4HNBA

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
176
Chain Sequence
MDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
molecule keywords LOV protein
total genus 54
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hnbA00
3IS2B 1P97A 3LIFA 4LRZE 1LT0A 4R3AA 3SW1A 3LIEA 1XFNA 2JHEA 4I3AA 4MN6A 4GCZA 2INWA 4KQDA 5F68A 4HNBA 5HD5A 2OWJA 5G4ZA 2WKRA 4YWZA 3UB6A 4GS9A 4HHDA 1OT6A 3E4OA 4HOIA 1OTEA 1TS8A 3VE4A 1MZUA 1JNUA 4RQ9A 3ZQ5A 5AVFA 4EEUA 1GSWA 3BWLA 5F69A 3NJAA 4I3JA 4WLAA 2PYRA 4JGRA 1OT9A 1N9OA 3H7WB 2V1BA 5DJTA 3G6OA 4HJ6A 4HI4A 4WF0A 3T50A 1F98A 2PD8A 3BY9A 3LIBA 4GS9B 3LI9A 5IS1A 1D06A 3CLOA 4WN5A 4BBUA 1DRMA 2D02A 1S1ZA 1F9IA 1V9YA 3UB7A 5DKKA 1T1CA 2A24A 2PYPA 2QJ5A 2VV7A 4GHIA 4L9EA 4L9GA 5HDDA 4EERA 3F1PA 3K3CA 3CWFA 4I3IA 4JGPA 2HV1A 1TS6A 5HWVA 3NOTC 3IBRA 5DJUA 4HQAA 5I5LA 3H9WA 3UB9A 4KUOA 2QWSA 3LIDA 4EETB 1LSWA 1OTIA 3UE6A 5HZHA 2H28A 2I9VA 2L1MA 2A24B 3F1OB 4I5SA 3BY8A 4JGQA 1S66L 4EEPA 1NWZA 1UWPX 1DP6A 2OWHA 3HJIA 3VE3A 1LSXA 4MN5A 3MQOA 1X0OA 4GW9A 2PD7A 1G28A 3EWKA 5G4YA 3ULFA 1OJ5A 1TS7A 2ZOHA 1KOUA 3B33A 3GECA 1UWNX 3C2WA 3H82B 3MJQA 1S4RA 5HDCA 1N9LA 3F1OA 3LYXA 4H6JA 1LSVA 4EXOA 3ICYA 5EFWA 4R70A 3UMDA 3F1NB 5DKLA 5HWWA 3F1NA 1DP9A 1V9ZA 3A0SA 1S67L 4R38A 2Z6CA 3A0VA 1N9NA 5HDSA 1P0ZA 1T1BA 3MXQA 4WL9A 3H82A 2M1CA 3FG8A 5J4EA 1XJ6A 1XJ4A 4R6LA 4BBTA 2Z6DA 2QJ7A 4HJ4A 4NXEA 1T1AA 5TBMB 4HH3A 4LLOB 4NXGA 3LUQA 5J7EA 1BYWA 2D01A 1LL8A 2WKPA 2PR5A 3E4QA 3VOLA 2V1AA 2KX6A 3PHYA 4XT2B 4EW7A 2B02A 2EA9A 1XJ2A 1GSXA 2K7SA 2QKPA 1S1YA 1D7EA 1VB6A 2R78A 3LI8A 3CAXA 4HP9A 4HY8A 4HH2A 1OTDA 2YKFA 4I39A 4KUKA 3UB8A 3GDIA 4BBVA 4DJ3A 3D72A 2J80A 4HP4A 4K08A 1GSVA 3NOPC 3K3DA 2QHKA 4GHIB 2BASA 2V0WA 3FC7A 5F5YA 3MQQA 5HSQA 1EW0A 1T19A 2VV6A 4E04A 4XT2A 2YKHA 1OTAA 3F1PB 4EQ1A 1TS0A 2P7JA 2ZBBA 3H7WA 5HD3A 4L9FA 5J3WA 4F3LA 2PDRA 4F3LB 5KIZA 2V9AA 1XFQA 3A0RA 4PKYG 1OJGA 5IU1A 5AVEA 2VLGA 3PYPA 4LRXC 2L4RA 2L0WA 1T18A 3RTYA 5TBMA 3KX0X 3EEHA 4EESA 1OTBA 3OLOA 3P7NA 2OOLA 2KDKA 2V0UA 3LICA 3NOUC 4HJ3A 4LRYC 4M4XA 4B9OA 1Y28A 4I38A 4WUJA 5HWTA 1S4SA 3E4PA 2JN7A 2PR6A 3NHQA 4NXFA 3UMEA 4LPZA 2VEAA 2CMNA 1XJ3A 2ZOIA 3C8CA 3MFXA 1DP8A 2W27A 3MR0A 5A8BA 2WKQA 2GJ3A 2PHYA 3HJKA 1ODVA 3LIAA 4HIAA 4PKYA 4H6JB 3RH8B 2VV8A 1UGUA 4NXBA 2W0NA 4JGOA 1WA9A 4DJ2A 5F6AA 3IS2A
chains in the Genus database with same CATH superfamily
4LRZE 4MN6A 2INWA 3U4LP 4ZBEA 5HD5A 3W4QA 3UB6A 2KLIA 3R4KA 3V50A 1O07A 5TJJA 3VE4A 3CUEA 4IBXA 2Z2LB 4JGRA 1SZVA 3QHYA 3DTEA 2V8FA 1J3WA 1V9YA 5CHJA 2E8JA 2HF6A 4QJGA 1K38A 2A3UA 3CJMA 3MMHA 5HZHA 1FCOA 4KZ7A 3ZG7B 5I94A 3VP3A 4KQQA 2WK0A 1STZA 4AFIA 3UPNA 5FQKA 2AVXA 3W8KA 1YT4A 4UA9A 5E2EA 3CI6A 4CLCE 1DP9A 3UDIA 2XA7S 3T4OA 2Z6DA 4HH3A 4OOLA 1P9RA 3E4QA 1WYBA 1YLTA 3R7WA 1JWZA 4KUKA 1KGEA 2Y59A 1GSVA 4S2NC 2VV6A 4XT2A 3VSKA 4PM5A 1CI8A 4EBLA 5HAIA 1XP4A 4OLDA 1XFQA 2ZC4B 5GLBA 3UE0A 3N6IA 3NDGA 1FQGA 5FAPA 3IHAA 2ZQ9A 3LR4A 1SDEA 1Y28A 3E4PA 3IF6C 1W8QA 2I72A 2C5WB 4WELA 3T4QA 1NRFA 2PHYA 3RH8B 4JKTA 4I3AA 4A5RA 1XGJA 4NKPA 4ETXA 3NY4A 5FDHA 1S6RA 3GQZA 3IQAA 4N9LA 3M6BA 2HZ5A 1SCWA 5HX9A 1K55A 4Y15A 1ZC2A 3UE6A 2QPNA 3N7WA 4R3BA 4LGWA 3S7QA 4NETA 4ZTKA 2GX5A 1MWRA 1Q2PA 4S2LA 4D60A 1VHMA 4UAAA 2DRWA 2M7VA 1S67L 3HUNA 3IBJA 3A0VA 3HVFA 3OPHA 3CPTA 4Q0HA 5DF9A 1K4FA 4P6BA 4LCLA 1JTDA 4B4ZA 4EQ1A 4EBNA 3PBTA 3HLGA 5M19A 2CC1A 3UB8A 4MBFA 4K08A 3T4TA 3LY3A 3IT9A 4O8GA 5EVIB 1IELA 3Q1FA 5KSHA 1E4DA 2PAVP 3MQ0A 3LR3A 2Q9MA 5L2FA 2XR0A 3PYPA 2O0YA 5FI2A 2HDQA 2PU2A 4PAUA 4Y17A 5HWTA 2ZL1B 1NYYA 4N92A 3BECA 2EWWA 3HJKA 2JKRI 4H6JB 3MS6A 3LIEA 4KQDA 3BM6A 3FPWA 1MPLA 1M40A 4O0PA 5HAQA 5A90A 3PBQA 3BEBA 4E6XA 4FUWA 1H5XA 2C6WB 4BMWA 1NRJA 5EVEA 4P85A 2Y8HA 1FR1A 3WS4A 4G3VA 5EPHA 4MMNA 1LSWA 2J9OA 4N1XA 3FWLA 4MBHA 2Y2HA 1LSXA 3ZDJA 2PD7A 3DBAA 3ULFA 4DXBA 3RJUA 3T4KA 2V8CA 3MJQA 4KZ9A 4DE2A 1ERQA 1BZAA 3SS4A 1PIOA 5E2FA 4EQIA 4OKPA 1P0ZA 5M18A 4KZ4A 3QP6A 2B5RA 1FOFA 4ZAMA 4KZ8A 3KYZA 2EX6A 3FPVA 2B02A 1XJ2A 5L10A 3BFCA 2FFFB 3KSGA 4Y7PA 4P6ZM 1SKFA 3HUOA 3BFGA 4Z9QA 3C4PA 4ZRRA 1W7FA 5HFOA 3SOIA 4X55A 1K57A 3NULA 4WZ4A 5IT5A 5D3OA 1MXOA 5TBMA 4WZ5C 4IBRA 3TSGA 3MR0A 2XK1A 5A8BA 3OC2A 5GLDA 3V3SA 4B88A 2XLNA 5EECA 3SS5A 5F68A 1P9WA 5G4ZA 1K6RA 1QMEA 3ZVTA 5CX7A 1JNUA 5GHXA 3D3OA 3JVUA 4KG5A 4IVKA 2PD8A 3C38A 4N1HA 2O9CA 1U60A 2XA7M 3MZFA 1ES4A 4UQIM 2O9AA 2EX9A 3HLEA 3UB9A 2V20A 4MCWA 2WGWB 3FKVA 4I5SA 4B4XA 1IYOA 4GW9A 5CGSA 2Y2GA 2HJ9C 5FQMA 3NI9A 4PPRA 3PBNA 3ICYA 3UMDA 3W2ZA 1LLBA 2W1RA 4LFUA 4JF6A 1K6SA 4BBTA 2QJ7A 3E0YA 3M6HA 5J7EA 3VP2A 1L0EA 2HPBA 3N8SA 4HY8A 4S2JA 2WADA 2EX8A 3UO9A 1OMEA 3Q7VA 4KZBA 1EI5A 4JBFA 2Y4AA 4EUVA 4JPMA 3GSGA 1CQAA 3DTKA 2L4RA 2UV0E 2L0WA 5DFXA 1T18A 3WS0A 4JXVA 3AGDA 5M1AA 3OLOA 1IEMA 3T1RA 3WWXA 3ZG9B 3GV9A 1JVJA 2W27A 4Y0UA 1M6KA 3D4FA 3DTIA 3Q7ZA 2XQZA 4GZBA 5F69A 3OCNA 2EFXA 3SZTA 3G6OA 3IH9A 1ZKJA 3LI9A 1KDSA 3CLOA 4WN5A 5L09A 2X71A 2A24A 2VV7A 1YLWA 2G2UA 4E3MA 2H10A 5LBRA 2FFYA 3WRZA 4MBKA 4R3JA 5GLAA 5FI6A 