4HNAD

Kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
GSDLGKKLLEAARAGQDDEVRILMANGADVNAEDDSGKTPLHLAAIKGHLEIVEVLLKHGADVNAADKMGDTPLHLAALYGHLEIVEVLLKNGADVNATDTYGFTPLHLAADAGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a kinesin-tubulin complex and implications for kinesin motility.
pubmed doi rcsb
source organism Artificial gene
molecule tags Motor protein
molecule keywords Tubulin alpha chain
total genus 53
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hnaD00
3JXIA 3KEAA 3EHQA 5BXUA 2F37A 4JB8P 3EHRA 4TUMA 5ENOD 5ENQD 5AAOA 3Q9NC 5CBNA 3ZUVB 4K5CA 1K1AA 4ZHBA 3LJNA 2MYOA 1YYHA 3V31A 5KBAA 4N5QA 4UUCA 1BI7B 4GMRA 4YDWA 5EYPF 2F8XK 2P2CP 1MX4A 5FINA 2AJAA 4HRLA 4DUIA 2Y0BG 2RFMA 4HB5A 2XEEA 1BI8B 2DZOA 2PNNA 3J5PA 4BSZB 5KWDA 3NOGD 1SW6A 4HNAD 3UI2A 4DX2A 3V79K 5JA4D 3UTMA 5EIBE 3EU9A 5ENRD 2XENA 4C48B 1DCQA 4DX1A 2ZGDA 1MYOA 4LNUD 4CYMD 4U8VD 5JMND 2B0OE 5ENPD 4F6RD 1BD8A 1G3NB 2RFAA 4HI9A 4BERA 5CEDB 4RLYA 3D9HA 1WDYA 3TWSA 3TWQA 2ZGGA 5ENSD 4OAVB 2QC9A 1D9SA 2DWZA 5HRYA 3TWVA 1OT8A 1SVXA 5EIDA 5AQ7A 3AJIA 4DRXE 1MJ0A 3T8KA 2DVWA 4U95D 1IKND 2ETBA 2ETCA 4O1PA 4DX7D 4BETA 4HRMB 5AN8A 3UXGA 3HRAA 2BKGA 1MX2A 3IXEA 4QFVA 3NBNB 2L6BA 1K3ZD 3F6QA 3JXJA 4BEPA 4HRNA 2XEHA 2Y1LE 5EILA 4YDYA 2QYJA 5BXOA 5CERB 5ITZF 5ENTD 4K5BA 5HS0A 4GPMA 4HQDA 3B95A 2NYJA 3C5RA 4BESA 3TWTA 3TWXA 3W9FA 4G8KA 5EYLA 2DZNA 2KXPC 3J5QB 1N0RA 4HI8A 1AP7A 1N11A 2V5QC 1DC2A 5EN5D 1YCSB 4LSZE 3ZKJA 2ETAA 2XZTG 4O1OA 3ZNGA 1UOHA 2BKKB 4QQIA 3TWUA 2A5EA 1MX6A 1N0QA 3Q9UC 4CZ2D 5FIOA 3TWRA 3HG0D 3DEPA 2JABA 5HKPA 2HE0A 4O60A 2J8SD 3AAAC 1OY3D 4G8LA 4J8YA 1IHBA 4OAUC 4K5AB 3SO8A 5AQ9A 2KBXA 2F8YA 1QYMA 5CEAA 1NFIE 4J7WA 4U8YD 5KNGA 3TWWA 4DX6D 4ZFHA 3DEOA 3B7BA 5KNHD 3ZU7B 1YMPA 3W9GA 1AWCB 5D66A 4HBDA 5AQBA 4B93B 2XZDG 4HLLA 1S70B 4NIKA 1TR4A 1A5EA 2V4HC 2VGEA 1BLXB 5AARA 4ATZD 5CBOA 1WG0A 4LG6A 5CECB 4U96D 3V2XA 3JUEA 5AQAA 4A63B 3NOCD 1BU9A 4DX5D 1K1BA 3V2OA 3V30A 4F1PA 4Z68A 2FO1E 3T9KA 1IXVA
chains in the Genus database with same CATH superfamily
2EIJE 3PS6A 3ZUVB 3MZLB 3U9WA 2GRRB 3D9JA 3FTZA 4Y6CA 3HXFA 4ME2A 2WXRA 2Y4TA 4WWOA 1E7VA 3DSSA 4ANVA 5EX0A 4GTVA 3AS4A 2P9PG 3CSTA 4GTMA 1TJFA 2OOEA 3ZYKA 4NACA 1NP7A 5ENPD 5BV0A 4JVSA 2PQRA 4HOSA 1U3CA 3NQPA 4G2VA 3TWVA 4MS6A 2BKGA 1K3ZD 5AJLA 5JHBA 4NQ0A 4GZDA 4YDYA 3JQ0A 3LVQE 3VLFA 2IJGX 3MKQA 4BESA 1JCQA 3ZPJA 3UM0A 2ETAA 2XZTG 4WNGA 3RRMB 4JA9A 4GTPA 2QY7A 3GZSA 3DSTA 1QZ2A 4J0UA 1TNYA 4L23A 4J6IA 1LTXA 3QWVA 1JCSA 1UN9A 1YMPA 4G23A 1IQUA 2XEVA 1N52A 3AG1E 2IFUA 3V2XA 5AQAA 4N3CA 1HG2A 5G05J 2J09A 4L2YA 5G04C 1E8WA 3CHMA 2CG2A 3I4RB 5D0OD 2BTDA 5AIJA 3AG4E 4Q96A 3SBSA 4BSZB 3IHVA 3ZRHA 3GZ2A 5ARFA 1MZCA 3Q78A 1LD7A 3PNTB 3D9MA 4WAFA 3ASNE 2JLBA 5LX8A 2KCVA 4HVBA 2B0OE 4IN3B 5E75A 1BD8A 2PM7A 4RLYA 4FA6A 3SBTB 2CHZA 4NRHB 1OT8A 3E34A 2P58C 3CVQA 3PZ1A 4YDEA 4TRQA 1X81A 2E0IA 3HRAA 3C98A 4B89A 3IXEA 4JEUA 1O1SA 1SA4A 3LYAA 5EILA 1KPSB 3B13A 3FTXA 3LJ3A 5CERB 3MKQB 3ABKE 1QBQA 3DSVA 5M72A 2I6HA 3RSEG 2CHWA 5EYLA 1IYGA 3D9PA 5CRVA 2LSUA 4HI8A 2EIME 4KZCA 1YCSB 4EZKA 3HDXA 4GA1A 3OTNA 3QK0A 3L13A 3PZ4A 3FTWA 5E76A 4CGWA 2KBXA 1E8YA 3R9MA 4CCAA 2VSXE 3TL5A 4HBDA 3APFA 4J8SA 4HLLA 4NIKA 4MLPA 1HG5A 2XHEA 3ASDA 5DBKA 4DX5D 3DWLG 3T5VA 1LD8A 2WXHA 3JXIA 3EHRA 3FU6A 3DSWA 5KBAA 3RO3A 5FINA 3SNXA 2VTBB 3VTYA 3DXMG 2GGFA 2NC9A 2R59A 3S7DA 3MCXA 2ZGDA 4EECA 1SZ9A 4RVBA 3SQVA 4N5CA 1WY6A 4U04A 4GMJA 3RO2A 3E33A 4DX7D 3TGOA 3AU4A 5LCWC 4QFVA 3NBNB 3DBSA 3FULA 1Z3YA 3U4TA 2C0MA 2Y1LE 2H6GA 5AJDA 4N39A 2RG8A 2A5UA 3MEKA 3HIZA 4UQYA 5B1BE 4H7XA 2P9UG 1W3BA 3FUIA 4AY5A 5LCWJ 4OYSA 4CZ2D 2P9LG 3L08A 2HE0A 2X6IA 4KZ0A 4FLBA 2VGYA 4G26A 5KNHD 1AWCB 1TEZA 3C3RA 1OCCE 3D9KA 1KT1A 2YNQA 3PREA 2OEWA 4A3VA 3FTUA 5C2YA 3PEVB 