4HMQA

Crystal structure of streptococcus pneumoniae tigr4 piaa in complex with ferrichrome
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
303
structure length
303
Chain Sequence
KIVLDHAFGQTILDKKPERVATIAWGNHDVALALGIVPVGFSKANYGVSADKGVLPWTEEKIKELNGKANLFDDLDGLNFEAISNSKPDVILAGYSGITKEDYDTLSKIAPVAAYKSKPWQTLWRDMIKIDSKALGMEKEGDELIKNTEARISKELEKHPEIKGKIKGKKVLFTMINAADTSKFWIYTSKDPRANYLTDLGLVFPESLKEFESEDSFAKEISAEEANKINDADVIITYGDDKTLEALQKDPLLGKINAIKNGAVAVIPDNTPLAASCTPTPLSINYTIEEYLNLLGNACKNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Streptococcus pneumoniae PiaA and Its Complex with Ferrichrome Reveal Insights into the Substrate Binding and Release of High Affinity Iron Transporters
pubmed doi rcsb
molecule keywords Iron-compound ABC transporter, iron compound-binding protein
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 103
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4hmqA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4hmqA02
2WHYA 4TKUB 3ZTTA 2RG7A 4G09A 2PRSA 4MLZA 2PS0A 1QH8A 3AETA 2O1EA 4K3VA 1M1NB 4LJSA 5BVHB 3K1AA 1N2ZA 5FLYA 1M1YA 3MINB 4OXQA 4WZAB 5CR9A 3AERB 1G20B 2ETVA 4HMOA 5BVGA 2M6LA 4ND8A 3R5TA 3AEUB 4OVKA 4TKVA 2AFHA 2R79A 2XDQA 3U7QA 5AFSA 1KARA 4WESA 4M7OA 4MO9A 3MWFA 3AEQB 2AFIB 4WZBB 1KAEA 5GGXA 4DBLE 1MIOA 2YNMC 1G21A 1L5HB 1K0FA 1M34B 3G9QA 4IRMA 1ESZA 1K75A 3CX3A 4UDOA 1FP4B 3HXPA 4H0FA 3TEFA 2PHZA 2PS3A 3NU1A 4XPIB 1N4AA 3HJTA 3TNYA 4WN9B 5HDQA 3LHSA 1H1LA 4HMPA 1QGUB 4PAGA 2OGWA 4WNAB 4INPA 2MINB 1PQ4A 1K2VN 3MFQA 5CX1A 3ZK8A 3ZK7A 4B8YA 4TKUA 5HX7A 3AESA 3BE6A 4NNPA 1N4DA 3MD9A 3UJPA 2YNMD 1M1NA 1M1YB 2OSVA 4GICA 4INOA 5BVHA 5KOJA 3HH8A 3PSHA 1N2CB 3PDIB 4WZAA 2Q8PA 1QH1B 4ND8B 2XUZA 3LI2A 5M3BA 3ZKAA 5M29A 4TKVB 2AFHB 3AEKB 2XDQB 3EIWA 3GI1A 4WESB 4H59A 2XQVA 3EIXA 1XVLA 4FKMA 5KOHA 2AFIA 4HN9A 2Q8QA 1G21B 4FILA 4MDYA 2XY4A 1KAHA 4UTPA 3BE5A 1M34A 4NNOA 1TOAA 1QH8B 3AETB 1FP4A 4UDNA 2M6KA 4FNAA 1H1LB 3K1AB 4FI3F 4LS3A 2XH8A 5B58T 4WN9A 5CX1B 5M34A 1QGUA 3MINA 4WNAA 3R5SA 2MINA 2OV1A 2WI8A 4UTOA 5JJ5A 3AESB 3AERA 4N01A 5BVGB 4CL2A 1G20A 1PSZA 3U7QB 5M2QA 2X4LA 4G07A 3AEUA 5KOJB 2OV3A 5JPDA 3AEQA 1N2CA 4HMQA 3PSAA 4BBPA 1MIOB 3PDIA 4WZBA 1K7SN 1EFDN 1QH1A 2R7AA 1L5HA 3ZK9A 3AEKA 4OXRA 5I4KA 2QI9F 5JOQA 5JG7A 5KOHB 3MWGA 4MX8A 4XPIA 4PM4A 3TLKA 2PS9A 5GGYA 5KHLB 2XV1A
chains in the Genus database with same CATH superfamily
1X42A 1UFQA 2OC4A 4RHYA 5CFQA 5JSZB 1M6NA 1E5XA 1YC2A 2C8LA 3AV3A 3D43A 3LC0A 4OHOA 4P3YA 1VCMA 5DK6A 1OZAA 3DYVA 1VP3A 1K3FA 1TF2A 2ZJOA 1Z0KA 4ILEA 3AILA 5IMSA 1RJ9B 2ID4A 1L1FA 1KTVA 3CM0A 1HLFA 2ZG6A 6ADHA 1R5JA 4K9DA 1E3WB 3HEMA 2HXYA 4D9BA 3X43A 3ORYA 1DZIA 1KHTA 4F21A 4F5EA 5FFMA 3HN7A 3NGXA 1P0CA 3QFRA 1R10A 1U2GA 2ZT6A 3BZWA 4CTNA 3HCAA 2ATCA 1F7UA 4P98A 4W99A 1N5IA 2MU1A 1SXJC 2QZJA 3MJFA 1US8B 3EW9A 4OIFA 5KX5A 1JH8A 2CVFA 1L5YA 2HC9A 3TVDA 4ACAA 1BE8A 3A6DA 2YVQA 3RRYA 2TYSB 1J70A 2IE0A 1TVCA 2FPIA 4XJTA 4DJTA 4I66A 1VBMA 1TPYA 5KTSA 3W8NA 2BI4A 4JY7A 2Z2IA 1E2DA 2HIGA 5TJ9A 2PKYX 2CDRA 2A5FA 4UBLA 2JPDA 2X5OA 4DR6B 1SBZA 3A1TA 3W5BA 4EVQA 2RC5A 1AKUA 1M2VB 3JVIA 3BFJA 3SHOA 2WMYA 1GZDA 3ESCA 3PYXA 1UKAA 2K87A 2FG7C 4DAEA 3C7AA 1NVUQ 1UP6A 2HDNB 4C06A 2ISSD 3LUGA 1DIHA 4IFEA 2ZS9A 4U7WA 2GN0A 5GZ1A 3D1VA 2F7SA 2GEUA 4GUDA 4QYTA 5K0GA 3HN2A 3EVFA 2X2OA 4ZEWA 4BO2A 1O8CA 4S1PA 3JXEA 4CHTA 4B6RA 3M6AA 4CKXA 3TZEA 1SKBA 3GW8A 4GI7A 5HCNA 4QEDA 5ERYA 3TR0A 4F06A 5JCPA 2H65A 3DUWA 1IHOA 2R86A 3PJEA 4MROA 5GJVC 3LGAA 1J09A 3PUHA 1G63A 1NHGA 1LTHR 2ID8A 3MD0A 5DWVA 5BWMA 3KE8A 4R2KA 1SKMA 1ZK3A 5DTQA 4CG0A 3Q2KA 2HFKA 2H00A 5BQOA 1KVRA 4WOBA 2AXEA 3PPVA 4TRMA 4YCJA 7AT1A 1KOJA 2Z9CA 3SAJA 3T7KA 3A11A 4LMRA 5TDHA 2BGRA 3FCOA 4BAGA 2WICA 4QRHA 4DL9A 1YC5A 2W98A 5AKHA 5ES4B 2CF5A 1HDGO 3WLRA 1Z35A 2VRCD 4YS6A 2MSLA 4YRIA 1PTJC 3WFIA 3PITA 1KDPA 2Q2OA 4KU4A 2MDTA 2QUHA 2VOJA 4UQLA 1D9XA 3MQ4A 3SHQA 1NT2A 1VMIA 3V8EA 1KWGA 2AIRA 5KWJA 1AZWA 3LIIA 1O94A 3G0IA 2UVDA 1AOXA 4DEVA 3H2ZA 2QMQA 1Z6ZA 1FDTA 4NONA 2BEUA 3T7RA 1WU8A 1MJGM 1Z2OX 4A0FA 1P4HA 1RKQA 4F6RB 3AP3A 5FKJA 3V1MA 2Q5IA 4IIVA 1QO0A 1SQ0A 2DQKA 4MQFA 5AJHA 521PA 3W7BA 2CXUA 2IHKA 4FKZA 4BQFA 4KXQA 4DLRA 1CVLA 4C4PA 1OXSC 4MV1A 2HCJB 1G2PA 1GKIA 2JLUA 2M2IA 2FPUA 3FSEA 3PQ2A 2O5CA 5KINB 1RJEA 4J0EA 4Y2TA 2ZQYA 3ESAA 5BV7A 2Q9AA 1CC1S 2UV8A 1BHQ1 3EEOA 3SVTA 3R3XA 1XROA 1UWKA 1WE2A 2GKSA 5HOQA 2XYHA 3K6JA 2IPMA 2O1WA 2Y0CA 2GRAA 1YZKA 4HRXA 5DHRA 3R9IA 2QYHA 1U8XX 3R9KA 3LOUA 3WGVA 4AB1A 3MAGA 1Z4QA 4BRUA 4XX0A 5TC4A 3U4HA 3PTAA 3WE7A 4OI4A 2RGYA 3V8MA 1VJGA 4IIGA 4LGCA 5DNEA 1HNZB 1XCPA 4OHWA 5JZ9A 1UXJA 3AQ4A 4TMYA 2BIFA 4TS3A 1P9OA 5FH9A 1VRVA 2P9EA 2V6BA 2OCXA 1W4AA 3B2EA 3KQVA 4YRBA 3QHQA 2G28A 1PQPA 3QM1A 1DJNA 1VIVA 2MWMA 2E37A 3H5RA 1RM3A 5F35A 4E1BA 1G64A 4HCJA 1KYWA 2H1CA 3DHNA 3P9XA 1OWPA 2A0YA 1YDMA 4NZYA 4XLZA 2PK3A 5LYYA 1HOXA 4WI1A 4JBIA 4B3XA 4Q1AA 2FHSA 2ET6A 1SRQA 2HI0A 3QU9A 2QSZA 3IR5A 3U4IA 3VR2D 1TAUA 3DBRB 1NWCA 5FTJA 1VCIA 1T36A 1WXHA 3N7UA 3TW4A 2HF2A 1DP4A 3IUBA 5IAGA 3S2EA 3EGDB 4Q4JB 1XDWA 3A31A 3JRNA 2FZ4A 3L7BA 4LNHA 5E2BA 