2K31A 5EVIC 3PAEA 2H0YA 1BLCA 4CLCB 3IX4A 4WBGA 1TS7A 1LHYA 4WYYA 3MFDA 5F83A 1YLZA 5DKLA 2X02A 2FH5A 5FQ9A 4BJPA 3MXQA 3FG8A 2G2WA 3HBRA 1YPRA 4DRTA 4U0TA 4EUZA 5JYOA 3Q07A 2P04A 3GMWA 4OQIA 4Q0IA 2QKPA 2K7SA 3CPTB 1TF1A 3CAXA 2Y2LA 2YKFA 4Y5FA 3VP0A 3QP5A 3T1SA 2Y2JA 4II7A 4JXSA 4E04A 3F1PB 4HBTA 5HD3A 3IF6A 1GCEA 2V9AA 2Y55A 1PI4A 2W3FA 2PRFA 1W79A 3KX0X 5AQBA 2KDKA 2ZMVA 3GVBA 4LV0A 1HVBA 1YLJA 5A92A 4OOMA 4DF6A 5CHUA 3TJZC 3TW8A 5CXWA 2H5SA 2JHEA 2RL3A 4HNBA 4WEKA 1VEUB 4YWZA 2HDRA 5CEDA 1Y54A 2QMIA 5FQIA 1K55C 2ZMFA 2WZZA 5HAPA 1D06A 5DKKA 1T1CA 4RYEA 3WS2A 2Y2OA 1H8MA 5HDDA 1Y4OA 4NK3A 5EOOA 2H28A 2L1MA 2O99A 2ZD8A 3BY8A 1E3UA 1WYCA 3MXRA 3ZNYA 2VX8A 3T12B 2WGIA 3C2WA 3F1OA 3S7OA 1AWIA 4ID4A 1LSVA 1W8YA 3EQVA 4OPZA 3A3JA 1MC0A 5HDSA 4JXWA 4XXRA 3BQAA 4GNUA 4FH4A 2P9VB 4LLOB 4NXGA 1NLYA 2ZM0A 3IF5A 4XT2B 4E3JA 1S1YA 2XSSA 2PU4A 4I39A 3ITBA 1KE3A 5CHMA 3EQUA 4Y3IA 5GHZA 2PDRA 4KZ6A 1L3LA 2BG1A 2VLGA 1JTGA 2K2NA 3OZHA 2LB5A 2W3EA 1RGZA 4K0XA 3UMEA 5DVAA 3ZNTA 3O88A 5TGFA 4KQRA 2GJ3A 5C5KA 4P6ZS 1Z6FA 3CITA 1OT6A 3G2YA 4EEUA 4B93A 5JYPA 2V1BA 5DF8A 4HI4A 1W63M 5AJGA 2VZWA 4EBPA 2WYXA 3BFDA 2JKFA 3RFBA 5L8MA 1PNEA 4OH0A 3N8RA 4HQAA 4KUOA 1XA1A 4R23A 3V67A 4G3WA 3G30A 2XFSA 4FH2A 3LEZA 1VETB 3PBOA 1LI0A 3IF6B 2WZXA 4XUZA 3VP1A 3Q7VB 2IA2A 4JLFA 4QHCA 1KOUA 3S22A 1H8ZA 1UWNX 1S4RA 5HDCA 5FEGA 1TEMA 5TR7A 4ARZB 4KQOA 5F1FA 1XJ6A 3LEQA 1LL5A 1LL9A 1QMFA 4DE3A 2D01A 3HCYA 3PHYA 1N4OA 1J9MA 4HP9A 5DTKA 3P01A 4HP4A 3K3DA 1KDWA 3FC7A 2MJ6A 3MQQA 3PXPA 4IHQA 3CHWP 3BLSA 1IYPA 4ZJ3A 1ZG6A 4OONA 1OJGA 3HREA 4HEFA 4CQHA 1MWSA 4LRYC 1FSYA 3Q82A 3TOIA 3IXBA 1WA9A 2DCFA 3L9KA 1XFNA 2XRNA 3BYDA 1ZTUA 5KMWA 3UDFA 3BW6A 1MZUA 5U47A 4DE0A 3NCKA 2W1TA 1K56D 1O7EA 5HARA 4L9EA 1PZOA 3K3CA 5EM1A 1K54A 5IHVA 3W4OA 3VFHA 1YMXA 4MNRA 3UE3A 2HP6A 4X69A 2QWSA 1HLUP 2A24B 1UWPX 4NG2A 4O7DA 4PHTA 4Q8IA 5DTSA 1ALQA 4PM7A 2WUQA 4X25A 3BFFA 2GNXA 1BT5A 2Z6CA 2VKSA 3OPRA 1T1BA 3JPUA 4QB8A 4C3QA 3S1YA 4R4SA 3KSFA 1D7EA 4WMCA 1S0WA 2VJWA 3HLBA 3NOPC 2EFUA 1HTZA 3ZVWA 3HUMA 3OPPA 4MEZA 5IU1A 4EWFA 2XD5A 1YSQA 1IFQA 4EESA 3FZCA 5FA7A 3PR6A 1JWPA 2JN7A 4NXFA 5FQQA 2ZM8A 3N4IA 4HIAA 5DFYA 3WS5A 5E2HA 2OLVA 4DXCA 3A3EA 5CRFA 2V1ZA 3LIFA 4GDBA 2OWJA 1TS8A 3UPOA 4U0XA 1CEGA 3T4LA 4RX3A 3G32A 3BY9A 3TG9A 5IS1A 3KSIA 3KSHA 5EVIA 5FL3A 2WGWA 4S2NA 3KYEA 4X68A 1ES3A 4BENA 4RA7A 2H0TA 4EETB 2B95A 2VGJA 1RP5A 3V39A 1K4EA 1RCJA 3DAVA 2EXAA 2NUTC 4UA6A 5HPFA 2ZOHA 3GECA 1N9LA 2PBYA 1YAXA 4PM6A 4ETZA 3F1NB 5F1GA 4BL3A 1XPBA 5FQJA 3ZFZA 1CI9A 1T1AA 1PW8A 1LL8A 1HD8A 3AGFA 3LR5A 2R78A 1CK3A 3LI8A 3B3XA 4WMCD 3HLFA 1PZPA 4E3KA 3LFVA 4E3IA 3S7NA 1ES5A 4GHIB 2XEPA 5GL9A 1G6OA 1T19A 2V2FF 4F3LB 4MN7A 3BQ8A 4IJGA 1ONGA 3PTEA 4M4XA 2CMNA 1XJ3A 2JKRM 4R0QA 3T4JA 3U2AA 4UEYA 5E2GA 1MBLA 4DJ2A 3OCLA 1KE0A 3SW1A 3MXSA 4S2PA 1YKDA 2XDMA 1OPXA 3E4OA 4S2IA 4I3JA 2EXBA 4WLAA 4R4RA 4WF0A 4GS9B 3ITAA 4GKUA 5AQ9A 3UB7A 2PBDP 3LO7A 3EEAA 4PM9A 3CWFA 4WM9A 4ESPA 2J3TD 1ESUA 2W3HA 4OVDA 3RXXA 4JGQA 3G34A 1S66L 1DP6A 2NUPC 3E2LA 2VGKA 1OJ5A 4YOFA 1PWGA 3MZEA 2OAP1 2P74A 2J3WA 4Y0OA 4JF5A 4ARZA 1MWTA 2ZL1A 4ZDXA 3VOYA 4R6LA 1XJ4A 5CTMA 2JKTI 3PBRA 1DJAA 4CLCA 3I7JA 5F5YA 1EW0A 2W3DA 2P7JA 4OQHA 5FEFA 5MC7A 1I2SA 4LRXC 4B9OA 2OOLA 2V0UA 4EV4A 3P09A 2ZC7A 2VEAA 4LCMA 1IOUA 4PKYA 1ODVA 1LT0A 4OP5A 4GCZA 2A2LA 2ZC3B 4Q0JA 3IH8A 4OOYA 3EGDC 2J9PA 3HLWA 2WAFA 3UN7A 4Y13A 1ONHA 1AXBA 2GZAA 3BLMA 4L9GA 4EERA 2VGLM 4YINA 1IYSA 2WKIA 2GDNA 3ZG0A 3QP8A 1NWZA 4IEDA 3EOIA 3MQOA 1X0OA 2OV5A 1CJFA 4BWIA 4CLCC 2B18A 2O9BA 5EFWA 2IWCA 4R70A 5FI7A 4E3NA 3R7WB 3AGEA 1IYQA 4OQ0A 5FASA 1I5QA 5J4EA 1I2WA 2W1TB 3IWQA 5TBMB 4PMAA 2WKPA 3TRCA 4E3OA 5CTNA 3TE8A 4C6YA 3ISGA 1CEFA 4OPRA 2XFTA 5L07A 5GLCA 1CF0A 1TS0A 5J3WA 4BD1A 2J3TC 1TDLA 3RTYA 3EEHA 5FDSA 4KENB 3LICA 3DW0A 1EROA 1HZOA 3G35A 2PR6A 4LPZA 5F82A 1H8YA 2WKQA 5KSCA 2JE5A 1VETA 2JCHA 3NDEA 5F6AA 3C30A 1P97A 4R3AA 1PFLA 2WKRA 3DWZA 1DJBA 2ZQAA 4X53A 3O3VA 1K54C 3SH7A 2J8YA 3ZG5A 3LIBA 4CJNA 1S1ZA 3QP1A 4GN2A 2QJ5A 4HBUA 3UY6A 5FAQA 3F1PA 5EVLA 4MDZA 4S2MA 1Z09A 3T4SA 3H9WA 2LB9A 3LIDA 4F94A 1YQSA 5AQAA 2HDUA 2JKGA 3ZGAB 4X1LA 2OWHA 2QZ6A 1KVMA 1MKMA 3L7HA 3EWKA 2ZM2A 3IX8A 5G4YA 1BUEA 3H82B 1XX2A 5FATA 4H6JA 4LV2A 4G3KA 3W4PA 5HWWA 3F1NA 3UE1A 3B47A 1FILA 2Q0OA 5GHYA 1F5MA 4ME4A 2DMWA 5DTTA 2RCXA 3LUQA 1E25A 3VOLA 2V1AA 4BLMA 3P98A 3ZHHA 1GA9A 3N8LA 4R1GA 1NYMA 3FV7A 2P9VA 3GDIA 3RXWA 1RGYA 2G7UA 4L0LA 5EOEA 1SKOA 3FKWA 3KYQA 3CG5A 3H7WA 5KIZA 4QU3A 5AQ7A 5CGXA 3A0RA 3O87A 4DE1A 3QP4A 2KOIA 2XH9A 3VP4A 2WKEA 3G4PA 3P7NA 1FR6A 3C7UA 1S4SA 2HP5A 1EWZA 1NZUA 2Y2NA 1H3QA 1XA7A 4HESA 2ZJ9A 3LCEA 3NECA 2W0NA 4GLQA 3GTCA 1PYYA 2OSUA 5FAOA 4GD8A 4JXGA 3V3RA 3ZQ5A 1W63Q 1DY6A 1OT9A 4BQMA 3H7WB 5DJTA 1F98A 4YFMA 1F9IA 3SH8A 3VV4A 2BLSA 2Z2MB 2HV1A 1TS6A 3BFEA 1TD5A 5CGWA 2I9VA 3MSHA 3G2ZA 2Y2MA 4GOGA 3O86A 3LR0A 5DF7A 3BRMA 1BLHA 1ES2A 1MY8A 3A0SA 4R38A 2IWDA 3LGOA 1N9NA 4WL9A 1XKZA 1K56A 3A3FA 4NXEA 4Y2FA 2DNSA 3QNBA 4UHUA 3UB5P 1YSPA 