4WNFA 2AXUA 3CQCB 3K9IA 3UUXA 2ZISA 4K5CA 3RU0A 4GA0A 2VSOE 4GMRA 2F8XK 1MX4A 1N4PA 3EHNA 1FVHA 4U63A 2WXGA 2LXLA 4TXQA 5CMYA 4A1SA 3CQGB 3HVEA 4UQXA 2EILE 1S0PA 2X6FA 2R03A 1UN8A 4AOFA 5BV1A 1JWGA 5B1AE 4FADA 3LS8A 1OWMA 1PAQA 1SVXA 3PUKA 4UQZA 2V8SE 2ETCA 4UI9K 3IKOB 2UY1A 1L5JA 3CLJA 3F6QA 5BXOA 1LF8A 3CKBA 4U7EB 3CK8A 4WWNA 2C2LA 3CVPA 3E32A 2IU1A 3SHFA 3PVLA 2V5QC 5FZQA 2X6JA 1UOHA 1E90A 5FIOA 3ABME 3CVVA 2J8SD 5JJ7A 1OY3D 2GRMA 3ABLE 5FWQA 4DJAA 3FUMA 3EIQC 2MOWA 4J8DA 4IYPA 4EPZA 1FT1A 5D0QD 3ZU7B 3SZ7A 4W9RA 4L7TA 2X3MA 2FULA 1BU9A 2A4ZA 3SI5A 3ESKA 1K1BA 3TG5A 1FPPA 3E37A 2F37A 4XKCA 2CG3A 5AAOA 4GZ5A 4PUCA 4ZHBA 3LDZA 3RJVA 1FCHA 3IHYA 4HRLA 3GZ1A 3PDNA 3ONKA 2Y69E 3ULQA 2VGXB 3MX3A 5HI7A 4Q69A 3ASFA 3CVLA 3E30A 3BU8A 4JC8A 5AQ7A 3JUIA 1TNOA 4KXKB 2HYZA 3CVYA 2ETBA 4CT0A 3QNKA 4BETA 3ONLA 4M3OA 2VSYA 1OWOA 2AWIA 4FU3A 2P9KG 4DPRA 2KATA 4I9CA 5ITZF 5AENA 3QB2A 4I6EA 1EF1C 4JHKA 3TJPA 3IBEA 3N71A 3LVRE 1HH8A 4HOTA 1FT2A 4URKA 4PS3A 5ARGA 5FZRA 2A5EA 2J08A 5JJTA 2YHEA 3SO8A 2H6FA 3AS5A 3HYMB 2F8YA 3LY8A 5D66A 1A17A 1ELRA 2YHCA 2HO1A 1E96B 2V4HC 5JHAA 3ZN3A 3L6AA 2QZAA 4WNDA 2CFZA 2I1JA 3BQOA 1UJJA 2ONDA 4LEUA 3UQ3A 2AW6A 3DRAA 3R7QA 5ANRA 3UT8A 3MYVA 4XX5A 5FZSA 1SQMA 4YDOA 4EHMA 4N2SA 1N4RA 3IV0A 3FTVA 3UTMA 3FUJA 2RKKA 2YQ8A 4BERA 4I2WA 3X2QE 3D9HA 4BWRA 3CHSA 3FUEA 4GMLA 3UM2A 2LSVA 5EDSA 3RRUA 4O1PA 4F7AA 3WXXA 1ZBPA 2GRQB 2V5FA 1OWPA 4XZ4A 4UWGA 5ENTD 3L82A 2XS1A 5EKQD 1H6PA 3R9AB 3LKUA 1O1RA 2XGMA 2X6KA 4AJWA 3S7FA 1MX6A 5CCLA 2XRYA 5FQ6A 3JQ1A 4IULA 3HXEA 5BUZA 5LP0A 3PZ3A 2P9SG 4KBQA 4GYYA 4L2LA 4XIFA 2KZTA 1EYHA 2J4DA 2HM8A 2DCPA 3ZFWA 4X8QA 4TV3A 1Z6TA 3JYSA 2GRNB 3LEWA 1BI8B 2DZOA 5KWDA 4ATGA 3QC1A 5C1DA 4C48B 4RG6A 1DCEA 4U8VD 4GPKA 5CEDB 3CEQA 4N3BA 4BSXA 4UWFA 3ULYA 1E8ZA 2P9IG 4HRNA 2L6JA 1XNFA 1TNUA 3FUFA 4JPSA 4CEMA 2BF0X 1D8EA 1WAO1 2DZNA 3E4BA 1E8XA 4BFRA 1KT0A 2M63A 3ZNGA 5BW8C 2VTBA 3CV0A 2PM6A 5JJ6A 4G8LA 4JEHA 4BX8A 3QWPA 3CGHA 2R05A 3FY4A 3C72A 4XEIG 2CFUA 2HR2A 3CVWA 2V4LA 3FUKA 1S70B 3DPYA 1OCOE 3QJZA 1U2VG 4E6HA 4FHKA 1RW2A 5BPPA 2UWJG 5ENQD 1PC2A 4GA2A 1K8KG 2MYOA 1Z5SC 3TXNA 2RFMA 5BT1A 3VTXA 3S7BA 2GROB 2P9NG 4BTAA 3LY9A 4GTOA 3KAEA 2KZTB 4OVVA 4GTRA 3EIJA 3PE4A 4HOQA 4U0SA 2XENA 2IONA 4GYOA 3DXKG 2WXOA 5FTPA 1TNZA 2FO7A 2QYUA 3Q7FA 1NZNA 4F6RD 2VGXA 5HRYA 5CCMA 4ACLA 1MJ0A 2R5SA 3Q73A 3PE3A 3MGBA 2AXVA 3EUVA 3CVXA 1TN7A 1EDUA 2RD0A 2R02A 2WXFA 1HX8A 3CSFA 5T3RA 3PNLB 5ENNA 1S63A 4U07A 4EBAG 4CDRA 1EPUA 4QQIA 3AG3E 5EX3A 4JHJA 4U0ZA 3DEPA 3AAAC 1IHBA 2OCCE 4K5AB 5AQ9A 3UX4A 3KSLA 1TYQG 4ABNA 2IOLA 3W9GA 2IEJA 1JPLA 1HE8A 4LUNU 4ACKA 5DIZA 1BPOA 5KJMA 4OVUA 4EBAA 3HXDA 3D9LA 4BTBA 1ELKA 3S2AA 4GYWA 4L9PA 3D9NA 2H6HA 3KSQA 1QQEA 3FU3A 2WMOA 2IOSA 3DSXA 2OEVA 3UKUG 4LNGA 1MQSA 3NAWA 4AXHA 5T8IA 3NF1A 5D2MC 4M7CA 4C0EA 2NSZA 2XQ0A 1Q2ZA 3OXGA 3ZGQA 4IRUA 3HVEB 5FQ4A 2VQ2A 2DVWA 4U95D 5KJKA 4TUUA 3G2SA 3B7SA 4ANUA 4J8EA 3Q79A 3G2WA 2I2OA 3VLDA 3TWXA 3W9FA 1AP7A 1TNBA 2VYIA 4LNBA 4CDMA 3ZKJA 2LUHA 4DI4A 4HLEA 4HORA 2KCLA 1OUVA 3ML8A 4OAUC 4DLOA 3G2VA 2XCBA 4GAAA 3CHPA 4L1BA 3B7BA 1P5QA 4FP7A 4FJYA 1A5EA 5CRUA 2IY0C 4CRWA 2BUGA 1IQRA 4JXTA 4KVOA 4A63B 4XKBA 1HXIA 2DIWA 3ZW3A 4N5QA 4GZ6A 5BNWA 5B3SE 2P2CP 2AJAA 3APCA 2E2EA 3UI2A 2FEZA 4AY6A 3NZSA 4WNEA 3V79K 1UJKA 2WXNA 3U64A 2KCKA 3MJWA 2NXPA 1V55E 5T4YA 3NB2A 3O4ZA 3FUHA 2RFAA 5FQ7A 2XGOA 2BEDA 1D9SA 1ZB1A 2GRLA 3AJIA 4N2QA 4I6GA 2X38A 3D9OA 3CHRA 4I17A 1JCRA 4HQDA 4PS7A 1Z3XA 3B95A 3TWTA 1KZOA 4G8KA 1HZ4A 1N11A 3TAXA 3QWWA 4O1OA 4XI0A 1SZAA 2Q7FA 4TXRA 2Y4UA 3TWRA 3KEZA 4FHJA 4GZCA 4UWHA 4FULA 1H6OA 2WPVA 1NFIE 4J7WA 4DX6D 4ZFHA 3ZHEB 1B89A 4A3TA 4C9BB 4APFA 1HU3A 1WM5A 1TR4A 3B7TA 4RG9A 1WG0A 1N4SA 4H7YA 3CHQA 3QARA 4G1TA 5H7PA 1OCZE 5G04J 3UPVA 3SY2A 