3AM3A 4MDYA 4MQ6A 2ZI5A 3B8HA 4JXJA 2YWEA 4AZWA 1Z4NA 3VBCA 3QVOA 3ZKWB 4CKBA 4DDUA 4F91B 1WW3A 3OCZA 4OHFA 4XA8A 5K20A 3U1BA 4N0PA 3I61A 4J0JA 2P2YA 3TKYA 1ZUIA 5IEBA 1W94A 4Q34A 4EMTA 3WNZA 1KAOA 2RH8A 4JA0A 5B58T 2VTBA 1DINA 5TPZD 2X22A 4NBWA 1C9DB 2FZWA 3DE6X 2BHNA 3MUNA 4ZYWA 5IUNC 4BJ1A 3PNVA 5LQNA 1BXGB 2J6BA 4W5HA 3UTDA 5I7SA 2RDMA 1FS5A 1J8YF 3ABIA 1YJQA 4RAQA 4TWJA 3CIOA 3UK1A 3WWYA 3D8UA 2WPDA 2AE1A 1QTNA 2PG3A 4YMVA 1FU8A 2DFPA 3IB3A 4GPTA 4XM2A 2QAIA 3U44A 1N33B 4NE7A 1JB9A 5LA6A 1C29B 3QJYA 4DLLA 1RQGA 1LRLA 1RXWA 2WEKA 1IXRC 5BT8A 2NPIA 4HO1X 2R7AA 1Z26A 4I50B 4QULA 2MOKA 4QJ5A 4JJFA 1XRQA 4XSGA 2NSYA 2W2TA 2FPRA 1V8BA 4HOYA 4PNZA 5KOHB 4KR0A 4B5LA 4DT1B 5JXIA 5MHTA 2X8BA 4W7SA 3VISA 4LHZA 1NFQA 3NHBA 2JDIA 3QKRB 5GGYA 5JEEA 1ILEA 3F73A 4YXWD 1FXWA 5DWDA 4BNIA 2GFIA 4U8GA 3RFXA 1RKBA 2W6ZA 2PXHA 2OD2A 3V4RA 3HXMA 2ZI6A 3O3CA 4NMMA 4MQLA 4Z4FA 1R0RE 2FVYA 1ODJA 1IE3A 4L5YA 2DC1A 3DZHA 1DXOA 3BMXA 5FI5A 3WBFA 3BGSA 4R1OA 1SULA 3N1UA 1W46A 4IH1A 2H17A 3L4JA 1U4OA 2WM2A 5JLJA 2JAQA 1I4EB 1M2WA 3A9UA 4LXQA 3OM8A 4XB1A 1Q2XA 2JHGA 4O4JB 4J75A 1SUSA 4MA4A 4BE4A 1XPRA 1NR5A 1TGYA 1TJNA 3JYOA 2GRUA 1Y9JA 4HVLA 3SS8A 4C6HA 5AVYA 1SUEA 3TGPA 4P34A 2BTOA 4A6EA 5D3MA 1EJ2A 2JIZA 3C45A 1ZOPA 4GBGA 1R9GA 1O96B 4UULA 3PX7A 2GLXA 4CIVA 4C4XA 4I4TB 5B4UA 3B5IA 3LLCA 1DX6A 2ODEA 1KI1A 1E7WA 4P6VF 4WRRA 5AK5A 4MR7B 3ORHA 2HCFA 1JFVA 3FMGA 3MLBA 3PGLA 3C4JA 3V7WA 1VPVA 5GM1A 3KUDA 5H59A 4AP5A 3OIYA 5HBGA 2O19A 1C7QA 2C4UA 1Y7HA 2C4WA 3AUAA 1JXMA 1JAHA 1D6MA 1QTIA 4HZGA 3AL0C 4QZVA 3E53A 3NORA 5LLSA 4QQFA 1U8AA 5JQWA 1N5DA 1MUUA 4WEQA 2XI4A 4EA6A 2O5RA 5FNVF 1RC8A 5BR4A 2ZIZA 3G5LA 3W4JA 3AH8A 1ONPA 3JQEA 2IYYA 2ZRDA 2O5EA 4ABYA 1RC0A 1WMEA 4MI1A 4Y6GB 4EF4A 3GFSA 2RK6A 3NHLA 4GRDA 4ZAYA 4CJXA 4GKKB 3AUKA 1KERA 4F2PA 1WZ2A 2ZZMA 3TG8A 1LF0A 1G8MA 1P8JA 3QFFA 3HCRA 5KWIA 1FSSA 2FSIA 5BNFA 3VHXB 2GI4A 1PIWA 1XTJA 3FFWA 3ZLJA 1PW5A 4ZI7A 5A0TA 5L45A 5TQVA 1MJNA 2XR1A 2Z56A 1JR3D 3HUEA 2X5XA 5ECDA 4O4HF 5EC8A 5J47A 5FL3A 1Z56C 4W8HA 3UB4A 1OFUX 2R8XA 2VA8A 2OCDA 4LTNA 1QU3A 3L04A 4V03A 1CK4A 1Y6QA 1WD5A 4PBSA 1HLPA 2G25A 2Z57A 3LCCA 3TSWA 4B71A 1MU0A 3SVZA 2HJVA 1NF9A 3ZCRA 4B3RB 2A0UA 4YRKA 5JY1A 1SVOA 5EEHA 2J9RA 3GLQA 4NK4A 2J3DA 4DA7A 2VIIA 2EHJA 3IAM1 3GU3A 1BHJA 2WQZA 3QKUA 2A9FA 4ESVA 3S5JA 1K5HA 3ZHTA 3ENVA 1W34A 2IXFA 1NNI1 4ND1A 3OPVA 4E09A 1CUWA 3TTVA 3WYAA 4D26A 4GZMA 1OR8A 4D7AA 3PTZA 1W25A 5D6OA 3RRJA 3CX6A 2OXTA 2B8WA 2B3TA 2WDZA 1OTXA 3SJZA 1Y42X 3SYNA 1W5FA 3RU2A 1QQBA 2FPLA 4U6NA 1C9JA 4HJXA 1FL9A 2FP4A 1YSCA 5AI5A 5JFGA 2QG6A 1G5QA 1PS8A 2WU4A 3VR6A 2H4YA 1G3IA 3KIPA 3QGMA 3K1TA 3D7MA 4ND8A 3LBAA 3NHAA 5A6SA 2WB2A 3AT1A 1YZ3A 9LDBA 5PGMA 3A28A 3MMZA 3RVSA 3WIBA 5JH7A 2MJLA 1FTGA 4L28A 3EZNA 2Y1DA 5ICMA 5JAPA 3HUDA 4XWYA 1FNMA 4AJ4A 4DJJA 4IOKA 4JT8A 4UU7A 3ZEAA 3EWIA 1XF9A 3K9WA 2WF6A 4M7RA 4M9QA 4AMZA 4D3FA 5J23A 3I8OA 1C4WA 3VI4B 3CQ9A 3D7RA 2ZSBA 1CYDA 4ZZ3A 5T4FA 3RIEA 2JD0A 3I6IA 3IALA 2E4VA 5A9RA 5ICEA 1SVLA 1SXIA 3GLRA 5GV8A 5LU8A 2IH2A 3ASUA 3ESQA 5CURA 2JLAA 4WSOA 2H5JA 4C20A 5FP0A 2WAXA 4MH0R 1KR5A 1SUDA 4B8YA 2SKDA 2C1XA 5NLLA 1ZRMA 5JNWA 1OH8A 3L05A 1D2NA 2EXXA 2HPAA 2VDLB 3GAAA 2GAAA 2PKQO 3QBJA 4OXNA 4P54A 3U81A 4YJ3A 4LECA 2R85A 3TFQA 5CB0A 5JDCA 1WBBA 2C3MA 2YBEA 4FT4A 3QA9A 3E27A 1W75A 5A2GA 3I53A 4KRYA 2XNSA 2EFEB 3SMVA 3G0CA 4LC1A 3K0FA 4Q12A 5T4HA 3RUIA 2RI1A 5ALQA 5FHRA 4JODA 1G8PA 4FOLA 4HLUA 3DAOA 1BXKA 1BH2A 1V7PC 2O8BA 1YBVA 1WDWB 3G88A 1UKEA 3HQ4O 5AM0A 4PSKA 3REQB 2Y67A 5F7XA 4F12A 3OQNA 3UGTA 1GL6A 1MRNA 3ZHOA 1KO5A 4LQCA 1A9QA 2PMKA 4AKIA 2BTQA 1WXDA 3FPSA 3HO6A 4J16A 1INLA 5J2UB 1Q7TA 4J2HA 2EKPA 5AWFC 1RWQA 4NNOA 2WF9A 4N18A 1GUBA 1KI8A 1J1UA 3ZIUA 4BO7A 2NP6A 2WJVA 4JX8A 1FFWA 3PJFA 1ZCAA 1BDMA 1MG0A 1QG6A 5DH9A 2QJTA 4AJ1A 2Q2NA 2YW2A 4US0R 5F5NA 2RFLA 1P73A 3MWKA 4GKJB 1P4RA 1ONOA 1WOMA 5ALOA 3ACBA 4J3NA 3U7QB 2COUA 5AJXA 2VHEA 1FUYB 1NYTA 3EUEA 3GR6A 3ILXA 4FNGA 3AEUA 1I3LA 2FWIA 3IDOA 1VLMA 1N8NA 1T5TA 1UK6A 3P9NA 4I7EA 3MTGA 1ZJ6A 1RPNA 4MUHA 3TEMA 1L5OA 1M2FA 5H82A 5BO5A 3EAQA 1NNEA 1QJCA 2FRDC 3LO8A 1K89A 2PKQP 4PZYA 3WQSB 1M2KA 2RARA 4WAUA 4EB6B 3QWIA 1PJ4A 3CF0A 4JKOA 4YP1A 3KQOA 1JEOA 1P5JA 4MAAA 1E5LA 2O1XA 2GM3A 1KBOA 1RS0A 2CYBA 2NIPA 3OY2A 4RW0A 1KZ6A 2ZS8A 4MV8A 1NBWB 1EGVB 2R4UA 4WZZA 1OFVA 2B4TO 2QUKA 2BC9A 5I9IA 3OOWA 2JIRA 4BRWA 4ZV7A 1DU4A 4MIOA 2BBTA 3O4RA 1AKYA 3GBPA 3UUFA 2W93A 1G5RA 1V5FA 3WHKA 2ZE7A 3LBHA 1CHNA 4ZT6A 2VJKA 4E4YA 2QX8A 4EGQA 2AJBA 4OXQA 2BGUA 3U7JA 5AT1A 3E2PA 4D79A 1V96A 1FVXA 4YDQA 1RI3A 5AKIA 2W90A 2XXAA 4N6OA 4HMOA 3TLAA 5BVGA 2WIBA 3ENKA 1J0CA 1HETA 1D4AA 4TN5A 2WMOB 3K1JA 3K9HA 1YRAA 4HLDA 5FLXA 1XTUA 4HNUA 5CA0B 1VIMA 4WZBB 4Q1EA 1LBHA 5DN6A 3CRW1 3AUXA 4NEGA 1R8QA 2DJIA 1TGVA 2HEGA 1GG8A 1ORRA 2GB4A 3AJDA 1P4AA 2IW3A 2WRZA 3LP6A 3N53A 3D5QA 3RSOA 1XQVA 4NZOA 2BP7A 1AKWA 1OWOA 2B9EA 3JSXA 4MVJF 3ZOZA 4DR4B 4Y2GA 1JG4A 5I7WA 4UHFA 1T4BA 1CZLA 2X86A 3CUEF 1QGUB 1ZJJA 3N05A 3Q0EA 1AGYA 2ZB3A 3N28A 3ZK8A 3T5AA 5TQ0B 1QYIA 3K31A 4KQHA 5CHEA 1BXRB 4TTJA 5EQDA 3I2YX 4MR9B 5FUWA 4TKLA 1PFWA 2HIMA 