4QPRA 4EW7A 2ZQCA 3LY4A 1BLPA 1OTDA 2M7UA 2J80A 2BTFP 2WGVA 1D1JA 2V0WA 1LI9A 4LV3A 4C75A 4K91A 2WKHA 3S7PA 4L9FA 3Q81A 4JF4A 4PKYG 4BD0A 4FTXA 4DDSA 1XXMA 2XD1A 5CERA 4P0MA 3NOUC 3M2KA 4X1MA 4I38A 3C8CA 2VGLS 1GHIA 3IWOA 3HL9A 3LIAA 3OPLA 2VV8A 3IHBA 4NXBA 4QY5A 1N9BA 2OAQ1 3MKFA 4HOIA 5AVFA 4FD8A 3NJAA 3V5MA 2UWXA 3GR2A 3OOVA 1NLZA 4KG6A 4UA7A 5HL6A 2A49A 2P08A 1DRMA 1C3BA 3WS1A 1PRQA 4LV1A 3PAGA 3WRTA 3DWKA 3C7VA 1SKOB 2Y2IA 1ESIA 3EGXC 3NC8A 4Z1WA 2XF3A 3IBRA 3NOTC 5DJUA 2FZ0A 1K0KA 4LENA 2XROA 1L0GA 4IVIA 3FYZA 3HJIA 1IKIA 1VM1A 1ZHHB 2ACGA 3NIAA 4D2OA 1JWVA 2JKTM 3B33A 2Q9NA 2R9WA 2Y91A 2W3GA 1V9ZA 1MWUA 5HL1A 3C5AA 3CZDA 2VA0A 4QY6A 1BYWA 2PR5A 2KX6A 2HJEA 4BBVA 4RVAA 4RX2A 1FCMA 1PW1A 2Y2PA 2JBFA 4FSFA 1PWCA 4O01A 3IXHA 5HSQA 2YKHA 2IWBA 1OTAA 4Y0TA 1VQQA 1IKGA 4F3LA 4N9KA 3T1XA 5A91A 4CLCD 4OPQA 4DKIA 1KGFA 4EEPA 3QP2A 1A0KA 1ERMA 3NBLA 4FOFA 2ZOIA 3MZDA 1DP8A 2HP9A 2QYBA 1NXYA 3PBSA 3MKEA 4NEED 1L0DA 3VMAA 2E8IA 1G68A 2ZMAA 3B42A 4GS9A 1FSWA 1OTEA 4S2OA 4RQ9A 4E6WA 4ZJ2A 1PWDA 1N9OA 1L0FA 1MKIA 4K0WA 4OLGA 2D02A 2PYPA 2Y2KA 4I3IA 4JGPA 5HWVA 4DMZA 4U3TA 1KGGA 1PI5A 4IUKA 5I5LA 5CECA 1TVFA 3BJNA 3ZG8B 3VE3A 4MN5A 1G28A 4M3KA 4PM8A 1ZG4A 3LYXA 4EXOA 1BULA 3G31A 3VFFA 2HGVA 5EE8A 3A3IA 4CPKA 3VSLA 1KE4A 5J8XA 3H82A 2M1CA 3ZYTA 5E43A 4OQGA 2R9XA 3CMZA 1FCNA 3HLCA 1YMSA 2VK3A 4DJ3A 2QHKA 2BASA 5CEBA 2ZQ7A 1WE4A 3K2NA 2ZBBA 3IWIA 1DJCA 3MBZA 1FIKA 3E98A 5AVEA 2Y2QA 3HLDA 1F2KA 1NY0A 1OTBA 4GD6A 5TFQA 5K5BA 5BOHA 1YLYA 1KVLA 5EUAA 1VEUA 2XGNA 3C4OA 1ACFA 4X6TA 1G5UA 5HW3A 1BTLA 4WUJA 3UDXA 3ZCZA 3IS2A 4WZ5A 3IS2B 4HHDA 4GB7A 3E2KA 1YM1A 4X56A 1GSWA 3BWLA 3UPPA 2PYRA 1BSGA 2J7VA 2EX2A 2ZC5B 3T50A 3IXGA 4BBUA 3KO6A 4KZ5A 3QNCA 3A3DA 4GHIA 4WEJA 3D9YA 3JVVA 1SHVA 4H8RA 1OTIA 1SDNA 4E3LA 2X01A 3S4XA 3F1OB 4DDYA 1NJ4A 2WAEA 4P87A 2EWVA 3CUEC 4OP8A 4EU0A 1GHPA 5FSRA 2HDSA 3MF0A 4XUXA 1BLSA 3OBFA 2Y79A 4BL2A 3JYIA 4YNRA 1W5DA 5EV0A 4KZ3A 3UNWA 3GRJA 4HJ4A 1L2SA 3IX3A 2PT7A 5KZHA 1K25A 3VOZA 1Q2QA 4HJ6A 2EA9A 1GSXA 1H0MA 1VB6A 4HH2A 1GHMA 4KZAA 3T1QB 3D72A 1XGIA 5A93A 5EVID 2ZC6B 4GJ4A 2JC7A 3DTMA 4MLLA 2OLUA 4DN0A 5HPIA 3SH9A 4IUHA 1NZOA 1TDGA 4ZJ1A 1GA0A 4QWOA 2ZQDA 4KG2A 5EM0A 4HJ3A 3NHQA 1K57C 3M2JA 4UQIS 3MFXA 4OPYA 2ZQ8A 3IXDA 4FCFA 4S2KA 3SS3A 4GDNA 1E3UD 1UGUA 1YLPA 1G6AA 4JGOA 2ZLYA 4QD4A 3O5YA 5G18A
chains in the Genus database with same CATH topology
3LIFA 4LRZE 4MN6A 2INWA 5HD5A 2OWJA 3UB6A 2KLIA 3R4KA 5TJJA 1TS8A 3VE4A 3ZQ5A 3CUEA 1W63Q 5F69A 3OCNA 3T4LA 4JGRA 1OT9A 3H7WB 5DJTA 3G6OA 1F98A 3BY9A 5IS1A 3LI9A 3CLOA 3KSIA 3KSHA 4WN5A 1F9IA 1V9YA 2A24A 2VV7A 5FL3A 3VV4A 2HF6A 2HV1A 1TS6A 5LBRA 3MMHA 1TD5A 4EETB 5HZHA 2K31A 2I9VA 1STZA 4AFIA 4CLCB 3LR0A 1TS7A 2NUTC 5HPFA 2ZOHA 3GECA 1N9LA 1YAXA 3CI6A 4CLCE 4ETZA 3F1NB 5DKLA 1DP9A 3A0SA 2FH5A 4R38A 2XA7S 1N9NA 4BJPA 3MXQA 4WL9A 3T4OA 3FG8A 2Z6DA 4NXEA 1T1AA 4Y2FA 4HH3A 4OOLA 1P9RA 3E4QA 1LL8A 2P04A 3LR5A 1YSPA 3R7WA 4Q0IA 2QKPA 2K7SA 2R78A 4QPRA 1TF1A 4EW7A 3LI8A 3CAXA 1OTDA 2YKFA 4KUKA 2M7UA 4Y5FA 2J80A 3LFVA 3S7NA 1GSVA 4GHIB 2V0WA 4II7A 1G6OA 2VV6A 1T19A 4E04A 4XT2A 3F1PB 3S7PA 5HD3A 4L9FA 4F3LB 2V9AA 1XFQA 4MN7A 4PKYG 2W3FA 3BQ8A 4IJGA 3KX0X 3NOUC 2KDKA 4M4XA 2ZMVA 3LR4A 1Y28A 4I38A 3E4PA 3C8CA 2CMNA 1XJ3A 2JKRM 2VGLS 3T4JA 3U2AA 4WELA 3T4QA 3LIAA 2PHYA 4OOMA 4UEYA 3RH8B 2VV8A 4DJ2A 4NXBA 3TJZC 3OCLA 3TW8A 3SW1A 2JHEA 4I3AA 1YKDA 2OAQ1 4HNBA 4WEKA 4NKPA 4ETXA 4YWZA 1OPXA 3E4OA 4HOIA 5AVFA 3NJAA 4I3JA 4WLAA 3OOVA 1NLZA 2ZMFA 5HL6A 4WF0A 4GS9B 1D06A 2P08A 1DRMA 3UB7A 5DKKA 1T1CA 1H8MA 3EEAA 5HDDA 3CWFA 3EGXC 4Z1WA 3NOTC 3IBRA 5DJUA 2FZ0A 2J3TD 2XROA 2W3HA 3UE6A 2H28A 2L1MA 2O99A 3BY8A 4JGQA 1S66L 1DP6A 3HJIA 3S7QA 2NUPC 1ZHHB 2GX5A 2VX8A 1OJ5A 3B33A 2JKTM 4YOFA 3C2WA 2OAP1 3F1OA 3S7OA 2W3GA 1LSVA 2J3WA 1VHMA 3EQVA 2M7VA 4ARZA 1V9ZA 1S67L 3IBJA 1MC0A 3A0VA 5HDSA 4Q0HA 5DF9A 3BQAA 4R6LA 1XJ4A 2JKTI 2VA0A 4LLOB 4NXGA 1BYWA 1NLYA 3PBRA 2PR5A 2KX6A 4XT2B 2HJEA 4EQ1A 1S1YA 2XSSA 3PBTA 4I39A 3UB8A 4BBVA 4K08A 3EQUA 4Y3IA 4CLCA 3T4TA 4O8GA 4FSFA 5F5YA 4O01A 5HSQA 1EW0A 2W3DA 2YKHA 1OTAA 5KSHA 2P7JA 4F3LA 3MQ0A 2PDRA 3LR3A 5MC7A 4CLCD 2VLGA 3PYPA 4LRXC 2O0YA 2K2NA 2LB5A 4B9OA 2OOLA 2V0UA 2W3EA 4PAUA 4EEPA 5HWTA 3UMEA 4FOFA 2VEAA 2ZOIA 1DP8A 2QYBA 2EWWA 3PBSA 2GJ3A 3HJKA 4PKYA 1ODVA 1IOUA 2JKRI 4H6JB 4NEED 5C5KA 4P6ZS 1LT0A 3LIEA 4GCZA 4KQDA 3B42A 3FPWA 2A2LA 3CITA 4Q0JA 4O0PA 4GS9A 3PBQA 1OT6A 1OTEA 4RQ9A 4EEUA 4B93A 3EGDC 1N9OA 2V1BA 4BMWA 4HI4A 1W63M 1NRJA 2VZWA 5AJGA 2D02A 2GZAA 2PYPA 4L9GA 2Y8HA 4EERA 3RFBA 2VGLM 4I3IA 4JGPA 5L8MA 4G3VA 5HWVA 4DMZA 4IUKA 4HQAA 4GLQA 5I5LA 4KUOA 3BJNA 4MMNA 1LSWA 3V67A 4G3WA 1NWZA 3VE3A 3EOIA 3PBOA 1LSXA 4MN5A 3MQOA 1X0OA 2PD7A 1G28A 3DBAA 3ULFA 2IA2A 4BWIA 4CLCC 1KOUA 2B18A 3T4KA 1UWNX 3MJQA 1S4RA 5HDCA 3LYXA 2O9BA 4EXOA 5EFWA 4R70A 4ARZB 4KQOA 2HGVA 3R7WB 1P0ZA 3H82A 2M1CA 3ZYTA 5J4EA 1XJ6A 2W1TB 5TBMB 3KYZA 2D01A 2WKPA 3HCYA 3FPVA 3PHYA 2B02A 1XJ2A 3TRCA 4HP9A 3KSGA 4P6ZM 3TE8A 4DJ3A 3P01A 4HP4A 3K3DA 