1V54E 4Z68A 2FO1E 3T9KA 3FUNA 1Y8MA 4AV7A 1BI7B 1FVFA 4DUIA 4I43A 1H2TC 3P2BA 2Y3AA 1SW6A 3D3MA 4HNAD 3ZXPA 4DX2A 2OV8A 1HS6A 3U3WA 2J9QA 3QOUA 1ZU2A 3ENEA 3HXBA 4CYMD 2WVIA 3D9IA 3FTYA 3ZEFA 2WXLA 4N3AA 2ZGGA 4C0MA 4V3IA 1UW4B 2FI7A 3MKRA 3UXGA 1OWNA 2L6BA 5ANLA 4AIFA 1OWLA 4DI3A 3Q5MA 1KLXA 2YINA 4UI9C 4UWLA 2NYJA 3DSUA 3EHMA 3J5QB 4BT8A 2XGSA 1DVPA 3QDNA 4B0ZA 4APOA 5J08A 3FFLA 4O60A 2OVFA 5HQ8A 1H19A 3G2UA 3PZDA 4U8YD 2WQHA 3FWVA 4ILGA 2WXKA 4U0UA 3S7JA 3CVNA 4KYOB 3AG2E 4YNDA 1UG3A 1N95A 1E7UA 2VGEA 1IHGA 5LFAA 4GB9A 1HF8A 1INZA 3JUEA 5CMWA 2L0TB 3LJNA 1PY1A 5A7DB 4G24A 3PH0C 2AVPA 1HFAA 2H6IA 2WQ6A 3RIBA 4B8CB 2L9BA 2I1KA 3EU9A 1MYOA 3P1UA 3AS8A 1G3NB 3TWSA 3O48A 5ENSD 2QC9A 3LXUX 2WM9A 3UKRG 4KMOA 4XE0A 1IKND 3APDA 3LY7A 3DPDA 4FC8A 3GYZA 2EQXA 3U66A 3ZYLA 2WXMA 4BT9A 4HOUA 2QYJA 1NA0A 3UIOC 4EZJA 3C5RA 4RQIA 4G25A 4LERA 5G55A 2OVBA 4F3VA 5A6CA 3RKVA 5IY5E 4JZYA 3L17A 2BKKB 2XPZA 4JD2G 1SA5A 3SFYA 3T8MA 3TG4A 3KD7A 4ILHB 4D10C 1U3DA 2WXJA 2R17C 2F0YA 3DEOA 2LO6A 2I9CA 3UINC 4LRZA 2XZDG 4MBGA 5LOZA 2XPYA 5AARA 4ATZD 4AEZC 4LG6A 4I1OB 5FQ8A 3V2OA 3V30A 3KEAA 5CHEE 2JEKA 3Q9NC 1H2VC 1YYHA 4UUCA 2C0LA 4DLQA 3L16A 3PEUB 3UM3A 3CK9A 3ZYQA 4CT4A 3ZXSA 3FHEA 3QKYA 4BY6A 3MA5A 4YVOA 3TWQA 1NL4A 2DWZA 4XI9A 5FJYA 3IEGA 2J4BA 3ZIMA 3RAUA 2LXMA 2PQNA 2DYRE 2XRZA 4AVXA 4K5BA 3MV2B 3SGHA 1N54A 3ASGA 3LPZA 4TXPA 4K0RA 4GTQA 4O6FA 5EN5D 4E85A 1RZ4A 3HG0D 2GRPB 5HKPA 5BXUA 3UT7A 4F1SA 1QNFA 2ZU6B 2WXQA 5CEAA 1GW6A 2ILRA 4I2ZA 3UM1A 3CK7A 4B93B 4JW1A 3CR3A 2ZIRA 3PRZA 3T5XA 3LCAA 1MHQA 3AU5A 5CBOA 2PL2A 5CECB 2LAIA 4U96D 2EINE 3NOCD 4WWPA 2ZXWE 3EDTB 1TJCA 3EHQA 4GTTA 3UMVA 5ENOD 4TUMA 5CBNA 3V31A 4EZLA 5EYPF 4KT6B 4HB5A 2XEEA 3FEXA 4AP2A 2IQCA 2WB2A 5EIBE 4GCNA 5ENRD 4DX1A 4NURA 2L0IA 4AM9A 4YVQC 1WDYA 2UY1B 3CIAA 2IO2C 5EIDA 3ASHA 4DRXE 3WG7E 4HRMB 3B7RL 5FT9A 3ML9A 3EJNA 4GPMA 3Q15A 5A23A 2KXPC 4HS2A 2XPIA 4R7LA 5KJNA 2AXZA 3ZVVA 1H2UA 5KCMA 4F53A 1N0QA 2IO3C 3Q7AA 3FH8A 2MRIA 2WXPA 3BUAA 4HXIA 1QYMA 4JHRA 3L9TA 1HO8A 1YA0A 4CGVA 4PH4B 3GW4A 2VJ8A 1N4QA 4MKTA 3ESLA 1IXVA 3FDHA 3UIPC 4GZ3A 4JA7A 4JB8P 1OXJA 3HXCA 3R7RA 2LNIA 4YDWA 3NZUA 4ILIA 2Y0BG 2WXIA 3NOGD 3SFZA 2J07A 3SFXA 1DCQA 1H0AA 3Q49B 4LNUD 3L54A 2KC7A 5JMND 3BG1B 4K03A 4RSYA 3BEEA 1JWFA 3FP3A 3FTSA 2LAHA 3B7UX 1N94A 4G11A 2QFCA 3ULEG 3CKCA 3OXFA 4J8FA 3QAQA 4BX9A 1OCRE 3CHOA 1NI1A 3ISMC 2EIKE 4UI9J 4PS8A 2MHKA 3HHMA 4GCOA 1N0RA 4B94A 5J90A 1O5MA 4FLHA 4KVMA 4LSZE 2FBNA 1KZPA 3TWUA 3Q9UC 2XCCA 5HS0A 3L22A 2JABA 5AYWD 4J8YA 3Q4AB 3SD5A 2DYSE 1Y6IA 1X5BA 3TWWA 1NA3A 5KNGA 4Q94A 4MRUA 5AQBA 4EQFA 1TN6A 4I9EA 3UT4A 4A1GA 3FU0A 1BLXB 3C3OA 1TN8A 3Q75A 4F1PA 3ZHEA 2KM4A 4I6JA 1XGWA 3PUJA 3ZYMA 1K1AA 4Y6WA 3RRNB 1S64A 3ASOE 2PNNA 3J5PA 3FEYA 4CDNA 3URZA 3I4GA 4JL0A 4I1AA 1N9AA 2J49A 4DK5A 2V0PA 5JA4D 1JUQA 3FUDA 3MV3B 1VDYA 5KJLA 4HFGA 3RK6A 2PZIA 4HI9A 4WUYA 2X6HA 4OAVB 2R2LA 3SF4A 3OXLA 3TXMA 4GU5A 4UWKA 4GTSA 2IF4A 3T8KA 1ELWA 5G05C 5AN8A 5G2NA 1MX2A 3Q47B 3JXJA 4LCTA 4BEPA 2CHXA 2XEHA 3KS2A 3I3NA 4FJZA 3JCKC 3VLEA 4ANWA 3FU5A 3CVUA 3BG0B 2FF4A 2DBAA 2XS8A 1D8DA 1O1TA 1DC2A 2WQ7A 4I1MA 3FH5A 3G2TA 3FH7A 4A55A 4B8AA 3PZ2A 1H6KA 2WMNA 4P29A 4PDXA 3EU5A 4U8HA 3C3QA 2B6CA 3OAWA 3I5PA 2GW1A 1DNPA 4ANXA 2VSNA
chains in the Genus database with same CATH topology