4RL6A 2PX0A 3TOVA 2GA9A 4PZZA 4IMJB 4LOIA 1PR0A 4Y6SA 5JLAA 3A4YA 1M5UA 1NI4B 1DUIA 4RH3A 3FCCA 2NU8A 1VLJA 2FMKA 3UG6A 1FFSA 4YMTA 2C2WA 3T5PA 3QPBA 2BJHA 1G60A 1IUPA 4AN0A 2ILVA 1MC4A 2CUNA 1E96A 1NL3A 4BKPA 5UKDA 3SQMA 2OLEA 2XHEA 3WLIA 2QK4A 3DNMA 1XZJA 2PD3A 1BDBA 1E69A 3PU6A 3GZNB 4L74A 4W5QA 2XGJA 1DAOA 4U7JA 3ZVMA 5BP7A 2Q4EA 2FGJA 1TMOA 3HU5A 1YIAA 5IVPA 3NIWA 1QP0A 1VLQA 2JI8A 3M6UA 3HNRA 1JV2B 4AT1A 4HUQA 5FTKA 5I9MA 2C7QA 1NJFA 3ZWWA 1W85B 3CIFA 3KLNA 1GUZA 2R9VA 3QVVA 1ZBDA 3VC7A 2MYUA 8ABPA 3TYXA 1FTYA 3VAYA 1H1DA 1XAJA 3HBAA 3IA7A 4WL0A 1WXFA 4JR1A 3S7ZA 1CB7A 1KI4A 3SBDA 4I9FA 5LL6P 4MV6A 3K1YA 4MVJM 2QRUA 4N12A 4UPDA 5KVQA 3SXJA 1MO3A 3PL1A 3Q6NA 3WBBA 2BSQA 3AFNA 4HR7A 1XA3A 3FPJA 4ZO4A 3FSRA 3OI7A 3X1ZA 4BBAA 3W2FA 1W8DA 1MHPA 3ONVA 4MWEA 4JJZA 4BBPA 4F3YA 5C18A 1YQ9A 2HHLA 3WIVA 3T15A 2OGUA 2FXIA 3GH3A 5JSYA 5C1IA 2NLOA 3AW8A 3OQOA 4KXWA 1KDZA 3RKRA 4HN2A 5I4KA 3DR5A 3EGOA 3LLUA 1TKBA 3MJVA 4NV0A 1U9IA 3HCPA 3W1EA 3H05A 1MOZA 3MAAC 5J4KA 1XHFA 2JVIA 3NFRA 2F17A 2QZPA 2Y66A 1YHYA 3FOBA 2ORIA 1XZMA 4BFVA 3KTAA 4IQ0A 5AM1A 5TPWB 4MLZA 5DBIA 2AOVA 2B0JA 5EE9A 5H3CA 3ROQA 1C3OA 4GVLA 3RYIA 4MW2A 1Z6YA 4KXLA 4AL4A 5H4GA 2G0NA 4AQYB 2AW3A 5IP5A 1PJQA 3H5WA 1OLSB 3L8YA 3A27A 1UBCA 3RS2A 1EH5A 3C3AA 3N8NA 4IWYA 1SCKA 2JLRA 2F9LA 2LVBA 5BMVB 4PCUA 4ZOCA 3VSCA 2OENG 2HK6A 1PP4A 1DG1G 2HBYA 3SJAA 4GP7A 3RYFB 2I87A 1JQDA 1QX3A 3CH6A 2J3HA 2I4NA 4JFRA 3UICA 4ZCIA 4D9HA 4QYWA 5LQJA 2OVBA 5IDVA 1U31A 4YRGA 3B89A 1X39A 3E48A 5C80A 5JCOC 2YIVX 5JAMA 1EE9A 4X1YA 2JCSA 3SX0A 4KIWA 4D6XA 3FPLA 1QPZA 2MTBA 5FBRB 3QU5A 4G86A 4NH0A 1Z6TA 4AWAA 4G0MA 4C2BA 1L8QA 2QM7A 4HWKA 4NG4A 4UVHA 3HJHA 3ZD7A 1AQLA 1L5HA 1XN4A 4GZLA 1A5BB 3RUFA 2WYHA 1S2DA 1NJSA 1Q83A 4PYQA 5F33A 2I7TA 1TFUA 2DJ5A 2B94A 1V2GA 3QNMA 2XWBF 2AN5A 4YP0A 2Q99A 4E1VA 4X8MA 2QTFA 2Y6VA 4PIVA 4RD3A 4PG7A 1POWA 4V2UA 2W6QA 4BO0A 5BW5A 4RV5A 2WHXA 3PUXA 1RE0A 1KI3A 3S4YA 4GO1A 3U7FB 2YNMD 3CPSA 3BMCB 1IAQA 4DXDA 5BVHA 5BY2A 5T41A 2DTEA 1YNOA 2YZKA 4MUMA 3HSYA 1BFUA 3JALB 4YFVA 3ZGYA 3NKFA 3O26A 1HT2E 1RIFA 2H07A 2IT1A 4WDRA 2HA3A 4EM6A 1SJ9A 1T4DA 5CA1B 1VFNA 1Z63A 2I9KA 1VJRA 2QRZA 1JAXA 2QZ9A 2VSXA 5EXXA 1DAHA 3JQ7B 2QGNA 2Y1WA 4E2YA 3DFFA 3ZD8A 4DA6A 1D8TA 1XTSA 4G4IA 3UUEA 4M76B 4ND3A 4CM9A 1ABBA 1T0BA 3AHGA 1Y81A 4KTVE 3JAWB 2JJ8A 1M34A 3RBVA 2D5LA 4DQDA 3EGCA 2OQRA 2VAPA 2GLTA 1QHXA 3DFIA 1GZ3A 3HKEB 3IEXA 3KJQA 3O8CA 4LF8B 4ZP1A 3L7IA 1OY1A 2ETXA 4M0LA 4BL5A 3MTBA 4HXGA 3CNLA 5KNCA 5CEFA 1R8YA 5KQSA 4RTRA 1I6MA 3UUGA 3UATA 1M7BA 2A14A 1IY2A 2VDQB 4K6CA 2HBRA 1R3DA 4DA9A 3LK6A 4FBLA 4R98A 1K6JA 4MULA 1S0UA 4PX9A 3WK7A 5D1HA 1W19A 2OFXA 1XA0A 1OVGA 2R68A 2R8YA 2VYFA 1K7FB 4HX2A 1EHCA 4KO4S 5FPSA 5G0SA 2V4UA 2R1TB 3ZY4A 5JMWA 4ZQGA 4GVXA 1VKNA 2UXDB 4YDSA 1BCSA 1YR9A 3JQ6A 3KQYA 4OHVA 3KT3A 3CRVA 3RBXA 3QZUA 1C3VA 1N0IA 5HIIA 5B64A 3WGIA 1HNWB 1JG2A 1IB0A 2HXSA 4IV5A 4X20A 3PNSA 2QDXA 1J22A 2Q4OA 4KIGA 3DDWA 4MQ4A 2Q7DA 2ATXA 4F3RA 3MEQA 2CCKA 3GRRA 4FFPA 1R6AA 1ZGCA 2G70A 4QU0A 4ZVLA 1RQLA 2QSJA 1PX0A 1ZIXA 3FKSD 1SBHA 2IY9A 2IXTA 3QLUC 1HE1C 4CM5A 1G18A 1KVSA 1FUIA 5HQJA 1YA6A 3H1PA 3KBOA 1LC0A 2AZTA 2Q3BA 1FSGA 3VR0A 1N1MA 3IUPA 2YZGA 4B3TB 3EBPA 3LH5A 4BTEA 4D42A 2XRMA 4A0RA 4OHYA 4RA6A 1KARA 1SIOA 2PWPA 3GVCA 3LQQA 2V9ZA 3ZTWA 1IQ0A 4UZFA 2J31A 2DR3A 3FFTA 4M7PA 1CKEA 3QWFA 1OX4A 3CZMA 3HYCA 5H9VA 2GN6A 4X84A 5KQMA 2UYHA 3LBYA 2NU9A 3MJ4A 4COOA 2PZ8A 3CF2A 1BHO1 3L82B 3WDLA 1UDAA 2HU8A 3ZLBA 5KJFA 4RTJA 4D25A 4I50F 5HCUA 2ZJBA 5IBRA 4EYGA 4ZICA 1TCBA 4CIBA 4O4IB 1QRAA 2WUEA 3H7AA 1OHHD 2EGHA 2Q4RA 3B48A 4IEIA 2VH1A 1T0UA 1W73A 2VJPA 3N86A 1L5RA 1MH1A 1XRRA 3DOIA 1EX7A 2JFXA 1IHXA 3ECCA 1MJHA 1Q3KA 4U2CA 1XJ0A 1AT1A 1A9YA 5JS8A 3U40A 2BFDB 4G4GA 4L07A 5DGCA 4Q1VA 4G4JA 4BNLA 3AOEA 3I39X 2QN1A 4LKOA 4OG2A 5EMJA 3NANA 1KYXA 5T57A 4M1WA 1SBCA 4FZ5A 4LF9B 3K94A 4YO7A 2R7NA 3WO1A 1BROA 3BX1A 4OK5A 1E1LA 4ZDJA 4LY9A 1Y8ZA 4RULA 1OWMA 2C00A 3I6MA 2AF3C 4R9NA 4TKVB 1MJ5A 2GESA 3ETEA 1YJ8A 4RD6A 4B83A 4BQEA 2H57A 2ESRA 2J67A 5G40A 3KYBA 4NENA 1A5ZA 3WWOA 3R0XA 3PI6A 4XOIA 4PZDA 1U3WA 3STXA 4L4UA 4QT4A 3SZMA 4EHJA 1QYDA 2GXAA 1I8TA 1GV0A 1PEYA 2ZJ5A 2GLUA 4FCVA 1L1QA 1AH2A 2C0CA 2J41A 2R7LA 4XGQA 3BTSA 1QHGA 2VJLA 1G7SA 4B74A 3DE4X 4MR8A 4OL9A 1Y5MA 2EFGA 1YZVA 1KIMA 2PX2A 2NYVA 4NCJA 4BZPA 4I4TF 3ONWA 1UUFA 1SVKA 4FOTA 1NUHA 1ENZA 1WHTA 1XDDA 2J48A 4GMHA 3EVNA 2FPGB 1J8VA 2WI8A 4DMKA 2IYLD 3AESB 3UGQA 3V8NA 3AHIA 4CLRA 3MWJA 2JBAB 3LY7A 2BGWA 3H6KA 3K0AA 4MYSA 1XMSA 4PX2A 2R8ZA 3M6FA 2IEIA 3EMVA 2VTDA 2BH9A 4FFRA 1NBHA 1EXMA 4IOLA 1E89A 3COZA 2B83A 4NS1A 4RL4A 4LJRA 1UCFA 1GITA 1UBGA 1EXNA 5CEEA 2GASA 2ZE6A 5JNVA 2I3AA 1KDTA 1BHSA 1WIWA 2OD7A 1VJ1A 2QTGA 2NO9A 2P4EA 3DAPA 2EDAA 5D3QA 2FF5A 3IQGX 1FJGB 1WXXA 2V54A 3R44A 4M8LA 3S99A 4BEJA 3MWGA 4H77A 4U2GA 4C3OB 2X0IA 1GTRA 4J3JA 2ZJ8A 4C0HA 4L4YA 1VG8A 2XCOA 3JD3A 2VDRB 4KDCA 4BP8A 3HPQA 1UDWA 4UMFA 3ANLA 3UXMA 3PLAE 4HYYA 4OB8A 3W3AH 1YR6A 1L7MA 4YNBA 5SY9A 2DOKA 4M1MA 2GAIA 4J43A 2IP4A 3DP7A 3V2GA 3B1JA 4DPMA 5EE1A 4LDPA 4AUKA 2C59A 3OVMA 3UMVA 5B3JC 1FFYA 3DGEC 4Z0NA 