2QHKA 2BASA 3FC7A 2MJ6A 3MQQA 4ZRRA 3K2NA 3PXPA 1TS0A 4IHQA 5J3WA 2ZBBA 3E98A 2J3TC 1OJGA 5AVEA 5IT5A 3RTYA 5TBMA 3EEHA 1OTBA 3LICA 4CQHA 5K5BA 4LRYC 2PR6A 4LPZA 3MR0A 5A8BA 2WKQA 3OC2A 4WUJA 1WA9A 5F6AA 3IS2A 3C30A 3IS2B 1P97A 4R3AA 1XFNA 2XRNA 1ZTUA 5F68A 1P9WA 5G4ZA 2WKRA 4HHDA 5CX7A 3BW6A 1MZUA 1JNUA 1GSWA 3BWLA 2PYRA 3D3OA 3JVUA 3T50A 2W1TA 2PD8A 3C38A 3LIBA 2O9CA 4BBUA 3KO6A 1S1ZA 2XA7M 2QJ5A 4GHIA 4WEJA 4L9EA 3JVVA 3F1PA 4UQIM 3K3CA 4MDZA 2O9AA 3T4SA 3UE3A 3H9WA 3UB9A 2LB9A 2QWSA 3LIDA 4MCWA 1OTIA 2A24B 3F1OB 4I5SA 1UWPX 2EWVA 3CUEC 2OWHA 4PHTA 1MKMA 4GW9A 4EU0A 3EWKA 5G4YA 3MF0A 2HJ9C 3H82B 4H6JA 3PBNA 3OBFA 3ICYA 3UMDA 3W2ZA 4G3KA 2Y79A 2W1RA 2GNXA 5HWWA 3F1NA 4YNRA 3B47A 2Z6CA 2VKSA 1T1BA 4BBTA 1F5MA 2QJ7A 4ME4A 2DMWA 4HJ4A 3E0YA 3LUQA 2PT7A 5J7EA 3KSFA 3VOLA 2V1AA 4HJ6A 2EA9A 1GSXA 1D7EA 1VB6A 4HY8A 4HH2A 2VJWA 3GDIA 3D72A 2G7UA 3NOPC 4L0LA 4GJ4A 3KYQA 4EUVA 3H7WA 5KIZA 4DN0A 5HPIA 3A0RA 4IUHA 2KOIA 5IU1A 1YSQA 2L4RA 2L0WA 5DFXA 1T18A 1IFQA 4EESA 3OLOA 3P7NA 4HJ3A 3PR6A 1S4SA 3NHQA 2JN7A 4NXFA 4UQIS 3MFXA 1H3QA 2W27A 4HIAA 5DFYA 1UGUA 2W0NA 4JGOA 3O5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IS2 B;  1P97 A;  3LIF A;  4LRZ E;  1LT0 A;  4R3A A;  3SW1 A;  3LIE A;  1XFN A;  2JHE A;  4I3A A;  4MN6 A;  4GCZ A;  2INW A;  4KQD A;  5F68 A;  4HNB A;  5HD5 A;  2OWJ A;  5G4Z A;  2WKR A;  4YWZ A;  3UB6 A;  4GS9 A;  4HHD A;  1OT6 A;  3E4O A;  4HOI A;  1OTE A;  1TS8 A;  3VE4 A;  1MZU A;  1JNU A;  4RQ9 A;  3ZQ5 A;  5AVF A;  4EEU A;  1GSW A;  3BWL A;  5F69 A;  3NJA A;  4I3J A;  4WLA A;  2PYR A;  4JGR A;  1OT9 A;  1N9O A;  3H7W B;  2V1B A;  5DJT A;  3G6O A;  4HJ6 A;  4HI4 A;  4WF0 A;  3T50 A;  1F98 A;  2PD8 A;  3BY9 A;  3LIB A;  4GS9 B;  3LI9 A;  5IS1 A;  1D06 A;  3CLO A;  4WN5 A;  4BBU A;  1DRM A;  2D02 A;  1S1Z A;  1F9I A;  1V9Y A;  3UB7 A;  5DKK A;  1T1C A;  2A24 A;  2PYP A;  2QJ5 A;  2VV7 A;  4GHI A;  4L9E A;  4L9G A;  5HDD A;  4EER A;  3F1P A;  3K3C A;  3CWF A;  4I3I A;  4JGP A;  2HV1 A;  1TS6 A;  5HWV A;  3NOT C;  3IBR A;  5DJU A;  4HQA A;  5I5L A;  3H9W A;  3UB9 A;  4KUO A;  2QWS A;  3LID A;  4EET B;  1LSW A;  1OTI A;  3UE6 A;  5HZH A;  2H28 A;  2I9V A;  2L1M A;  2A24 B;  3F1O B;  4I5S A;  3BY8 A;  4JGQ A;  1S66 L;  4EEP A;  1NWZ A;  1UWP X;  1DP6 A;  2OWH A;  3HJI A;  3VE3 A;  1LSX A;  4MN5 A;  3MQO A;  1X0O A;  4GW9 A;  2PD7 A;  1G28 A;  3EWK A;  5G4Y A;  3ULF A;  1OJ5 A;  1TS7 A;  2ZOH A;  1KOU A;  3B33 A;  3GEC A;  1UWN X;  3C2W A;  3H82 B;  3MJQ A;  1S4R A;  5HDC A;  1N9L A;  3F1O A;  3LYX A;  4H6J A;  1LSV A;  4EXO A;  3ICY A;  5EFW A;  4R70 A;  3UMD A;  3F1N B;  5DKL A;  5HWW A;  3F1N A;  1DP9 A;  1V9Z A;  3A0S A;  1S67 L;  4R38 A;  2Z6C A;  3A0V A;  1N9N A;  5HDS A;  1P0Z A;  1T1B A;  3MXQ A;  4WL9 A;  3H82 A;  2M1C A;  3FG8 A;  5J4E A;  1XJ6 A;  1XJ4 A;  4R6L A;  4BBT A;  2Z6D A;  2QJ7 A;  4HJ4 A;  4NXE A;  1T1A A;  5TBM B;  4HH3 A;  4LLO B;  4NXG A;  3LUQ A;  5J7E A;  1BYW A;  2D01 A;  1LL8 A;  2WKP A;  2PR5 A;  3E4Q A;  3VOL A;  2V1A A;  2KX6 A;  3PHY A;  4XT2 B;  4EW7 A;  2B02 A;  2EA9 A;  1XJ2 A;  1GSX A;  2K7S A;  2QKP A;  1S1Y A;  1D7E A;  1VB6 A;  2R78 A;  3LI8 A;  3CAX A;  4HP9 A;  4HY8 A;  4HH2 A;  1OTD A;  2YKF A;  4I39 A;  4KUK A;  3UB8 A;  3GDI A;  4BBV A;  4DJ3 A;  3D72 A;  2J80 A;  4HP4 A;  4K08 A;  1GSV A;  3NOP C;  3K3D A;  2QHK A;  4GHI B;  2BAS A;  2V0W A;  3FC7 A;  5F5Y A;  3MQQ A;  5HSQ A;  1EW0 A;  1T19 A;  2VV6 A;  4E04 A;  4XT2 A;  2YKH A;  1OTA A;  3F1P B;  4EQ1 A;  1TS0 A;  2P7J A;  2ZBB A;  3H7W A;  5HD3 A;  4L9F A;  5J3W A;  4F3L A;  2PDR A;  4F3L B;  5KIZ A;  2V9A A;  1XFQ A;  3A0R A;  4PKY G;  1OJG A;  5IU1 A;  5AVE A;  2VLG A;  3PYP A;  4LRX C;  2L4R A;  2L0W A;  1T18 A;  3RTY A;  5TBM A;  3KX0 X;  3EEH A;  4EES A;  1OTB A;  3OLO A;  3P7N A;  2OOL A;  2KDK A;  2V0U A;  3LIC A;  3NOU C;  4HJ3 A;  4LRY C;  4M4X A;  4B9O A;  1Y28 A;  4I38 A;  4WUJ A;  5HWT A;  1S4S A;  3E4P A;  2JN7 A;  2PR6 A;  3NHQ A;  4NXF A;  3UME A;  4LPZ A;  2VEA A;  2CMN A;  1XJ3 A;  2ZOI A;  3C8C A;  3MFX A;  1DP8 A;  2W27 A;  3MR0 A;  5A8B A;  2WKQ A;  2GJ3 A;  2PHY A;  3HJK A;  1ODV A;  3LIA A;  4HIA A;  4PKY A;  4H6J B;  3RH8 B;  2VV8 A;  1UGU A;  4NXB A;  2W0N A;  4JGO A;  1WA9 A;  4DJ2 A;  5F6A A;  3IS2 A; 
#chains in the Genus database with same CATH topology
