4HNBA

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
176
Chain Sequence
b'MDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 54
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hnbA00
3E4QA 3UB7A 4I5SA 1XFNA 1ODVA 3MXQA 4HH2A 2V1BA 4HI4A 1OJGA 4HQAA 1BYWA 3G6OA 2B02A 5EFWA 2VLGA 3LIDA 4GW9A 4M4XA 5G4ZA 5HWTA 5KIZA 2PDRA 4I38A 3H7WB 3K3DA 2L0WA 5J7EA 4HIAA 3E4OA 1DP6A 3E4PA 3BY8A 1OTDA 4LRZE 1T18A 1TS7A 1D7EA 3KX0X 3GECA 5J4EA 2KX6A 2V1AA 4HOIA 3EWKA 4E04A 4I3IA 1TS6A 1LSVA 3F1PA 3VE3A 1DRMA 3F1PB 1TS0A 4EW7A 3UMEA 2PR6A 5DJTA 2VEAA 4BBUA 1XJ2A 2GJ3A 2D02A 1XJ4A 2Z6DA 1NWZA 2VV7A 4WLAA 5HZHA 4L9EA 3T50A 4DJ2A 3HJKA 4GHIB 2BASA 2Z6CA 4BBVA 2R78A 4MN6A 5TBMA 5TBMB 3FC7A 3GDIA 4R38A 2ZOIA 4NXFA 2CMNA 4EERA 1XJ6A 4LRXC 3NJAA 3LIBA 3SW1A 1KOUA 3RH8B 3C2WA 2W0NA 5G4YA 5AVFA 1P0ZA 2PYPA 2WKRA 2PR5A 4I3AA 5HDCA 2YKHA 4GS9A 1N9NA 4JGRA 5AVEA 4GS9B 4I39A 2QJ5A 4RQ9A 3ULFA 3OLOA 1S1ZA 3F1NA 1V9ZA 3D72A 3F1NB 4WF0A 3K3CA 3LIAA 5A8BA 1XFQA 3MQQA 2P7JA 1S4SA 2EA9A 3NOPC 3A0VA 1OTEA 4DJ3A 2K7SA 3H7WA 3H82A 1UWPX 3H82B 3MQOA 3FG8A 5HWWA 3A0RA 3HJIA 1P97A 2QKPA 4HY8A 4GCZA 1GSVA 1S1YA 5F69A 1LSXA 2JN7A 1OTAA 2PD7A 3C8CA 4B9OA 3IBRA 2QHKA 3LUQA 4H6JA 5J3WA 4H6JB 4HNBA 2PYRA 2VV8A 3EEHA 1JNUA 4HJ3A 1N9OA 3LIFA 5HDDA 2OOLA 4KUKA 3PYPA 4XT2B 2V0WA 3P7NA 4LPZA 2JHEA 5HD3A 4GHIA 5IS1A 1T1AA 1OTBA 4NXEA 1S66L 3LI8A 3NHQA 2L1MA 4R6LA 4PKYA 3NOTC 1S67L 3UB6A 2D01A 4HHDA 1DP8A 1V9YA 2H28A 3VE4A 2A24B 4JGPA 2OWJA 5DJUA 2PHYA 3UB8A 1UWNX 1GSWA 1Y28A 2QWSA 1GSXA 4KUOA 3A0SA 1OJ5A 1X0OA 3F1OB 2V0UA 2ZOHA 5F6AA 2J80A 1OTIA 2YKFA 1D06A 4R70A 1LL8A 3NOUC 1T1CA 4HJ6A 4LRYC 4PKYG 2PD8A 3MR0A 3CAXA 3CLOA 4EESA 5IU1A 4EETB 1DP9A 2ZBBA 1G28A 1T1BA 4L9FA 1S4RA 1XJ3A 4WUJA 2M1CA 4YWZA 5HDSA 5F5YA 5HWVA 4EEUA 4K08A 3BWLA 1LSWA 2W27A 2VV6A 2HV1A 2OWHA 1N9LA 4F3LA 4F3LB 4I3JA 1UGUA 3ZQ5A 1WA9A 4NXBA 3LI9A 4R3AA 1OT9A 1OT6A 2V9AA 3UMDA 4JGQA 4XT2A 5DKLA 4HP9A 3PHYA 3H9WA 4EEPA 4HJ4A 4EQ1A 1TS8A 3RTYA 3MJQA 4WL9A 4KQDA 5HD5A 1MZUA 3LYXA 3UB9A 4WN5A 2WKQA 4HP4A 3VOLA 3MFXA 2INWA 5I5LA 2QJ7A 3ICYA 2L4RA 1EW0A 2WKPA 2A24A 3UE6A 5F68A 5DKKA 5HSQA 3LICA 1VB6A 3LIEA 1T19A 2KDKA 3BY9A 3F1OA 4LLOB 4BBTA 4NXGA 1F9IA 4L9GA 1F98A 4MN5A 3CWFA 3IS2A 4HH3A 4EXOA 3IS2B 3B33A 2I9VA 4JGOA 1LT0A
chains in the Genus database with same CATH superfamily