5DNCA 2I6XA 2WFLB 4I81A 4QJ4A 4WK0B 4KOAA 2ZQ5A 5F51A 5K3CA 5TF4A 3SBOA 1DZ3A 1KYTA 2F1IA 3SQNA 1IXKA 3DMHA 4QVGA 3ZY6A 4FXPA 1Y4UA 3HBFA 1W4CA 3QEBZ 2B20A 1DIBA 3OURA 1G2QA 1KNQA 2GZ3A 2V98A 3LCUA 1H22A 3O82A 1VCOA 4Y6PA 2ST1A 3TWOA 4HEA6 1V5WA 1A71A 3K9BA 4REOA 5FPHA 1LY1A 2PBLA 1IOVA 3IOYA 5IH7A 5KYWB 3BILA 4HWSA 5AKGA 1RHJA 3CNNA 1JQKA 2CHGA 4UE3S 3QIVA 1H4VB 1DDIA 1OLXB 2FYTA 3G5MA 3HCNA 2J4FA 3LL4A 3NIDB 1N6PA 4RO0A 4ZVNA 3ESDA 3ZH9B 4HN4B 2YWRA 5IDWA 2QB5A 1MO5A 3LDGA 2ZSEA 4IIJB 3FB4A 2R60A 1O4WA 3ND6A 4MO2A 1XCOA 3NEYA 3TTYA 3ZK7A 4DG5A 1ADGA 3WNBA 3A9CA 5CCEA 1NTOA 4ZO9A 4CU2A 3KLOA 4DDTA 3K9FC 3MLAA 5FBQB 1E3QA 2F8MA 1K8ZB 2C4MA 4RWZA 3ITDA 3ADOA 5F2OA 1ZOOA 3D6NB 1BS2A 1E9BA 4XDZA 4XTCS 1JE0A 3QWBA 4KI0A 4DPKA 2GTHA 3OJOA 1FX1A 4YCSA 1KYIA 1OXXK 1NDUA 2WA2A 1J9EA 5A4AA 3R3HA 3B5JA 3LI2A 5KYXA 1VXRA 1U7WA 4PGMA 1MBZA 2VSYA 3H4TA 5HM6A 5TT0A 2IODA 1U0GA 3PPIA 5EA2A 3PWSA 3E81A 5HKOA 4U3JB 2Q21A 3QEKA 4LSWA 3WDKA 1RM5A 2OE2A 3FG9A 4YPVA 1DRUA 3GRVA 1F2DA 3L6EA 5HKKA 4ZQCB 3GFPA 1FTNA 2JGNA 2R96A 4LC9A 4F11A 2FTKE 5LYJB 3L6OO 1GUFA 1N9KA 3RUEA 4ZYZA 4HZUB 3EXHA 3KHUA 3KWMA 3KXIA 5K4HA 2P0EA 5HF5A 1N36B 2GCOA 4QUEA 4B79A 2GBLC 1EAYA 5BN1A 2NXNA 2QENA 2QTCA 1RFLA 4XASA 5I47A 4AQ7A 4BE9A 2J33A 4H7JA 2CXSA 3C3MA 3L92A 4M9UA 3RJTA 3MBKA 1E4EB 1Y1PA 3RKSA 4PYMA 4BNVA 2OXIA 4E21A 1QVRA 4L2IB 2NTVA 4BQOA 5CVTA 3CTMA 2JBHA 3K5WA 1A9OA 2PH1A 3E9ZA 4DW8A 3BH7A 1ZJWA 5KMGA 4H7KA 2CLOB 2PZMA 3PA8A 2RI6A 1ZA2A 3QUQA 4IDAA 3TBFA 5IJ0A 4RLQA 5IN4A 3HB4X 3KWFA 3MW8A 2C20A 4MPPA 3W9YA 4ARCA 2ZUEA 3DKIA 4X45A 4DIDA 5JCXA 2VHJA 2PSDA 3AHEA 2P6UA 3ROMA 3DKKA 3REGA 3ET4A 4ZEXA 4OHCA 3PTLA 4CF6A 4HDKA 5J2UF 3T4PA 2G17A 3MWDB 1E2NA 1Z7WA 3JRWA 3Q3IA 4M6WA 2WJYA 1ZWLA 5YASA 4EW2A 3CX8A 1NY6A 1RRKA 3ETCA 3IO5A 1Z7BA 1KZYC 3Q8KA 2HMVA 1NY5A 3ND9A 3GARA 3T1OA 1SKUA 2JF0A 1KOFA 3DBHA 4EB3A 1GLGA 4RTLA 2VDNB 5DXFA 2LIVA 3KOMA 4P80A 4XIFA 1NAIA 3KVVA 4MKHA 1DX9A 3ZI4A 3QP9A 2AJ8A 5ENDA 4HNAB 1NKVA 1NULA 2YWGA 2QMOA 1EVKA 4FMCB 5ALXA 5FQNA 2ATIA 2EOAA 5IAAA 1Z5ZA 4H3KB 3TIXB 3ZWVA 1DSSG 1N0VC 1AHPA 4BCBA 4WINA 3G5AA 5EMHA 5LJLA 3SHWA 3W34A 3LP5A 2AOXA 2CMGA 3GDFA 1UANA 4CUZA 4K03A 3KQMA 4G1EB 4UW9A 2QT9A 1J2TA 4JLAA 4MWOA 5E7IA 4BV2A 3ADKA 4IILA 3TKAA 1VJCA 2ES4A 1XA4A 4BNZA 1J8MF 3BCHA 4EVRA 4F4UA 3KJNA 1DUVG 3F3SA 3DEJA 4J0IA 5JDIA 4TYWA 1DTWA 1KEZA 4XB2A 1Q1GA 1HDOA 2Y2UA 4EBFA 1ZMXA 3LBNA 1XLTA 5CPFA 3H11B 4R6XA 3WFJA 1J20A 3MJHA 1CETA 5EJGA 4F1WA 3OD5A 1M2OA 1CUZA 1RZ3A 4ZCQA 3B9PA 1MB2A 4P2GA 5A3RA 2OZLB 4M9RA 2GN8A 2GJKA 3O8NA 3WMEA 2HXGA 1NW6A 1R16A 3EEBA 4UCQA 1EFVB 3GJSA 1TAQA 3AZQA 5IBPA 4D9EA 3OQBA 1Z39A 3RAPR 5CA0F 3MT8A 2VHVA 4HFNA 5CXSA 4QOSA 1O94D 1JHXA 1WDLA 5EIFA 1U8ZA 1KBZA 3M83A 2ZRLA 2PD4A 2F55A 1P80A 4KUHA 3K4QA 2I8AA 2GZSA 2QZZA 3U7IA 1ICEA 5KNBH 1TPZA 2FZGA 2W70A 4AZ0B 3OQPA 4ZYVA 2W6NA 1EKXA 1WEHA 3CPJB 5KCMA 1D2MA 1QO0D 5LB4A 1I80A 4YEDA 4Z1MA 4EW3A 2BSXA 4D0RA 1G2IA 1B43A 3WR5A 3WL5A 1HE3A 1Z18A 4KHZA 3VXKA 1OC2A 3N6VA 5CH8A 1KEWA 2AMLA 2FSHA 5EIAA 5A3SA 4HY3A 5K0TA 4PSAA 3IURA 3EVAA 3H9GA 3NT5A 4L95C 3G1WA 2ZIXA 3MWYW 1CLEA 2VEOA 3GGPA 2DWOA 3H3JA 3C6ZA 3VSAA 2EVWX 3IEMA 4KQCA 2I62A 2FG6C 3WMWA 1TL7C 4IBOA 4Y2XA 5G1NA 2DY0A 2GPBA 4C5CA 2QQ0A 4NP6A 4Z2AA 4IXTA 5EJ4A 1E8DA 1I7PA 2OVFA 1PVVA 4IHAA 3U1VA 3T7JA 3CTPA 3TLMA 3UWDA 3VZRA 4D3YA 4UATA 1FE8A 3VI3B 2E5WA 1IIRA 2LUOA 3QPAA 4DR3B 1B3BA 4UCWA 3SZOA 3VPBA 1BFDA 1LS6A 1OIXA 3O31A 4YR7A 3MOGA 4GM4A 4S1VA 1TD1A 4NOKA 4C6TB 2FV8A 2QA5A 4IJQA 5C1OA 3W5SA 4UBKA 4ZVKA 1EX6A 2CFTA 3BXGA 3I8SA 1XDBA 4BX9A 3HRKA 1LA2A 2BKVA 7GPBA 4J2OA 4Q19A 2V7UA 1VGQA 5DGIA 1E58A 1UJBA 2B69A 2PQ6A 2OG1A 3BTVA 5KYYB 3ZV5A 5IJAA 4CKWB 2DULA 4KLRA 2LDBA 2I2DA 4R9RA 5TNXA 3TNDA 3L8FA 3TLXA 5ALPA 1XVTA 4DIEA 1YAJA 3NWEA 4CETA 1F0PA 1IN7A 1AN0A 4LNUA 3VAAA 1W7AA 3ETNA 3AM1A 3TTWA 3U49A 5B1YA 4AAYA 4RVSA 1R27A 2JH9A 1W5BA 4O2AB 4C43A 3O3MB 3WC4A 2NACA 4A73A 4ETIA 2P11A 3WHLA 4W1QA 1T6NA 2FP3A 2V59A 1WCWA 2JGDB 3QVKA 4A10A 5K3FB 3ZWXA 4CM8A 2H48A 3WISA 1UDXA 2B35A 1MNQA 2HA0A 2VZLA 3CLTD 2IK8A 1JHUA 3IQXA 3DM9B 3IP6A 4YRQA 4JI1B 3DKPA 2FWRA 2AS0A 1L7RA 1JU9A 3OEYA 3AG6A 4LMPA 2XTAA 3P2IA 3WNDA 2PZEA 1VA5A 2I9PA 2V3WA 3JQQA 4DMHA 5F23A 3I09A 2I76A 1U2PA 1DPFA 1Z0IA 1UBJS 1HV8A 2JFOA 2QD3A 3JD2A 3O83A 3BC1A 1TMGE 2GEDA 4MMXB 2V03A 5IVDA 5IN5A 4EL5A 4NZZA 2PKCA 2H59A 4HDNB 3TVTA 2WPDD 1RHKA 3KAPA 2IOQA 1A9RA 3I1IA 4OYRA 3OKFA 1E6MA 4Z3OA 5HMMA 1SXPA 1AKEA 1KOGA 2C96A 3KT8A 2QLJA 3FA2A 3QJ5A 1FS6A 4IFTA 4YRSA 4RHXA 5BMVF 1OXUA 4KFTA 2QQ5A 5BN3A 2PH3A 3IBTA 3DWIA 1Z2DA 5EZYA 3V00A 5L6MB 4XDGA 2GKGA 2PLFA 3TKLA 3KZNA 4KXFB 4CTMA 2A7QA 3G49A 3WK6A 3EIUA 4KTTE 4M8IA 2ZVDA 2A9OA 3CH4B 1RNLA 4L8WB 3OUZA 3B5EA 1IPEA 3BSFA 4GPEA 2B78A 1IOWA 1ID1A 1I2CA 2JDID 3GRKA 3MAJA 4G5YA 4NABA 1Q21A 5JFOA 2EZ4A 1NSYA 1QCDA 3QXXA 1NBOA 5DGHA 1BVYF 1GAJA 2FVXA 1XRPA 2VCHA 1JLLB 3C4VA 2GPNA 4JBGA 4S24A 4C29A 4CVNA 2E1RA 5ADUS 3UHJA 5CX1B 1JQ5A 1P0QA 1TIBA 1S2NA 3H9CA 4YT8A 1XDUA 2FW6A 2B8EA 2GYVA 4C5AA 2ZJ3A 5AJZA 5TT1A 2M1ZA 4HFRA 5LP6A 3HZRA 3IXMA 4PR0A 3N3BC 2H7VA 2W2XA 1U0HC 