A 3OD5A 1L5VA 2AN4A 2J45A 3H0EA 1KI4A 3I8OA 3S99A 3RG2A 4ZO6A 3QNWA 3L06A 5THXA 4A0RA 1UUFA 2I71A 2VT7A 1KK0A 5KEIA 1GKLA 1SO8A 3RUDA 2FQ1A 3WQRA 2BH9A 2X2EA 5BN1A 3JWJA 1ZX1A 2GERA 2WMDA 2LCFA 1G8KA 1Y9EA 4IOKA 3KEFA 4LHWA 5IDQA 5JXIA 2HSEA 1EFUA 3PCXA 1KEZA 3LGXA 4UEWA 4YRQA 4YP9A 5C2JB 4P08A 4QUIA 3SKYA 1PSZA 3W9YA 4NDNE 4L8GA 1GUZA 3MWFA 5ALKA 4NE2A 3T34A 1Y34E 1DVRA 3D7NA 3CBGA 4Z9XA 2AG8A 4WFJA 3O26A 3A6LA 3P5BA 1CE8A 2Q5FA 2H1HA 3SSAA 2A9VA 2Q49A 4G2TA 1T2NA 1I4EB 4CT0A 1LFAA 2WIKA 4E1BA 4EUNA 3FWYA 4HDQB 1OIWA 2NZXA 2OUKA 2SKDA 1R0LA 4WTOA 3MELA 1ZZEA 1H1DA 3NEYA 4YGYA 2JD1A 3VRHA 4RYDA 1QVVA 4EH1A 1D2AA 2WWFA 3SK0A 2V7EA 4CVNA 3EGWA 1SKBA 4LKOA 1WETA 1SC1A 4GC5A 3OQNA 1CTQA 3PUVA 4FBMA 2PWZA 1OZHA 2WU3A 1RQLA 1DS6A 2I2BA 3NR2A 1L2TA 4UW9A 4KG7A 4HV4A 5AW3A 4X3CA 4V1CA 3Q0TA 3T3NA 2NPFA 3AJAA 1K06A 2D5CA 4BN5A 4RDIA 4BNJA 2IYZA 3MYYA 2QTVB 3UWSA 5JZVA 4F9GA 3CC8A 1LFDB 1RXUA 3EG9A 2R6DA 1T6XA 3C3EA 1NYQA 4OBBA 3CTMA 1YS9A 1MR3F 2PM8A 2RH4A 2XCIA 3DMHA 3EZ9A 4K9SA 4P4UA 4JLWA 1H2YA 2QD3A 4ZAWA 3UAOA 5KWIA 3D2AA 1TUBA 2QU7A 5DHAA 1GGJA 3AIKA 1T0JB 1TFRA 5FPQA 3CT6A 4R1LA 4MQUA 1E6WA 1YCDA 2I67A 1IXKA 4ZAVA 3UV6A 1X9HA 2CVOA 2JFWA 2PEZA 3EWSA 1TU0A 2CD9A 4JIMA 4P32A 4RE5A 3O3NB 3THRA 2C4TA 1XDDA 1ZR2A 2BR3A 5EZQA 4BNNA 1MXHA 4RVDA 4QPDA 4WFQA 3WYCA 1DX4A 4LK2A 3RRMA 1EM8A 3K1AB 3OFND 1SBNE 4G3XA 4LYAA 4HNGA 2ZJ3A 1MORA 1ZSVA 2GA9A 1GPJA 1AB6A 1O94D 3B2NA 5AI5A 3I9V6 5T57A 4C22A 4GVLA 5C4MA 3RYCB 4CQNA 1ZVKA 1TM1E 2R8XA 5JAQA 2FW9A 4GX2A 1H6AA 4HZUB 3IMGA 1F2TB 3OIVA 4CUKA 1DG9A 4MGEA 1YDMA 3DO8A 1IM2A 5CXQA 2WVJA 1KQGA 3ZE1B 2ZROA 2EARA 4QKQA 4KN9S 3G68A 1AV7A 3EXHA 4Y2RA 1F6WA 1VM6A 5DM1A 1M0SA 4LMAA 1XLTA 3KB2A 1KR5A 3KK0A 4D9NA 2KJQA 4Y6OA 3O1LA 4B2LA 4D4KA 4GX5A 5EQJB 3STXA 1EX7A 3AR3A 4K1LA 4EUKA 3W5CA 3MQFA 3K71B 3R44A 1ZUNA 4CM3A 1AK1A 1RPTA 4DCPA 4IXDA 5JD4A 5I7AA 4KUGA 1NVTA 3AB8A 5E4TA 3NEPX 1LX6A 1QFXA 4JSYA 1MNQA 2GDJA 4DUYB 3AWIA 1N57A 2R87A 3NIGB 1UM9A 4RGYA 5FJIA 4B09A 3AL2A 5BV0A 4DSTA 1KFEB 4QNRA 4PAWA 5KS2A 1KTVA 2XIJA 2WE7A 4COKA 1G3MA 1FQOA 3OAAD 4H4DA 3WGTA 2Y66A 1II8A 3VM6A 4KBGA 4IQ4A 3H2YA 4ALIA 4JJIA 4DLTA 5A04A 3GROA 2WIDA 3ETHA 1RE0A 1SCQA 1PEDA 1VLLA 4J4BA 3DEIA 5J9FA 4KNYA 1NC3A 2JFUA 2YV3A 2XMZA 3FFAA 3TBHA 3UJBA 1MX9A 1Y1LA 5K8CA 4WLEA 3V3TA 2ZUCA 4KXVA 5IRCD 3SZLA 1RWWA 1T29A 2COEA 4RIFA 1AKTA 4Q66C 3PQFA 1P4JA 3KB6A 2OHFA 1SZPA 6ABPA 1M83A 3J81A 2XMSA 5DZSA 1ZBQA 1ZM3A 5CW1A 4YMGA 2HWXA 4X6XA 1DLIA 5AP9A 1ETUA 2NVUA 3WQSB 4YCCA 1WLSA 1T1IA 2FOIA 1I7QB 4CYMA 2O2IA 1KF0A 4TROA 4JUFA 4ZYYA 2D06A 4TVOA 3GRKA 4ZVTA 4Y6RA 2ZOSA 2GO7A 3K70D 4TTJA 1UT5A 4HQ0A 1CUIA 3HLYA 3ZLUA 4K1XA 2LKCA 1ZCJA 1I0LA 2UZIR 2W5UA 4B3FX 1A1VA 1ONSA 5KQRA 1I30A 2A7QA 3IAS6 3OCJA 4UDYX 5CNKA 1ST2A 4Z4FA 2B7LA 3ROGA 3SQMA 3KQVA 5DM60 1GAEO 2WILA 5EUQB 1J8MF 3LKZA 4FGZA 3NCHA 2HT1A 4ZCLA 3BJMA 3N87A 4J7AA 5DN9A 1XQ9A 4O3MA 1H6BA 4M55A 4F3RA 1TYEB 1AZTA 4PAGA 1T1EA 3O8NA 2QRUA 4GRDA 1RZRA 3R6WA 1FDRA 4HLUC 4BHTA 5EMJA 2WHQA 2D13A 4D8UA 2SKCA 4GM4A 2HDHA 4NHOA 3C4QA 2HGZA 4ZZ3A 1QRAA 3I62A 1GUYA 2IZ1A 1JG2A 4MS1B 2WYOA 1OSNA 2R4UA 2F8SA 1QGZA 1EMDA 3F4KA 2VKQA 3OX1A 4GRIA 1IHXA 4V24A 3ROEA 3SMVA 5AKKA 4OJNA 4ZDIA 1QE0A 2EJBA 3ESDA 3TOCA 1PGQA 3LQ4A 4GI7A 1JJFA 4A8JC 4DANA 1I24A 3OX3A 4XDGA 1NFFA 2GYYA 4P33A 4QDZA 5CXXA 3SX0A 1ODIA 1QS0B 3N2LA 3EY9A 4IQGA 3OCUA 5JNWA 3DBRB 4RVGA 2KB0A 4MWCA 1FFAA 4G8DA 2JDIA 1NQAO 3EISA 5DW0A 2Q3JA 3E7XA 3UTCA 2RAPA 4PG4A 5EESA 2P3SA 5H7XA 4N47A 2X0EA 1QOZA 3WK4A 5EJEA 2GI4A 3JD4A 2MTBA 5FUMA 4W9MC 2YHSA 3PC3A 1ORWA 2JHAA 3NALA 1COWD 4DR5B 4HNSA 4FN4A 2HMWA 4FN5A 3VYUB 1JQBA 3WA7A 3BX1A 4DUGD 2X3YA 3PQ3A 3WLIA 5JMOA 4S2EA 1S96A 1ZBDA 2J08A 3IVAA 1XQXA 1JHZA 2JH8A 4LOLA 3SDBA 1XAGA 3GNSA 4RA9A 3P97A 1MG5A 1N5JA 4MV0A 4I8IA 4BGIA 5I8WA 4ND1A 1LPOA 1ISFA 1E5VA 2WVHA 3ICWA 1QDLB 2W37A 1OZ0A 3TVDA 2P90A 2Q1WA 3QVTA 3QXXA 4CEJB 4NSNA 1EWQA 3G9ZA 2KBFA 3C4VA 4HK4A 1XJCA 2FOXA 4RESA 4YCSA 4X44A 5E9WA 5LMZA 3QVUA 2WSIA 1EK2A 1EG7A 1HRDA 3NOOA 4TTIA 1ORDA 3W8NA 1BD4A 2FPGA 5AKHA 5KTTA 1T4CB 1DNPA 1PN3A 1MAHA 1M1NB 1CP3A 1WO8A 3ORRA 3RI3A 1P9RA 2ZBUA 2A78A 3IMEA 5EP2A 3UKOA 3QK7A 1AIPA 1NJ8A 5CFMA 2IYSA 1T1SA 1DJOA 2C7BA 3PD7A 4G24A 4ZYLA 2PUEA 3HTXA 2GFQA 1UIMA 2JHPA 4KLNA 2F3UA 3D3JA 1Z3IX 1RKQA 1SA0A 1M75A 1ZC3A 4BUJA 1YB1A 3I32A 1WPRA 1RHJA 3DL4A 1P1JA 2X4IA 1Z28A 4LGCA 2GUWA 4WBSA 4RF4A 3DBLA 3QEMA 4AZ3B 4EY4A 5IAOA 3GGOA 1OCEA 2Y71A 5KNDA 3CLHA 3Q40A 1D4FA 3NZEA 3I58A 2XA9A 1OLOA 1TVCA 1ULUA 3V1LA 3K1YA 1N75A 5EGNA 1QHHB 3TZCA 4XJSA 2IY9A 4I99A 2WY2D 4B4WA 3CURA 4HGNA 5ALEA 2AFHA 3OT5A 4KN8A 4RPKA 