3E4QA 4G3VA 1XFNA 4WEKA 3T4JA 4DDYA 4HH2A 3VP3A 1MXOA 4GZBA 3IX4A 4HI4A 1VEUA 4DE0A 2GZAA 2VGKA 3PAGA 3G6OA 2B02A 1H3QA 3M6HA 5CXWA 3G2ZA 4X55A 2Y2HA 2ZL1B 1ZHHB 2EX2A 4QY6A 2WKIA 3VFHA 2G2WA 2PDRA 2VGJA 3N4IA 3CG5A 2L0WA 5KMWA 1L0EA 4CLCB 1FCOA 4HIAA 4OOMA 3E4OA 3LGOA 4OQHA 1YKDA 3C38A 2Z2LB 4NEED 3B3XA 4LRZE 1D7EA 4OP5A 3ZG7B 3KX0X 1LL5A 2FH5A 1K25A 4DF6A 2V8CA 4MCWA 1IYSA 4PPRA 1ESUA 2HP9A 5EVID 4E04A 2GX5A 1TS6A 1KGGA 5CHMA 3F1PA 2OSUA 3Q7VA 4C75A 3MS6A 3V3SA 1SKOB 1ES2A 1VETA 1NWZA 1PW8A 4IVKA 4GHIB 4P6ZS 3SH9A 4DE1A 4BBVA 5DTSA 2XA7M 1PRQA 2QZ6A 4MN6A 1VQQA 4JXGA 1W79A 4UA7A 1FCMA 1S6RA 3QP4A 1AXBA 3A3FA 5EV0A 4LGWA 4NXFA 3ZCZA 3UNWA 2WGWB 4OH0A 1P9WA 4MDZA 1JWPA 2WZZA 1YAXA 5TGFA 4E3MA 2H5SA 1CF0A 5F1GA 5DFXA 5E2HA 3IF5A 1VHMA 4DXCA 2JC7A 5FQMA 1FR1A 1K54A 5AVFA 2XEPA 4Y15A 5HDCA 1MC0A 1BT5A 1PYYA 3JVUA 4GS9B 3BECA 4IBXA 3LIAA 2FFFB 1W7FA 4KENB 2P04A 4IHQA 4B93A 2OLVA 4Z1WA 1S4SA 1E25A 2G7UA 4PMAA 2W1RA 3NOPC 3W2ZA 5EVIB 4O0PA 2XROA 5DF9A 2Y2JA 3H82A 1TF1A 3IXDA 4CPKA 5HWWA 3NY4A 3A3DA 5IHVA 4BL3A 4HY8A 3I7JA 1IYPA 4MMNA 2KLIA 2ZMAA 1K0KA 1KE3A 2IWBA 3DTKA 1ZKJA 3C7VA 2VJWA 3LUQA 2IWCA 5AJGA 2H0YA 2VV8A 2JKRI 3LIFA 3WS5A 2HDRA 1KDWA 2V0WA 5EUAA 5FASA 3TG9A 1VM1A 2JHEA 5A92A 2K31A 2XF3A 1NLZA 5HD3A 3V67A 4E3IA 5IS1A 1Z6FA 1T1AA 4HEFA 4Y0OA 1SCWA 4KZ6A 1S66L 3IWIA 3LI8A 3NHQA 2GDNA 3CPTA 4PKYA 1S67L 2D01A 3E2KA 1V9YA 2H28A 3VE4A 2PT7A 3SH7A 3T4OA 3MFDA 1ZTUA 2OWJA 5DJUA 3PAEA 1ERMA 4K0WA 3UB8A 3V3RA 2XR0A 1GSWA 3ZG9B 1Y28A 3E98A 3FYZA 1GSXA 4KUOA 1XA1A 3A0SA 2PU2A 5E2FA 3ZYTA 3WS1A 1QMFA 4BLMA 1KVLA 2J80A 1ONHA 1BLPA 1D06A 1LL8A 3BLSA 5F1FA 2ZD8A 2WKHA 1T1CA 2V20A 3OPHA 4LRYC 4PKYG 2ZJ9A 4ME4A 3V50A 4JXWA 4S2IA 1DJAA 2LB9A 1KGEA 3O5YA 3CHWP 2PRFA 2Y2LA 5HL6A 2UV0E 2I72A 4O01A 4KZ9A 1G28A 1T1BA 1OMEA 1IELA 3U2AA 1GA0A 1G5UA 2JKGA 3UE3A 3BFGA 5CGXA 2X71A 1SHVA 5HDSA 4EEUA 4K08A 4ESPA 2B5RA 4KZ4A 2HV1A 4JF5A 1L0GA 3ZG0A 3W4OA 2PU4A 1K38A 4S2LA 4I3JA 1UGUA 4KG6A 3PBOA 2AVXA 4OLDA 4R3AA 3C7UA 1OT9A 5FSRA 4A5RA 2WGVA 4RX3A 4JGQA 4RVAA 4EEPA 4HJ4A 2EX8A 4EQ1A 3NCKA 3QP1A 3KYEA 3Q7VB 3LYXA 3IX8A 3UB9A 5CRFA 1D1JA 1PFLA 2WKQA 4HP4A 4U0TA 4GDBA 3VSLA 3AGEA 4IUHA 1HZOA 3PBQA 4Q0JA 5FDHA 3C5AA 5FEFA 3TJZC 3P09A 4R1GA 1YM1A 3GMWA 4BD0A 3MQ0A 2Y79A 1CEGA 4P6BA 3MKFA 1J3WA 1VB6A 5BOHA 2WZXA 3EGXC 5FAOA 4IBRA 2E8IA 2R9XA 5TFQA 4EBNA 3LCEA 5FL3A 4GB7A 1L0DA 1CI8A 2XK1A 4LLOB 3VP2A 4S2NC 1N9BA 5TR7A 5HX9A 4OPQA 4KZAA 2CC1A 4LV0A 5GL9A 3KSIA 4HH3A 4RYEA 2HDQA 4JGOA 2Y2KA 2W1TB 4S2JA 1K55A 3BM6A 1IYQA 2Y4AA 4WZ5C 1NRFA 4HQAA 4MEZA 3OOVA 3VSKA 1BYWA 1MWSA 2W3HA 3O87A 2VGLM 2XA7S 2J7VA 2X02A 3WS0A 4QY5A 3WS4A 4M4XA 1SDNA 3UDXA 4OP8A 2HDSA 3JYIA 3QP6A 5G18A 4R0QA 5J7EA 3OC2A 1ES4A 4JLFA 4KZ5A 1TS7A 2EX6A 2FZ0A 1YQSA 2HF6A 3GECA 5J4EA 3ZVWA 2Y2GA 4HOIA 3T4LA 3EWKA 1YLZA 3UO9A 2ZLYA 3NI9A 3VE3A 1DRMA 