3O1LA 3QVLA 4ITRC 4OLFA 3RSLA 1I4TD 1XFDA 4WERA 5FOQA 5ICSA 3BWCA 2W42A 3ZE7A 5LUAA 1DDGA 3DOFA 1WV0A 2CLLB 4XVUA 3B70A 3D8RA 3R0QA 4DYHA 7REQB 4O2BA 5KNDH 4OU5A 5BUSA 2B4YA 4IJ6A 5FWYA 1TT7A 2GTIA 1PK8A 4DMUB 3HVUA 2G1AA 1K6IA 4YWHA 3FUVA 2JIZD 2F48A 5B1DA 5LCXA 4BMSA 2Z4SA 5LXTB 5CA1F 1KA9H 4HPXB 1FFXA 4Y1GA 3CN9A 5DFAA 2JLWA 1UZNA 1OU4A 1UXGA 4L3WA 1DOHA 4UARA 3SBEA 1U80A 4G5OA 1YD7A 2ZCJA 3KPUA 4KMOA 1JKJA 3GQBA 3VC3A 4CMIB 5DCYA 2GZHA 3LL7A 1JP7A 2PGNA 2XMRA 3B9QA 1N5JA 1DTEA 2PS1A 1UMDB 1IAVA 1QE0A 3GFQA 4LRYA 3ZZTA 4W9RA 1HX7A 4I2NA 2WR8A 5ELMA 5FHQA 3RYHB 3UK7A 4URVR 4CRWB 1ZL2A 3KVRA 2ZBQA 1D3AA 4P53A 3SIWA 1K5GA 4B3FX 2RBKA 3HDYA 3HHEA 3G7UA 3JQDA 3KCQA 4TYQA 5CCDA 2F8LA 4UPEA 1MB0A 1CUSA 4KDRA 1A96A 3N0VA 2AZ4A 4DANA 2I65A 1ZIOA 2D3WA 2QD4A 1M6VB 2GDJA 3GRYA 2NO5A 3F9CA 4LX8A 1PYGA 4GC9A 3A3NA 2VS1A 3SM9A 1H2ZA 2VPZA 3TW8A 2FFQA 1D03A 1Y3BE 2GZ1A 3DLHA 4LK3A 2JZOA 2H8GA 1TU0A 4XIJA 5TY0A 3HXPA 4HDOB 3VFDA 4DNQA 3ROTA 1JE1A 1GFZA 4AJPA 5E7JA 1CJMA 1U28C 2W2KB 3OJ0A 5CJPA 4MS3A 3L4BC 1C7JA 1XKXA 2ZWIA 3A4LA 1YI0A 1K2VN 1LH0A 1DO8A 2ZU6A 4PEVA 4W1PA 4BMZA 2IS6A 3GPDG 5G1PA 2XB6A 5AESA 4PZ0A 2NZVG 4BYGA 4DKXA 1YB2A 1UJCA 2OORA 9GPBA 3I04M 1WCYA 3MTEA 3PDUA 4DRZA 4DDVA 3R6DA 2YMLA 1FX0A 2J59A 2PRKA 1M34E 4RTKA 4MRMA 3CZ4A 4LMBA 4QYIA 4R2JA 3TMAA 1XIVA 1TU3A 3I3OA 1SUCA 2Z6UA 1RXYA 2RGGA 5TIIA 4HH1A 2B6NA 2C99A 4BE7B 1SOWA 4CM6A 1IVSA 1FDUA 4HJRA 4ZXPA 4IDPA 2PWAA 1H5QA 1KJWA 2NU7A 4MCAA 2IUUA 2Q4TA 4ENUA 2BHTA 1C1YA 1TEVA 5DP1A 4GMDA 3F6CA 2ZETA 9ATCA 1CEEA 3E03A 1KI6A 4V0NA 1LK7A 5FO0A 4I5EA 3IEUA 1P2DA 3ZZNA 4AMGA 4NZNA 1J0XO 5BNIA 3P4XA 2DR2A 1HL3A 4AICA 2OCBA 4XH9B 4XAQA 3FYDA 1NBMA 3GLGA 2GD2A 3T34A 4WBXC 3ND8A 4GI3A 3TW6A 4O4IF 3N9IA 3HCBA 3MGCA 3CY6A 1JI0A 1F9EA 1XYVA 1YIDA 3L2OB 5AHKA 2XEDA 2VT3A 3A9TA 1UXHA 4YP7A 4B76A 1Z0FA 2F90A 2V7TA 5CFRA 1QGDA 2JKYA 3I52A 4WXEA 3VR6D 3A6PC 1LB1B 1YTLA 2FSVC 2GOYA 3RHZA 1NZDA 3H7IA 3ZXYA 4ER7A 1JNYA 1A8QA 3E6AA 4BIIA 1A9TA 2WHQA 3SEAA 4BQNA 3WLNA 4R1UA 5KX5B 4L0CA 4BDSA 3B6EA 3ZDFA 2XZPA 1QE3A 4YXFA 3CVOA 4R51A 1O4VA 3WLFA 1WMSA 2FPIB 3CBGA 4XPIA 2XWQA 4OM8A 2GBCA 1KETA 3PXAA 4QTXA 3K70D 1P1HA 3M4ZA 1CFZA 2F64A 2P7IA 1X7ZA 1VJDA 3UMRA 1E2QA 4S0ZA 4BNDA 4IRUB 1V9LA 2HA6A 5EHQA 2OB2A 2CV1A 1LGYA 1ZUD1 3CMCO 4ARIA 1EX1A 5K09A 3G2KA 4A03A 2G63A 4HBZA 4B6SA 4G8JA 1MZVA 2NUTB 5BSTA 5ITWA 2QMYA 2Z58A 1G7CA 1CZHA 3A9RA 4M53A 1EK5A 3SD7A 2IPXA 5ALTA 2BR3A 2DUWA 2UUPA 1DIGA 1J90A 3C1TA 1TYEB 2CBGA 2OESA 3T41A 1YK0A 5LKRA 5GPBA 3UBTA 1C41A 2QRKA 3FNBA 4QM7A 1ZXBA 4WKCA 3VU8A 2P75A 4AY5A 3TLCA 1ZH0A 1Q0TA 4NCIA 3L0PA 2ADFA 3KLBA 2QUAA 4NCHA 3PC3A 3QPCA 4BTVA 3E15A 1IIBA 4W4TA 1LDYA 4HQRA 2QBYA 1SG6A 2UZ1A 1D0VA 5ALFA 4Q4AB 2FOLA 3THOA 3NZEA 2YJ5A 4RU1A 1V11A 4LHXA 4KHPB 1KIFA 4CCYA 1IZ7A 3AWDA 2Y76A 2IVFA 5L3SA 2GMWA 4TKUA 5ENVA 5JXJA 2NXEA 1QGED 2CLCX 3WQQA 3CFYA 2BZSA 2Q7XA 5IDXA 1M2NA 4MSUA 2FJPA 4AY3A 2EEPA 1GIAA 1FU7A 4NI5A 1T8TA 1TA4A 4OOFA 2IYEA 16PKA 1X7WA 2QE7A 2O3TA 3DR3A 3M3PA 4M3NA 5DBHX 3EGEA 1E18A 3BGDA 4WFJA 3HU2A 1OGYA 1ZH8A 3A3OA 3ENNA 4OHZA 3D7SA 3ZYZA 4HV4A 5EQTA 2AUMA 1Y1QA 2GNOA 2XMZA 1NV8A 2HCBA 2BI7A 4YJFA 3EC7A 2VP5A 2FX2A 4CFYA 1Y80A 2CNOA 1ELOA 4DQVA 1FBTA 1BEEA 1ADYA 1PVDA 4D4JA 4U2KA 1FDWA 4NPHA 2OM6A 1RYNA 4RFSB 1ORVA 2O52A 4W8GA 2QX9A 1NFRA 3VR4H 3RPEA 1JLSA 3F5QA 5DK4A 1RWMA 3WGGA 1EEHA 2O3JA 1Y6RA 2VHUA 4PLHA 1UM9B 1GTG1 5JADA 2LKDA 4HTFB 4K8RB 1JHDA 3FVRA 4QLAA 2BLNA 4FFDA 4RY9A 2YOFA 3U17A 3WXBA 4YHHB 1SD2A 3F67A 4YRRA 4IIJF 2GN9A 1SEPA 3A6EA 4CL2A 4S3MA 4RPKA 5AVRA 3CX4A 3F5DA 3ZIAA 3VSBA 2VP3A 2WFAA 2JEOA 4NRDA 4X24A 4BYMA 4EQZA 4FQ7A 4Q48A 2IHTA 1SUBA 2Y1FA 3GC6A 4BV3A 1SHTX 3KK0A 2JAOA 4I14A 4ICIA 2JZNA 3PXEA 3KYIB 4UHCA 2Q0XA 2RIRA 4EG3A 4XX0B 5HOEA 1HF3A 5DN6D 3MA0A 4Q15A 4X1IA 3W04A 3H8WA 5M5BA 1MN6A 3U56A 4RKEA 4NCXA 3E0QA 3PUZA 2DTDA 3KO8A 3OCVA 2UUOA 3DAHA 3PGVA 4ZU6X 4RZ2A 1TI7A 1SXQA 2CHUA 2AB0A 3PD0A 2ZWOA 5BRNA 4EFDA 4DMRA 1FW8A 4G09A 2IH4A 2VVTA 2EW1A 3BWXA 1DAEA 2RGNA 1IU9A 4MIYA 5FWXA 2JLBA 3ZCPA 3PEWA 1NVFA 1K97A 1Q7RA 1VJTA 2F3RA 4OKSA 5DE3A 2WIGA 3LPLA 1EG2A 1ZESA 3PBKA 3WFZA 5EJEA 3TTXA 1PUIA 2FMUA 3BMQA 4NSNA 2XUJA 4EKGA 1GPAA 3R3JA 1BTOA 1NMXA 1E2GA 1A4UA 1PR5A 2D5AA 2C2KA 3U37A 2AZDA 4JR0A 2FQQA 1D2HA 3CUUA 2QW8A 1ZVVA 5ED4A 4C22A 2YRXA 5DM4A 4HVAA 4JDUA 4RA9A 4AXBA 4FFVA 4KP7A 2DCUA 2PCLA 4C4YA 3PC8C 1T36B 1WSWA 5HVNA 2GHQA 3RU9A 4IVRA 1YZYA 4A16A 3ON5A 5J9FA 4U39A 1TZBA 1AIPA 5GGXA 2GRJA 4O4LA 1OZFA 1X2BA 3HA5A 1MIOA 4WLNA 3NM5A 3KUUA 4CKBB 2ZYDA 1ZHHA 3BOSA 2XNDA 2CLHB 5ALJA 1V3UA 3SYKA 3W3ZB 1GNTA 2B1QA 2QJWA 3OZEA 1CR1A 1Y48E 2P9JA 4J1TC 4OMDA 4Q4LA 2FA9A 2CXPA 4U9HS 4XLTA 5EZSA 3OAAA 3LC2O 4PQEA 3GLHA 3OJEA 4JLSA 1SNYA 2VTBB 3RLFA 2VK1A 3COJA 2Q1UA 1U7HA 4H7PA 4BGIA 2PL9A 3E8MA 4A92A 4FQ5A 5KAPA 3A4IA 3NDIA 1MA3A 4MWZA 4QUJA 2VZ9A 1JZQA 2NP7A 1BWRA 3CF4A 4QG3A 3IKLA 4MI9A 5G3ZA 2RE8A 2IQIA 1QZTA 3AHCA 1KGSA 1U1GA 1EQ2A 5JE8A 3WLEA 2F1HA 1Z2EA 2UUBB 2ACKA 2XGGA 1ODSA 2V4MA 3F46A 1ZCJA 2PBFA 3IT0A 2G83A 3NNNA 4PSDA 2AMJA 2H2HA 2D1TA 2WY2D 3SPXA 3UCFA 4CMAA 1L0BA 2P9QA 2VK4A 