3PKJA 3D81A 3FZQA 4NFLA 4NYMQ 2WNIA 5KSYA 4BY9E 3GFTA 3W06A 3QU9A 2WJ4A 3O4FA 4TVSA 4IBOA 1J5XA 2MINA 4GXTA 1O03A 3O8DA 5EZYB 3ZGYA 1Y5IA 3HMQA 4DUGA 1Z5UA 3P0RA 1C3JA 1EUYA 1DJMA 2X42A 4OXKA 5ERYA 3ESQA 3OF5A 4TS4A 2XNKA 5EMMA 1C7QA 1JZSA 1RRKA 1WVGA 2GXQA 3IKJA 1N2HA 5JG7A 4RACA 3BK7A 2FR1A 2AW5A 2OD2A 1A77A 2BHLA 4S1PA 4XKJA 3U7HB 3RFTA 1E64A 5TDHA 4PZZA 4KFCA 2P62A 1GZUA 5A6SA 2C42A 2JGKA 2ZYAA 2V54A 1THGA 2ZAGA 4IUDS 4RKRA 5EWLB 3T5CA 3W9SA 2Q0QA 4AC9A 3AINA 5FTLA 2AZXA 5CDUA 1G7TA 3HKEA 3I2IA 4QSHA 4BNHA 2BIFA 2XI4A 4E4YA 2W6QA 3ZXIA 3RFXA 3T9DA 4IIVA 3K3PA 3RJ5A 1A9XB 4QU5A 2HWKA 4EFNA 2UYOA 4RJKA 3LSTA 2QXTA 3OLVA 4YBZA 1JEYB 2RFLA 2X2FA 2P6NA 3LV8A 3OOHA 3RM3A 3LOQA 1FXSA 1FSPA 1JI0A 1AXGA 4UJ3A 4JBGA 1BCRA 5K8IA 3OX4A 3R0JA 2GS9A 2QHXA 3GNTA 2BUAA 1DOHA 3SJCA 2BSXA 5DGXA 3TDMA 4AICA 1PDOA 2EF1A 1LVHA 1ZGHA 2ZATA 2I3DA 4M9UA 3WFZA 1T1RA 3MTGA 5KPDA 3AVVA 4LI0A 3NM5A 4OREX 1F5SA 1J2TA 4ND7A 4UVEA 5L4LA 2WJYA 3UMMA 1OX5A 4P54A 3PFHA 1U5CA 1E1QD 2X7XA 3CJQA 3H11B 4OYHA 4I08A 3SNKA 3T38A 1CCWA 3CGGA 4R9SA 1V8BA 2OZVA 4FILA 2G0AA 4YWJA 3HFRA 2IE0A 2GBIA 4DA7A 1CF4A 2ZIEA 4RPIA 3EAQA 4I46A 4QQFA 3OIWA 3OQPA 4LA4A 3IA7A 4AWXA 1MH9A 1W4CA 1NBME 3I4FA 4HRYA 3WWDA 3FOEC 4K9NA 5U4XA 5FWAA 5FR1A 4E2XA 1BWRA 3CYFA 2JLXA 2Y1WA 2WM3A 3AR6A 1X1TA 4W5WA 3ZXXA 2GCIA 2OWDA 5IEBA 4BLUA 2GEDA 3OZTA 4ARVA 5IM4A 3MAJA 1Z0DA 1VYHA 4OGGA 2G40A 3G5MA 1VL0A 2VLIA 3DFMA 1A9PA 1RWBA 4OP3A 4PXYA 1JXAA 2RBGA 1XE3A 2NU6B 4HXEB 2C7OA 2ZUWA 3H7IA 2D0OB 1RQNA 5GP1A 4MGZR 3WLJA 1C8LA 3AB3A 1RVV1 3ZXYA 2WZQA 3TD2A 2GM9A 3HVKA 4F97A 1F38A 2I29A 4MYCA 3O83A 4LJ4A 3PHBE 4HFMA 1X2BA 1TVKA 4MTLA 1ULHA 3H0KA 2OLKA 3E3MA 5TIIA 1I0ZA 4P3KA 3HDYA 4NH4A 4B6QA 5LBUA 3DV0A 3E27A 1AZLA 4NCBA 1MU0A 1V2HE 1KO8A 1KY5A 2QRKA 3AR4A 4O5OA 5AWFC 4HPWA 5JFOA 4DUZB 3S5UA 3N2KB 5KNCD 1X7HA 4BKPA 1B6RA 1OBVA 2RONA 4A9AA 4D9KA 4L4XA 3W2IA 4MLDA 3JV7A 4ASUA 4BJHB 2MYTA 5CM8B 2BC9A 2OGUA 2VXCA 3ROKA 5SY4A 4IHJA 4AXBA 1H2FA 3IDZA 1FSZA 2E4YA 3T1OA 3SLKA 2PS3A 2A30A 4UHFA 2B35A 2RHOA 1JAYA 2OSVA 5KOYA 4JBIA 4FKBA 4MV1A 4RAQA 1L5LA 3DYIA 2BD0A 4IOJA 4CW7A 3IPAA 1O6FA 4BKRA 4TQ9A 4P4SB 4L16A 2W98A 2GN1A 4I55B 1ADFA 2JCGA 1ZU4A 3MLEA 5KYYB 4ZJYA 1SCNE 1JTEA 4GPD1 5C7LO 2G1KA 3B53X 2CDCA 5I3CA 4LQDA 1R4ZA 3WGNA 4WLOA 1NBEA 2I3AA 1L4UA 3UYLA 3ZQJA 1ATZA 4WXMA 2H0RA 1HBJA 2HSZA 2WJHA 2X6TA 3H04A 1M33A 3N6XA 4PZ9A 1KWKA 2YVLA 3CEPB 1ZHOA 3ZLVA 3FDJA 3G9XA 3C6ZA 1T5DX 2AOTA 1E3WB 3OP4A 1ISHA 1GADO 1K4KA 2QR2A 1FVFA 1UXOA 3AEKB 4TKUA 2WLSA 3ZHRA 5E9JA 2I3GA 3L40A 3ZIAD 1ZEJA 4LYGA 3O90A 5I5GA 4UOZA 1O9BA 4ZGGA 2IF0A 4Y2SA 5EMLA 1KZGB 2RKBA 1E3EA 5TPWB 4KQMA 3GA5A 3GMDA 5K20A 3AKZA 4WVLA 1TYCA 3U4CA 3QPBA 4TMFA 3FDXA 1Q77A 3WK7A 3BREA 3F67A 2JAOA 3D4LA 4M53A 3GPLA 1HQYE 4DQLA 4BFXA 1ZMOA 1XT6A 4PBRA 4ENUA 5JYBA 1J23A 1R0KA 3AUSA 4B2IA 1NUPA 2FWNA 1SXQA 2IV3A 3U16A 1TTQB 3IDSA 1EZ4A 2BFPA 1GQSA 1U0JA 1T5TA 3I9JA 2AUNA 3NFRA 4TWZA 5EHGA 2JRCA 5MFPA 3C3BA 3QX9A 2Q9AA 2AMFA 5DX1A 1VBKA 1WB4A 1H94A 1GG2A 3REFA 2BJVA 4L4ZA 2QPOA 1JYFA 2GT1A 4UBIA 2EZ9A 2P6PA 4X1IB 1T43A 1H4TA 1TQDA 2WPDA 2MR6A 3IUEA 1U2DA 3WBFA 4ZHQB 4Q6WA 1WV0A 5I01A 4DA4A 1MW9X 2WA2A 16PKA 2ZKLA 2Z5FA 4CIDA 1GNQA 1QO0A 1EK5A 2ETVA 3TTYA 5EFZA 4X24A 4I36A 2QMOA 1V5GA 2R11A 1KEEA 2P2CA 4I4NA 2DWQA 2H4JA 2OPBA 4LX0A 4S1TA 1AT1A 3OPNA 1BU8A 4ZZ0A 3JXEA 5EJIA 1AV6A 2FPKA 1F51E 1V6SA 4RS3A 4ARUA 4LFBB 4ZEVA 4J03A 2C5SA 4GWLA 4KIUA 1W5EA 2EWMA 2IP4A 4KZPA 4MIEA 4YFYA 3UHFA 4EI7A 5AM2A 3GHYA 3JQDA 3DZFA 3PGA1 3DZIA 4CM1A 4KI0A 4FINA 4XJVA 2IYFA 1UJBA 1WAMA 4ROSA 1X80B 4GGMX 4MRNA 1Z2DA 2OZEA 2LWIA 2PRIA 2P1DA 4B4DA 4Q3EA 1VRCA 4AIIA 4UOQA 3DMTA 1UWLA 4I1VA 4M46A 3JRNA 5CLLA 3BWEA 5WRFA 1REQB 2I65A 3ONWA 4BX0A 3SEFA 3UYKA 4D74A 5ITZB 2QL7A 3D3WA 3D6NB 4JC0A 2PBLA 5BPHA 1TCUA 3VUFA 3FPJA 3UBTA 1YC5A 3JARB 1H2AS 4IOLA 4ZQFA 5EJAA 5KYTA 1ZY2A 4IVNA 3DZHA 2J9RA 3FUTA 1B8VA 4MKHA 3FZYA 4P83A 2M32A 3FGOA 2BDEA 6GPBA 1CUAA 1HEUA 4QEKA 1FS6A 3ER6A 3F4BA 1WUIS 2C04A 5JECA 4GPZA 2WJJA 2UYQA 3COYA 1FTGA 2AG0A 2JJ2D 3E03A 3ID6C 5BY2A 4LNUA 1XGKA 2D62A 3DXFA 2QM7A 3P94A 4IXMA 4V38A 3ZD9A 3LAWA 1WW3A 5K8TA 3ONFA 4K46A 3SFZA 4IJQA 4J9VA 2R8RA 3T5MA 1I14A 2G5CA 2O5RA 3HUUA 3P9SA 3ZOZA 4DLLA 4EG1A 3J80A 5H68A 1AMNA 2ADOA 1DOZA 3IEUA 3RBXA 3D5QA 5AW2A 4ZFNA 2W00A 4NOJA 3RGGA 5J23A 1F14A 2DHRA 1AN0A 2B8EA 1DCFA 1IWBB 2OL4A 3W5AA 1LK5A 5D1NA 4TSRA 2C9MA 3BA1A 5TXGA 4Z51A 3WYDA 5K3BA 5IJ9A 5CD1A 2CB9A 2A59A 4TSFA 5EJ6A 2HAEA 3TSZA 4L72A 4Q21A 1DXYA 4RVNA 3M83A 2QAGC 2BELA 3S44A 4F5DA 3DUWA 5ALRA 1ODTC 1CEEA 2HR1A 5C7YA 1BWPA 1SXJB 2WA1A 3OE7D 3SKVA 1OB5A 2AXNA 