2V8FA 2W3FA 1Z09A 4ARZA 4EBPA 5A91A 4CLCD 3UMEA 2HJ9C 3G31A 3VMAA 2DMWA 5DJTA 1CI9A 2V2FF 2V1ZA 4MBFA 4X1LA 2DNSA 4ZDXA 3MZDA 5HZHA 1RP5A 3NULA 4XXRA 1JWVA 1FQGA 3HJKA 3HVFA 3FKVA 1XX2A 2EFXA 4LV1A 2XSSA 4QB8A 2HJEA 2GNXA 2Y59A 3MZEA 5TBMB 1STZA 3FC7A 1LL9A 1C3BA 2J3TC 2ZMVA 4R38A 4Y0TA 4Y3IA 4BD1A 2ZOIA 5M18A 1GHPA 3RH8B 2Y2MA 2XQZA 4HESA 3HUMA 4D2OA 4BQMA 5LBRA 1XPBA 5G4YA 2PYPA 3L7HA 3T4SA 3DTMA 4OPYA 3UPOA 5A90A 2ZQCA 2YKHA 1FSYA 2FFYA 4I39A 2QJ5A 5GHXA 2WK0A 3F1NA 1V9ZA 3D72A 4QU3A 4WF0A 3FZCA 1G6OA 4KQQA 1ONGA 4OKPA 3S7OA 1HD8A 1XFQA 3FPVA 2P7JA 3UPPA 3CUEA 4Y13A 1G68A 2DCFA 3H7WA 3KSHA 1UWPX 3JPUA 1H8ZA 5KZHA 5FI2A 3RXXA 5GHZA 3MQOA 3FG8A 3A0RA 2JKTM 3HJIA 1JVJA 4MNRA 1P97A 4DKIA 2JKFA 4R4RA 4YNRA 4R4SA 1I2SA 5DTKA 1K57A 2Q9MA 1S1YA 5F69A 1OTAA 1W5DA 5L09A 2PD7A 4GKUA 1FIKA 4GNUA 2PBYA 3R4KA 2QHKA 3BJNA 4ZBEA 1ALQA 5HL1A 3TE8A 4H6JB 4AFIA 1JNUA 2NUPC 4NETA 2OOLA 4FOFA 4YINA 1E4DA 5U47A 3DW0A 4QJGA 4E3LA 1ZG4A 4N92A 1LI0A 1K54C 2HZ5A 3LEZA 4P85A 1MBLA 4K0XA 4DN0A 3GQZA 4WMCD 5KSCA 2HP6A 3OBFA 3MMHA 1DP8A 2QPNA 4EQIA 2HGVA 2ACGA 3Q81A 2BLSA 3IBJA 3HLBA 2P08A 1UWNX 1Q2PA 4FD8A 3O3VA 5K5BA 4OQGA 3UB5P 5C5KA 5A93A 2J9PA 3EGDC 2XD5A 4ZJ3A 4Y7PA 4GLQA 1H5XA 3LEQA 3FPWA 1MWRA 2H10A 1MKIA 4IJGA 1RCJA 4KQRA 3NOUC 4F94A 2PD8A 4UAAA 3EQUA 3IX3A 1H8MA 3SS5A 5F83A 4ID4A 4GOGA 5GLCA 4EETB 4UEYA 1NYMA 3GV9A 2ZMFA 5EOEA 4FH2A 4L9FA 3MF0A 3OPPA 1S4RA 4WUJA 4XUXA 3FKWA 1TVFA 3BFCA 4YWZA 3IT9A 1CJFA 4PM7A 2VV6A 3GVBA 4GJ4A 4MN7A 2EWWA 4MBHA 4OQ0A 4UQIM 5HPFA 4F3LA 3LR3A 3TW8A 2J3TD 3LFVA 4FCFA 4G3KA 4JXSA 1PIOA 1P9RA 3MBZA 5FAQA 3BFEA 2V9AA 3UMDA 5F82A 4XT2A 4HP9A 3PHYA 4BJPA 4OPZA 4WELA 5E2EA 1HLUP 1TS8A 4PM9A 2VGLS 4WL9A 4KQDA 3DTIA 1PW1A 1F2KA 4WN5A 4XUZA 4WYYA 5EOOA 5I5LA 3ICYA 1ERQA 3T4TA 4L0LA 3UY6A 3MKEA 1EW0A 2WKPA 4E6XA 1PWDA 1YLJA 3ZDJA 4Q0IA 2ZQ9A 4KG2A 4M3KA 2IWDA 1I2WA 1JTDA 4KQOA 1ZC2A 5FQIA 3LIEA 3V39A 3R7WA 2KOIA 1NYYA 3VP0A 3F1OA 2PAVP 1MWTA 4X56A 5EVEA 3GRJA 3FWLA 3IS2A 3UPNA 3B33A 4Y5FA 2I9VA 1FCNA 3Q7ZA 4BWIA 3GTCA 2Y2PA 4I5SA 4X25A 2EFUA 1E3UD 4QPRA 3MXQA 4KG5A 2V1BA 4C3QA 3W4PA 1VEUB 4NK3A 1XA7A 1SDEA 3IQAA 3S7PA 4QHCA 2A2LA 4IUKA 5CGSA 4OVDA 5EFWA 2VLGA 2ZL1A 2HPBA 1PZOA 4GW9A 5HARA 5GLBA 3G4PA 5G4ZA 5HWTA 4FSFA 4PM8A 3RFBA 3TSGA 5KIZA 3GR2A 4I38A 3H7WB 3K3DA 3WRZA 5AQ7A 4CLCA 1LI9A 4N1HA 3IH8A 4NG2A 2Y91A 1YMXA 1ES3A 5FQJA 3E4PA 2DRWA 3BY8A 1BULA 1OTDA 5HW3A 2UWXA 3NDGA 3A3EA 3PBSA 1H0MA 4OPRA 2JCHA 2V1AA 1WYCA 4EUVA 2Y2OA 4PM6A 3WWXA 4ETZA 5CHJA 1LSVA 1EROA 4GD6A 1K56A 3F1PB 3UDFA 4EW7A 5EM1A 3BQ8A 2XRNA 2PR6A 4CJNA 2VEAA 4ZJ2A 