5FBVB 2BONA 1ZK4A 3KJEA 1ZS9A 2DF8A 2OBLA 3JWEA 4HDRB 2YXLA 4C1BA 1L4NA 2PPVA 3L79A 4CCAA 4PG8A 4MAFA 4NJEA 4FMCF 4QUIA 2ZPUA 3MMNA 1XZBA 4GOKA 1E4VA 2C4KA 2OV6A 3B6MA 3HWRA 5E4YA 1NVVR 4EIWA 3PXGA 4WJKB 2VUIB 1G42A 4E30A 4J0CA 5LVAA 3Q88A 1PHPA 4RQBA 2VR1A 1D2EA 1YUBA 1ZPDA 3AXTA 1XCGB 3I72A 4M86A 4O1HA 3M4JA 2ZYRA 1ZUHA 3THSA 4CPDA 5IABA 4DDHA 4Z7JA 5LYJF 3SSNA 3TQQA 1QP7A 2CLMB 2R5NA 4GOXA 1QRTA 3ICCA 3FTDA 3PDWA 4JU9A 3GFVA 2W2PA 2QDKA 1N2JA 3LW7A 4JOBA 3WBKA 4B75A 3EYAA 3D4IA 2QAGA 3KHKA 2J0SA 4JI6B 1NQ5A 3FHCB 2WF5A 3VNRA 1AA6A 1E2PA 1OREA 4UZEA 2GYWA 4MUIA 4EI7A 5HNKA 4P7BA 2AT1A 3OLWA 3GGJA 4RPLA 4TQUS 1EDBA 4MGEA 1BVRA 3FIJA 4QQRA 1RAGA 3HCFA 5D3MB 4AZTA 5ADWA 3KR9A 3KL2A 1H4QA 3GNSA 1EFDN 1UKZA 4NFYA 1V25A 3PI7A 5FTNA 4CTOA 2OV8A 1H8HA 4XRGA 2YY6A 1OYOA 2OZEA 2G67A 4LYEA 3CONA 5JG7A 4YJ2B 2F43A 1XEFA 4GMFA 2CJPA 4M0CA 1Q2UA 4UFOA 4Q3DA 3WB1A 4YRZA 5F2NA 1VOTA 3G2IA 1NI5A 2YXDA 1CJVC 3VTKA 4CDRA 2ECOA 1LI7A 3HI4A 2DBRA 2C2OA 1UMCB 4AY2A 4WHMA 4I4NA 4MVJP 2WJ4A 3N5CA 5T8KC 4DG8A 3U0BA 4BVKA 1VXOA 3HS3A 3O84A 1RBZA 3AR5A 3CH7A 3I6QA 4YACA 3BK7A 4EWLA 3LUAA 1DBRA 1GSIA 1LDNA 3EN0A 1H8ED 3OM0A 2EYUA 4GLOA 4KAXA 2WLSA 1QNFA 3DVRX 1WETA 1O3YA 4UDXX 2CDBA 3DE1X 1RM0A 2PSSA 2HO5A 2VDWA 1EFKA 3KOZA 3SKXA 4MUGA 1BEUB 1WZIA 2XYGA 5F9HA 1W0JA 3YASA 3PKZA 4YIHA 3X1MA 3K7EA 1L1RA 4KGZA 4Q3EA 2VQSA 1BDIA 2IELA 2I4LA 3OZGA 2R0QC 2IP1A 2CXXA 3LIPA 3SFZA 1OTHA 2GEKA 1G21A 1G8KA 4J76A 3UYKA 1C14A 1LW7A 3SVLA 2P2GA 5IAJA 2GAFA 3EDRA 4QNRA 1YFZA 2H5EA 3UFXA 4C76A 4V0SA 1AS0A 1B2RA 1PV2A 1QOZA 3SU8A 1TVKB 2P69A 3PQFA 2QU7A 4R41A 4JP1A 3RK1A 4E94A 3ORFA 1QIMA 2PY6A 3D81A 3GRAA 4JXKA 3DO5A 3HJUA 3TPZA 1GZHB 1PR9A 2BCEA 5KNCD 1C2TA 5BW4A 1K1EA 1A9XA 4B3GA 3MILA 3OT1B 4NCBA 1IQPA 2C03A 2C57A 1ZMBA 3H17A 5JAUA 1B41A 4ARZA 4DVGA 1W5SA 4NEQA 5B3AA 4ZOEA 2UVPA 1N2EA 4WZAA 1V6SA 3D3KA 3EQ8A 3K6KA 4ALMA 1E5QA 2VO1A 2FN3A 2NVWA 3D3WA 3I01A 2CCJA 3PEFA 5EN4A 5ALIA 5CP8A 5AW5A 3ZTYA 4KNWA 1GZVA 4B34A 1VYTA 4DM4A 3BGWA 1R18A 2AXPA 3TE6A 1NPDA 2Q6VA 4JP3A 4NZMA 1OWNA 1ZIDA 1XYYA 1PG0A 5EVJA 1BJTA 4HN9A 1EP9A 2CDAA 3KELA 2ZRCA 3WYCA 1KJQA 4KQ9A 4ZOQI 3TLBA 5GJCA 4O2AF 1I24A 5E9AA 2HDOA 3RREA 3SYLA 1Z4IA 2E82A 3C3CA 1OV6A 1T2VA 3IIEA 3SS7X 3QPUA 4M98A 2HFJA 3B1WA 1T2DA 1N3LA 2V5VA 3ONEA 3TZLA 2IY7A 4WXYB 1K5DA 4C2AA 2PTHA 2IYZA 2YYAA 1JMYA 3DTVD 4CV1A 2GFQA 5AICA 4EF6A 2EYQA 1YTUA 3R7WA 2VRBA 2FSGA 3DZFA 4RLHA 3WLTA 3RAGA 5CIQA 7ADHA 1IRIA 3DD1A 3GJZA 3A2LA 3NC4A 1IHDA 4G65A 5M2QA 2K5UA 1GTZA 2WC1A 3SYTA 5IJZA 1C7IA 4B6OA 3WRWA 4E70A 3TGWA 4F2GA 1YIOA 1H3FA 2F3UA 3BG5A 4DV3B 3AZPA 4KSYA 4C0QC 2ZIGA 1RWPA 5L7WA 1EBBA 2CD9A 2J0EA 5ADVA 3I30X 4Y8VA 4TYYA 4HNHA 2O4UX 1XCLA 2QYOA 2CK3D 1V43A 1K06A 3SDSA 3ZK9A 4U6QA 1RHUA 3K70B 1CY7A 4KQXA 5FUYA 1CQXA 1T3GA 1M8FA 4IGEA 1I4DD 1N7GA 2R97A 2WD7A 5C5EA 1AC5A 3LK7A 1UKBA 3KS9A 4NHEA 1GO2A 3H42B 5JSQA 3WL7A 3I45A 5HJ2A 4OGLA 1I0IA 4PLZA 5AI0A 5KS2A 3SEQA 4FB5A 2BM0A 4ZGBA 2I4RA 4L7VA 3UB2A 1KFEB 2I8LA 2W2MA 2HYDA 4YJ3B 4ASUD 3ZCSA 2AX4A 2HTEA 5BUCA 1I3OA 3G7SA 4R1NA 1DCFA 2IIQA 2AN4A 1QHHA 2WAMA 1RXEA 2G36A 2Q3CA 4ZJZA 2FSSA 2ZYVX 1DARA 1RU3A 1ZLXA 3QX7A 4LFCB 4F9FA 1E1QA 1XQXA 4GPZA 4IQFA 2J9ZB 4UAGA 2ZTMA 3UHFA 4BWGA 1QANA 4P8RA 3LTNC 1VE3A 2C1EA 3R5TA 4MJXA 5DHQA 2R6FA 3DT6A 3TR5A 3H9BA 4WXRA 1DKNA 5FPQA 1T29A 4ZYYA 2P5UA 4IOJA 2A3RA 3EY9A 2HGSA 5LDDC 2NYRA 2ATEA 1NXQA 3QYJA 1XLWA 4IH9A 5FBLB 2NGRA 2BTQB 4WVFA 3S8YA 3CC8A 4OXXA 2FCRA 2OCPA 4QYXA 4RD2A 1UBMS 4YUZA 1I4OA 2BDEA 5BN4B 1YUNA 1C4KA 4KRFA 4YCMA 2V4ZA 4OY3A 5LXTF 3M1AA 2D8AA 4N9WA 5DHFA 3SX4A 3ISTA 1H69A 2PGIA 1MA0A 2YFHA 4QT0A 2DWCA 3RVPA 2IBSA 2X9VA 1WPRA 5L3ZA 1ZHFA 4EYSA 3USCS 1C3LA 3DHVA 1R1DA 2D1SA 1IY0A 2VPWA 1PD0A 3P2OA 1J9ZA 1EFPA 3FW1A 1MC1A 3KZXA 4HQKA 1GPH1 2IPLA 4UFNA 4RH0A 1HY3A 2TECE 1M1ZA 2DMRA 1HYHA 2R6CA 1GPKA 5EXTA 5JNLA 4MW7A 1HLDA 3ORSA 2Q0HA 3D3QA 3QJGA 4FYVA 3K0BA 2X76A 2HMYB 4YRDA 3KVOA 4V2IA 3T3PB 3QPWA 4LF7B 1AGNA 3CKLA 3GD7A 3KSMA 2O23A 1SC6A 4MKRA 4HLCA 2GJ9A 4YMHA 2ONYA 1XTPA 3VHLB 4ZAZA 2EC5A 4JT4A 1VSQA 5F77A 4G0YA 1CY6A 4YRLA 1KKLA 3GIWA 1UINA 2P5TB 3H0KA 4AC9A 4BKOA 2I7XA 4ILKA 1GR0A 5FR1A 4DGSA 2C5AA 1O5OA 1HDEA 4F9GA 4ZYUA 1E5VA 2M98A 4H1VA 3UB3A 3N0WA 2A5LA 4MVYA 1YS2X 2I2CA 5EE3A 4DBZA 1EUCA 4DPLA 3BRQA 4GM1A 4KV9A 2FDXA 5BN5A 4PQRA 1G6Q1 2GEBA 5IHPA 2FE4A 1II0A 2O2HA 3A3KA 1I1NA 4KUEA 4UVDA 4BATA 2Q29A 3GO4A 2OV1A 3V1LA 1L2TA 1MD9A 3EJ6A 2YXNA 3TINA 2HA5A 3WGYA 2J5RA 2ZPTX 4RHUA 4BEVA 2JI6A 5J58A 4EECA 5JI2E 1XL1A 3V1UA 5I45A 4C7XA 4JU8A 4WXHA 4TWBA 2OFOA 2O54A 1IEXA 2XITA 5C3UA 3L01A 5JUWA 2XTZA 4Q1FA 4DNXA 4DV2B 3PWZA 3RRZA 2JZCA 1ESCA 5EHZA 1NNLA 2OCGA 1JGTA 2NSDA 5K5EA 1WUKS 4QBKA 1U7UA 3A06A 5JARA 4MKGA 1BD3A 4Y0NA 1T25A 5GOTA 5TXGA 4YRNA 5LIPA 2BP7B 3LY8A 3IT1A 1DAFA 3VZQA 3HKCA 2PL3A 3UF0A 3EFOA 3KHSA 4X44A 2CJXA 3ZXSA 1O0SA 4QLBA 1TZMA 3HR8A 2AR7A 2FSUA 2JRLA 1BAPA 1T9ZA 3I83A 1DFIA 4O08A 4I6GA 4QGFA 2WVHA 5FF9A 1ZW1A 3T1NA 3CT4A 5DMXA 3C8DA 5DW3A 4ZRMA 1F5SA 1P2FA 4Y1FA 3RAJA 1JWLA 1BCRA 3RFCA 1E3IA 1R4MA 3GHYA 4ENWA 4YJGA 1Z36A 4DREA 4ZCPA 1XNJA 4CLOB 3EX7C 1Q1ZA 