2I78A 4AMGA 3OPYB 3VOAA 4RSGA 3OFKA 4BVGA 1IDOA 3DOJA 4MQEB 4RTNA 1ZD2P 2PX4A 2RG1A 4AX8A 1BXKA 3TPZA 4JASB 2SCUA 3NKLA 2JLVA 5JSUA 5K5EA 4UNNA 2JG3A 1FMJA 2HGSA 3L79A 4IYRA 3G8CA 3CCBA 3L7YA 3BDIA 3D8UA 2ZRMA 1DUIA 3KL4A 3T7AA 1KDZA 3WRWA 4DR6B 5E95A 2CNKA 5JWRA 1Q22A 1QMPA 4NZ9A 1M2WA 2WTUA 4WXRA 1F2VA 4GP6A 4BFCA 2PMDA 2OBFA 1OFTA 1RQPA 4A0HA 4RKEA 1YBHA 2PV7A 2PGJA 2H1IA 3V4SA 1PZMA 3IP3A 4PE5B 2HN9A 2BGWA 1SBQA 1PUXA 1QGUA 5KNBH 2Q3DA 1WUYA 2EAUA 1HOXA 5CB4F 3L1IA 4BQRA 1A5SB 2G07A 2VATA 3Q2IA 5K6AC 1KMIY 4NU5A 3N0RA 3FE2A 3TZQA 1NHWA 1W5BA 3I05A 2D7CA 1S89A 4I4IA 2I6XA 3KKKA 3G7NA 4BRSA 1CEQA 1CUUA 3OC0A 5TR9A 3WO1A 3QELA 4YRGA 2ZI5A 2CLIB 3MS7A 5GV7A 1VRWA 1J0AA 3CUYA 1XN1A 5J1SB 3D3WB 4RVOA 1XYYA 1M8GA 3WQQA 5C8VA 3PJGA 1CUWA 3AHGA 2P41A 4YJKA 4EX6A 1I36A 2WT4A 4XB6B 4GQBA 3UWOA 4DNQA 4JEIA 3G5UA 4AJJA 3NHMA 5I4BA 3HXOA 4H59A 4PWZA 2AZTA 4IW3B 4C3ZA 4QREA 2IS1A 1PLJA 1E7MA 2X0KA 3T9CA 4GSYA 5JJ5A 1CY7A 2YWDA 3KM0A 4QOHA 4B3SB 3OTIA 1PR5A 1A27A 2J3MA 3AY6A 3DFIA 4QA9A 1SCIA 4EFDA 4D9FA 1CD5A 5CGQB 3GYGA 1JEQB 2V74B 3CLSD 3P0JA 4HDOB 1W2HA 1ZH0A 2BM9A 1A69A 1VE9A 2FX5A 4LJ5A 5AXDA 4AJNA 3KQKA 2V98A 2N47A 5D85A 2IWHA 5FYQA 4DREA 1TECE 3MJSA 3SKXA 3DMGA 2I6TA 4IRUB 3L8ZA 3C6BA 4QUGA 1VHQA 1JMKC 2WD8A 5DYYA 1DPFA 3BL6A 1H2XA 3NGMA 3R6DA 4FQ7A 2B8WA 1AZWA 1ZKDA 10MHA 2BMFA 3CF4A 4P53A 4AWBA 5HKLA 2J87A 2NM0A 1FPQA 4O2BB 5HIMA 2QR5A 2Y1EA 3CR7A 2GA8A 1S2OA 1VP3A 1PNOA 1OTHA 2JAPA 3TQQA 1O9GA 1ULBA 1OBHA 4NG4A 1LS6A 2BY4A 1Z6ZA 3A27A 3AL0C 3Q5GA 3G0DA 5JO9A 1GPMA 3RBVA 4IUBS 4B3MB 1YRAA 2W8ZA 4GYYA 3IHTA 1CDZA 3H4IA 4PZCA 1O8CA 1G7RA 4GI2A 4IIJF 3UKJA 5LB4A 3I12A 2WZCA 2GPNA 5KTSA 1Q19A 1G21B 1RZVA 1DB3A 1XRLA 2Z08A 3A9UA 1TI7A 1U7UA 4BB5A 1L7BA 3EARA 4ETWA 1Q7BA 5HE8A 1TEZA 4MDEA 4PBSA 3DHYA 4B8YA 1B7GO 1M8JA 4CTMA 5D6NA 5FHQA 1RAHA 1F8XA 1MB2A 4FCVA 3OD1A 3OQMA 1IYZA 5ECGC 4Q7KA 1FUKA 1X70A 4HUJA 5LZ4A 1N1GA 3DTNA 4PAMA 3CXUA 4QBIA 1L7AA 1OY1A 4OA8A 3CF4G 3PIRA 5IDVA 1MJHA 4OFXA 1VIAA 3D2BA 1NVFA 2O7RA 3INTA 4UMDA 3TIGA 4FR2A 4DVGA 2F55A 1XK7A 1N6IA 4HX9A 2I66A 4KQXA 4LY0A 2GFHA 4W7SA 5C34B 5BPFA 3D8NA 4OU5A 1K0UA 3BH6A 2VHYA 2EFGA 3GRUA 4A15A 2UU9B 2WLTA 4UUMA 3L4BA 1C80A 2WJ3A 3IQDB 2X6RA 2J30A 2YFHA 3WADA 2V65A 4C9BA 2H1LA 4PONA 4GS5A 3FOBA 1HRKA 3P32A 4P4NA 3DL7A 3TE7A 5JIBA 1I7SB 1NAIA 2F00A 3DO6A 3RKSA 1W52X 1I94B 2FUG6 4JYPA 2XB4A 2BEWB 4OKIA 4RNCA 4EG6A 3SOPA 1TE2A 3QUBA 5HVNA 3EK2A 1R8SA 2JLWA 4G4GA 3G1TA 1XNJA 4DJEC 1PS8A 1JDTA 1A5BB 4KLCA 3DVSX 4UVIA 1QLJA 5CPFA 1UPFA 1NTRA 1PWEA 1N0UA 2HK9A 1PW5A 3HKBA 1WCWA 4LRUA 1X94A 4Q01A 1ADGA 1EJ2A 4O2BF 2Q9UA 1KJIA 2JGLA 2JIRA 4JQSA 4FYHA 1ZCAA 2J4FA 3N8KA 3WLHA 4I81A 5F4ZA 3K6SB 1NQ5A 1JVBA 1Z36A 2E48A 3PNYA 1CX9B 3BMQA 4AF6A 2J7KA 1JJVA 1E3DA 1M2OB 2NTNA 3ENVA 3JD1A 4KFSA 1Y63A 4LX8A 4JKOA 1F20A 4P80A 3DWGA 1VGQA 1JALA 4PX2A 5TEWA 4DNFA 1GR0A 1NYLA 1K8YB 2OENG 1PD0A 2ZIZA 1TIKA 4IFEA 4WI1A 4GPBA 1COWA 1KH1A 3Q0IA 3K09C 1QVZA 2AYYA 4Q03A 3GEDA 4EUFA 4ZICA 2FGKA 3NB0A 4RSMA 5C8ZA 3D0QA 5EEGA 4F7WA 5JNLA 2VSQA 3QE9Y 3P9IA 2YY5A 1WY5A 5HGXA 4Q1FA 1T3HA 2ONKA 1T4BA 3Q4GA 5IDWA 4I50F 4JJ6A 4L2IA 2PX3A 1WMFA 3LY7A 3V33A 5C8YF 5L3RA 2P11A 4L3OA 4KBFA 4X71A 2Y1DA 1ESCA 4BRZA 2GPTA 4A10A 3HWWA 3KKEA 3R20A 4GL2A 2GAOA 2HA6A 1G21A 1E9BA 5BSMA 2EYUA 2VK2A 3LRPA 2ZVQX 2H5JA 2JFHA 3RG8A 2F48A 4Z4QA 4LF9B 1S2LA 5JAHA 1RHUA 3HRKA 4O4JF 3C7DB 3HBLA 3TZ6A 3URMA 4F5WA 1Z3CA 1KYZA 3W9BA 2CFOA 1BOOA 1LNQA 4M3NA 2FK7A 1J99A 3BFJA 4LW8A 3SYLA 3WGQA 5CA1F 4WLVA 5DLEA 1PR4A 5LQCA 1UC5B 1IY9A 2OSBA 3A8TA 3PGVA 1KC3A 4NS4A 4FIDA 4RHYA 1DBWA 5TS3A 3W7VA 3EOZA 1PR3A 4JT8A 1JQLB 1ONOA 4MYSA 4TMTA 1LD3A 3ZDEA 2A94A 3GLQA 2JIQA 1YRYE 3TLCA 1SFRA 4MRSA 4PR3A 3RVLA 2CK3A 3QFCA 3NHUA 4WCDA 4Y18A 3WFJA 3O0TA 2D5LA 4D0RA 1E2UA 1R4MA 2C9CA 4M9ZA 4OQQA 4NKRA 5ALUA 5BW8A 1J2RA 2M98A 4PQYA 1IAQA 1U8YA 2VJMB 4JODA 1UK8A 4C0JA 1RC1A 1ABBA 3MUEA 3HFGA 4ZRDA 2V8OA 3PQ2A 3GUYA 4RJJA 3RS0A 3PXXA 2J0SA 1CETA 4NYIR 2IITA 2ASVA 3DDSA 1GJRA 3I5MA 3L0CA 1Q14A 2W6CX 5DPMA 5CIYA 2ECOA 2PFGA 2WYVA 3BZBA 4M8NE 4GP7A 3HV0A 3QLUA 621PA 1QIKA 4I2NA 2ETXA 3CY6A 2XZPA 4CQMB 3RAPR 4B6RA 4XJXA 1N3IA 2A0WA 3ZI0A 3F9IA 5A4AA 1WLYA 1KKLA 4P8RA 2WFMA 3IQXA 4RCYA 5MN6A 4BBJA 3W5BA 5GM1A 4D9GA 1G17A 4E7PA 4YASA 2GN8A 1T9ZA 5LZ2A 1FIUA 5FNVB 4FE3A 4KFUA 4W99A 4X1KB 4TX1A 5EMKA 3UWKA 2O8FA 3HYNA 3FRIA 1RQ7A 1OLXA 2RJNA 2VSYA 3G2QA 2FY8A 4MUFA 3QE0A 5CURA 2WWVD 4F06A 3BE8A 1Y1PA 1S8AA 3DZBA 1LZKA 4QFBA 1J39A 1NIPA 4JIGA 5AR1A 4KRGA 3X1XA 1RWPA 2EQAA 3TMKA 3DAOA 1RI1A 4EO4A 1F6DA 1OREA 1OR8A 4Z0TA 4N12A 3F6EX 5I8ZA 1MQ8B 1U1GA 3SR4A 2VCHA 2ZK7A 