3JXIA 3KEAA 3EHQA 5BXUA 2F37A 4JB8P 3EHRA 4TUMA 5ENOD 5ENQD 5AAOA 3Q9NC 5CBNA 3ZUVB 4K5CA 1K1AA 4ZHBA 3LJNA 2MYOA 1YYHA 3V31A 5KBAA 4N5QA 4UUCA 1BI7B 4GMRA 4YDWA 5EYPF 2F8XK 2P2CP 1MX4A 5FINA 2AJAA 4HRLA 4DUIA 2Y0BG 2RFMA 4HB5A 2XEEA 1BI8B 2DZOA 2PNNA 3J5PA 4BSZB 5KWDA 3NOGD 1SW6A 4HNAD 3UI2A 4DX2A 3V79K 5JA4D 3UTMA 5EIBE 3EU9A 5ENRD 2XENA 4C48B 1DCQA 4DX1A 2ZGDA 1MYOA 4LNUD 4CYMD 4U8VD 5JMND 2B0OE 5ENPD 4F6RD 1BD8A 1G3NB 2RFAA 4HI9A 4BERA 5CEDB 4RLYA 3D9HA 1WDYA 3TWSA 3TWQA 2ZGGA 5ENSD 4OAVB 2QC9A 1D9SA 2DWZA 5HRYA 3TWVA 1OT8A 1SVXA 5EIDA 5AQ7A 3AJIA 4DRXE 1MJ0A 3T8KA 2DVWA 4U95D 1IKND 2ETBA 2ETCA 4O1PA 4DX7D 4BETA 4HRMB 5AN8A 3UXGA 3HRAA 2BKGA 1MX2A 3IXEA 4QFVA 3NBNB 2L6BA 1K3ZD 3F6QA 3JXJA 4BEPA 4HRNA 2XEHA 2Y1LE 5EILA 4YDYA 2QYJA 5BXOA 5CERB 5ITZF 5ENTD 4K5BA 5HS0A 4GPMA 4HQDA 3B95A 2NYJA 3C5RA 4BESA 3TWTA 3TWXA 3W9FA 4G8KA 5EYLA 2DZNA 2KXPC 3J5QB 1N0RA 4HI8A 1AP7A 1N11A 2V5QC 1DC2A 5EN5D 1YCSB 4LSZE 3ZKJA 2ETAA 2XZTG 4O1OA 3ZNGA 1UOHA 2BKKB 4QQIA 3TWUA 2A5EA 1MX6A 1N0QA 3Q9UC 4CZ2D 5FIOA 3TWRA 3HG0D 3DEPA 2JABA 5HKPA 2HE0A 4O60A 2J8SD 3AAAC 1OY3D 4G8LA 4J8YA 1IHBA 4OAUC 4K5AB 3SO8A 5AQ9A 2KBXA 2F8YA 1QYMA 5CEAA 1NFIE 4J7WA 4U8YD 5KNGA 3TWWA 4DX6D 4ZFHA 3DEOA 3B7BA 5KNHD 3ZU7B 1YMPA 3W9GA 1AWCB 5D66A 4HBDA 5AQBA 4B93B 2XZDG 4HLLA 1S70B 4NIKA 1TR4A 1A5EA 2V4HC 2VGEA 1BLXB 5AARA 4ATZD 5CBOA 1WG0A 4LG6A 5CECB 4U96D 3V2XA 3JUEA 5AQAA 4A63B 3NOCD 1BU9A 4DX5D 1K1BA 3V2OA 3V30A 4F1PA 4Z68A 2FO1E 3T9KA 1IXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXI A;  3KEA A;  3EHQ A;  5BXU A;  2F37 A;  4JB8 P;  3EHR A;  4TUM A;  5ENO D;  5ENQ D;  5AAO A;  3Q9N C;  5CBN A;  3ZUV B;  4K5C A;  1K1A A;  4ZHB A;  3LJN A;  2MYO A;  1YYH A;  3V31 A;  5KBA A;  4N5Q A;  4UUC A;  1BI7 B;  4GMR A;  4YDW A;  5EYP F;  2F8X K;  2P2C P;  1MX4 A;  5FIN A;  2AJA A;  4HRL A;  4DUI A;  2Y0B G;  2RFM A;  4HB5 A;  2XEE A;  1BI8 B;  2DZO A;  2PNN A;  3J5P A;  4BSZ B;  5KWD A;  3NOG D;  1SW6 A;  4HNA D;  3UI2 A;  4DX2 A;  3V79 K;  5JA4 D;  3UTM A;  5EIB E;  3EU9 A;  5ENR D;  2XEN A;  4C48 B;  1DCQ A;  4DX1 A;  2ZGD A;  1MYO A;  4LNU D;  4CYM D;  4U8V D;  5JMN D;  2B0O E;  5ENP D;  4F6R D;  1BD8 A;  1G3N B;  2RFA A;  4HI9 A;  4BER A;  5CED B;  4RLY A;  3D9H A;  1WDY A;  3TWS A;  3TWQ A;  2ZGG A;  5ENS D;  4OAV B;  2QC9 A;  1D9S A;  2DWZ A;  5HRY A;  3TWV A;  1OT8 A;  1SVX A;  5EID A;  5AQ7 A;  3AJI A;  4DRX E;  1MJ0 A;  3T8K A;  2DVW A;  4U95 D;  1IKN D;  2ETB A;  2ETC A;  4O1P A;  4DX7 D;  4BET A;  4HRM B;  5AN8 A;  3UXG A;  3HRA A;  2BKG A;  1MX2 A;  3IXE A;  4QFV A;  3NBN B;  2L6B A;  1K3Z D;  3F6Q A;  3JXJ A;  4BEP A;  4HRN A;  2XEH A;  2Y1L E;  5EIL A;  4YDY A;  2QYJ A;  5BXO A;  5CER B;  5ITZ F;  5ENT D;  4K5B A;  5HS0 A;  4GPM A;  4HQD A;  3B95 A;  2NYJ A;  3C5R A;  4BES A;  3TWT A;  3TWX A;  3W9F A;  4G8K A;  5EYL A;  2DZN A;  2KXP C;  3J5Q B;  1N0R A;  4HI8 A;  1AP7 A;  1N11 A;  2V5Q C;  1DC2 A;  5EN5 D;  1YCS B;  4LSZ E;  3ZKJ A;  2ETA A;  2XZT G;  4O1O A;  3ZNG A;  1UOH A;  2BKK B;  4QQI A;  3TWU A;  2A5E A;  1MX6 A;  1N0Q A;  3Q9U C;  4CZ2 D;  5FIO A;  3TWR A;  3HG0 D;  3DEP A;  2JAB A;  5HKP A;  2HE0 A;  4O60 A;  2J8S D;  3AAA C;  1OY3 D;  4G8L A;  4J8Y A;  1IHB A;  4OAU C;  4K5A B;  3SO8 A;  5AQ9 A;  2KBX A;  2F8Y A;  1QYM A;  5CEA A;  1NFI E;  4J7W A;  4U8Y D;  5KNG A;  3TWW A;  4DX6 D;  4ZFH A;  3DEO A;  3B7B A;  5KNH D;  3ZU7 B;  1YMP A;  3W9G A;  1AWC B;  5D66 A;  4HBD A;  5AQB A;  4B93 B;  2XZD G;  4HLL A;  1S70 B;  4NIK A;  1TR4 A;  1A5E A;  2V4H C;  2VGE A;  1BLX B;  5AAR A;  4ATZ D;  5CBO A;  1WG0 A;  4LG6 A;  5CEC B;  4U96 D;  3V2X A;  3JUE A;  5AQA A;  4A63 B;  3NOC D;  1BU9 A;  4DX5 D;  1K1B A;  3V2O A;  3V30 A;  4F1P A;  4Z68 A;  2FO1 E;  3T9K A;  1IXV A; 
#chains in the Genus database with same CATH topology