2O9BA 4N9LA 1J9MA 3AGDA 2GJ3A 1VETB 1Q2QA 2Z6DA 2Q9NA 1IFQA 2NUTC 4L9EA 4S2OA 3T50A 4E3KA 3T4KA 3NC8A 2Z6CA 4B4ZA 1ACFA 1K55C 5L8MA 2R78A 5FA7A 1W63M 5M19A 3TOIA 3UE0A 1A0KA 1K6RA 1FOFA 3M6BA 5CX7A 4MLLA 5DFYA 4FH4A 4IEDA 2CMNA 2WGWA 4EUZA 4JPMA 4BENA 4EERA 1N4OA 4LRXC 5FEGA 2QYBA 4ZRRA 3IH9A 1RGZA 2W0NA 4U3TA 1WE4A 3UN7A 4CLCE 3NBLA 1P0ZA 2PR5A 4I3AA 4ZJ1A 4KZ7A 4GS9A 4JGRA 4RQ9A 3ULFA 2M7UA 4UA6A 5HFOA 4JBFA 1BZAA 3IWQA 1M40A 3MQQA 2G2UA 3AGFA 4IVIA 4X69A 2EA9A 5EVIA 3A0VA 1OTEA 2J9OA 4DJ3A 2K7SA 1K6SA 4N9KA 3H82B 3C4OA 1HTZA 2Q0OA 3D4FA 5HPIA 3U4LP 5HAQA 4KZBA 4EWFA 2ZC6B 5FDSA 1HVBA 2JN7A 4BMWA 3C8CA 3S7QA 4FTXA 2VX8A 1K4EA 4WMCA 1WYBA 1NY0A 1KDSA 5J3WA 5MC7A 4HNBA 3EEHA 4LFUA 5HDDA 3C30A 4KUKA 5CEDA 4XT2B 3CI6A 1JTGA 1W63Q 3VFFA 3P7NA 4LPZA 3Q07A 2EXAA 1NRJA 3N8LA 1PWCA 4RA7A 3W8KA 3DWKA 4NKPA 1GHIA 4DE3A 3ZFZA 3DBAA 3G35A 1BLSA 1OTBA 3CJMA 4CQHA 1FR6A 4NXEA 5JYOA 3LR5A 2L1MA 4R6LA 5L10A 2PBDP 1EWZA 3CPTB 5FQQA 4B88A 1TDLA 4HHDA 2QMIA 3DAVA 4UQIS 4JGPA 2W3EA 2ZC4B 5AQAA 1EI5A 2M7VA 3CUEC 3UE1A 2ZQDA 4S2KA 4S2MA 3R7WB 3T12B 1OJ5A 3A3JA 3F1OB 3A3IA 3OCNA 1OTIA 3OPRA 2E8JA 2BG1A 2EX9A 2YKFA 3LY3A 2EWVA 1L3LA 4PHTA 4R70A 3BFDA 3N6IA 5FI7A 1K57C 2Y8HA 4Z9QA 3B47A 3EQVA 4WEJA 3EOIA 3SZTA 3N8SA 1MPLA 3QHYA 3MR0A 3CAXA 3CLOA 1CQAA 4EESA 5IU1A 1DP9A 2ZBBA 1IYOA 3LR4A 4Y2FA 2XGNA 4UHUA 3T1RA 3MZFA 1XJ3A 2ZQ7A 3S22A 3LO7A 5FAPA 5HWVA 5AQ9A 5HAIA 3BWLA 3HLDA 4Q8IA 1LSWA 4X53A 3HUNA 2C5WB 1N9LA 2ZQ8A 1YMSA 3BLMA 2HDUA 3E0YA 2K2NA 4PM5A 4E3JA 1NLYA 1WA9A 3RXWA 4Y17A 3SH8A 4DXBA 2B18A 3QNBA 4HBUA 3G32A 3H9WA 4OONA 3HLFA 3NDEA 4DMZA 1YT4A 3RTYA 3MJQA 3IWOA 3ZVTA 5EM0A 3KYQA 1MZUA 3T1SA 1YSPA 1FILA 2H0TA 1XKZA 4FUWA 4EU0A 3VOLA 3B42A 2INWA 3KO6A 3VP1A 2L4RA 3MXSA 3G34A 4EBLA 2WYXA 1O07A 4HBTA 4Q0HA 2WAEA 1IKGA 2A24A 2RL3A 2ZC3B 2XDMA 3Q82A 5FQKA 5DTTA 3BQAA 5F68A 2Z2MB 3QP5A 5DKKA 1E3UA 4YFMA 3BW6A 4ZAMA 3LICA 1CK3A 2ZM2A 2KDKA 1TD5A 3BY9A 4JKTA 1ZG6A 3DTEA 3LR0A 4NXGA 1PNEA 2LB5A 3CMZA 2JKTI 1YSQA 1L2SA 3CWFA 2R9WA 2JKRM 5AQBA 3IF6C 3VV4A 2W3GA 3G30A 1XGJA 3UB7A 2W1TA 1ODVA 3ZG8B 1BTLA 1GHMA 1OJGA 4DE2A 3NECA 3SOIA 2Y2IA 2O0YA 1SKFA 1YLYA 5J8XA 4ETXA 4OOLA 3PTEA 3HUOA 5DF7A 4KZ8A 1IEMA 3N7WA 4E6WA 5HAPA 4Y0UA 3LIDA 5CTNA 3IF6A 5L07A 3K2NA 4DRTA 5CGWA 3ISGA 3W4QA 2JBFA 3HLCA 3HL9A 4LV2A 3UDIA 3SS4A 1W8YA 1DP6A 1F5MA 4WM9A 1YLWA 1T18A 1BLHA 1Y4OA 1KVMA 1GA9A 2A3UA 2KX6A 1DJBA 3ZG5A 4I3IA 4OQIA 1QMEA 1TS0A 4ARZB 4O8GA 2JE5A 1FSWA 2P9VA 4BBUA 1U60A 1OPXA 1XJ2A 1XP4A 2D02A 3BEBA 1XJ4A 1MKMA 3MSHA 4BL2A 2VV7A 4WLAA 2ZC7A 4DJ2A 2OLUA 2BASA 1RGYA 3O86A 4P0MA 2X01A 