3SX2A 4CIYA 6REQB 3U56A 1OIXA 2NZYA 1JHQA 1WTAA 3ETGA 4UUAA 5ETJA 2O2EA 4ITUA 4YLGA 4MAFA 2NYAA 2X41A 3ZY2A 1FLAA 5LA6F 4KGDA 3H13A 5BUZA 3JTMA 1GCGA 3HCFA 2X9GA 2JGNA 3LBIA 4PGGA 2HX1A 4XVUA 2J5QA 2CFRA 1T6ZA 3WYEA 2QP3A 4CLEA 3SVLA 2GEFA 4IIHA 1LVUA 4NAUA 2FZVA 2JHFA 1WMBA 3H2KA 4IDNA 4MIOA 4RSRA 2BKAA 2QM0A 3EZ6A 1OXVA 2C7RA 4ZQCB 1F8FA 3OZWA 5CA1A 3I04M 3LW7A 3EASA 4GBJA 1FTWA 1MJFA 1SXJC 4ZQBA 3FETA 4Q4AB 2BCGY 3CISA 1NMSA 5H80A 2IPMA 3AU9A 3D7SA 4UEKA 2R7NA 1E18A 1NJ6A 3AF0A 3PFKA 4RZIA 1QGDA 2VA9A 4Q12A 3OJEA 4B8WA 1LLDA 2QI9C 1ZUHA 5KHLB 5BMVA 5IAGA 3TIXB 5AVJA 3CN7A 3DKIA 1KVSA 4Y2YA 4PYMA 2ZUTA 1KVTA 4DMFA 1H2RS 1L5MA 2Y27A 4BE9A 4G25A 2WHPA 1RJFA 4M8SA 5U1PA 3DVRX 5C46F 3LX6A 2UXCB 2IELA 2DLCX 1KHHA 2C4VA 2D2XA 4TSFD 2AZMA 2QLBA 2FG7C 1D07A 1TK2A 1JLSA 1E99A 1KYQA 2LGJA 2J3QA 3IDAA 1V96A 2ZP1A 3RB8A 4BO2A 2EW2A 5F5XA 4M86A 5K0FA 2W8BA 3BN3A 5THKA 2C5LA 2Z3WA 2YHIB 1ZN7A 3FPHA 4V0OA 2WUVA 1FU8A 1UBFA 4OMUA 3B2EA 1KO4A 4L0CA 4NH0A 2IXFA 1IN8A 1H9CA 1Z37A 4BKQA 4WZBB 4BV2A 2IH2A 4O0MA 1EFVB 1UC9A 2HTFA 2VTBB 3K0FA 4G1UC 1H66A 4FONA 4YJ2B 3WK5A 1I0IA 1NP3A 3ZWMA 1U9YA 2AYZA 1ZI8A 4Q1BA 1NN3A 1BHJA 5D5PA 1HDCA 1Z7GA 1E6EA 2OC4A 2IYRA 4IIBA 5TT1A 4MINA 2ZTSA 1QV7A 1GNPA 2XVYA 2I4TA 3E2MA 3I37X 4K6KA 4FB4A 1WX1A 4TS9A 5JVDA 1NN0A 1AQYA 1Y5RA 2B8TA 2DPHA 2XNDD 4LXYA 3OZRA 3HN6A 4JENA 1MA0A 4ARZA 1F8GA 1W7AA 2AEMA 1NZFA 1NURA 2EZTA 3GN1A 3SDZA 4E22A 1HDGO 1XTKA 1D6JA 5FPSA 1ZXBA 2PT6A 3DF9A 5JCZA 4YV2A 1PV4A 1QYWA 4RJLA 4ZOLF 4BX3A 1T3LA 1EFTA 1R16A 2G70A 5M29A 3EIUA 3NJ8A 5EJMA 1IOLA 1PTJC 1NT4A 2PMKA 1T8UA 1E1CB 1KDTA 3GNQA 2G04A 3UBMA 3W77A 4OGWA 3BWDD 1I4WA 1UPBA 3DLBA 2AOUB 3NEAA 3EZGA 1DWPA 4EG3A 5H3HA 4PYKA 5E4YA 1PGOA 3P96A 2BONA 4R8MA 3U2QA 2YHUA 1TJYA 2H17A 4UTRA 4LMRA 1TQ8A 1ZGGA 3ADPA 3BRWA 3N0VA 2JCYA 1P6QA 1T0BA 4MCHA 4M7PA 1XCOA 2OXCA 1Z0JA 1FVXA 4WN9A 3EVCA 4QODA 3VOSA 3I4CA 1ARZA 3ODGA 1P77A 3PGLA 5FPTA 1A8IA 2ZPUA 3KRTA 1GNRA 4JVNA 3O4HA 1XCMA 3GVPA 3J81k 2B69A 4M7WA 4LE1A 2PXHA 1EWVA 1NSTA 1S1CA 1U98A 4X1YA 2FF7A 3HCWA 3M5PA 4C0HA 2AC2A 2JLCA 3IS3A 5G1OA 3WR5A 3TB6A 1DINA 4HDMB 1RBMA 1Q16A 3PFNA 4QGSA 1DV2A 3DOFA 5JR3A 3CN9A 5HIAA 1R6TA 1EP1B 3C3KA 3D31A 4GR4A 2ZB7A 5LYJA 4UHKA 1BS9A 3PVZA 3L1UA 1CQZA 1NRXA 1WMEA 3ORYA 2C9OA 3H2ZA 3ZYZA 1QAMA 4RHTA 4W1RA 3SSOA 1CHDA 4D4GA 3U6BA 1D8AA 4L9RA 3JQCA 3TGWA 4ZWNA 2Y67A 2VPTA 5HTKA 5HUQA 5IT5A 1O95C 3KSDO 3U7FB 2QMYA 1IY1A 3CZMA 2YUIA 2A4MA 4BNDA 4NNJA 4DCTA 1WCXA 3OVMA 4UU0A 1IUOA 5FT9A 3AKCA 2O0MA 2O8EA 1ZQ9A 4IGAA 3UXYA 2GVDC 4HQRA 4C4TA 4KDRA 1O1YA 1USKA 4CEIA 1EWYA 3G79A 3OEED 3IL2A 1PNRA 1NXTA 3AVWA 1UOEA 3EXIA 4ZJZA 1GKUB 1PHPA 2CXTA 2YINC 3ZE7A 4G8CA 3ESAA 2A88A 3U7IA 5FX2A 4J6EA 1OFGA 4NARA 1N0IA 4HSEA 1ONBA 1SC6A 2MSEB 3PPWA 4JCOA 1WU7A 2G63A 4XR4A 2BZSA 2FEKA 1G6OA 2VWPA 4EZIA 1QGED 2FPIB 3VSCA 4DHEA 2ZTVA 5EVJA 4FJ0A 2NSYA 3LC1O 1GRCA 1EFAA 2J7PD 1RWXA 5ITWA 1XLUA 1AXRA 4KO2S 2NUPA 1U0RA 3LWZA 4B75A 4B2YA 5C3MA 5J4VA 2IU0A 2ZR9A 5TRTA 2WICA 4YQEA 1TZ2A 5CHYA 1U2ZA 3U7QA 1W30A 3HCEA 3JWIA 3OIGA 2FQYA 3CB4A 2GZ1A 2F90A 4QTZA 5L40A 2QTVA 2GHQA 3FPAA 5ENVA 5F78A 1H0SA 3WA6A 2HFKA 2PX8A 2TMYA 4RNDB 4WJLA 3TTWA 1C0EA 1DQNA 5B4VA 4A36A 1BXGA 1G7SA 1NA5A 2YRFA 2HPVA 4AF8A 4MWSA 1YQWA 2C9DA 1FUIA 3UB3A 3CLTD 4V3BA 1UXHA 1C1HA 4O8CA 2DXIA 2ZI7A 3LLSA 3W8EA 3GDGA 3ZCXA 3M1LA 2N3ZA 4BBZA 1B14A 4V0KA 2Y93A 5A3RA 4KQKA 1E0JA 1VMIA 4IIUA 5DYGA 5TF4A 2VDQB 3OF3A 4H6XA 5AW7A 1Z7YA 3L0PA 3ZDZB 2Q46A 1KP2A 1G20A 2BR5A 2XMPA 2BM0A 4YV0A 1XRJA 4G0NA 1DXOA 3V8MA 2ZJ1A 5J2UA 1QRRA 2POCA 3PI7A 3VNBA 4Q1AA 1L8XA 1UZLA 5SV2A 1TCVA 3W6NA 4GVPA 3EHDA 3EN0A 2PMCA 3UA3A 5FL3A 5A4DA 2OV1A 3KS9A 4YT8A 3KD2A 1SOVA 4GYJA 4EZEA 4ZRNA 1KY3A 1YZVA 1XXHE 2FUCA 3HCCA 2V7GA 2PH1A 4UKDA 3N76A 1Z5OA 2H9YA 1OAOA 2VDPB 4IMIB 4MQFA 4F21A 4OY3A 3U7JA 4LIPD 3PFIA 2P0EA 4GRAA 4C3UA 1Z0KA 4TT3D 3R4CA 5C1IA 2ZULA 3UC9A 1RLTA 2YS7A 2DPLA 1M5RA 2JVIA 4DY4A 4F93B 1D2CA 3AJEA 3N2NA 1CNEA 1TK9A 3IEKA 4U3JB 1UDAA 4WLFA 4ZGWA 1E2GA 2R79A 3MFQA 4MZDA 4OLFA 4R7TA 5DOVA 2WFLB 4UM7A 5K8JB 3HDHA 3IAS1 4GAEA 3R76A 1YWGO 3BMCB 3WRYA 3OKFA 4Y30A 2GRUA 4Z86A 1MDBA 3JYPA 3LCJA 4D98A 2G9RA 3ZQKA 1I2CA 2I4RA 2QRVA 4I7EA 1DO0A 4M21A 4IH9A 1F2DA 4J0QA 3M8KA 3VXKA 4EX7A 3OQOA 3KTAB 2W6PA 4YUXA 1J9EA 1BMFD 2WUEA 3T4EA 2P78A 3JQRA 3PXCX 3FZNA 5ADWA 3BGOS 3JQ9A 4IV0A 2D59A 3GZTB 3G2MA 5IXYA 3QMPA 2BMWA 2EQ5A 1W5SA 3B5EA 3WE7A 4QXQA 1LDYA 1IXYA 1XU4A 3TMYA 4O2RA 2PWYA 1G16A 2B1IA 3H2SA 3IGFA 3LKDA 3H1EA 1FZTA 4MYTA 4L8FA 3K0CC 1R66A 3VO8A 4Z1MD 4PNEA 2RHJA 1UKZA 2AA3A 2WB4A 3IP1A 2XADA 3ESRA 4DCSA 2Q27A 1QKKA 2WNHA 1NLUA 3N6RA 