 2EIJ E;  3PS6 A;  3ZUV B;  3MZL B;  3U9W A;  2GRR B;  3D9J A;  3FTZ A;  4Y6C A;  3HXF A;  4ME2 A;  2WXR A;  2Y4T A;  4WWO A;  1E7V A;  3DSS A;  4ANV A;  5EX0 A;  4GTV A;  3AS4 A;  2P9P G;  3CST A;  4GTM A;  1TJF A;  2OOE A;  3ZYK A;  4NAC A;  1NP7 A;  5ENP D;  5BV0 A;  4JVS A;  2PQR A;  4HOS A;  1U3C A;  3NQP A;  4G2V A;  3TWV A;  4MS6 A;  2BKG A;  1K3Z D;  5AJL A;  5JHB A;  4NQ0 A;  4GZD A;  4YDY A;  3JQ0 A;  3LVQ E;  3VLF A;  2IJG X;  3MKQ A;  4BES A;  1JCQ A;  3ZPJ A;  3UM0 A;  2ETA A;  2XZT G;  4WNG A;  3RRM B;  4JA9 A;  4GTP A;  2QY7 A;  3GZS A;  3DST A;  1QZ2 A;  4J0U A;  1TNY A;  4L23 A;  4J6I A;  1LTX A;  3QWV A;  1JCS A;  1UN9 A;  1YMP A;  4G23 A;  1IQU A;  2XEV A;  1N52 A;  3AG1 E;  2IFU A;  3V2X A;  5AQA A;  4N3C A;  1HG2 A;  5G05 J;  2J09 A;  4L2Y A;  5G04 C;  1E8W A;  3CHM A;  2CG2 A;  3I4R B;  5D0O D;  2BTD A;  5AIJ A;  3AG4 E;  4Q96 A;  3SBS A;  4BSZ B;  3IHV A;  3ZRH A;  3GZ2 A;  5ARF A;  1MZC A;  3Q78 A;  1LD7 A;  3PNT B;  3D9M A;  4WAF A;  3ASN E;  2JLB A;  5LX8 A;  2KCV A;  4HVB A;  2B0O E;  4IN3 B;  5E75 A;  1BD8 A;  2PM7 A;  4RLY A;  4FA6 A;  3SBT B;  2CHZ A;  4NRH B;  1OT8 A;  3E34 A;  2P58 C;  3CVQ A;  3PZ1 A;  4YDE A;  4TRQ A;  1X81 A;  2E0I A;  3HRA A;  3C98 A;  4B89 A;  3IXE A;  4JEU A;  1O1S A;  1SA4 A;  3LYA A;  5EIL A;  1KPS B;  3B13 A;  3FTX A;  3LJ3 A;  5CER B;  3MKQ B;  3ABK E;  1QBQ A;  3DSV A;  5M72 A;  2I6H A;  3RSE G;  2CHW A;  5EYL A;  1IYG A;  3D9P A;  5CRV A;  2LSU A;  4HI8 A;  2EIM E;  4KZC A;  1YCS B;  4EZK A;  3HDX A;  4GA1 A;  3OTN A;  3QK0 A;  3L13 A;  3PZ4 A;  3FTW A;  5E76 A;  4CGW A;  2KBX A;  1E8Y A;  3R9M A;  4CCA A;  2VSX E;  3TL5 A;  4HBD A;  3APF A;  4J8S A;  4HLL A;  4NIK A;  4MLP A;  1HG5 A;  2XHE A;  3ASD A;  5DBK A;  4DX5 D;  3DWL G;  3T5V A;  1LD8 A;  2WXH A;  3JXI A;  3EHR A;  3FU6 A;  3DSW A;  5KBA A;  3RO3 A;  5FIN A;  3SNX A;  2VTB B;  3VTY A;  3DXM G;  2GGF A;  2NC9 A;  2R59 A;  3S7D A;  3MCX A;  2ZGD A;  4EEC A;  1SZ9 A;  4RVB A;  3SQV A;  4N5C A;  1WY6 A;  4U04 A;  4GMJ A;  3RO2 A;  3E33 A;  4DX7 D;  3TGO A;  3AU4 A;  5LCW C;  4QFV A;  3NBN B;  3DBS A;  3FUL A;  1Z3Y A;  3U4T A;  2C0M A;  2Y1L E;  2H6G A;  5AJD A;  4N39 A;  2RG8 A;  2A5U A;  3MEK A;  3HIZ A;  4UQY A;  5B1B E;  4H7X A;  2P9U G;  1W3B A;  3FUI A;  4AY5 A;  5LCW J;  4OYS A;  4CZ2 D;  2P9L G;  3L08 A;  2HE0 A;  2X6I A;  4KZ0 A;  4FLB A;  2VGY A;  4G26 A;  5KNH D;  1AWC B;  1TEZ A;  3C3R A;  1OCC E;  3D9K A;  1KT1 A;  2YNQ A;  3PRE A;  2OEW A;  4A3V A;  3FTU A;  5C2Y A;  3PEV B;  4WNF A;  2AXU A;  3CQC B;  3K9I A;  3UUX A;  2ZIS A;  4K5C A;  3RU0 A;  4GA0 A;  2VSO E;  4GMR A;  2F8X K;  1MX4 A;  1N4P A;  3EHN A;  1FVH A;  4U63 A;  2WXG A;  2LXL A;  4TXQ A;  5CMY A;  4A1S A;  3CQG B;  3HVE A;  4UQX A;  2EIL E;  1S0P A;  2X6F A;  2R03 A;  1UN8 A;  4AOF A;  5BV1 A;  1JWG A;  5B1A E;  4FAD A;  3LS8 A;  1OWM A;  1PAQ A;  1SVX A;  3PUK A;  4UQZ A;  2V8S E;  2ETC A;  4UI9 K;  3IKO B;  2UY1 A;  1L5J A;  3CLJ A;  3F6Q A;  5BXO A;  1LF8 A;  3CKB A;  4U7E B;  3CK8 A;  4WWN A;  2C2L A;  3CVP A;  3E32 A;  2IU1 A;  3SHF A;  3PVL A;  2V5Q C;  5FZQ A;  2X6J A;  1UOH A;  1E90 A;  5FIO A;  3ABM E;  3CVV A;  2J8S D;  5JJ7 A;  1OY3 D;  2GRM A;  3ABL E;  5FWQ A;  4DJA A;  3FUM A;  3EIQ C;  2MOW A;  4J8D A;  4IYP A;  4EPZ A;  1FT1 A;  5D0Q D;  3ZU7 B;  3SZ7 A;  4W9R A;  4L7T A;  2X3M A;  2FUL A;  1BU9 A;  2A4Z A;  3SI5 A;  3ESK A;  1K1B A;  3TG5 A;  1FPP A;  3E37 A;  2F37 A;  4XKC A;  2CG3 A;  5AAO A;  4GZ5 A;  4PUC A;  4ZHB A;  3LDZ A;  3RJV A;  1FCH A;  3IHY A;  4HRL A;  3GZ1 A;  3PDN A;  3ONK A;  2Y69 E;  3ULQ A;  2VGX B;  3MX3 A;  5HI7 A;  4Q69 A;  3ASF A;  3CVL A;  3E30 A;  3BU8 A;  4JC8 A;  5AQ7 A;  3JUI A;  1TNO A;  4KXK B;  2HYZ A;  3CVY A;  2ETB A;  4CT0 A;  3QNK A;  4BET A;  3ONL A;  4M3O A;  2VSY A;  1OWO A;  2AWI A;  4FU3 A;  2P9K G;  4DPR A;  2KAT A;  4I9C A;  5ITZ F;  5AEN A;  3QB2 A;  4I6E A;  1EF1 C;  4JHK A;  3TJP A;  3IBE A;  3N71 A;  3LVR E;  1HH8 A;  4HOT A;  1FT2 A;  4URK A;  4PS3 A;  5ARG A;  5FZR A;  2A5E A;  2J08 A;  5JJT A;  2YHE A;  3SO8 A;  2H6F A;  3AS5 A;  