 4LRZ E;  4MN6 A;  2INW A;  3U4L P;  4ZBE A;  5HD5 A;  3W4Q A;  3UB6 A;  2KLI A;  3R4K A;  3V50 A;  1O07 A;  5TJJ A;  3VE4 A;  3CUE A;  4IBX A;  2Z2L B;  4JGR A;  1SZV A;  3QHY A;  3DTE A;  2V8F A;  1J3W A;  1V9Y A;  5CHJ A;  2E8J A;  2HF6 A;  4QJG A;  1K38 A;  2A3U A;  3CJM A;  3MMH A;  5HZH A;  1FCO A;  4KZ7 A;  3ZG7 B;  5I94 A;  3VP3 A;  4KQQ A;  2WK0 A;  1STZ A;  4AFI A;  3UPN A;  5FQK A;  2AVX A;  3W8K A;  1YT4 A;  4UA9 A;  5E2E A;  3CI6 A;  4CLC E;  1DP9 A;  3UDI A;  2XA7 S;  3T4O A;  2Z6D A;  4HH3 A;  4OOL A;  1P9R A;  3E4Q A;  1WYB A;  1YLT A;  3R7W A;  1JWZ A;  4KUK A;  1KGE A;  2Y59 A;  1GSV A;  4S2N C;  2VV6 A;  4XT2 A;  3VSK A;  4PM5 A;  1CI8 A;  4EBL A;  5HAI A;  1XP4 A;  4OLD A;  1XFQ A;  2ZC4 B;  5GLB A;  3UE0 A;  3N6I A;  3NDG A;  1FQG A;  5FAP A;  3IHA A;  2ZQ9 A;  3LR4 A;  1SDE A;  1Y28 A;  3E4P A;  3IF6 C;  1W8Q A;  2I72 A;  2C5W B;  4WEL A;  3T4Q A;  1NRF A;  2PHY A;  3RH8 B;  4JKT A;  4I3A A;  4A5R A;  1XGJ A;  4NKP A;  4ETX A;  3NY4 A;  5FDH A;  1S6R A;  3GQZ A;  3IQA A;  4N9L A;  3M6B A;  2HZ5 A;  1SCW A;  5HX9 A;  1K55 A;  4Y15 A;  1ZC2 A;  3UE6 A;  2QPN A;  3N7W A;  4R3B A;  4LGW A;  3S7Q A;  4NET A;  4ZTK A;  2GX5 A;  1MWR A;  1Q2P A;  4S2L A;  4D60 A;  1VHM A;  4UAA A;  2DRW A;  2M7V A;  1S67 L;  3HUN A;  3IBJ A;  3A0V A;  3HVF A;  3OPH A;  3CPT A;  4Q0H A;  5DF9 A;  1K4F A;  4P6B A;  4LCL A;  1JTD A;  4B4Z A;  4EQ1 A;  4EBN A;  3PBT A;  3HLG A;  5M19 A;  2CC1 A;  3UB8 A;  4MBF A;  4K08 A;  3T4T A;  3LY3 A;  3IT9 A;  4O8G A;  5EVI B;  1IEL A;  3Q1F A;  5KSH A;  1E4D A;  2PAV P;  3MQ0 A;  3LR3 A;  2Q9M A;  5L2F A;  2XR0 A;  3PYP A;  2O0Y A;  5FI2 A;  2HDQ A;  2PU2 A;  4PAU A;  4Y17 A;  5HWT A;  2ZL1 B;  1NYY A;  4N92 A;  3BEC A;  2EWW A;  3HJK A;  2JKR I;  4H6J B;  3MS6 A;  3LIE A;  4KQD A;  3BM6 A;  3FPW A;  1MPL A;  1M40 A;  4O0P A;  5HAQ A;  5A90 A;  3PBQ A;  3BEB A;  4E6X A;  4FUW A;  1H5X A;  2C6W B;  4BMW A;  1NRJ A;  5EVE A;  4P85 A;  2Y8H A;  1FR1 A;  3WS4 A;  4G3V A;  5EPH A;  4MMN A;  1LSW A;  2J9O A;  4N1X A;  3FWL A;  4MBH A;  2Y2H A;  1LSX A;  3ZDJ A;  2PD7 A;  3DBA A;  3ULF A;  4DXB A;  3RJU A;  3T4K A;  2V8C A;  3MJQ A;  4KZ9 A;  4DE2 A;  1ERQ A;  1BZA A;  3SS4 A;  1PIO A;  5E2F A;  4EQI A;  4OKP A;  1P0Z A;  5M18 A;  4KZ4 A;  3QP6 A;  2B5R A;  1FOF A;  4ZAM A;  4KZ8 A;  3KYZ A;  2EX6 A;  3FPV A;  2B02 A;  1XJ2 A;  5L10 A;  3BFC A;  2FFF B;  3KSG A;  4Y7P A;  4P6Z M;  1SKF A;  3HUO A;  3BFG A;  4Z9Q A;  3C4P A;  4ZRR A;  1W7F A;  5HFO A;  3SOI A;  4X55 A;  1K57 A;  3NUL A;  4WZ4 A;  5IT5 A;  5D3O A;  1MXO A;  5TBM A;  4WZ5 C;  4IBR A;  3TSG A;  3MR0 A;  2XK1 A;  5A8B A;  3OC2 A;  5GLD A;  3V3S A;  4B88 A;  2XLN A;  5EEC A;  3SS5 A;  5F68 A;  1P9W A;  5G4Z A;  1K6R A;  1QME A;  3ZVT A;  5CX7 A;  1JNU A;  5GHX A;  3D3O A;  3JVU A;  4KG5 A;  4IVK A;  2PD8 A;  3C38 A;  4N1H A;  2O9C A;  1U60 A;  2XA7 M;  3MZF A;  1ES4 A;  4UQI M;  2O9A A;  2EX9 A;  3HLE A;  3UB9 A;  2V20 A;  4MCW A;  2WGW B;  3FKV A;  4I5S A;  4B4X A;  1IYO A;  4GW9 A;  5CGS A;  2Y2G A;  2HJ9 C;  5FQM A;  3NI9 A;  4PPR A;  3PBN A;  3ICY A;  3UMD A;  3W2Z A;  1LLB A;  2W1R A;  4LFU A;  4JF6 A;  1K6S A;  4BBT A;  2QJ7 A;  3E0Y A;  3M6H A;  5J7E A;  3VP2 A;  1L0E A;  2HPB A;  3N8S A;  4HY8 A;  4S2J A;  2WAD A;  2EX8 A;  3UO9 A;  1OME A;  3Q7V A;  4KZB A;  1EI5 A;  4JBF A;  2Y4A A;  4EUV A;  4JPM A;  3GSG A;  1CQA A;  3DTK A;  2L4R A;  2UV0 E;  2L0W A;  5DFX A;  1T18 A;  3WS0 A;  4JXV A;  3AGD A;  5M1A A;  3OLO A;  1IEM A;  3T1R A;  3WWX A;  3ZG9 B;  3GV9 A;  1JVJ A;  2W27 A;  4Y0U A;  1M6K A;  3D4F A;  3DTI A;  3Q7Z A;  2XQZ A;  4GZB A;  5F69 A;  3OCN A;  2EFX A;  3SZT A;  3G6O A;  3IH9 A;  1ZKJ A;  3LI9 A;  1KDS A;  3CLO A;  4WN5 A;  5L09 A;  2X71 A;  2A24 A;  2VV7 A;  1YLW A;  2G2U A;  4E3M A;  2H10 A;  5LBR A;  2FFY A;  3WRZ A;  4MBK A;  4R3J A;  5GLA A;  5FI6 A;  2K31 A;  5EVI C;  3PAE A;  2H0Y A;  1BLC A;  4CLC B;  3IX4 A;  4WBG A;  1TS7 A;  1LHY A;  4WYY A;  3MFD A;  5F83 A;  1YLZ A;  5DKL A;  2X02 A;  2FH5 A;  5FQ9 A;  4BJP A;  3MXQ A;  3FG8 A;  2G2W A;  3HBR A;  1YPR A;  4DRT A;  4U0T A;  4EUZ A;  5JYO A;  3Q07 A;  2P04 A;  3GMW A;  4OQI A;  4Q0I A;  2QKP A;  2K7S A;  3CPT B;  1TF1 A;  3CAX A;  2Y2L A;  2YKF A;  4Y5F A;  3VP0 A;  3QP5 A;  3T1S A;  2Y2J A;  4II7 A;  4JXS A;  4E04 A;  3F1P B;  4HBT A;  5HD3 A;  3IF6 A;  1GCE A;  2V9A A;  2Y55 A;  1PI4 A;  2W3F A;  2PRF A;  1W79 A;  3KX0 X;  5AQB A;  2KDK A;  2ZMV A;  3GVB A;  4LV0 A;  1HVB A;  1YLJ A;  5A92 A;  4OOM A;  4DF6 A;  5CHU A;  3TJZ C;  3TW8 A;  5CXW A;  2H5S A;  2JHE A;  2RL3 A;  4HNB A;  4WEK A;  1VEU B;  4YWZ A;  2HDR A;  5CED A;  1Y54 A;  2QMI A;  5FQI A;  1K55 C;  2ZMF A;  2WZZ A;  5HAP A;  1D06 A;  5DKK A;  1T1C A;  4RYE A;  3WS2 A;  2Y2O A;  1H8M A;  5HDD A;  1Y4O A;  4NK3 A;  5EOO A;  2H28 A;  2L1M A;  2O99 A;  2ZD8 A;  3BY8 A;  1E3U A;  1WYC A;  3MXR A;  3ZNY A;  2VX8 A;  3T12 B;  2WGI A;  3C2W A;  3F1O A;  3S7O A;  1AWI A;  4ID4 A;  1LSV A;  1W8Y A;  3EQV A;  4OPZ A;  3A3J A;  1MC0 A;  5HDS A;  4JXW A;  4XXR A;  3BQA A;  4GNU A;  4FH4 A;  2P9V B;  4LLO B;  4NXG A;  1NLY A;  2ZM0 A;  3IF5 A;  4XT2 B;  4E3J A;  1S1Y A;  2XSS A;  2PU4 A;  4I39 A;  3ITB A;  1KE3 A;  5CHM A;  3EQU A;  4Y3I A;  5GHZ A;  2PDR A;  4KZ6 A;  1L3L A;  2BG1 A;  2VLG A;  1JTG A;  2K2N A;  3OZH A;  2LB5 A;  2W3E A;  1RGZ A;  4K0X A;  3UME A;  5DVA A;  3ZNT A;  3O88 A;  5TGF A;  4KQR A;  2GJ3 A;  5C5K A;  4P6Z S;  1Z6F A;  3CIT A;  1OT6 A;  3G2Y A;  4EEU A;  4B93 A;  5JYP A;  2V1B A;  5DF8 A;  4HI4 A;  1W63 M;  5AJG A;  2VZW A;  4EBP A;  