3ILHA 1PKXA 4FFBA 4NBRA 4RPJA 4IJ5A 1XRSB 5H1YA 3IT3A 5F12A 3A1VA 1CB7A 3FYUA 3GT0A 4IDAA 8ADHA 1CJKC 4JI0B 3B1ZA 1CK4A 4FFOA 2KW5A 2QQEA 4H35A 3RQIA 4PC7A 4AMUA 4BAGA 1S2IA 2O6LA 2QN3A 4H1UA 4F84A 3UK7A 3CVUA 1SD5A 4KMOA 2H7XA 2P27A 2XMBA 3FWZA 4P98A 4WXEA 5DNDA 3VSAA 1N25A 4XTCS 2K5UA 5JSFA 1NRJB 4M0PA 1OH6A 3S2EA 3EW9A 1GARA 1HSOA 4R3NA 1G20B 3VTKA 3WI7A 4B7ZA 5K99A 3MW8A 1BAPA 1EUDB 5EIOA 1JECA 1U8AA 5K0BA 2VQFB 1C3OA 3JPYA 1VA5A 3Q3VA 1X3LA 4QQKA 3G2IA 4F3KA 4CL3A 2GSDA 2EJVA 1XZLA 4F38A 1W36B 2ATEA 4MWDA 1O7JA 1WXQA 1L7EA 1E8DA 1P1HA 4IIEA 1XJ0A 3KLPX 2H1FA 5ESRA 4EI9A 3GG2A 1F8YA 2XYGA 3DLPX 3ISVA 1J09A 2XUGA 3AEQA 3GDHA 3L7OA 4P1ZA 3GT3A 2C84A 1S8OA 1Z7BA 5H9VA 3ZE8A 1R64A 1B0PA 3ESYA 3G13A 2WAYA 3QENA 3TLBA 3T5AA 3I30X 5IK2A 1L8OA 1VJ1A 2D0PB 2JBAA 1YMUA 1YK1A 2YWFA 4U00A 5GV8A 3T94A 4YR7A 4WFKA 2UUCB 2AN1A 1CJSA 2WD7A 1I3CA 3E9EA 2AR7A 1GM5A 2RKOA 4G0UA 3JALA 3A1WA 2FAXA 3HNRA 3ETLA 4P3XA 4PO3X 2XUJA 5SZIA 2WJZB 2Z98A 3LY5A 3UCEA 1AXEA 1U0EA 3D3EA 3DLIA 3H5VA 2HU5A 3R40A 2MJLA 4XYEA 2O7QA 3ZV7A 4KE9A 2RGBA 2WQZA 4MYUA 4BE7B 1F4VA 2A6PA 1QFSA 1RHQA 1U8FO 3C3DA 3PDHA 2BKEA 4IL5A 4KJXA 4PRLA 5K6RA 3WAJA 3ZBUA 1EK1A 4CKXA 1U31A 1OV4A 3TSCA 2G5TA 5DB4A 1P2UA 3QI2A 1LI5A 3KKOA 1ZGZA 4BAZA 1RLJA 4OHRA 5F64A 4IV8A 3I1JA 4OFZA 1Y9DA 2GZMA 3N2YA 5FLEX 1Z0ZA 2C5AA 3AR7A 2VAWA 1T9CA 1KYIA 3AF1A 1GGNA 2M6LA 1OBOA 1BOFA 1N6RA 3I6YA 3RS8A 5CDHA 4L28A 2BGUA 1K5PA 5JROA 4IHKA 2XE4A 5IARA 1CP2A 2GNPA 2WWRA 4ZOLA 3QVWA 3F9CA 4Q4HB 4AS3A 2FDCA 3AFNA 2VPQA 2JIZD 5EINA 3DDNA 2GBLA 3QLTA 5FUYA 1UBEA 2DH6A 1SVKA 3C7AA 1OXTA 2KLBA 3ZBQA 4S05A 4BYMA 1E0SA 2DC1A 3DUFA 3C6XA 5C7OO 1UOQA 4BO5A 4PO9A 4MDFA 1U1DA 3LC0A 1W85B 5HKBA 4JUIA 2K6GA 5DNYB 3QYPA 5FOUA 1QTRA 4D9MA 3KWFA 1U6KA 4XYLA 1XEFA 2H8GA 1XA3A 1E0KA 3QW4B 4BXOB 7MDHA 2IP2A 4KMRA 4D8TA 1RPZA 2CLEB 4R1QA 1D7AA 4UULA 1IB6A 2Q5EA 4MKXA 3VYSB 3OEHA 4FCTA 2FGJA 3G2HA 2HMUA 1SK9A 4OB6A 1KZ4A 3OOEA 5BMOA 4YJGB 2P75A 1XQVA 3ZW9A 2PSSA 2WWYA 4RZHA 4XIIA 1AQUA 2UZ1A 2WTXA 4WFIA 1U8CB 1XZKA 1UEIA 3WJ2A 2RHCA 4Q9DA 4DEYA 1E4VA 3KJNA 1ZZGA 3L1KA 1RIIA 2C5HA 2G7MC 4WZAE 2EW8A 3WNDA 4I3FA 2I91A 1K7EB 3GP3A 1MENA 1M6NA 4TT8A 3FR8A 2IEYA 4RKQA 3REQA 3LLUA 3FPKA 3N0XA 5KYKA 1ODKA 3P2MA 4I5EA 1MC5A 2GZSA 4PG8A 3BD6A 3E82A 3ABIA 2WOOA 4MAMA 1XB2A 2W43A 3OM1A 5CCXA 5F2EA 1EFKA 2XMRA 1VKHA 3OTGA 4V03A 4E5PA 4EHKA 1O57A 3BG5A 4HNHA 5DHQA 1A5AB 2IE8A 3MGBA 4Q3NA 4MV3A 2FMUA 3JALB 1LDBA 5CFRA 3VO9A 1K5HA 3C1TA 3LQKA 5JYCA 2QIOA 3WK8A 5CFOA 1TUEA 2W4IA 1XXLA 4LFAB 1LPAB 1UT6A 2I7TA 4NP6A 5B3AA 3Q8KA 1ZM2A 2RGGA 5IMBA 3IURA 4X20B 4DMLA 1PT7A 1U3WA 1QONA 3SGLA 3Q11A 2EZ4A 1W4RA 3AIIA 3TI9A 1QLWA 1PI3A 3ONNA 2ZIXA 4LJYA 1P4GA 4G4SO 5I7RA 3LDAA 1U4OA 3NC0C 4EJSA 1OAAA 1EIZA 5AESA 4B4UA 2HLNA 3S8YA 4OHXA 1EFCA 2XUDA 3L7MA 1NJFA 4BWFB 4PFKA 4KQ1A 1JYSA 4EABA 4YWHA 2VTVA 1B76A 4OBEA 4TXJA 1JFVA 4NBUA 3SQOA 1YS6A 2Q0HA 3C8DA 3CH5A 4IDGA 5AIAA 2J41A 1VB5A 2YRXA 2ZSUA 4B83A 4COOA 4YMVA 1K7YA 5EHIA 2ICAA 3M3DA 4EJ0A 1IZZA 2WWGA 3BJEA 1CSEE 2AD5A 4A2QA 2ONYA 4XOUA 2VIIA 1VL6A 1UWVA 4JJZA 4ESVA 3MWEB 4MRMA 2VZ8A 4QPZA 3VU3A 5BNTA 5HYVA 2QB5A 1JHXA 4EPXA 4RZQA 1J25A 4HB3A 4LZPA 1UKEA 2IGTA 4PAQA 4XQEA 4F4FA 4QTYA 2W6OA 1AHIA 1Z6TA 5DCYA 4O3FA 1E6CA 2VDWB 3KFLA 3JR3A 2GN6A 3AEXA 3EDMA 3TH5A 5A4FS 2ZS7A 4C5CA 4AMBA 3LYHA 2VOJA 2OOSA 3LHIA 3DD5A 3RDPA 3DLHA 4BNWA 1ZL2A 4BNFA 4LNHA 1DOAA 4XE5A 1DIGA 3D8RA 4K9QA 4EKYA 4ETMA 3ZDDA 2HV8A 1ZU5A 4HY3A 4AMZA 1PGJA 1QRDA 1NP6A 1MQSA 2W2NA 1XDBA 1ZRNA 3WIBA 1E0DA 1FBTA 1Z08A 2NU6A 4R2MA 2WKSA 2A0FA 4RD3A 3HA5A 1V37A 1B8UA 4QC2A 4ZCPA 3W2GA 3WGJA 4G6ZA 1VBFA 3FYSA 2BJHA 2REQA 1P0MA 1ZA2A 2O8BA 5BNZA 2IPAB 4IF4A 2J4CA 2BFDB 2A9JA 2OV6A 4XSGA 7AT1A 3OY2A 3TOVA 1CJMA 2XKJE 5TF0A 3S2ZA 3GD7A 1C81A 3GRFA 4IIJB 1HNXB 2PBFA 4UDNA 5M2QA 3H5AA 2AVDA 1X8JA 4AUKA 2C78A 1HDEA 2OD9A 1UCFA 2ACVA 3HI4A 4B85A 1BYIA 4TLAA 2WABA 4AUNA 1SQFA 1TKAA 4F45A 2H7YA 3VTFA 2B5VA 2YIMA 4HQ6A 5LJLA 4S1NA 1N8KA 3KBOA 2G82A 1NXWA 2Q2OA 3I76A 4DQKA 3AP3A 1J9GA 3ZDYB 3MERA 2BI8A 2Q0SA 4RQTA 2H07A 2JS7A 4PX5A 2NT3A 1EDBA 3A9TA 2QPLA 2XJ4A 4ZKDA 1G38A 2BFOA 2GD2A 5EA2A 5LBTA 3ROMA 1TAUA 1JF8A 3PNBA 1PQ4A 3E1SA 4HAUA 3UMFA 1FSFA 5L45A 3ZGOA 5HXAA 4E46A 1MBZA 1GV1A 3R0XA 1ZWKA 3QHAA 3QPVA 2CL6X 4I4TF 4MWTA 4YYEA 5REQB 4U0KA 1T2EA 1VIYA 1XVIA 3FOCA 4IJWA 5FRDA 4PYIA 3O2SB 3WZ2A 3JQAA 3BXOA 4P5EA 3D2CA 4MPJA 1QKIA 3CEHA 2QVYX 4B33A 2E4XA 3GEIA 4HLNA 4R7GA 5JWOA 2UZ4A 4BQSA 4BCDA 2XCRB 2JJYA 5EXSA 2UVQA 4NU0A 1XVTA 4ZT4A 1ULAA 2BVNA 1RAFA 3QA9A 1ZRHA 1XCGB 2NWQA 3HJFA 1R4MB 1JKFA 1S6YA 2B7BA 1FUEA 1KVRA 1GL6A 1Y9AA 2NSHA 3BWCA 