3HYM B;  2F8Y A;  3LY8 A;  5D66 A;  1A17 A;  1ELR A;  2YHC A;  2HO1 A;  1E96 B;  2V4H C;  5JHA A;  3ZN3 A;  3L6A A;  2QZA A;  4WND A;  2CFZ A;  2I1J A;  3BQO A;  1UJJ A;  2OND A;  4LEU A;  3UQ3 A;  2AW6 A;  3DRA A;  3R7Q A;  5ANR A;  3UT8 A;  3MYV A;  4XX5 A;  5FZS A;  1SQM A;  4YDO A;  4EHM A;  4N2S A;  1N4R A;  3IV0 A;  3FTV A;  3UTM A;  3FUJ A;  2RKK A;  2YQ8 A;  4BER A;  4I2W A;  3X2Q E;  3D9H A;  4BWR A;  3CHS A;  3FUE A;  4GML A;  3UM2 A;  2LSV A;  5EDS A;  3RRU A;  4O1P A;  4F7A A;  3WXX A;  1ZBP A;  2GRQ B;  2V5F A;  1OWP A;  4XZ4 A;  4UWG A;  5ENT D;  3L82 A;  2XS1 A;  5EKQ D;  1H6P A;  3R9A B;  3LKU A;  1O1R A;  2XGM A;  2X6K A;  4AJW A;  3S7F A;  1MX6 A;  5CCL A;  2XRY A;  5FQ6 A;  3JQ1 A;  4IUL A;  3HXE A;  5BUZ A;  5LP0 A;  3PZ3 A;  2P9S G;  4KBQ A;  4GYY A;  4L2L A;  4XIF A;  2KZT A;  1EYH A;  2J4D A;  2HM8 A;  2DCP A;  3ZFW A;  4X8Q A;  4TV3 A;  1Z6T A;  3JYS A;  2GRN B;  3LEW A;  1BI8 B;  2DZO A;  5KWD A;  4ATG A;  3QC1 A;  5C1D A;  4C48 B;  4RG6 A;  1DCE A;  4U8V D;  4GPK A;  5CED B;  3CEQ A;  4N3B A;  4BSX A;  4UWF A;  3ULY A;  1E8Z A;  2P9I G;  4HRN A;  2L6J A;  1XNF A;  1TNU A;  3FUF A;  4JPS A;  4CEM A;  2BF0 X;  1D8E A;  1WAO 1;  2DZN A;  3E4B A;  1E8X A;  4BFR A;  1KT0 A;  2M63 A;  3ZNG A;  5BW8 C;  2VTB A;  3CV0 A;  2PM6 A;  5JJ6 A;  4G8L A;  4JEH A;  4BX8 A;  3QWP A;  3CGH A;  2R05 A;  3FY4 A;  3C72 A;  4XEI G;  2CFU A;  2HR2 A;  3CVW A;  2V4L A;  3FUK A;  1S70 B;  3DPY A;  1OCO E;  3QJZ A;  1U2V G;  4E6H A;  4FHK A;  1RW2 A;  5BPP A;  2UWJ G;  5ENQ D;  1PC2 A;  4GA2 A;  1K8K G;  2MYO A;  1Z5S C;  3TXN A;  2RFM A;  5BT1 A;  3VTX A;  3S7B A;  2GRO B;  2P9N G;  4BTA A;  3LY9 A;  4GTO A;  3KAE A;  2KZT B;  4OVV A;  4GTR A;  3EIJ A;  3PE4 A;  4HOQ A;  4U0S A;  2XEN A;  2ION A;  4GYO A;  3DXK G;  2WXO A;  5FTP A;  1TNZ A;  2FO7 A;  2QYU A;  3Q7F A;  1NZN A;  4F6R D;  2VGX A;  5HRY A;  5CCM A;  4ACL A;  1MJ0 A;  2R5S A;  3Q73 A;  3PE3 A;  3MGB A;  2AXV A;  3EUV A;  3CVX A;  1TN7 A;  1EDU A;  2RD0 A;  2R02 A;  2WXF A;  1HX8 A;  3CSF A;  5T3R A;  3PNL B;  5ENN A;  1S63 A;  4U07 A;  4EBA G;  4CDR A;  1EPU A;  4QQI A;  3AG3 E;  5EX3 A;  4JHJ A;  4U0Z A;  3DEP A;  3AAA C;  1IHB A;  2OCC E;  4K5A B;  5AQ9 A;  3UX4 A;  3KSL A;  1TYQ G;  4ABN A;  2IOL A;  3W9G A;  2IEJ A;  1JPL A;  1HE8 A;  4LUN U;  4ACK A;  5DIZ A;  1BPO A;  5KJM A;  4OVU A;  4EBA A;  3HXD A;  3D9L A;  4BTB A;  1ELK A;  3S2A A;  4GYW A;  4L9P A;  3D9N A;  2H6H A;  3KSQ A;  1QQE A;  3FU3 A;  2WMO A;  2IOS A;  3DSX A;  2OEV A;  3UKU G;  4LNG A;  1MQS A;  3NAW A;  4AXH A;  5T8I A;  3NF1 A;  5D2M C;  4M7C A;  4C0E A;  2NSZ A;  2XQ0 A;  1Q2Z A;  3OXG A;  3ZGQ A;  4IRU A;  3HVE B;  5FQ4 A;  2VQ2 A;  2DVW A;  4U95 D;  5KJK A;  4TUU A;  3G2S A;  3B7S A;  4ANU A;  4J8E A;  3Q79 A;  3G2W A;  2I2O A;  3VLD A;  3TWX A;  3W9F A;  1AP7 A;  1TNB A;  2VYI A;  4LNB A;  4CDM A;  3ZKJ A;  2LUH A;  4DI4 A;  4HLE A;  4HOR A;  2KCL A;  1OUV A;  3ML8 A;  4OAU C;  4DLO A;  3G2V A;  2XCB A;  4GAA A;  3CHP A;  4L1B A;  3B7B A;  1P5Q A;  4FP7 A;  4FJY A;  1A5E A;  5CRU A;  2IY0 C;  4CRW A;  2BUG A;  1IQR A;  4JXT A;  4KVO A;  4A63 B;  4XKB A;  1HXI A;  2DIW A;  3ZW3 A;  4N5Q A;  4GZ6 A;  5BNW A;  5B3S E;  2P2C P;  2AJA A;  3APC A;  2E2E A;  3UI2 A;  2FEZ A;  4AY6 A;  3NZS A;  4WNE A;  3V79 K;  1UJK A;  2WXN A;  3U64 A;  2KCK A;  3MJW A;  2NXP A;  1V55 E;  5T4Y A;  3NB2 A;  3O4Z A;  3FUH A;  2RFA A;  5FQ7 A;  2XGO A;  2BED A;  1D9S A;  1ZB1 A;  2GRL A;  3AJI A;  4N2Q A;  4I6G A;  2X38 A;  3D9O A;  3CHR A;  4I17 A;  1JCR A;  4HQD A;  4PS7 A;  1Z3X A;  3B95 A;  3TWT A;  1KZO A;  4G8K A;  1HZ4 A;  1N11 A;  3TAX A;  3QWW A;  4O1O A;  4XI0 A;  1SZA A;  2Q7F A;  4TXR A;  2Y4U A;  3TWR A;  