2WYX A;  3BFD A;  2JKF A;  3RFB A;  5L8M A;  1PNE A;  4OH0 A;  3N8R A;  4HQA A;  4KUO A;  1XA1 A;  4R23 A;  3V67 A;  4G3W A;  3G30 A;  2XFS A;  4FH2 A;  3LEZ A;  1VET B;  3PBO A;  1LI0 A;  3IF6 B;  2WZX A;  4XUZ A;  3VP1 A;  3Q7V B;  2IA2 A;  4JLF A;  4QHC A;  1KOU A;  3S22 A;  1H8Z A;  1UWN X;  1S4R A;  5HDC A;  5FEG A;  1TEM A;  5TR7 A;  4ARZ B;  4KQO A;  5F1F A;  1XJ6 A;  3LEQ A;  1LL5 A;  1LL9 A;  1QMF A;  4DE3 A;  2D01 A;  3HCY A;  3PHY A;  1N4O A;  1J9M A;  4HP9 A;  5DTK A;  3P01 A;  4HP4 A;  3K3D A;  1KDW A;  3FC7 A;  2MJ6 A;  3MQQ A;  3PXP A;  4IHQ A;  3CHW P;  3BLS A;  1IYP A;  4ZJ3 A;  1ZG6 A;  4OON A;  1OJG A;  3HRE A;  4HEF A;  4CQH A;  1MWS A;  4LRY C;  1FSY A;  3Q82 A;  3TOI A;  3IXB A;  1WA9 A;  2DCF A;  3L9K A;  1XFN A;  2XRN A;  3BYD A;  1ZTU A;  5KMW A;  3UDF A;  3BW6 A;  1MZU A;  5U47 A;  4DE0 A;  3NCK A;  2W1T A;  1K56 D;  1O7E A;  5HAR A;  4L9E A;  1PZO A;  3K3C A;  5EM1 A;  1K54 A;  5IHV A;  3W4O A;  3VFH A;  1YMX A;  4MNR A;  3UE3 A;  2HP6 A;  4X69 A;  2QWS A;  1HLU P;  2A24 B;  1UWP X;  4NG2 A;  4O7D A;  4PHT A;  4Q8I A;  5DTS A;  1ALQ A;  4PM7 A;  2WUQ A;  4X25 A;  3BFF A;  2GNX A;  1BT5 A;  2Z6C A;  2VKS A;  3OPR A;  1T1B A;  3JPU A;  4QB8 A;  4C3Q A;  3S1Y A;  4R4S A;  3KSF A;  1D7E A;  4WMC A;  1S0W A;  2VJW A;  3HLB A;  3NOP C;  2EFU A;  1HTZ A;  3ZVW A;  3HUM A;  3OPP A;  4MEZ A;  5IU1 A;  4EWF A;  2XD5 A;  1YSQ A;  1IFQ A;  4EES A;  3FZC A;  5FA7 A;  3PR6 A;  1JWP A;  2JN7 A;  4NXF A;  5FQQ A;  2ZM8 A;  3N4I A;  4HIA A;  5DFY A;  3WS5 A;  5E2H A;  2OLV A;  4DXC A;  3A3E A;  5CRF A;  2V1Z A;  3LIF A;  4GDB A;  2OWJ A;  1TS8 A;  3UPO A;  4U0X A;  1CEG A;  3T4L A;  4RX3 A;  3G32 A;  3BY9 A;  3TG9 A;  5IS1 A;  3KSI A;  3KSH A;  5EVI A;  5FL3 A;  2WGW A;  4S2N A;  3KYE A;  4X68 A;  1ES3 A;  4BEN A;  4RA7 A;  2H0T A;  4EET B;  2B95 A;  2VGJ A;  1RP5 A;  3V39 A;  1K4E A;  1RCJ A;  3DAV A;  2EXA A;  2NUT C;  4UA6 A;  5HPF A;  2ZOH A;  3GEC A;  1N9L A;  2PBY A;  1YAX A;  4PM6 A;  4ETZ A;  3F1N B;  5F1G A;  4BL3 A;  1XPB A;  5FQJ A;  3ZFZ A;  1CI9 A;  1T1A A;  1PW8 A;  1LL8 A;  1HD8 A;  3AGF A;  3LR5 A;  2R78 A;  1CK3 A;  3LI8 A;  3B3X A;  4WMC D;  3HLF A;  1PZP A;  4E3K A;  3LFV A;  4E3I A;  3S7N A;  1ES5 A;  4GHI B;  2XEP A;  5GL9 A;  1G6O A;  1T19 A;  2V2F F;  4F3L B;  4MN7 A;  3BQ8 A;  4IJG A;  1ONG A;  3PTE A;  4M4X A;  2CMN A;  1XJ3 A;  2JKR M;  4R0Q A;  3T4J A;  3U2A A;  4UEY A;  5E2G A;  1MBL A;  4DJ2 A;  3OCL A;  1KE0 A;  3SW1 A;  3MXS A;  4S2P A;  1YKD A;  2XDM A;  1OPX A;  3E4O A;  4S2I A;  4I3J A;  2EXB A;  4WLA A;  4R4R A;  4WF0 A;  4GS9 B;  3ITA A;  4GKU A;  5AQ9 A;  3UB7 A;  2PBD P;  3LO7 A;  3EEA A;  4PM9 A;  3CWF A;  4WM9 A;  4ESP A;  2J3T D;  1ESU A;  2W3H A;  4OVD A;  3RXX A;  4JGQ A;  3G34 A;  1S66 L;  1DP6 A;  2NUP C;  3E2L A;  2VGK A;  1OJ5 A;  4YOF A;  1PWG A;  3MZE A;  2OAP 1;  2P74 A;  2J3W A;  4Y0O A;  4JF5 A;  4ARZ A;  1MWT A;  2ZL1 A;  4ZDX A;  3VOY A;  4R6L A;  1XJ4 A;  5CTM A;  2JKT I;  3PBR A;  1DJA A;  4CLC A;  3I7J A;  5F5Y A;  1EW0 A;  2W3D A;  2P7J A;  4OQH A;  5FEF A;  5MC7 A;  1I2S A;  4LRX C;  4B9O A;  2OOL A;  2V0U A;  4EV4 A;  3P09 A;  2ZC7 A;  2VEA A;  4LCM A;  1IOU A;  4PKY A;  1ODV A;  1LT0 A;  4OP5 A;  4GCZ A;  2A2L A;  2ZC3 B;  4Q0J A;  3IH8 A;  4OOY A;  3EGD C;  2J9P A;  3HLW A;  2WAF A;  3UN7 A;  4Y13 A;  1ONH A;  1AXB A;  2GZA A;  3BLM A;  4L9G A;  4EER A;  2VGL M;  4YIN A;  1IYS A;  2WKI A;  2GDN A;  3ZG0 A;  3QP8 A;  1NWZ A;  4IED A;  3EOI A;  3MQO A;  1X0O A;  2OV5 A;  1CJF A;  4BWI A;  4CLC C;  2B18 A;  2O9B A;  5EFW A;  2IWC A;  4R70 A;  5FI7 A;  4E3N A;  3R7W B;  3AGE A;  1IYQ A;  4OQ0 A;  5FAS A;  1I5Q A;  5J4E A;  1I2W A;  2W1T B;  3IWQ A;  5TBM B;  4PMA A;  2WKP A;  3TRC A;  4E3O A;  5CTN A;  3TE8 A;  4C6Y A;  3ISG A;  1CEF A;  4OPR A;  2XFT A;  5L07 A;  5GLC A;  1CF0 A;  1TS0 A;  5J3W A;  4BD1 A;  2J3T C;  1TDL A;  3RTY A;  3EEH A;  5FDS A;  4KEN B;  3LIC A;  3DW0 A;  1ERO A;  1HZO A;  3G35 A;  2PR6 A;  4LPZ A;  5F82 A;  1H8Y A;  2WKQ A;  5KSC A;  2JE5 A;  1VET A;  2JCH A;  3NDE A;  5F6A A;  3C30 A;  1P97 A;  4R3A A;  1PFL A;  2WKR A;  3DWZ A;  1DJB A;  2ZQA A;  4X53 A;  3O3V A;  1K54 C;  3SH7 A;  2J8Y A;  3ZG5 A;  3LIB A;  4CJN A;  1S1Z A;  3QP1 A;  4GN2 A;  2QJ5 A;  4HBU A;  3UY6 A;  5FAQ A;  3F1P A;  5EVL A;  4MDZ A;  4S2M A;  1Z09 A;  3T4S A;  3H9W A;  2LB9 A;  3LID A;  4F94 A;  1YQS A;  5AQA A;  2HDU A;  2JKG A;  3ZGA B;  4X1L A;  2OWH A;  2QZ6 A;  1KVM A;  1MKM A;  3L7H A;  3EWK A;  2ZM2 A;  3IX8 A;  5G4Y A;  1BUE A;  3H82 B;  1XX2 A;  5FAT A;  4H6J A;  4LV2 A;  4G3K A;  3W4P A;  5HWW A;  3F1N A;  3UE1 A;  3B47 A;  1FIL A;  2Q0O A;  5GHY A;  1F5M A;  4ME4 A;  2DMW A;  5DTT A;  2RCX A;  3LUQ A;  1E25 A;  3VOL A;  2V1A A;  4BLM A;  3P98 A;  3ZHH A;  1GA9 A;  3N8L A;  4R1G A;  1NYM A;  3FV7 A;  2P9V A;  3GDI A;  3RXW A;  1RGY A;  2G7U A;  4L0L A;  5EOE A;  1SKO A;  3FKW A;  3KYQ A;  3CG5 A;  3H7W A;  5KIZ A;  4QU3 A;  5AQ7 A;  5CGX A;  3A0R A;  3O87 A;  4DE1 A;  3QP4 A;  2KOI A;  2XH9 A;  3VP4 A;  2WKE A;  3G4P A;  3P7N A;  1FR6 A;  3C7U A;  1S4S A;  2HP5 A;  1EWZ A;  1NZU A;  2Y2N A;  1H3Q A;  1XA7 A;  4HES A;  2ZJ9 A;  3LCE A;  3NEC A;  2W0N A;  4GLQ A;  3GTC A;  1PYY A;  2OSU A;  5FAO A;  4GD8 A;  4JXG A;  3V3R A;  3ZQ5 A;  1W63 Q;  1DY6 A;  1OT9 A;  4BQM A;  3H7W B;  5DJT A;  1F98 A;  4YFM A;  1F9I A;  3SH8 A;  3VV4 A;  2BLS A;  2Z2M B;  2HV1 A;  1TS6 A;  3BFE A;  1TD5 A;  5CGW A;  2I9V A;  3MSH A;  3G2Z A;  2Y2M A;  4GOG A;  3O86 A;  3LR0 A;  5DF7 A;  3BRM A;  1BLH A;  1ES2 A;  1MY8 A;  3A0S A;  4R38 A;  2IWD A;  3LGO A;  1N9N A;  4WL9 A;  1XKZ A;  1K56 A;  3A3F A;  4NXE A;  4Y2F A;  2DNS A;  3QNB A;  4UHU A;  3UB5 P;  1YSP A;  4QPR A;  4EW7 A;  2ZQC A;  3LY4 A;  1BLP A;  1OTD A;  2M7U A;  2J80 A;  2BTF P;  2WGV A;  1D1J A;  2V0W A;  1LI9 A;  4LV3 A;  4C75 A;  4K91 A;  2WKH A;  3S7P A;  4L9F A;  3Q81 A;  4JF4 A;  4PKY G;  4BD0 A;  4FTX A;  4DDS A;  1XXM A;  2XD1 A;  5CER A;  4P0M A;  3NOU C;  3M2K A;  4X1M A;  4I38 A;  3C8C A;  2VGL S;  1GHI A;  3IWO A;  3HL9 A;  3LIA A;  3OPL A;  2VV8 A;  3IHB A;  4NXB A;  4QY5 A;  1N9B A;  2OAQ 1;  3MKF A;  4HOI A;  5AVF A;  4FD8 A;  3NJA A;  3V5M A;  2UWX A;  3GR2 A;  3OOV A;  1NLZ A;  4KG6 A;  4UA7 A;  5HL6 A;  2A49 A;  2P08 A;  1DRM A;  1C3B A;  3WS1 A;  1PRQ A;  4LV1 A;  3PAG A;  3WRT A;  3DWK A;  3C7V A;  1SKO B;  2Y2I A;  1ESI A;  3EGX C;  3NC8 A;  4Z1W A;  2XF3 A;  3IBR A;  3NOT C;  5DJU A;  2FZ0 A;  1K0K A;  4LEN A;  2XRO A;  1L0G A;  4IVI A;  3FYZ A;  3HJI A;  1IKI A;  1VM1 A;  1ZHH B;  2ACG A;  3NIA A;  4D2O A;  1JWV A;  2JKT M;  3B33 A;  2Q9N A;  2R9W A;  2Y91 A;  2W3G A;  1V9Z A;  1MWU A;  5HL1 A;  3C5A A;  3CZD A;  2VA0 A;  4QY6 A;  1BYW A;  2PR5 A;  2KX6 A;  2HJE A;  4BBV A;  4RVA A;  4RX2 A;  1FCM A;  1PW1 A;  2Y2P A;  2JBF A;  4FSF A;  1PWC A;  4O01 A;  3IXH A;  5HSQ A;  2YKH A;  2IWB A;  1OTA A;  4Y0T A;  1VQQ A;  1IKG A;  4F3L A;  4N9K A;  3T1X A;  5A91 A;  4CLC D;  4OPQ A;  4DKI A;  1KGF A;  4EEP A;  3QP2 A;  1A0K A;  1ERM A;  3NBL A;  4FOF A;  2ZOI A;  3MZD A;  1DP8 A;  2HP9 A;  2QYB A;  1NXY A;  3PBS A;  3MKE A;  4NEE D;  1L0D A;  3VMA A;  2E8I A;  1G68 A;  2ZMA A;  3B42 A;  4GS9 A;  1FSW A;  1OTE A;  4S2O A;  4RQ9 A;  4E6W A;  4ZJ2 A;  1PWD A;  1N9O A;  1L0F A;  1MKI A;  4K0W A;  4OLG A;  2D02 A;  2PYP A;  2Y2K A;  4I3I A;  4JGP A;  5HWV A;  4DMZ A;  4U3T A;  1KGG A;  1PI5 A;  4IUK A;  5I5L A;  5CEC A;  1TVF A;  3BJN A;  3ZG8 B;  3VE3 A;  4MN5 A;  1G28 A;  4M3K A;  4PM8 A;  1ZG4 A;  3LYX A;  4EXO A;  1BUL A;  3G31 A;  3VFF A;  2HGV A;  5EE8 A;  3A3I A;  4CPK A;  3VSL A;  1KE4 A;  5J8X A;  3H82 A;  2M1C A;  3ZYT A;  5E43 A;  4OQG A;  2R9X A;  3CMZ A;  1FCN A;  3HLC A;  1YMS A;  2VK3 A;  4DJ3 A;  2QHK A;  2BAS A;  5CEB A;  2ZQ7 A;  1WE4 A;  3K2N A;  2ZBB A;  3IWI A;  1DJC A;  3MBZ A;  1FIK A;  3E98 A;  5AVE A;  2Y2Q A;  3HLD A;  1F2K A;  1NY0 A;  1OTB A;  4GD6 A;  5TFQ A;  5K5B A;  5BOH A;  1YLY A;  1KVL A;  5EUA A;  1VEU A;  2XGN A;  3C4O A;  1ACF A;  4X6T A;  1G5U A;  5HW3 A;  1BTL A;  4WUJ A;  3UDX A;  3ZCZ A;  3IS2 A;  4WZ5 A;  3IS2 B;  4HHD A;  4GB7 A;  3E2K A;  1YM1 A;  4X56 A;  1GSW A;  3BWL A;  3UPP A;  2PYR A;  1BSG A;  2J7V A;  2EX2 A;  2ZC5 B;  3T50 A;  3IXG A;  4BBU A;  3KO6 A;  4KZ5 A;  3QNC A;  3A3D A;  4GHI A;  4WEJ A;  3D9Y A;  3JVV A;  1SHV A;  4H8R A;  1OTI A;  1SDN A;  4E3L A;  2X01 A;  3S4X A;  3F1O B;  4DDY A;  1NJ4 A;  2WAE A;  4P87 A;  2EWV A;  3CUE C;  4OP8 A;  4EU0 A;  1GHP A;  5FSR A;  2HDS A;  3MF0 A;  4XUX A;  1BLS A;  3OBF A;  2Y79 A;  4BL2 A;  3JYI A;  4YNR A;  1W5D A;  5EV0 A;  4KZ3 A;  3UNW A;  3GRJ A;  4HJ4 A;  1L2S A;  3IX3 A;  2PT7 A;  5KZH A;  1K25 A;  3VOZ A;  1Q2Q A;  4HJ6 A;  2EA9 A;  1GSX A;  1H0M A;  1VB6 A;  4HH2 A;  1GHM A;  4KZA A;  3T1Q B;  3D72 A;  1XGI A;  5A93 A;  5EVI D;  2ZC6 B;  4GJ4 A;  2JC7 A;  3DTM A;  4MLL A;  2OLU A;  4DN0 A;  5HPI A;  3SH9 A;  4IUH A;  1NZO A;  1TDG A;  4ZJ1 A;  1GA0 A;  4QWO A;  2ZQD A;  4KG2 A;  5EM0 A;  4HJ3 A;  3NHQ A;  1K57 C;  3M2J A;  4UQI S;  3MFX A;  4OPY A;  2ZQ8 A;  3IXD A;  4FCF A;  4S2K A;  3SS3 A;  4GDN A;  1E3U D;  1UGU A;  1YLP A;  1G6A A;  4JGO A;  2ZLY A;  4QD4 A;  3O5Y A;  5G18 A; 
#chains in the Genus database with same CATH homology