4CE6A 5C5CA 6NULA 2VK4A 3HI6A 3M70A 3PFGA 5FLKA 2JF0A 2NU7A 4LY3A 4O33A 1W0CA 4URVR 1T6YA 2CMKA 1C50A 1KQPA 3EAGA 5ELMA 1N32B 1IQ0A 1JKMA 2DQKA 2ZJ6A 3OEWA 3SBXA 1TC2A 4W7IA 2JKVA 4GMGA 2I7VA 3UICA 5KDOA 2VUUA 3AW8A 3IJRA 3ZHBA 4CMAA 1ZJ5A 3GAFA 1LRJA 3L7LA 1N7HA 5D6OA 4OXQA 4RZUA 4IVPA 4FEGA 4M0EA 4YVFA 7GPBA 1EP9A 2ZWMA 3CRQA 1XZPA 5B3LA 2ZWOA 3CHYA 3H9UA 5C9ZA 1W35A 2BHTA 3PHLA 2ZAYA 4QFDA 4DCOA 2H4XA 3C8UA 4Q4CA 2I1LA 4S1OA 4QO8A 2DOKA 2ZJ4A 4II3A 3KX2A 1ISGA 1JA0A 1ONPA 2W2KB 4WNCA 4W9RA 1GNVA 1P4AA 3EDOA 3I04A 1Y7LA 3K20A 1M0WA 3IRUA 2O8NA 1VFNA 4Y2HA 3T9FA 4MW0A 3C5EA 2GCOB 1GGKA 2V6BA 5L95A 3G1UA 1YFZA 2CLOB 3U9LA 3RVDA 3NI2A 5KNDH 3BCHA 3LYUA 1T4MA 1Z4MA 3DOEA 5DTIA 3SF8A 4MW1A 4C08A 1N5DA 1E1QA 3USCS 4A26A 3R0QA 4PX3A 3GBSA 5AW0A 1H2WA 1TQHA 1N8TA 3MZ0A 2ZSEA 3Q7RA 3HBMA 3QPWA 1KDPA 3GCZA 1QMGA 3QFTA 5TJ9A 4DZZA 4EA9A 1ZVVA 2X13A 4W6QA 3LK6A 2GO1A 2C2WA 4L50A 4PLZA 1L5GB 4BJ6A 3IHLA 4M1SA 1P9NA 1ULSA 2HRQA 3KWMA 1KEEB 4CG3A 2GRJA 3FUUA 5DCUA 4QAQA 3SHOA 3T35A 4MV8A 1YR2A 3IUYA 1E8MA 1GPH1 4N7BA 3OM0A 4TV9A 5JBIA 1Q17A 4WV3A 3HBFA 2KLHA 3CG0A 2J0VA 5TJHA 3V5NA 1E4OA 3E7PA 1GPYA 4FYPA 5JSZB 4CKBA 4DR3B 4IDOA 1NDUA 1RACA 3N9IA 5AXAA 1SRQA 1XOIA 3A3YA 3DAPA 5GGXA 4C4XA 4BNKA 1E61A 4JUBA 4WZZA 1EVZA 5E7IA 4BP3A 5I7SA 2FWAA 5CVUA 2FX3A 5DULA 3MB5A 2XHZA 3I9MA 3IH5A 3YASA 2XRZA 3DYVA 4IIYA 2A1TS 4NTZA 2X76A 1ODCA 4TMYA 3OPQA 4I1SA 3BTOA 3VC1A 3THWB 4MWEA 4DSUA 3O47A 4BC1A 4DLPA 1QGOA 1EX1A 3UF0A 3ND6A 2K2QB 5SZJA 3PEVA 3IIKA 2JI6A 2EBFX 2PEYA 3FCEA 2YFYA 3NUZA 4I4TA 3SZUA 2PGOA 4LAFA 2EOAA 3E9MA 1MJGM 1C2YA 3H6HA 3CLTC 3QG5A 5M04A 3HEAA 1BO6A 2FEWB 1OFIA 1L4MA 1ZNWA 1E9SA 2O2HA 3Q9NA 4TL8A 4Q9KA 3ZIAA 1RQGA 4J2OA 4D8YA 3MCUA 1E9RA 3WXMA 1OZGA 1QTNA 4JZKA 4WNAB 3B6IA 2EYQA 1GZSA 2WYHA 3CX4A 3I5YA 1QZZA 3H3FA 3IUPA 3R3VA 1RYNA 2VCYA 3VDQA 4DMGA 4XM1A 1M7HA 1OTYA 3BZUA 1QYXA 2ZB4A 4QGBA 1PK7A 5F7ZA 4YCJA 3RFUA 3SU8A 4KR0A 2AUTA 2YW2A 3KQWA 4XDHA 4BQEA 5JDCC 4B5KA 1YS2X 3M6UA 4JB3A 1WMAA 4HS9A 2X9VA 4MJXA 3SJUA 1GL7A 2XRYA 3DDOA 2XWSA 3E9ZA 4ZVKA 4X65B 2UYCA 1XMOB 2H9AA 4MEJA 3GR6A 2JH3A 2MSKA 3HSKA 2ZAIA 3VR6D 3L8GA 2FN7A 2QX9A 3VR3D 3UGKA 4B8ZA 1YB2A 5AOBA 4RD2A 1K5DA 2PLNA 2DFNA 1NMZA 4LHSA 1IZ8A 1F0NA 3G0CA 1N1EA 1DX9A 2J0UA 4RMIA 1CIJA 1F6BA 4ETNA 5DNAA 2IHBA 1GPBA 5T67A 2QN6A 2OZKA 3WLTA 2VTKA 5JZSA 1YZFA 1T9HA 3OQIA 4FCCA 4DILA 3S2UA 4UTPA 1GRRA 2R6CA 4GBGA 1NR1A 3BGIA 3M4JA 4JDUA 3P26A 3HM9A 3UJ9A 4OX9B 3PVSA 5AK0A 1RCTE 2Z9CA 2WD9A 3N0TA 2PAAA 2WC1A 3WTBA 4EEXA 3ETEA 1TA4A 3ISTA 5DVZA 1GPAA 3CZ4A 2NO4A 3E7DA 4L6CA 3Q3CA 4PZLA 1KI3A 1Q7GA 2WV7A 1JLHA 1EJ0A 4LZAA 2R1VA 1M34A 2C8KA 2X0IA 3HJTA 4QLAA 3AF2A 2AH5A 3FMFA 1DC5A 3FNBA 3CB2A 5DYIA 1Z47A 4BP1A 2JGAA 2NTEA 3WFIA 1BEUB 5BSHA 3EMKA 2BGJA 3F0TA 4L08A 4NFYA 2BISA 4OMCA 4WE3A 1A95A 1Z75A 2BI4A 2PIAA 1G4UR 1JQ5A 1ILEA 2AD1A 1Q1QA 4AJKA 1OWMA 4ZEMA 1JH9A 2WK1A 4RVHA 2XB2A 2ROQA 4NU6A 2HWUA 5EXPA 1Y1KE 1C3XA 3O3MB 3KYCB 4RPCA 5EGSA 4HWPA 5A3JA 1OLUB 1NIJA 3VTAA 3KOUA 2IFTA 5EUCA 3NAZA 3ZX4A 4QM6A 2RGYA 3GRZA 2M9MA 3DZGA 4J07A 1PYDA 4PLFA 2C92A 4BGEA 1YDWA 2YWHA 3FCAA 3OLQA 3GEEA 3UWDA 1J2JA 1DTSA 3SXPA 1NTOA 4MAAA 2BKLA 1G6Q1 2JATA 3HUEA 1J70A 3QWBA 2OCYC 4K3VA 1CUVA 2YRWA 3LX8A 4P81A 1C4XA 2XLBA 1RNLA 4RZ2A 4ZI7A 5C7IO 4Q9NA 3PQDA 2EBWA 4BLSA 4F4HA 4H31A 1FA9A 4PPGA 3COZA 3ZZ1A 3NV7A 2V7UA 5EKDA 3P0HA 3JWHA 1ST3A 3FTQA 4FZJA 4KVGA 4BNZA 1OGYA 3TD6A 5K0CA 3JWGA 1KY2A 4WZ6A 1H3EA 1L4FA 2GMWA 4UBKA 1AGPA 4LXXA 4LSWA 5CK4A 5DT9A 4RS4A 3RT9A 5A5FA 5CM9C 4ZI5A 1E7RA 3ZXSA 3TFOA 1JEYA 4HZIA 3M5DA 4DJTA 3HMKA 2VH5R 1ZNYA 4BS9A 5KB3A 5LKAA 2NUAB 1WEKA 1J06A 2RHWA 1IUPA 1SM4A 3MIIA 4RFVA 3RHTA 1V1MA 2REBA 1JLKA 5BN5A 1V9SA 3KEMA 1U65A 4JSTA 2FRXA 4KQFA 5F73A 4JI4B 4R84A 1T5IA 3U7RA 3WRYC 4C5AA 4XUCA 4MUEA 5B36A 3E3OA 3Q12A 3UJHA 5AW1A 4OEHA 4OUDB 3IP7A 4ZJPA 3C85A 2VRBA 4CRWB 2OAQ1 1X8KA 2CMGA 2HRCA 1J42A 1MQ9A 2OCKA 5EXXA 5KNBD 3VPGA 5KKCA 1XR3A 4UFPA 4IKPA 5DYTA 1QH9A 3AESA 4HH1A 3CW2A 3B38A 4JMLA 3KJGA 2E4UA 4YPFA 2P5TB 4KOAA 4D41A 3I9LA 1SRRA 1K8XB 1S3GA 2R86A 2P67A 4IYJA 3N3AC 2FZKA 4PHTA 3TSOA 1VGVA 4JOQA 1R18A 2PO5A 5DTJA 2KMLA 4DMKA 3AL3A 4DL9A 3NBKA 3I83A 1CS0B 4IKOA 5CLJA 1C8KA 5JO0A 2F1OA 4YJ3B 2I1WA 4NMWA 3IKTA 4PYRA 3GLFB 4OXYA 2IY7A 1XLVA 2ZRGA 1HZJA 3EH1A 3FSEA 1CXZA 1V39A 2OEPA 2YBDA 4HYYA 5HBGA 2IRWA 4PN7A 1J90A 2KSQA 3LDGA 5AHOA 5FLXA 1KBOA 1PZGA 3VKVA 2C3OA 3H5NA 1KI1A 3FTDA 3O8QB 4K05A 5JRDS 4NBTA 5AFSA 5CH3A 1DL5A 2DTXA 1JKJA 4G8JA 5FF9A 1UPAA 5C4GB 1HG0A 1HZZC 1NF9A 4K6FA 1RMTA 1UQRA 1PJQA 3ZDRA 5KVVA 3T54A 3NNNA 3SF0A 1T9GS 2P5YA 3UPDA 4BTVA 3KHSA 4IRMA 1EBFA 