4K9QA 3M3DA 2QG4A 4QDKA 2MIIA 3DFKA 4I1PA 2YQ5A 3A4TA 1OAKA 3B1KA 3OZAA 5BQ3A 5LBTA 4MV9A 2ZIEA 2I3DA 3R6TA 1Z8FA 2W4IA 3HDHA 4I08A 2Q9BA 4QFCA 1NA5A 3IT3A 5JC8A 3KKZA 3E2MA 2RB4A 2ZAIA 5BPFA 3W78A 1R6VA 4D81A 3K2EA 4MW1A 5E7MA 4S1OA 1ETHA 3FNFA 5EQJB 1VTKA 1IULA 1N6NA 1NM5C 1Q15A 4NNJA 2NXJA 1X80A 2CWWA 1QB8A 1P2VA 3LQ4A 4HB3A 3HZZA 4MEBA 4HUQB 4X3CA 1EMDA 5HA5A 2P62A 3UMJA 2AGVA 1EZZA 2V0NA 5HKKD 1YVRA 3T9FA 1THGA 1KC3A 4XTRA 1W44A 3LCJA 1KYQA 1SY7A 2A4KA 2B3DA 1J1IA 1OJLA 1N75A 2G6BA 1OF1A 2NADA 2O2JA 1QR2A 1RWOA 2Q6TA 2IV3A 4JQOA 2LRHA 3RE1A 4BMDA 1DLJA 3BAFA 5BV2P 4HDCA 3OIWA 4ZVQA 1H23A 5B1HA 1YVUA 3NAGA 1KO7A 2DUJA 2EWVA 2MR6A 3MD9A 4INJA 4OHBA 1ECBA 3RC3A 3GAZA 4DC0A 2OSVA 2DH5A 2H52A 3EEIA 3I5XA 2EL7A 3RJ5A 2H4WA 1SCQA 2W2QA 2ZAMA 4D5GA 4MYRA 1NBME 2Z1NA 3C2QA 4RYDA 2X0EA 3T12A 1E9SA 1YZGA 5BVGB 1K66A 2G9QA 3HGTA 4C7OA 4N49A 2PMWB 1I0ZA 4LZWA 1RACA 1LPAB 1PGJA 1QYRA 2QTLA 2Q2WA 3OKAA 4Q9DA 5AW0A 1HURA 3RVRA 3HO1A 2J3KA 1KK3A 4RZHA 5TX7A 1R66A 1M72A 3LQ2A 1BMFA 3F4BA 1RVV1 3DNFA 3RYIB 1KEPA 1HO3A 5F4ZA 2IA5A 2WNIA 3GVHA 2ADMA 1F3OA 1S02A 4F1KA 1IWBB 2P0AA 2O0JA 1KO4A 3IQDB 2QT1A 2ODAA 4OXIA 3T5GA 2Q2VA 3TNFA 3GN2A 1S9DA 3NDRA 3RNLA 5K3OA 2FEXA 3DL7A 3RRXA 4G0VA 4JI7B 3ZCTA 1Y89A 1EG7A 2B25A 2WUDA 3GT4A 2ZUWA 4KPUB 3STWA 3A6GA 2HAEA 5H9WA 3HKBB 1Y9DA 5AHXA 3TBKA 3VTZA 2GZDA 4H1TA 4F5WA 4YO8A 3DL0A 4DR5B 4X1YB 5ELXA 1WW8A 4DJAA 3H86A 3NVDA 4IDGA 5GWXA 2G09A 1I9GA 1KVQA 2I7VA 2Q50A 3W7AA 1LVGA 5DRYA 2XMPA 2Y77A 4AS1A 1GAXA 3BL8A 3T4EA 4ZEOA 3J7TA 3TQCA 3R7AA 3QBDA 2OXCA 3CWCA 2YY5A 4MUBA 2CLEB 3DXYA 3OPXA 1PK9A 1XEXB 2OHIA 5GTDA 4WX2B 621PA 2IOHA 1NJGA 4M9XA 2NUPB 2ZAGA 3OZCA 1TNDA 4R40A 3V55A 4HAVA 4FD2A 1SXJA 2Q0QA 4OHUA 1I5OA 4OPMA 3B2NA 5EYPB 1S8AA 4OATA 4N5NA 3QE0A 3LXMA 5DJ5A 3NBZC 4OFZA 4DV0B 3ZJYA 4CMBA 4YN3A 4C4TA 4Z4HA 2AG8A 5BVHB 4YVFA 3BH0A 5JZSA 5LQRA 2WYIA 3MINB 3RHSA 1JFRA 4CLDA 4H3SA 3RYCB 4X54A 3WICA 5AM2A 4EDHA 1AZSC 2CWDA 1GPBA 2ICAA 3ISJA 4JB3A 1J23A 1E8NA 3THXA 2W22A 3VH1A 1DRVA 3IAUA 2BL4A 4EY5A 3KDPA 3LHIA 2DWPA 3KB1A 4CI0B 3D4BA 1DCMA 1F2UB 3PQCA 1TU4A 1Y7LA 3N6XA 1CJUC 1CNFA 1O9GA 1D9ZA 2EATA 2F1JA 1U8YA 3A1WA 1QZ3A 4LVNA 1C1HA 5C1DA 1OTYA 3AYZB 3KALA 1JWAB 1N8SA 1M34B 1FYVA 1NC3A 5AK4A 1E3TA 1Y3DE 3I1FA 4X95A 2YYZA 4AUNA 3DAFA 2NYUA 3TLGB 4D43A 4RUKA 1QGAA 2IYVA 3MZ0A 2JHPA 2GNPA 5HYVA 1AHHA 4E3WA 1T5OA 4I4IA 3MB5A 4JBYA 4N82A 4UHBA 3E9NA 4JKYA 1CQIA 1R5OA 3UMFA 1P4GA 3RU3A 2DYKA 3EDMA 4RVGA 2WQ6A 3C0KA 2Z3WA 1N3BA 3AJ8A 4WT7A 4UXIA 4CG1A 2BFBA 3EXEA 3EDYA 5AJYA 3IV7A 1XCJA 2I7DA 4UDYX 5CGZA 4CXMA 3CT6A 5EKXA 1CHDA 4Z7QB 4UE6A 1RYDA 3EPJA 2AJLI 1N9ZA 4UUNA 4YV2A 4D0SA 5KKAA 3T3HA 1QPGA 1NUUA 1EHIA 2W7TA 3AY0A 5IARA 5AW3A 4AO7A 2FOXA 5DI3A 2ZUUA 5M04A 1L7PA 3BMNB 4RY2A 1C9MA 5CDUA 2KBFA 5FPPA 2QQGA 3RABA 3U13A 4X20B 5AVZA 4GNKA 3AVYA 3P0FA 3CR8A 1JTFA 3NRCA 2JLVA 1SQ5A 4MKIA 3AIKA 3NBKA 1F6WA 3L6UA 1JYSA 1A1SA 4NWIA 1PTJA 3S8EA 3DTVB 2JIPA 2W2VA 4K6MA 1CIJA 1I7QB 2SICE 4F6CA 4UM8B 1SOVA 2BKEA 2HQ1A 2I03A 3PRJA 3CPEA 1UH5A 2WJ6A 4NKRA 3VC1A 2ZRNA 4RA6B 1G55A 1H94A 2A33A 4U6SA 3DYBA 4RD0A 4E5UA 4BNJA 1I01A 2FW0A 1EINA 3AEQA 2B8JA 4MUEA 1LJLA 4HMQA 3ZWPA 4CQMA 1FJ2A 5AHWA 3OFND 2C3PA 3EIOA 1DJPA 4MTLA 4UNQA 1QH1A 2FE1A 3NUGA 3ZBUA 3ZDXB 2Q45A 3W5DA 4OXRA 2ON6A 4FX2A 3F7OA 3NDJA 4CUJA 2DFNA 1SFRA 1EDDA 1HXHA 4X0EA 1ZOSA 3MG9A 4YUVA 4CTKA 3V8VA 1CR2A 1SPBS 4BRZA 3OT5A 4U7PB 4U2BA 1FPQA 4FS8A 3WKBA 3ED1A 1B6TA 1GL9B 4JOQA 4GVPA 1PL6A 1O1YA 1E1MA 2VCEA 4YX9A 4ETWA 3ZD6A 3W7VA 1JI3A 1IJFA 2P4QA 5E2IA 2QD2A 1H9CA 2CJWB 2JFZA 2LWIA 1A27A 2VPYA 4GRIA 2HO4A 3NWPA 3F6PA 3OZTA 1JG7A 1ODTC 2VAMA 2DE0X 1TYZA 4PY2A 1II9A 5CB4A 4F84A 3GLHE 3TR6A 4URYR 4EG5A 2PZJA 2HW8A 4NENB 4BTLA 4W5TA 2VSFA 3TTUA 1HTBA 1QPBA 1NP7A 2GJAA 4Q9JA 1NN5A 4PYLA 4Z3DA 2FCAA 1O0CA 1MXHA 1GOTA 3GCWA 5HIMA 2P9ZA 3O4GA 4W8OA 3TW0A 3AL3A 3WGKA 1JZSA 3AF0A 3NHMA 4K0KB 2GJSA 4JLVA 1DRKA 3MMSA 3GJRA 5AKEA 5KWSA 2RHTA 3ZE9A 1D0IA 2CLIB 4BO3A 1KU6A 4IZ6A 5ALEA 1CZKA 2KB0A 1LUAA 3HJTA 3N0XA 1ND5A 4OJKA 4DMGA 1YS4A 2P2LA 3LYAA 4YJ2F 3WADA 3WRXC 1XQ9A 1X7YB 3C5EA 4AO8A 4HQNA 2OO7A 3HA7A 5A1TA 4RXUA 4OJNA 5AVSA 2FMTA 1L4YA 2WKRA 4JMLA 4JQYA 1VP9A 3AY7A 1LLDA 2RAUA 4FDUA 3UJ9A 4LTDA 5E6SA 3IXLA 4DRXB 2YWFA 3TZHA 2CVHA 2H1HA 3AJAA 3N39C 1Q84A 2JFHA 3D5TA 2A88A 3U4QB 1JMKC 2IHVA 2ZJ0A 4GLBA 5KOJA 1YE8A 4MLDA 3T3NA 2P90A 3O0TA 1VGVA 1G8JA 4KYTA 1R6UA 2QPOA 1D09A 4OQXA 4XD7A 3BKXA 4UHJA 1F6DA 2IYXA 4R31A 1C7ZA 3GI1A 1CR4A 2P1DA 2OAQ1 2GK6A 3BGOS 1NXXA 3OQHA 4TTVA 2XT0A 2O7SA 3N2LA 4NYMR 4WWHA 4K6HA 3T3DA 3IOCA 4EA9A 3QKSA 3CURA 3W4IA 4E12A 3FHTA 1S2GA 3LAWA 2CMFA 4IEEA 1N2SA 4LC0A 1EX9A 2OBNA 3BJMA 5LDHA 4AJ2A 3F6YA 2ZE5A 3PUIA 2AG1A 4RVDA 4TMKA 5CM8B 5MFZA 3HBMA 2VT2A 4ESEA 3G2LA 4I5FA 3Q98A 4YH1A 5M34A 2J9FA 1CJCA 2OP1A 3GZ4A 1SUIA 2FN7A 2W83A 4UTOA 4YAWA 1OFIA 4ID9A 5FOTA 5FR2A 3WK8A 4BJHB 5IK2A 3TOCA 1E99A 4CNQA 4J7XA 3V4VB 1B6SA 4G37A 1RZRA 4R2IA 4I5GA 2R8RA 4Y0VA 2OO5C 1BDHA 2ZWVA 3PNYA 4OMCA 4MRPA 4NE2A 5U9CA 4WKGA 3MTDA 1KJYA 1OH7A 1YO6A 3SZGA 3AB3A 3PFFA 3GJQA 2UZIR 4MRVA 1Q17A 1CS0A 3D9QX 3GPBA 