4R3JA 4ZTKA 4H8RA 5TBMA 2VA0A 3OPLA 1H8YA 1GCEA 3GDIA 3T1QB 3ZNYA 1PZPA 3PXPA 5DF8A 3ZGAB 5FI6A 4JXVA 3RJUA 2OV5A 5CTMA 5GLDA 2XFSA 5DVAA 1XJ6A 3NJAA 3LIBA 5I94A 3SW1A 1Y54A 1KOUA 4E3OA 3C2WA 3QNCA 2RCXA 2BTFP 4II7A 4CLCC 1XXMA 2WKRA 2ZM0A 1PI4A 3TRCA 5L2FA 3HCYA 2OAQ1 3WRTA 1G6AA 1N9NA 3BYDA 5AVEA 4B4XA 1TDGA 1NZUA 3OLOA 1S1ZA 1KE4A 1I5QA 3F1NB 3DWZA 3K3CA 1YPRA 5A8BA 3BFFA 3PR6A 4RX2A 3P98A 3CITA 4X1MA 4S2PA 2Y55A 3QP8A 5CEBA 2ZM8A 2O9AA 3IXHA 3PBRA 4PAUA 3HLGA 3HREA 4P6ZM 3IHBA 3O88A 4OOYA 2VK3A 3S1YA 5IT5A 2QKPA 5EECA 4U0XA 2O99A 4GCZA 1GSVA 4P87A 3ITBA 2WGIA 3S4XA 1LSXA 1S0WA 4C6YA 3T4QA 2EXBA 4WBGA 4K91A 4B9OA 3IXBA 3IBRA 4H6JA 2XFTA 1IOUA 2C6WB 2PYRA 3G2YA 4HJ3A 1NJ4A 1N9OA 1SKOA 3PYPA 1BLCA 3JVVA 3HLEA 1NXYA 5EPHA 5JYPA 4GHIA 4QWOA 4E3NA 4JF6A 1XGIA 3PBTA 5GLAA 3KSFA 3NOTC 3UB6A 1PI5A 4KZ3A 3WS2A 1BUEA 5D3OA 2A24B 4YOFA 5CHUA 2WAFA 1YLTA 3NIAA 2PHYA 5EVIC 3GSGA 3M2KA 2QWSA 4R23A 3OZHA 3IXGA 1YLPA 1M6KA 5CERA 1X0OA 2V0UA 4O7DA 2ZOHA 5F6AA 1ESIA 1K4FA 2OAP1 3L9KA 3VP4A 2WADA 4X68A 4G3WA 3IHAA 1AWIA 4HJ6A 1JWZA 4LCMA 5TJJA 1LLBA 2WKEA 4GDNA 3VOZA 2O9CA 5EVLA 1LHYA 4UA9A 4R3BA 3PBNA 3HBRA 3E2LA 4GN2A 4S2NA 5CECA 3S7NA 3QP2A 4EV4A 1L0FA 5E2GA 1DY6A 2ZQAA 4DDSA 3IF6B 3ZHHA 3T1XA 2M1CA 1W8QA 3HLWA 4WZ4A 3EEAA 5F5YA 2J3WA 1TEMA 3M2JA 2W27A 4JF4A 2P74A 2HP5A 2OWHA 4WZ5A 1ES5A 5E43A 4F3LB 1MY8A 1O7EA 3BRMA 2XH9A 3ZQ5A 4NXBA 3LI9A 5FQ9A 3LY4A 3VOYA 5KSHA 1PWGA 1OT6A 2WUQA 1DJCA 2Y2QA 1SZVA 2MJ6A 1NZOA 5DKLA 4MBKA 1IKIA 2W3DA 2XLNA 4LCLA 1KE0A 3CZDA 5HD5A 3FV7A 4LV3A 3Q1FA 4X6TA 2VZWA 2P9VB 3P01A 3MFXA 5GHYA 2QJ7A 3D9YA 4N1XA 3D3OA 3UE6A 2J8YA 5EE8A 1MWUA 2B95A 3V5MA 5HSQA 2Y2NA 2VKSA 2XD1A 3SS3A 1K56D 1T19A 2ZC5B 4OLGA 4QD4A 3N8RA 4GD8A 4LENA 4D60A 4BBTA 3OCLA 1KGFA 3KYZA 1F9IA 1BSGA 3ITAA 4L9GA 3ZNTA 1F98A 5M1AA 4MN5A 2IA2A 3MXRA 3KSGA 5FATA 4EXOA 3IS2B 2A49A 3C4PA 1CEFA 1LT0A
chains in the Genus database with same CATH topology
3E4QA 4BWIA 4G3VA 3UB7A 4I5SA 2W1TA 1XFNA 2W1TB 4WEKA 3T4JA 1ODVA 4QPRA 3MXQA 4HH2A 2V1BA 4HI4A 1OJGA 2GZAA 4HQAA 3OOVA 1BYWA 2O0YA 2W3HA 3G6OA 3S7PA 2B02A 2A2LA 4ETXA 4OOLA 4IUKA 1H3QA 2VGLM 2XA7S 5EFWA 2VLGA 3LIDA 4GW9A 1ZHHB 3K2NA 4M4XA 5G4ZA 5HWTA 4FSFA 3RFBA 5KIZA 2PDRA 4I38A 3H7WB 3K3DA 2L0WA 4CLCA 4CLCB 5J7EA 4HIAA 4OOMA 3OC2A 3E4OA 1DP6A 1F5MA 3E4PA 1YKDA 3C38A 3BY8A 4NEED 1OTDA 4LRZE 1T18A 1TS7A 3PBSA 1D7EA 2FZ0A 2HF6A 3KX0X 3GECA 5J4EA 2KX6A 2FH5A 2V1AA 4MCWA 4HOIA 3T4LA 3EWKA 4E04A 4EUVA 2GX5A 4I3IA 4ETZA 1TS6A 1LSVA 3F1PA 3VE3A 1DRMA 3F1PB 2W3FA 4ARZA 1TS0A 4CLCD 4EW7A 3BQ8A 2HJ9C 3UMEA 4O8GA 4ARZB 2XRNA 