4LVUA 2MCFA 2IIVA 1FDVA 1MRSA 2I8LA 2VA8A 2V6GA 3DBRA 3HXKA 4BZZA 1JKIA 1ZGJA 2OBLA 1RYEA 3L8CA 3QKSA 4O1MA 1JHYA 3A4MA 1SC9A 2OBXA 4MUYA 2JFNA 4V2UA 4E03A 4JLVA 1TQ4A 3DOIA 4IWYA 3V8RA 3B3FA 1YR3A 3ZZ0A 2X9LA 3ZJTA 5A4JA 3PL1A 2QY6A 2V03A 1DKOA 2GXSA 3I0MA 2X8JB 4P31A 3ZGNA 1XZCA 3KR0A 3CX6A 1IBLB 2WSMA 2WDZA 4B5LA 3KETA 3K9BA 4B84A 1VIVA 3O8RA 4I6JA 4UMEA 3VJMA 4BQOA 1C1DB 3EAFA 2F17A 2OQVA 3QWIA 2HADA 1DAOA 4NATA 5EHXA 1TT5A 2J6CA 3GZJA 4B3JA 4CEJA 1ZONA 3SICE 3OY7A 4LECA 5F1YA 1GU1A 4NV3A 1FLDA 1IN5A 4D0SA 1KGDA 4EYSA 2QZPA 3IV9A 3PXEA 3GFBA 4WHMA 4AKHA 4Q4JA 2EFYA 2CLSA 1EEHA 3WL3A 4DV2B 4D6XA 2AKEA 1KI2A 1JBKA 1U9IA 2WWIA 3SLRA 2YXLA 3ROXA 3RSQA 1VECA 2ZIGA 3L0OA 3K5IA 1BH6A 1GGMA 2I2XB 3DBHB 3FVRA 1WZEA 5ALWA 3RU7A 1ICIA 3R5JA 1C14A 2Y1LA 3EZ7A 4QIHA 3LSYA 2FMIA 4QDKA 3ZDQA 5GZ6A 2SHKA 4I66A 4MQEA 4QNNA 3NP7A 4RTJA 2O1EA 1M1XB 3PIIA 4GU5A 5JNUA 1E3WA 2LXNA 1WDMA 4ZT2A 1NLMA 4KFRA 3WZMA 2H1CA 4ESEA 2CSXA 1M5TA 1Y5MA 2AUMA 1WXXA 3OZSA 1YH3A 2YWBA 1CS0A 2OO5A 1XELA 5EAIA 1X6VA 4A8HA 3ZKWB 2XYRA 1PZXA 4O29A 4G1VA 2YMQA 2RK6A 3BHIA 1U2QA 3ZTWA 4EHBA 5ESXA 2EGGA 2P68A 2PD4A 3ZQ6A 4F8JA 1PNQA 2PSEA 2HZBA 5HZMA 3AERA 4DLNA 1RC0A 2UYHA 4KC0A 2PKRA 1EK0A 5IVKA 2ID4A 2Y1OA 5F1KA 2GXAA 3INGA 2VP2A 4O0LA 1KI9A 4ZN6A 2JFYA 1H1LA 1O9HA 5HCNA 3RKRA 4D3FA 3K8YA 1T6BY 3LY9A 4X66B 4MKZA 2B6HA 3DPUA 3EPPA 1Y6FA 1H93A 1RYHA 5EE1A 3SNHA 1A1SA 1LK0A 3FM9A 2ADMA 2J9YB 4UBMA 3FPLA 2GF9A 5EKUA 1GG8A 5JLAA 1UEJA 4WDRA 2R2AA 3VZPA 2HHHB 5JNVA 3EOBI 3PRJA 2O57A 2VJAA 4HZUA 4CTJA 1XHEA 2J85A 3JYOA 4H2DA 2E5FA 3BS4A 1GN9A 5IZCA 3RRZA 1AQLA 4CTOA 3ZHVA 2Z1DA 3RU3A 1LTKA 3ACCA 1A88A 2E6KA 2IDMA 3I1IA 2FZ4A 1NW9B 4OMDA 2F9LA 5B1HA 1PF7E 4XB1A 1OH5A 2P9YA 2GXUA 4TTPA 2WU4A 3GQVA 3AU8A 1QRTA 1YTUA 4PF1A 3K8OE 3TL2A 2ODWA 3RPEA 2XITA 3T3HA 3U13A 4XRRA 1JWLA 1VCIA 4GMXA 3IHKA 1N2CE 1N7GA 3VR6H 3K0CA 1ZYUA 3EZNA 4JVMA 3C7TA 3FTPA 2CNBA 4CLOA 1VMKA 3VX3A 4EY7A 4LYHA 4G01B 2Q1YA 4KLRA 4N01A 4QU8A 4ZYTA 2BBSA 5CYFA 4F3TA 2RHLA 4F12A 4J3NA 1AHHA 2G80A 1ES9A 3RLIA 4F91B 4DCCA 2ZYTX 1WZCA 4UUNA 1Q2UA 2I5PO 1EHCA 2H06A 2PL9A 3DT8A 2HF7A 3E9QA 1E98A 4PZ0A 4LJ8A 1B0ZA 4ZA2A 1V25A 3CZ9A 4R1SA 4N5HX 5ED0A 5C80A 2LDBA 2GJKA 3A4TA 5A3SA 3BMOA 1YJQA 4NCXA 3BD9A 4EVIA 2QN7A 1NJGA 4JXZA 3DTVD 2FZWA 2QW8A 4TWRA 1J33A 2O4UX 2WKQA 3MNFA 1HE3A 1N5MA 1UEXC 2ZCVA 4RXMA 4TMKA 5B53A 4IO0A 3ZCQA 1OWNA 5KSWB 2CXPA 2V7XA 3DR5A 4FHGA 2ENWA 4F4UA 1ZW6A 4MVJI 1R6UA 1X1EA 3B9BA 1RRFA 2QMUA 2NUTA 1Z2NX 1M6WA 2R5WA 3SE0A 1K9SA 3KDSE 2O8DB 4YDSA 1DBPA 2P2SA 3KZ1E 3PLAE 3WHPA 1GHTA 1NN5A 4KO8A 1WMDA 4CMEC 3HKCA 3GQBA 2G09A 3B13B 3N86A 5K6TA 2FLKA 2NZ8A 2Y6UA 2D3TA 2AJCA 4D4HA 4IY1A 1YC2A 5BVHB 1Y6ZA 1W93A 1AKRA 2TECE 4YXWA 1PBTA 4I5GA 4QTTB 3ZKWA 3JYLA 4EUSA 1MAVA 1Z4PX 1EP3B 2J3HA 4CR8A 2Y1XA 2Z2XA 3QV2A 5BSGA 5TVGA 1IAVA 1ZAKA 3CUKA 3H19A 3OZIA 4K2AA 4MS4B 1NW3A 4W7HA 4W5NA 4M6WA 4RGQA 1NONA 3MYRA 5CDFA 3RWOA 1KEPA 3AFIA 2JGMA 2IS2A 3CX8A 4B6SA 2ZVJA 4TWAA 1K6MA 4ZALA 3VR4A 5K0NA 3SXJA 5JAOA 4QDTA 1JJIA 1NVUQ 4OXIA 2NAFA 3N2KA 1ZOPA 3MJVA 4G4JA 4XQ0A 5AVYA 4NZMA 1XAJA 3ZPXA 3IAFA 2ZZMA 3N8IA 3OWOA 3B9RA 3NBYC 1YZKA 2XDAA 3U81A 4ZAYA 1QR2A 3SPXA 1RKUA 3IDFA 1BX3A 1ZICA 4MUBA 5IF9A 3M6WA 4AY5A 5CB4A 5J4YA 3THXA 2ATXA 2JFFA 2GZHA 5E2IA 1R5JA 3WB0A 4TKVB 4A27A 2ZIXB 4NJMB 1WQ1R 2FEMA 4B81A 1IM5A 3ESXA 1KMNA 3DDZX 2C2OA 4OJTA 1FJHA 3FMGA 5A5GA 4K9OA 4OKNA 4OH7A 1I1NA 1LLFA 1ZJYA 4LJRA 3QX3A 3ZOKA 3R9XA 1BFKA 1NWHA 4OHCA 4G09A 4K6GA 3NAGA 5ICSA 1PNTA 4GWKA 2H4HA 3IT0A 3VBEA 4RTOA 4I8DA 3T7KA 2QG4A 1PQYA 1KMCA 3W4KA 2XCUA 4RK0A 2W6ZA 1GTSA 4P86A 1R0WA 4ALLA 1JFFA 4OM7A 5E2AA 2IU3A 1TFUA 1ECCA 3CF6R 5AHRA 1J8VA 5KC8A 1ZKMA 1N9GA 3L7NA 2Q3CA 4EG0A 1BX0A 3R7LA 3C3YA 4R5MA 1C1XA 4W6ZA 5BRNA 2E4AA 1UADA 2RD2A 1OI3A 3PFCA 4IEEA 3AR2A 3F7MA 1WOYA 1XHFA 1XEWY 2G8NA 3WLEA 3GRVA 1V1RB 5EIEA 4DDHA 1DARA 3VR4D 2QGZA 1E2QA 1VKRA 1XU7A 4CM8A 4W5OA 1YL5A 4DM4A 3DFUA 1RE1A 2W6NA 1YZ3A 4MKFA 2FSSA 1JUDA 3W1VA 1Z6XA 3FOAA 3PD1A 3T7EA 3ER9A 4IDQA 2UUBB 3P2EA 3D8BA 3NWEA 4YPVA 4GZLA 4M9SA 4A5OA 4CLHA 3FGPA 1M1YB 4N6OA 3GAZA 2QSJA 5A71A 3PD0A 4IIDA 4ND8A 5BVGA 4UFNA 4R1TA 3KHKA 2PV0A 2A9QA 4N7MA 4WECA 2O1SA 4FLMA 3HBAA 1I51A 3KP1A 5DTQA 1EDOA 2O8BB 1U11A 1DAFA 2PUTA 2BFEA 2PDAA 3GLHA 4LWQA 3TOZA 5IKMA 2I4MA 3LZDA 5E6SB 2G7ZA 1SIWA 1ZH8A 2APJA 2CJXA 2H5LA 2JI4A 4NG5A 3WL8A 4ZCIA 3ZGVA 4BYGA 4CF6A 5C4IA 2DERA 2AEEA 1EVLA 3L7JA 2ERXA 4OHMA 1YACA 3HCAA 3EVNA 5GJWC 4O2BA 3AR8A 5JMPA 4WMLA 5GINE 3FI9A 2VPZA 4MCJA 3G88A 4ETIA 4RTQA 3TKLA 1Z17A 3M7IA 4YP0A 2J46A 3BCUA 3UJ6A 1R0SA 3NHZA 4FHFA 3PQ7A 1XG5A 3UANA 4KB5A 1LBSA 4M8KA 1U3VA 1U99A 1DGQA 2XOXA 3OPXA 2ALJA 2VWGA 2MINB 2X8WA 3BHJA 3R5XA 3AUKA 2FPXA 5EZYA 1DAGA 1WCIB 1ZJZA 2GLTA 4UHHA 1P62B 3IO3A 4ZT7A 2R6AA 1MV8A 1CQJA 1FDUA 2R1ZA 4WINA 2NNWB 1V0JA 4QICA 1V6AA 3A1NA 3CF0A 1N2OA 2X3UA 3GUUA 3U6KA 1V4BA 3QE4A 5CYPA 5KINB 4CEHB 2BKXA 4UC0A 1M54A 2P0YA 4HHEA 4XOIA 3NANA 4Y9RA 3RVOA 4C87A 5KSOA 2P91A 3BORA 4MXDA 5A03A 1OYYA 1V5WA 1LVGA 1XKXA 5DHTA 3T3DA 3HKEB 2G9UA 3L4BC 1BVRA 4ZK6A 5IJ0A 1EFHA 5IAEA 3LRXA 1SCBA 1TZBA 4LEIA 3TG2A 4R9RA 1SG0A 4P6VF 1JAXA 1KO7A 2R9VA 3QGMA 4RABA 4EHJA 4HN2A 1KZHA 1Y4ZA 5ALZA 2NSLA 2YQZA 2C2HA 3E8XA 3EVBA 3OCCA 3P9PA 4O1HA 4N8EA 4B3XA 3RADC 4HKTA 4I1PA 5I7WA 3RHFA 3SBDA 1WKBA 1AC5A 2QW1A 1NW7A 3AMVA 1UFRA 2O2DA 4QWWA 4FYWA 5SYAA 3VHXB 1NOKA 4PSDA 1T15A 2A33A 5AICA 4H1TA 4EB0A 4QBKA 1OWOA 2JIPA 2Z9DA 2ZITA 1DLJA 3EULA 4GEKA 3S1SA 4JR0A 5J2UB 1ZOOA 3AGQA 3GVIA 2J0QA 3BMNB 5G0WA 2KPOA 3W90A 5JALA 1NVVQ 2JB9A 5EKXA 1PK8A 2PGXA 2Y9PB 4CKWB 4CGYA 1ADYA 4YT2A 5GIOE 3F74A 3CLVA 3QFHA 3QSGA 5KI6A 1RRMA 1NUQA 1VL2A 3PICA 5LDGA 3M3HA 4XZ3A 5KAPA 1I1QB 2DBZA 1HH4A 2GPWA 4GD3Q 1SKAA 3V55A 2XW6A 1X9IA 9ABPA 1RZRD 2FR8A 1AQ6A 5C8DA 1G8YA 1UBLS 1QSGA 1XBTA 1US8A 2Q1XA 2ZTMA 3HB7A 3ECSA 3NT5A 4QDJA 4PPQA 4IM7A 1LU9A 3FNRA 4HWGA 4IQ0A 4RV4A 4UCWA 1BFDA 1V8DA 5IAJA 1UXIA 4HGRA 1QK3A 1GD1O 3A58B 2YJ6A 2ZJBA 1DEAA 2QAGB 3EY4A 3O82A 5E1OA 4A6XA 2P5UA 3MGCA 1E7SA 3S2FA 3U09A 1RXYA 4KGXA 4OQLA 3B89A 1USGA 4FDVA 1CKEA 3HP1A 1BEEA 1W88A 1RJDA 3NCTA 4BFLA 3FXAA 5EHZA 3BXZA 4FZ3A 3ZHSA 3ZVRA 4ZDKA 3K0HA 4PCVA 3M2TA 4R69A 5CAEA 3AHDA 1R4NB 4NEGA 1NR7A 1NF8A 3W5IA 4US1R 2H63A 1Z6AA 1CE8B 2B21A 3MWKA 3BFKA 4CMEA 4XWWA 4B3TB 1FS5A 2UUOA 1PEYA 4JL8A 5B5SA 5HR5A 3U0VA 3W05A 3M0EA 2CNDA 4XH9B 3WMRA 1WCV1 2CK3D 2CDNA 3LDFA 4JC4A 4RUKA 3TTVA 4EHDA 1WS6A 3FTFA 5E3JA 3TM4A 2OECA 5GJVC 4LISA 1W2WB 721PA 3FFTA 1N1DA 2VAXA 5FWYA 3LQ2A 4F3NA 2E0IA 3GFPA 1Z16A 3C3WA 1AD2A 5DDIP 2HBQA 2ZE5A 1RLUA 4YO8A 1MFPA 4F4CA 3OZDA 2V4ZA 2CFIA 5E3HA 1ULTA 2IEAA 4YUWA 3T5PA 3AM1A 4C5BA 1NW4A 1FFBA 4MARA 5DN6D 1P9WA 5G3ZA 4UEQA 3KDAA 3NYWA 4MLZA 4NENA 4KNWA 2V0GA 1R15A 5JEEA 5BUQA 5DT2A 5DEIA 2PQ0A 5KZMB 1SUIA 5HQTA 4TYNA 5F9FA 1JLRA 2TMGA 5AJVB 3NHYA 3CWZA 4KBYA 1BGXT 6AT1A 4Z4EA 3QY9A 3HCOA 2QT1A 4ZPJA 1FFGA 1P4SA 4K9KA 4DCNA 2C7PA 2DWCA 4HJRA 3KTOA 4R8LA 4MB2A 1KWGA 4UQPA 2PLWA 1DV1A 4A23A 5BV7A 4DR4B 4TOIA 3CRVA 2REXB 3DMRA 2R8EA 3OEEA 3T9EA 3L07A 2OCIA 3RVSA 1XIVA 3G7UA 2CD7A 3I8XA 4TM8A 3I92A 2HIMA 3KYDB 2V1UA 4DB2A 4EY3A 4XDYA 2YCLA 5DTEA 4NBNA 5FLYA 3RO7A 4AXXA 3NMUF 3LHSA 5E7QA 4ARCA 3SQXA 2W4MA 3L6DA 1ML4A 3F5SA 4HRAA 1EUDA 1JHMA 1DC6A 1SCKA 3A9VA 3RYFB 4R51A 3GEHA 4FGKA 1HUQA 5CBPA 4DADA 4JK3A 3BMNA 1OWPA 3BZWA 4IDPA 2V55B 3V7NA 1O6GA 4BFTA 4KWTA 4TYYA 1ECJA 3CINA 1SBYA 4GXQA 1QM5A 3KSRA 4G4IA 4IIGA 1VI6A 3V8BA 4QJBA 1E63A 2XAUA 1VBMA 1F2TA 3MTAA 5E9AA 3TOXA 2PGLA 3QWFA 3WKBA 5JCPA 3G5AA 4UM9B 4L4YA 5K51A 1Z5ZA 5D3KA 3RV4A 4GZMA 1H85A 4Y9UA 1NU6A 4QELA 1SD2A 2YR0A 3CQ9A 4F04A 4BL5A 4TYQA 1NATA 3LF2A 3HC7A 3WJ7A 1KGSA 2HSWA 2QAGA 3ZJ4A 1OAKA 1TLTA 1NI4A 4FBLA 1BZYA 3SQLA 2YMLA 3OCWA 4TT3A 4URHA 3EEOA 3PE3A 4DARA 4LHXA 3JYHA 1B41A 1ORVA 5CD9A 1K68A 1W0JA 1Y1QA 2Z6VA 2ORYA 3JQBC 2P8SA 4LOIA 2XGMA 4PWYA 4ZC8A 3X1DA 1DKMA 1U7OA 2UYGA 1Z5PA 2DR2A 1KMHA 2ODEA 1RLOA 3D8HA 1BJRE 2G5GX 4Q02A 2AFIB 5DGIA 4LFCB 2VOEA 3R0VA 4HNQA 3ZY6A 2BEVA 4PFJA 3N39C 3ZUPA 5E7JA 2GK7A 4KQGA 5AKIA 5A7FA 3RS9A 2A3NA 5EZSA 3R7AA 3V6MA 1MZPA 2IW3A 1Z2CA 3D43A 1TF5A 2VXYA 2WINI 3L43A 3QI7A 1JXQA 2QRLA 2JIDA 2CLDX 4HLUA 1PQWA 4MMXB 2YV1A 5D5HA 3GFGA 5HBRA 4CI0B 1AO0A 5JANA 3REGA 4X93A 2BW0A 1QCYA 3PZRA 3D6JA 4P22A 2ZSAA 2O4CA 5ITVA 2DUWA 2J67A 3EDYA 1NW5A 1L4GA 1KHTA 3V4ZA 1P8AA 5B3JA 2A7XA 3MM4A 1IJEA 1OI7A 1O97D 3BILA 3QF4A 4RK4A 4HXGA 4J8PA 1Q5PA 1JVNA 2VUHB 1TAQA 4IJKA 4OQYA 4PLVA 3TKYA 5C8XA 5MFZA 1O2DA 1Y3AA 3E8SA 4ATNA 2PZGA 4FUTA 4U6NA 4U8GA 3SBOA 3ROTA 1LBQA 3CO0S 3L93A 3W34A 3AJDA 1BS1A 1VL8A 3O9ZA 4D9EA 4CI9A 2C1EA 4AG3A 4HFJA 1E2IA 3C39A 2H1RA 5CU7A 3SZMA 4CODB 1YE3A 4JJEA 4HBZA 4X91A 3V32A 2ZWVA 2II6A 2ZJAA 1CZOA 3DUFB 5FOSA 2Q3EA 1X0XA 3OOSA 3EDCA 3PSHA 3WMEA 2O7SA 1XLTC 5BMVB 2VF8A 2ZT5A 2CVZA 3FNHA 2W83A 1Z8NA 3BGVA 1O96A 3GRAA 3L8EA 2NVUB 1IPEA 1FP4A 4H08A 5I3ZA 2FW1A 5DP2A 4R2LA 1YZLA 2E21A 1TVKB 2WIJA 2YVQA 1MPTA 4CV0A 2IPLA 3N6VA 4P0PB 3FLEA 2PLFA 2E87A 2CXSA 2XODA 1WHTA 5H4GA 3FWHA 4FZ5A 1SHZA 3IAHA 4H7HA 2YMPA 4AMVA 3FUWA 3O9VA 1YAJA 1BMFA 4JKYA 2UZ1B 2VP0A 4M0UA 3QQPA 4A0FA 5JI3E 4X61A 1AQJA 4Y67A 4MS3B 5DLQC 2GVZC 3L4EA 2KBEA 1LW6E 1YS1X 3WNBA 2W6JD 1SCJA 2VHCA 5ALJA 3TW6A 1U9ZA 4M0LA 4UPDA 2I3BA 3RH0A 3W1EA 3ZU2A 4NIMA 4OI4A