3KEZ A;  4FHJ A;  4GZC A;  4UWH A;  4FUL A;  1H6O A;  2WPV A;  1NFI E;  4J7W A;  4DX6 D;  4ZFH A;  3ZHE B;  1B89 A;  4A3T A;  4C9B B;  4APF A;  1HU3 A;  1WM5 A;  1TR4 A;  3B7T A;  4RG9 A;  1WG0 A;  1N4S A;  4H7Y A;  3CHQ A;  3QAR A;  4G1T A;  5H7P A;  1OCZ E;  5G04 J;  3UPV A;  3SY2 A;  1V54 E;  4Z68 A;  2FO1 E;  3T9K A;  3FUN A;  1Y8M A;  4AV7 A;  1BI7 B;  1FVF A;  4DUI A;  4I43 A;  1H2T C;  3P2B A;  2Y3A A;  1SW6 A;  3D3M A;  4HNA D;  3ZXP A;  4DX2 A;  2OV8 A;  1HS6 A;  3U3W A;  2J9Q A;  3QOU A;  1ZU2 A;  3ENE A;  3HXB A;  4CYM D;  2WVI A;  3D9I A;  3FTY A;  3ZEF A;  2WXL A;  4N3A A;  2ZGG A;  4C0M A;  4V3I A;  1UW4 B;  2FI7 A;  3MKR A;  3UXG A;  1OWN A;  2L6B A;  5ANL A;  4AIF A;  1OWL A;  4DI3 A;  3Q5M A;  1KLX A;  2YIN A;  4UI9 C;  4UWL A;  2NYJ A;  3DSU A;  3EHM A;  3J5Q B;  4BT8 A;  2XGS A;  1DVP A;  3QDN A;  4B0Z A;  4APO A;  5J08 A;  3FFL A;  4O60 A;  2OVF A;  5HQ8 A;  1H19 A;  3G2U A;  3PZD A;  4U8Y D;  2WQH A;  3FWV A;  4ILG A;  2WXK A;  4U0U A;  3S7J A;  3CVN A;  4KYO B;  3AG2 E;  4YND A;  1UG3 A;  1N95 A;  1E7U A;  2VGE A;  1IHG A;  5LFA A;  4GB9 A;  1HF8 A;  1INZ A;  3JUE A;  5CMW A;  2L0T B;  3LJN A;  1PY1 A;  5A7D B;  4G24 A;  3PH0 C;  2AVP A;  1HFA A;  2H6I A;  2WQ6 A;  3RIB A;  4B8C B;  2L9B A;  2I1K A;  3EU9 A;  1MYO A;  3P1U A;  3AS8 A;  1G3N B;  3TWS A;  3O48 A;  5ENS D;  2QC9 A;  3LXU X;  2WM9 A;  3UKR G;  4KMO A;  4XE0 A;  1IKN D;  3APD A;  3LY7 A;  3DPD A;  4FC8 A;  3GYZ A;  2EQX A;  3U66 A;  3ZYL A;  2WXM A;  4BT9 A;  4HOU A;  2QYJ A;  1NA0 A;  3UIO C;  4EZJ A;  3C5R A;  4RQI A;  4G25 A;  4LER A;  5G55 A;  2OVB A;  4F3V A;  5A6C A;  3RKV A;  5IY5 E;  4JZY A;  3L17 A;  2BKK B;  2XPZ A;  4JD2 G;  1SA5 A;  3SFY A;  3T8M A;  3TG4 A;  3KD7 A;  4ILH B;  4D10 C;  1U3D A;  2WXJ A;  2R17 C;  2F0Y A;  3DEO A;  2LO6 A;  2I9C A;  3UIN C;  4LRZ A;  2XZD G;  4MBG A;  5LOZ A;  2XPY A;  5AAR A;  4ATZ D;  4AEZ C;  4LG6 A;  4I1O B;  5FQ8 A;  3V2O A;  3V30 A;  3KEA A;  5CHE E;  2JEK A;  3Q9N C;  1H2V C;  1YYH A;  4UUC A;  2C0L A;  4DLQ A;  3L16 A;  3PEU B;  3UM3 A;  3CK9 A;  3ZYQ A;  4CT4 A;  3ZXS A;  3FHE A;  3QKY A;  4BY6 A;  3MA5 A;  4YVO A;  3TWQ A;  1NL4 A;  2DWZ A;  4XI9 A;  5FJY A;  3IEG A;  2J4B A;  3ZIM A;  3RAU A;  2LXM A;  2PQN A;  2DYR E;  2XRZ A;  4AVX A;  4K5B A;  3MV2 B;  3SGH A;  1N54 A;  3ASG A;  3LPZ A;  4TXP A;  4K0R A;  4GTQ A;  4O6F A;  5EN5 D;  4E85 A;  1RZ4 A;  3HG0 D;  2GRP B;  5HKP A;  5BXU A;  3UT7 A;  4F1S A;  1QNF A;  2ZU6 B;  2WXQ A;  5CEA A;  1GW6 A;  2ILR A;  4I2Z A;  3UM1 A;  3CK7 A;  4B93 B;  4JW1 A;  3CR3 A;  2ZIR A;  3PRZ A;  3T5X A;  3LCA A;  1MHQ A;  3AU5 A;  5CBO A;  2PL2 A;  5CEC B;  2LAI A;  4U96 D;  2EIN E;  3NOC D;  4WWP A;  2ZXW E;  3EDT B;  1TJC A;  3EHQ A;  4GTT A;  3UMV A;  5ENO D;  4TUM A;  5CBN A;  3V31 A;  4EZL A;  5EYP F;  4KT6 B;  4HB5 A;  2XEE A;  3FEX A;  4AP2 A;  2IQC A;  2WB2 A;  5EIB E;  4GCN A;  5ENR D;  4DX1 A;  4NUR A;  2L0I A;  4AM9 A;  4YVQ C;  1WDY A;  2UY1 B;  3CIA A;  2IO2 C;  5EID A;  3ASH A;  4DRX E;  3WG7 E;  4HRM B;  3B7R L;  5FT9 A;  3ML9 A;  3EJN A;  4GPM A;  3Q15 A;  5A23 A;  2KXP C;  4HS2 A;  2XPI A;  4R7L A;  5KJN A;  2AXZ A;  3ZVV A;  1H2U A;  5KCM A;  4F53 A;  1N0Q A;  2IO3 C;  3Q7A A;  3FH8 A;  2MRI A;  2WXP A;  3BUA A;  4HXI A;  1QYM A;  4JHR A;  3L9T A;  1HO8 A;  1YA0 A;  4CGV A;  4PH4 B;  3GW4 A;  2VJ8 A;  1N4Q A;  4MKT A;  3ESL A;  1IXV A;  3FDH A;  3UIP C;  4GZ3 A;  4JA7 A;  4JB8 P;  1OXJ A;  3HXC A;  3R7R A;  2LNI A;  4YDW A;  3NZU A;  4ILI A;  2Y0B G;  2WXI A;  3NOG D;  3SFZ A;  2J07 A;  3SFX A;  1DCQ A;  1H0A A;  3Q49 B;  4LNU D;  3L54 A;  2KC7 A;  5JMN D;  3BG1 B;  4K03 A;  4RSY A;  3BEE A;  1JWF A;  3FP3 A;  3FTS A;  2LAH A;  3B7U X;  1N94 A;  