2PR6A 2DMWA 5DJTA 2VEAA 4BBUA 2O9BA 1OPXA 1XJ2A 2GJ3A 2D02A 1XJ4A 1MKMA 2Z6DA 1NWZA 1IFQA 2VV7A 4WLAA 5HZHA 2NUTC 4L9EA 3T50A 4DJ2A 3HJKA 4GHIB 2BASA 4P6ZS 3T4KA 2Z6CA 4BBVA 2XA7M 2XSSA 5L8MA 2R78A 2HJEA 2GNXA 4MN6A 5TBMA 1W63M 5TBMB 1STZA 3FC7A 2VA0A 3GDIA 2J3TC 2ZMVA 3PXPA 4R38A 5CX7A 4Y3IA 5DFYA 2ZOIA 4NXFA 2CMNA 4EERA 1XJ6A 4LRXC 3NJAA 1P9WA 4MDZA 1YAXA 3LIBA 3SW1A 1KOUA 2QYBA 3RH8B 3C2WA 4ZRRA 5DFXA 2W0NA 4II7A 5LBRA 1VHMA 4CLCC 4CLCE 5G4YA 5AVFA 1P0ZA 2PYPA 2WKRA 2PR5A 4I3AA 3TRCA 3T4SA 5HDCA 3HCYA 2OAQ1 1MC0A 2YKHA 4GS9A 3JVUA 1N9NA 4JGRA 5AVEA 4GS9B 4I39A 2QJ5A 4RQ9A 3ULFA 3OLOA 1S1ZA 2M7UA 3F1NA 1V9ZA 3D72A 3F1NB 4WF0A 3K3CA 3LIAA 1G6OA 5A8BA 3PR6A 2P04A 3CITA 3S7OA 1XFQA 3MQQA 4IHQA 4B93A 3FPVA 4Z1WA 2P7JA 1S4SA 3CUEA 2G7UA 2EA9A 2W1RA 3NOPC 3W2ZA 3A0VA 1OTEA 4DJ3A 4O0PA 2XROA 5DF9A 2K7SA 3H7WA 3H82A 3KSHA 1UWPX 2O9AA 1TF1A 3H82B 3PBRA 4PAUA 4P6ZM 3MQOA 3FG8A 5HWWA 3A0RA 5HPIA 2JKTM 3HJIA 1P97A 4YNRA 5IT5A 2QKPA 4HY8A 2O99A 4GCZA 1GSVA 1S1YA 5F69A 4MMNA 1LSXA 2KLIA 4BMWA 2JN7A 1OTAA 3T4QA 2PD7A 3C8CA 4B9OA 3S7QA 3R4KA 2VJWA 2VX8A 3IBRA 2QHKA 3BJNA 3LUQA 4H6JA 5J3WA 1IOUA 3TE8A 4H6JB 4HNBA 5AJGA 5MC7A 4AFIA 2PYRA 2VV8A 3EEHA 1JNUA 4HJ3A 1N9OA 2JKRI 3LIFA 2NUPC 5HDDA 3C30A 2OOLA 4KUKA 3PYPA 4FOFA 4XT2B 3CI6A 1W63Q 3JVVA 2V0WA 3P7NA 4LPZA 1NRJA 2JHEA 4Y5FA 2K31A 1NLZA 4GHIA 5HD3A 4NKPA 3V67A 3DBAA 5IS1A 1T1AA 1OTBA 4CQHA 4NXEA 4DN0A 1S66L 3PBTA 3LI8A 3NHQA 3LR5A 2L1MA 3KSFA 4R6LA 4PKYA 3NOTC 1S67L 3UB6A 2D01A 3OBFA 4HHDA 3MMHA 1DP8A 1V9YA 2H28A 3VE4A 2A24B 2PT7A 4YOFA 2HGVA 4UQIS 3T4OA 1ZTUA 4JGPA 2OWJA 2W3EA 5DJUA 3IBJA 2PHYA 2M7VA 3UB8A 3CUEC 2P08A 1UWNX 1GSWA 1Y28A 2QWSA 3E98A 1GSXA 4KUOA 5K5BA 3R7WB 3A0SA 1OJ5A 5C5KA 1X0OA 3F1OB 3ZYTA 2V0UA 3EGDC 3OCNA 2ZOHA 5F6AA 2J80A 4GLQA 1OTIA 3FPWA 2OAP1 2YKFA 2EWVA 1D06A 4PHTA 4R70A 1LL8A 4IJGA 4G3WA 2Y8HA 3NOUC 3B47A 1T1CA 3EQVA 4HJ6A 5TJJA 4LRYC 4PKYG 4WEJA 2PD8A 2O9CA 3EOIA 4ME4A 3EQUA 2LB9A 1H8MA 3MR0A 3CAXA 3O5YA 3CLOA 3PBNA 4EESA 5IU1A 4EETB 1DP9A 5HL6A 4UEYA 2ZMFA 2ZBBA 4O01A 1G28A 3S7NA 1T1BA 3LR4A 4L9FA 3U2AA 3MF0A 4Y2FA 3UE3A 1S4RA 1XJ3A 4WUJA 2M1CA 4YWZA 5HDSA 3EEAA 5F5YA 2J3WA 5HWVA 4EEUA 4K08A 3BWLA 1LSWA 2W27A 2VV6A 4GJ4A 2HV1A 4MN7A 2EWWA 4UQIM 5HPFA 2OWHA 1N9LA 4F3LA 3LR3A 4F3LB 4I3JA 1UGUA 3TW8A 2J3TD 3E0YA 3PBOA 2K2NA 3LFVA 4G3KA 1NLYA 3ZQ5A 1P9RA 1WA9A 3LI9A 4NXBA 4R3AA 5KSHA 1OT9A 1OT6A 2MJ6A 2V9AA 3UMDA 4JGQA 2B18A 4XT2A 5DKLA 4HP9A 3PHYA 3H9WA 4BJPA 4WELA 4DMZA 4EEPA 4HJ4A 4EQ1A 1TS8A 2W3DA 3RTYA 2VGLS 3MJQA 4WL9A 4KQDA 5HD5A 3KYQA 1MZUA 1YSPA 3LYXA 3UB9A 4WN5A 4EU0A 2VZWA 