 3LIF A;  4LRZ E;  4MN6 A;  2INW A;  5HD5 A;  2OWJ A;  3UB6 A;  2KLI A;  3R4K A;  5TJJ A;  1TS8 A;  3VE4 A;  3ZQ5 A;  3CUE A;  1W63 Q;  5F69 A;  3OCN A;  3T4L A;  4JGR A;  1OT9 A;  3H7W B;  5DJT A;  3G6O A;  1F98 A;  3BY9 A;  5IS1 A;  3LI9 A;  3CLO A;  3KSI A;  3KSH A;  4WN5 A;  1F9I A;  1V9Y A;  2A24 A;  2VV7 A;  5FL3 A;  3VV4 A;  2HF6 A;  2HV1 A;  1TS6 A;  5LBR A;  3MMH A;  1TD5 A;  4EET B;  5HZH A;  2K31 A;  2I9V A;  1STZ A;  4AFI A;  4CLC B;  3LR0 A;  1TS7 A;  2NUT C;  5HPF A;  2ZOH A;  3GEC A;  1N9L A;  1YAX A;  3CI6 A;  4CLC E;  4ETZ A;  3F1N B;  5DKL A;  1DP9 A;  3A0S A;  2FH5 A;  4R38 A;  2XA7 S;  1N9N A;  4BJP A;  3MXQ A;  4WL9 A;  3T4O A;  3FG8 A;  2Z6D A;  4NXE A;  1T1A A;  4Y2F A;  4HH3 A;  4OOL A;  1P9R A;  3E4Q A;  1LL8 A;  2P04 A;  3LR5 A;  1YSP A;  3R7W A;  4Q0I A;  2QKP A;  2K7S A;  2R78 A;  4QPR A;  1TF1 A;  4EW7 A;  3LI8 A;  3CAX A;  1OTD A;  2YKF A;  4KUK A;  2M7U A;  4Y5F A;  2J80 A;  3LFV A;  3S7N A;  1GSV A;  4GHI B;  2V0W A;  4II7 A;  1G6O A;  2VV6 A;  1T19 A;  4E04 A;  4XT2 A;  3F1P B;  3S7P A;  5HD3 A;  4L9F A;  4F3L B;  2V9A A;  1XFQ A;  4MN7 A;  4PKY G;  2W3F A;  3BQ8 A;  4IJG A;  3KX0 X;  3NOU C;  2KDK A;  4M4X A;  2ZMV A;  3LR4 A;  1Y28 A;  4I38 A;  3E4P A;  3C8C A;  2CMN A;  1XJ3 A;  2JKR M;  2VGL S;  3T4J A;  3U2A A;  4WEL A;  3T4Q A;  3LIA A;  2PHY A;  4OOM A;  4UEY A;  3RH8 B;  2VV8 A;  4DJ2 A;  4NXB A;  3TJZ C;  3OCL A;  3TW8 A;  3SW1 A;  2JHE A;  4I3A A;  1YKD A;  2OAQ 1;  4HNB A;  4WEK A;  4NKP A;  4ETX A;  4YWZ A;  1OPX A;  3E4O A;  4HOI A;  5AVF A;  3NJA A;  4I3J A;  4WLA A;  3OOV A;  1NLZ A;  2ZMF A;  5HL6 A;  4WF0 A;  4GS9 B;  1D06 A;  2P08 A;  1DRM A;  3UB7 A;  5DKK A;  1T1C A;  1H8M A;  3EEA A;  5HDD A;  3CWF A;  3EGX C;  4Z1W A;  3NOT C;  3IBR A;  5DJU A;  2FZ0 A;  2J3T D;  2XRO A;  2W3H A;  3UE6 A;  2H28 A;  2L1M A;  2O99 A;  3BY8 A;  4JGQ A;  1S66 L;  1DP6 A;  3HJI A;  3S7Q A;  2NUP C;  1ZHH B;  2GX5 A;  2VX8 A;  1OJ5 A;  3B33 A;  2JKT M;  4YOF A;  3C2W A;  2OAP 1;  3F1O A;  3S7O A;  2W3G A;  1LSV A;  2J3W A;  1VHM A;  3EQV A;  2M7V A;  4ARZ A;  1V9Z A;  1S67 L;  3IBJ A;  1MC0 A;  3A0V A;  5HDS A;  4Q0H A;  5DF9 A;  3BQA A;  4R6L A;  1XJ4 A;  2JKT I;  2VA0 A;  4LLO B;  4NXG A;  1BYW A;  1NLY A;  3PBR A;  2PR5 A;  2KX6 A;  4XT2 B;  2HJE A;  4EQ1 A;  1S1Y A;  2XSS A;  3PBT A;  4I39 A;  3UB8 A;  4BBV A;  4K08 A;  3EQU A;  4Y3I A;  4CLC A;  3T4T A;  4O8G A;  4FSF A;  5F5Y A;  4O01 A;  5HSQ A;  1EW0 A;  2W3D A;  2YKH A;  1OTA A;  5KSH A;  2P7J A;  4F3L A;  3MQ0 A;  2PDR A;  3LR3 A;  5MC7 A;  4CLC D;  2VLG A;  3PYP A;  4LRX C;  2O0Y A;  2K2N A;  2LB5 A;  4B9O A;  2OOL A;  2V0U A;  2W3E A;  4PAU A;  4EEP A;  5HWT A;  3UME A;  4FOF A;  2VEA A;  2ZOI A;  1DP8 A;  2QYB A;  2EWW A;  3PBS A;  2GJ3 A;  3HJK A;  4PKY A;  1ODV A;  1IOU A;  2JKR I;  4H6J B;  4NEE D;  5C5K A;  4P6Z S;  1LT0 A;  3LIE A;  4GCZ A;  4KQD A;  3B42 A;  3FPW A;  2A2L A;  3CIT A;  4Q0J A;  4O0P A;  4GS9 A;  3PBQ A;  1OT6 A;  1OTE A;  4RQ9 A;  4EEU A;  4B93 A;  3EGD C;  1N9O A;  2V1B A;  4BMW A;  4HI4 A;  1W63 M;  1NRJ A;  2VZW A;  5AJG A;  2D02 A;  2GZA A;  2PYP A;  4L9G A;  2Y8H A;  4EER A;  3RFB A;  2VGL M;  4I3I A;  4JGP A;  5L8M A;  4G3V A;  5HWV A;  4DMZ A;  4IUK A;  4HQA A;  4GLQ A;  5I5L A;  4KUO A;  3BJN A;  4MMN A;  1LSW A;  3V67 A;  4G3W A;  1NWZ A;  3VE3 A;  3EOI A;  3PBO A;  1LSX A;  4MN5 A;  3MQO A;  1X0O A;  2PD7 A;  1G28 A;  3DBA A;  3ULF A;  2IA2 A;  4BWI A;  4CLC C;  1KOU A;  2B18 A;  3T4K A;  1UWN X;  3MJQ A;  1S4R A;  5HDC A;  3LYX A;  2O9B A;  4EXO A;  5EFW A;  4R70 A;  4ARZ B;  4KQO A;  2HGV A;  3R7W B;  1P0Z A;  3H82 A;  2M1C A;  3ZYT A;  5J4E A;  1XJ6 A;  2W1T B;  5TBM B;  3KYZ A;  2D01 A;  2WKP A;  3HCY A;  3FPV A;  3PHY A;  2B02 A;  1XJ2 A;  3TRC A;  4HP9 A;  3KSG A;  4P6Z M;  3TE8 A;  4DJ3 A;  3P01 A;  4HP4 A;  3K3D A;  2QHK A;  2BAS A;  3FC7 A;  2MJ6 A;  3MQQ A;  4ZRR A;  3K2N A;  3PXP A;  1TS0 A;  4IHQ A;  5J3W A;  2ZBB A;  3E98 A;  2J3T C;  1OJG A;  5AVE A;  5IT5 A;  3RTY A;  5TBM A;  3EEH A;  1OTB A;  3LIC A;  4CQH A;  5K5B A;  4LRY C;  2PR6 A;  4LPZ A;  3MR0 A;  5A8B A;  2WKQ A;  3OC2 A;  4WUJ A;  1WA9 A;  5F6A A;  3IS2 A;  3C30 A;  3IS2 B;  1P97 A;  4R3A A;  1XFN A;  2XRN A;  1ZTU A;  5F68 A;  1P9W A;  5G4Z A;  2WKR A;  4HHD A;  5CX7 A;  3BW6 A;  1MZU A;  1JNU A;  1GSW A;  3BWL A;  2PYR A;  3D3O A;  3JVU A;  3T50 A;  2W1T A;  2PD8 A;  3C38 A;  3LIB A;  2O9C A;  4BBU A;  3KO6 A;  1S1Z A;  2XA7 M;  2QJ5 A;  4GHI A;  4WEJ A;  4L9E A;  3JVV A;  3F1P A;  4UQI M;  3K3C A;  4MDZ A;  2O9A A;  3T4S A;  3UE3 A;  3H9W A;  3UB9 A;  2LB9 A;  2QWS A;  3LID A;  4MCW A;  1OTI A;  2A24 B;  3F1O B;  4I5S A;  1UWP X;  2EWV A;  3CUE C;  2OWH A;  4PHT A;  1MKM A;  4GW9 A;  4EU0 A;  3EWK A;  5G4Y A;  3MF0 A;  2HJ9 C;  3H82 B;  4H6J A;  3PBN A;  3OBF A;  3ICY A;  3UMD A;  3W2Z A;  4G3K A;  2Y79 A;  2W1R A;  2GNX A;  5HWW A;  3F1N A;  4YNR A;  3B47 A;  2Z6C A;  2VKS A;  1T1B A;  4BBT A;  1F5M A;  2QJ7 A;  4ME4 A;  2DMW A;  4HJ4 A;  3E0Y A;  3LUQ A;  2PT7 A;  5J7E A;  3KSF A;  3VOL A;  2V1A A;  4HJ6 A;  2EA9 A;  1GSX A;  1D7E A;  1VB6 A;  4HY8 A;  4HH2 A;  2VJW A;  3GDI A;  3D72 A;  2G7U A;  3NOP C;  4L0L A;  4GJ4 A;  3KYQ A;  4EUV A;  3H7W A;  5KIZ A;  4DN0 A;  5HPI A;  3A0R A;  4IUH A;  2KOI A;  5IU1 A;  1YSQ A;  2L4R A;  2L0W A;  5DFX A;  1T18 A;  1IFQ A;  4EES A;  3OLO A;  3P7N A;  4HJ3 A;  3PR6 A;  1S4S A;  3NHQ A;  2JN7 A;  4NXF A;  4UQI S;  3MFX A;  1H3Q A;  2W27 A;  4HIA A;  5DFY A;  1UGU A;  2W0N A;  4JGO A;  3O5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...