4G11 A;  2QFC A;  3ULE G;  3CKC A;  3OXF A;  4J8F A;  3QAQ A;  4BX9 A;  1OCR E;  3CHO A;  1NI1 A;  3ISM C;  2EIK E;  4UI9 J;  4PS8 A;  2MHK A;  3HHM A;  4GCO A;  1N0R A;  4B94 A;  5J90 A;  1O5M A;  4FLH A;  4KVM A;  4LSZ E;  2FBN A;  1KZP A;  3TWU A;  3Q9U C;  2XCC A;  5HS0 A;  3L22 A;  2JAB A;  5AYW D;  4J8Y A;  3Q4A B;  3SD5 A;  2DYS E;  1Y6I A;  1X5B A;  3TWW A;  1NA3 A;  5KNG A;  4Q94 A;  4MRU A;  5AQB A;  4EQF A;  1TN6 A;  4I9E A;  3UT4 A;  4A1G A;  3FU0 A;  1BLX B;  3C3O A;  1TN8 A;  3Q75 A;  4F1P A;  3ZHE A;  2KM4 A;  4I6J A;  1XGW A;  3PUJ A;  3ZYM A;  1K1A A;  4Y6W A;  3RRN B;  1S64 A;  3ASO E;  2PNN A;  3J5P A;  3FEY A;  4CDN A;  3URZ A;  3I4G A;  4JL0 A;  4I1A A;  1N9A A;  2J49 A;  4DK5 A;  2V0P A;  5JA4 D;  1JUQ A;  3FUD A;  3MV3 B;  1VDY A;  5KJL A;  4HFG A;  3RK6 A;  2PZI A;  4HI9 A;  4WUY A;  2X6H A;  4OAV B;  2R2L A;  3SF4 A;  3OXL A;  3TXM A;  4GU5 A;  4UWK A;  4GTS A;  2IF4 A;  3T8K A;  1ELW A;  5G05 C;  5AN8 A;  5G2N A;  1MX2 A;  3Q47 B;  3JXJ A;  4LCT A;  4BEP A;  2CHX A;  2XEH A;  3KS2 A;  3I3N A;  4FJZ A;  3JCK C;  3VLE A;  4ANW A;  3FU5 A;  3CVU A;  3BG0 B;  2FF4 A;  2DBA A;  2XS8 A;  1D8D A;  1O1T A;  1DC2 A;  2WQ7 A;  4I1M A;  3FH5 A;  3G2T A;  3FH7 A;  4A55 A;  4B8A A;  3PZ2 A;  1H6K A;  2WMN A;  4P29 A;  4PDX A;  3EU5 A;  4U8H A;  3C3Q A;  2B6C A;  3OAW A;  3I5P A;  2GW1 A;  1DNP A;  4ANX A;  2VSN A; 
#chains in the Genus database with same CATH homology
 3JXI A;  3KEA A;  3EHQ A;  5BXU A;  2F37 A;  4JB8 P;  3EHR A;  4TUM A;  5ENO D;  5ENQ D;  5AAO A;  3Q9N C;  5CBN A;  3ZUV B;  4K5C A;  1K1A A;  4ZHB A;  3LJN A;  2MYO A;  1YYH A;  3V31 A;  5KBA A;  4N5Q A;  4UUC A;  1BI7 B;  4GMR A;  4YDW A;  5EYP F;  2F8X K;  2P2C P;  1MX4 A;  5FIN A;  2AJA A;  4HRL A;  4DUI A;  2Y0B G;  2RFM A;  4HB5 A;  2XEE A;  1BI8 B;  2DZO A;  2PNN A;  3J5P A;  4BSZ B;  5KWD A;  3NOG D;  1SW6 A;  4HNA D;  3UI2 A;  4DX2 A;  3V79 K;  5JA4 D;  3UTM A;  5EIB E;  3EU9 A;  5ENR D;  2XEN A;  4C48 B;  1DCQ A;  4DX1 A;  2ZGD A;  1MYO A;  4LNU D;  4CYM D;  4U8V D;  5JMN D;  2B0O E;  5ENP D;  4F6R D;  1BD8 A;  1G3N B;  2RFA A;  4HI9 A;  4BER A;  5CED B;  4RLY A;  3D9H A;  1WDY A;  3TWS A;  3TWQ A;  2ZGG A;  5ENS D;  4OAV B;  2QC9 A;  1D9S A;  2DWZ A;  5HRY A;  3TWV A;  1OT8 A;  1SVX A;  5EID A;  5AQ7 A;  3AJI A;  4DRX E;  1MJ0 A;  3T8K A;  2DVW A;  4U95 D;  1IKN D;  2ETB A;  2ETC A;  4O1P A;  4DX7 D;  4BET A;  4HRM B;  5AN8 A;  3UXG A;  3HRA A;  2BKG A;  1MX2 A;  3IXE A;  4QFV A;  3NBN B;  2L6B A;  1K3Z D;  3F6Q A;  3JXJ A;  4BEP A;  4HRN A;  2XEH A;  2Y1L E;  5EIL A;  4YDY A;  2QYJ A;  5BXO A;  5CER B;  5ITZ F;  5ENT D;  4K5B A;  5HS0 A;  4GPM A;  4HQD A;  3B95 A;  2NYJ A;  3C5R A;  4BES A;  3TWT A;  3TWX A;  3W9F A;  4G8K A;  5EYL A;  2DZN A;  2KXP C;  3J5Q B;  1N0R A;  4HI8 A;  1AP7 A;  1N11 A;  2V5Q C;  1DC2 A;  5EN5 D;  1YCS B;  4LSZ E;  3ZKJ A;  2ETA A;  2XZT G;  4O1O A;  3ZNG A;  1UOH A;  2BKK B;  4QQI A;  3TWU A;  2A5E A;  1MX6 A;  1N0Q A;  3Q9U C;  4CZ2 D;  5FIO A;  3TWR A;  3HG0 D;  3DEP A;  2JAB A;  5HKP A;  2HE0 A;  4O60 A;  2J8S D;  3AAA C;  1OY3 D;  4G8L A;  4J8Y A;  1IHB A;  4OAU C;  4K5A B;  3SO8 A;  5AQ9 A;  2KBX A;  2F8Y A;  1QYM A;  5CEA A;  1NFI E;  4J7W A;  4U8Y D;  5KNG A;  3TWW A;  4DX6 D;  4ZFH A;  3DEO A;  3B7B A;  5KNH D;  3ZU7 B;  1YMP A;  3W9G A;  1AWC B;  5D66 A;  4HBD A;  5AQB A;  4B93 B;  2XZD G;  4HLL A;  1S70 B;  4NIK A;  1TR4 A;  1A5E A;  2V4H C;  2VGE A;  1BLX B;  5AAR A;  4ATZ D;  5CBO A;  1WG0 A;  4LG6 A;  5CEC B;  4U96 D;  3V2X A;  3JUE A;  5AQA A;  4A63 B;  3NOC D;  1BU9 A;  4DX5 D;  1K1B A;  3V2O A;  3V30 A;  4F1P A;  4Z68 A;  2FO1 E;  3T9K A;  1IXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...