4TLEA 5KYVA 2M1XA 1HG1A 1SKAA 3C41J 3IAM6 2H2IA 2HHAA 3B52X 2A6PA 1JFSA 2Q1XA 4MRAA 1H65A 4CT5A 3P0EA 2FZVA 3BVPA 2IP2A 4ND6A 5B1SA 4YAOA 2QRJA 1U2ZA 4HC4A 3QEMB 1IDOA 4U1RA 5GY7A 3EOZA 4OAPA 5A1JA 4L5IA 1LLQA 5ALGA 3DLBA 3FTFA 1QFSA 4GI2A 4MZXA 4FINA 1VMEA 1RI1A 3T6KA 5CDFA 1NE7A 1ADBA 3QQ5A 1E6UA 1G21E 2YHIA 1RLIA 1N2ZA 3K1AA 3LRXA 1EJBA 1K6XA 3OIVA 4JB8A 5DULA 5T3UA 4QREA 3S1LA 1FRVA 1LC3A 1TJ5A 5TRTA 1O6CA 3OZIA 4ALIA 2DH6A 2BEWB 4Z2YA 3HYNA 4OUDA 5ABPA 2P9FA 2VNKA 3ETDA 4E5MA 4BVGA 3FPKA 3P71T 3X3HA 3HY6A 4ROSA 5EWMB 1V1MB 2XUIA 1YFLA 3ZHBA 1IN4A 3G2PA 1J5EB 2TMYA 4WADA 5GIPE 4P5PA 4NH4A 2FHPA 1T3SA 4A2CA 1S4QA 3I62A 2QVXX 2NAPA 4C4AA 4R1LA 3NP9A 4RSMA 2G07A 3PFGA 3A37A 2WZDA 2KPOA 1FVFA 3CX3A 3EXFA 3FLEA 4NBNA 4ANFA 4WZAE 2P2CA 3FOEC 1E6LA 3D1JA 5DNDA 3EXHB 1TYBE 4BHTA 2XZOA 2QUIA 1A8PA 1NBMD 2GCOB 5JCZA 1I7DA 1M74A 3OU6A 1CP2A 1V7ZA 2BUBA 2PMBA 3CEJA 3HWWA 2A3NA 3UJ6A 1YVDA 3GPCA 1NF8A 4CQJA 5IMBA 3LRPA 5JYEA 2A2ZA 4R8LA 5IEJA 4DBVO 5KBYA 4YJ3F 1CE8B 3VHQA 4CKCB 3ETJA 3GJ3A 3S29A 3K09C 4WLVA 5E1MA 4R3UC 4RKFA 1EI9A 1IBCA 4YCBA 1HKUA 4UNNA 1L4UA 1E0JA 1R8JA 5LMNB 1YBAA 3D6MA 3TXXA 3NH6A 1RWXA 2AVDA 2Z04A 4FFMA 1CDDA 1J2EA 4QHSA 4ROTA 5IJ0B 4IUCS 3UT5B 1NZFA 2VDJA 5BV8A 4ZRNA 4I2VA 1VBNA 4PHGA 3R7FA 4S05A 1IK6A 3B6JA 1IUKA 4BWVA 2OYSA 3O74A 3KP1A 5A0FA 4U4AA 3C7TA 2H0RA 4LJ7A 3I42A 3PVCA 1OOEA 2ZP1A 5AK6A 3TLYA 4ER6A 1Q16A 2G5CA 4HDSA 4MEJA 4GRAA 1X74A 3SNKA 1MZPA 3NIGB 1JLMA 4URHA 5TQJA 4MYDA 4ER0A 1F8GA 4IV0A 4GUAA 5F3WB 5JJLA 4GX5A 4NDZA 3DWGA 5IXYA 3L1IA 2FKAA 1ZD4A 4PN7A 4ZVUA 1E9FA 1EM8B 2JFPA 2ZAOA 3TLJA 5CBPA 3AL2A 1V3QE 2HGZA 1EIWA 4JQZA 1Z0ZA 5CVCA 3R40A 2OCYC 1KU0A 4PPGA 2V7XA 3SZ3A 4KPYA 4TN1A 3GLTA 4DIOA 4YMWA 5BR7A 8MHTA 1TZJA 1ESMA 1QBKC 3B9RA 3NALA 4MPJA 5D2CA 3OM9A 1HEYA 4BFWA 1G3UA 2FW1A 1NRWA 3E5HA 4KK3A 2AQ8A 5L7TA 3OKCA 1ZUNA 3P45A 3BXHA 4I1OA 1BWPA 2ZDHA 3QEOA 2XCRB 4HEA1 4XB6B 2VBGA 2XCLA 5DLYA 1W36B 2O8DB 5TEVA 3FF4A 2WOJA 4MCHA 2QMZA 3EEFA 4H60A 5JXHA 1BE6A 3EW7A 3K53A 3C5HA 5JD6A 3DHEA 1L4FA 5DKFA 2RG7A 1T34A 5L3VA 2FH5B 3N76A 3NV9A 2X9LA 3NOVA 5GIOE 1E0KA 3QFHA 1UBLS 3HE3A 3LCVB 1NOJA 5HGXA 4DNPA 5F9FA 3GLSA 1FFCA 4D4KA 4V39A 1Z0DA 3CVXA 3PXCX 4Q7JB 1XZDA 1H42A 1BKYA 2EX0A 4B6PA 1EPUA 1I7SB 1QV9A 2QE7D 2MSDB 3C14C 1O2DA 1XHEA 2Q41A 1AHNA 1DG3A 1OAOC 5TR9A 3CEPB 4OJYA 3KV3O 3NDPA 2QR5A 4E5YA 3AF4A 3DOCA 3UMCA 4KVZA 1QF7A 2J0UB 4P32A 3PNOA 1DDOA 4RK7A 3VOAA 4V3BA 5LR6A 2YNMC 3SF8A 2OILA 2YYYA 1AS2A 2HCTA 1JDSA 4N8SA 5ALVA 2EP7A 4FB4A 5IXJA 1OW3B 4LJ9A 3HB5X 4KAJA 3HLKA 3LHSA 4B45A 5SZKB 2AMVA 2YASA 3LHFA 2PR2A 1YRLA 3R76A 3C6YA 3I3SR 4ZEVA 5C7LO 2O7VA 2O8FB 1FJXA 1GN9A 2VTVA 1WXEA 5MFPA 4FYIA 1NUAA 3I9LA 3IB6A 4O0MA 1CUGA 3DMGA 1EFHA 4WPGA 1YDHA 1MAAA 4DLZA 2HKIA 1X8LA 3A1CA 3WL3A 1P18A 3IAAA 2ZIXB 3ZIAD 3QLJA 4GU5A 3CUYA 2HSGA 1Z38A 1C7RA 3VYSB 4RMGA 1HT3A 1OLOA 4UHEA 4UC0A 4BB0A 2P1RA 1U63A 3L46A 4NBUA 2MSKA 3EEQA 3WI7A 1RYYA 3AI1A 2WM8A 4A0HA 4PFKA 2CXHA 4AJOA 1NVBA 4TV8B 1SOAA 1B8VA 2DWQA 4N5HX 1WB5A 2AXQA 2Q6IA 3O4JA 1XJWA 4CN9A 3KJHA 5L3SB 1YOBA 3JTEA 4Z1OA 1YACA 2FRDA 2VYND 1HDXA 4QPJC 4HXEB 1Y6ZA 1VIDA 3I2IA 4FJ1A 4DBLC 4P0PB 2LCIA 3TSZA 4EEXA 3LU1A 3UJDA 1ZNWA 3NH9A 4Q9IA 1S3FA 4U7GA 3RSHA 4ZHQA 3N2YA 4B9EA 3PHIA 3RVQA 3M6VA 3V2HA 5BWOA 3O9VA 4Q4HB 4JUBA 4JSRA 4URFA 2B4AA 4TMVA 2AQIA 1ZY2A 4JJAA 2AEEA 3QVUA 4LNUB 4RK4A 3ZNNA 1LX7A 1CP3A 1OZHA 2FX5A 4A8PA 1GGEA 2DR0A 3BMOB 4HGYA 2OPBA 2NAFA 4OQNA 3AK4A 3UAYA 1PE0A 1W0CA 3GA5A 4E33A 5LFAA 3PDIA 5FYDA 1E60A 1E7QA 1JKXA 3DMYA 3FF1A 1LSUA 1R15A 4YBRA 2A0KA 3HFRA 4BVEA 1Y8QA 2IF0A 1GWNA 3AEKA 4CM8B 4PO3X 2WT8A 2GAJA 3AVOA 3PL5A 4QM6A 3I12A 4TV9F 1CUUA 2XUKA 3STVA 3PQ8A 2XNDD 3L7AA 3WA6A 4MYUA 3RIHA 1GGKA 3FSGA 3L7OA 2WV7A 4PG6A 1G3QA 3WA7A 1RP7A 1KS9A 2IHJA 3OAAD 3TSAA 1ZMRA 2CLKB 2RHMA 3FDFA 1ZSNA 4GE0A 5EVCA 4PU0A 5FTLA 5EWLA 1E1RD 4CI9A 3K32A 2ZYTX 3A6ZA 5BXQC 4RVNA 3O8BA 4FR5A 4QOIA 3KYCA 4BB6A 3FDIA 3HG7A 4KG7A 1ESEA 4EUEA 3Q3JB 2RKWA 2ZEJA 821PA 1KORA 4GOND 4BLOA 3T4UA 1W4BA 1W6RA 2XOXA 4DIKA 3QLVC 3ZHRA 3E05A 3IAXA 4HGOA 2VK2A 1Q0HA 1U7OA 1T6XA 4FW9A 5AFSA 4P0TA 3OSZA 3IBYA 1OCEA 3NM4A 1WHSB 3I4FA 4AJEA 4N03A 2GBFA 4RDCA 1EB8A 4M60A 1JLHA 1QAOA 1PJCA 2XDAA 4PZEA 3T38A 5IAOA 4BS9A 2LZ0A 3BH6A 4IO1A 1ECGA 1DKLA 3LUKA 3OFSA 3QLTA 4JC8A 5I9SA 3SFVA 4YUYA 1I36A 1XDZA 1OVMA 1HE8B 3L0SA 4M0EA 4WW0A 3SXUB 1R6DA 2C0PA 5ALHA 2REOA 5HILA 4BVJA 2VEDA 1H1LA 3Q8WA 4FZVA 2QXUA 3T9AA 4GYJA 3R6LA 1U1EA 2BEVA 3ISVA 1WJGA 3PE4A 1VSBA 1H2YA 3H5OA 3L7MA 5CYPA 3B51X 3L6DA 4IKPA 2AWNA 4BMYA 5BR8B 3F8SA 3PQ4A 4FR2A 3C70A 4TROA 4D6YA 1EA5A 3TDNA 3ENWA 4JWTA 4O2BB 4R8RA 1JEQB 3RG8A 2Z1MA 3H2SA 2HWWA 3GBSA 2PUGA 2IEZA 4MYCA 2JHFA 3DMTC 4TGLA 3ZGNA 1P44A 2FPKA 4ZVOA 3CNHA 4QDXA 5ARDA 4EA7A 3OZVA 3OTIA 3DAGA 3ZLTA 1HQYE 3ABOB 3TXYA 2QY9A 4CMKA 2Q4DA 1FFXB 2GGSA 2GF9A 4Y2QA 3EWSA 2FWJA 4NBVA 2DQZA 3BCUA 1B0AA 5IANA 2F6RA 1HMYA 1Z75A 4FILA 3Q8MA 1NUSA 4GDMA 4LY0A 4QO8A 4Z8XA 1NHWA 1NQXA 5FLKA 5H1YA 2RGAA 3CUTA 1SCAA 2O8EB 3EAGA 5IJ9A 2P3SA 2XMSA 2X8JB 3O2JA 1OXVA 2DHCA 5COAA 4KOEC 1ULBA 3DXFA 4H0NA 4BCCA 4F4IA 3DV0B