2WKQA 3P01A 4HP4A 3VOLA 3B42A 3MFXA 2INWA 5I5LA 2QJ7A 3ICYA 3KO6A 4IUHA 2L4RA 3T4TA 3PBQA 4L0LA 3D3OA 1EW0A 2WKPA 4Q0JA 3TJZC 4Q0HA 2A24A 3UE6A 3MQ0A 2Y79A 4Q0IA 3BQAA 5F68A 5DKKA 5HSQA 4KQOA 2VKSA 3BW6A 3LICA 1VB6A 3EGXC 3LIEA 1T19A 5FL3A 3R7WA 2KOIA 2KDKA 1TD5A 3BY9A 3F1OA 4LLOB 4BBTA 3OCLA 3LR0A 4NXGA 3KYZA 1F9IA 2LB5A 4L9GA 1F98A 2JKTI 1YSQA 4MN5A 2IA2A 3CWFA 3IS2A 2JKRM 3KSGA 3KSIA 4HH3A 4EXOA 3IS2B 3VV4A 2W3GA 3B33A 2I9VA 4JGOA 1LT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4Q A;  3UB7 A;  4I5S A;  1XFN A;  1ODV A;  3MXQ A;  4HH2 A;  2V1B A;  4HI4 A;  1OJG A;  4HQA A;  1BYW A;  3G6O A;  2B02 A;  5EFW A;  2VLG A;  3LID A;  4GW9 A;  4M4X A;  5G4Z A;  5HWT A;  5KIZ A;  2PDR A;  4I38 A;  3H7W B;  3K3D A;  2L0W A;  5J7E A;  4HIA A;  3E4O A;  1DP6 A;  3E4P A;  3BY8 A;  1OTD A;  4LRZ E;  1T18 A;  1TS7 A;  1D7E A;  3KX0 X;  3GEC A;  5J4E A;  2KX6 A;  2V1A A;  4HOI A;  3EWK A;  4E04 A;  4I3I A;  1TS6 A;  1LSV A;  3F1P A;  3VE3 A;  1DRM A;  3F1P B;  1TS0 A;  4EW7 A;  3UME A;  2PR6 A;  5DJT A;  2VEA A;  4BBU A;  1XJ2 A;  2GJ3 A;  2D02 A;  1XJ4 A;  2Z6D A;  1NWZ A;  2VV7 A;  4WLA A;  5HZH A;  4L9E A;  3T50 A;  4DJ2 A;  3HJK A;  4GHI B;  2BAS A;  2Z6C A;  4BBV A;  2R78 A;  4MN6 A;  5TBM A;  5TBM B;  3FC7 A;  3GDI A;  4R38 A;  2ZOI A;  4NXF A;  2CMN A;  4EER A;  1XJ6 A;  4LRX C;  3NJA A;  3LIB A;  3SW1 A;  1KOU A;  3RH8 B;  3C2W A;  2W0N A;  5G4Y A;  5AVF A;  1P0Z A;  2PYP A;  2WKR A;  2PR5 A;  4I3A A;  5HDC A;  2YKH A;  4GS9 A;  1N9N A;  4JGR A;  5AVE A;  4GS9 B;  4I39 A;  2QJ5 A;  4RQ9 A;  3ULF A;  3OLO A;  1S1Z A;  3F1N A;  1V9Z A;  3D72 A;  3F1N B;  4WF0 A;  3K3C A;  3LIA A;  5A8B A;  1XFQ A;  3MQQ A;  2P7J A;  1S4S A;  2EA9 A;  3NOP C;  3A0V A;  1OTE A;  4DJ3 A;  2K7S A;  3H7W A;  3H82 A;  1UWP X;  3H82 B;  3MQO A;  3FG8 A;  5HWW A;  3A0R A;  3HJI A;  1P97 A;  2QKP A;  4HY8 A;  4GCZ A;  1GSV A;  1S1Y A;  5F69 A;  1LSX A;  2JN7 A;  1OTA A;  2PD7 A;  3C8C A;  4B9O A;  3IBR A;  2QHK A;  3LUQ A;  4H6J A;  5J3W A;  4H6J B;  4HNB A;  2PYR A;  2VV8 A;  3EEH A;  1JNU A;  4HJ3 A;  1N9O A;  3LIF A;  5HDD A;  2OOL A;  4KUK A;  3PYP A;  4XT2 B;  2V0W A;  3P7N A;  4LPZ A;  2JHE A;  5HD3 A;  4GHI A;  5IS1 A;  1T1A A;  1OTB A;  4NXE A;  1S66 L;  3LI8 A;  3NHQ A;  2L1M A;  4R6L A;  4PKY A;  3NOT C;  1S67 L;  3UB6 A;  2D01 A;  4HHD A;  1DP8 A;  1V9Y A;  2H28 A;  3VE4 A;  2A24 B;  4JGP A;  2OWJ A;  5DJU A;  2PHY A;  3UB8 A;  1UWN X;  1GSW A;  1Y28 A;  2QWS A;  1GSX A;  4KUO A;  3A0S A;  1OJ5 A;  1X0O A;  3F1O B;  2V0U A;  2ZOH A;  5F6A A;  2J80 A;  1OTI A;  2YKF A;  1D06 A;  4R70 A;  1LL8 A;  3NOU C;  1T1C A;  4HJ6 A;  4LRY C;  4PKY G;  2PD8 A;  3MR0 A;  3CAX A;  3CLO A;  4EES A;  5IU1 A;  4EET B;  1DP9 A;  2ZBB A;  1G28 A;  1T1B A;  4L9F A;  1S4R A;  1XJ3 A;  4WUJ A;  2M1C A;  4YWZ A;  5HDS A;  5F5Y A;  5HWV A;  4EEU A;  4K08 A;  3BWL A;  1LSW A;  2W27 A;  2VV6 A;  2HV1 A;  2OWH A;  1N9L A;  4F3L A;  4F3L B;  4I3J A;  1UGU A;  3ZQ5 A;  1WA9 A;  4NXB A;  3LI9 A;  4R3A A;  1OT9 A;  1OT6 A;  2V9A A;  3UMD A;  4JGQ A;  4XT2 A;  5DKL A;  4HP9 A;  3PHY A;  3H9W A;  4EEP A;  4HJ4 A;  4EQ1 A;  1TS8 A;  3RTY A;  3MJQ A;  4WL9 A;  4KQD A;  5HD5 A;  1MZU A;  3LYX A;  3UB9 A;  4WN5 A;  2WKQ A;  4HP4 A;  3VOL A;  3MFX A;  2INW A;  5I5L A;  2QJ7 A;  3ICY A;  2L4R A;  1EW0 A;  2WKP A;  2A24 A;  3UE6 A;  5F68 A;  5DKK A;  5HSQ A;  3LIC A;  1VB6 A;  3LIE A;  1T19 A;  2KDK A;  3BY9 A;  3F1O A;  4LLO B;  4BBT A;  4NXG A;  1F9I A;  4L9G A;  1F98 A;  4MN5 A;  3CWF A;  3IS2 A;  4HH3 A;  4EXO A;  3IS2 B;  3B33 A;  2I9V A;  4JGO A;  1LT0 A; 
#chains in the Genus database with same CATH topology
 3E4Q A;  4G3V A;  1XFN A;  4WEK A;  3T4J A;  4DDY A;  4HH2 A;  3VP3 A;  1MXO A;  4GZB A;  3IX4 A;  4HI4 A;  1VEU A;  4DE0 A;  2GZA A;  2VGK A;  3PAG A;  3G6O A;  2B02 A;  1H3Q A;  3M6H A;  5CXW A;  3G2Z A;  4X55 A;  2Y2H A;  2ZL1 B;  1ZHH B;  2EX2 A;  4QY6 A;  2WKI A;  3VFH A;  2G2W A;  2PDR A;  2VGJ A;  3N4I A;  3CG5 A;  2L0W A;  5KMW A;  1L0E A;  4CLC B;  1FCO A;  4HIA A;  4OOM A;  3E4O A;  3LGO A;  4OQH A;  1YKD A;  3C38 A;  2Z2L B;  4NEE D;  3B3X A;  4LRZ E;  1D7E A;  4OP5 A;  3ZG7 B;  3KX0 X;  1LL5 A;  2FH5 A;  1K25 A;  4DF6 A;  2V8C A;  4MCW A;  1IYS A;  4PPR A;  1ESU A;  2HP9 A;  5EVI D;  4E04 A;  2GX5 A;  1TS6 A;  1KGG A;  5CHM A;  3F1P A;  2OSU A;  3Q7V A;  4C75 A;  3MS6 A;  3V3S A;  1SKO B;  1ES2 A;  1VET A;  1NWZ A;  1PW8 A;  4IVK A;  4GHI B;  4P6Z S;  3SH9 A;  4DE1 A;  4BBV A;  5DTS A;  2XA7 M;  1PRQ A;  2QZ6 A;  4MN6 A;  1VQQ A;  4JXG A;  1W79 A;  4UA7 A;  1FCM A;  1S6R A;  3QP4 A;  1AXB A;  3A3F A;  5EV0 A;  4LGW A;  4NXF A;  3ZCZ A;  3UNW A;  2WGW B;  4OH0 A;  1P9W A;  4MDZ A;  1JWP A;  2WZZ A;  1YAX A;  5TGF A;  4E3M A;  2H5S A;  1CF0 A;  5F1G A;  5DFX A;  5E2H A;  3IF5 A;  1VHM A;  4DXC A;  2JC7 A;  5FQM A;  1FR1 A;  1K54 A;  5AVF A;  2XEP A;  4Y15 A;  5HDC A;  1MC0 A;  1BT5 A;  1PYY A;  3JVU A;  4GS9 B;  3BEC A;  4IBX A;  3LIA A;  2FFF B;  1W7F A;  4KEN B;  2P04 A;  4IHQ A;  4B93 A;  2OLV A;  4Z1W A;  1S4S A;  1E25 A;  2G7U A;  4PMA A;  2W1R A;  3NOP C;  3W2Z A;  5EVI B;  4O0P A;  2XRO A;  5DF9 A;  2Y2J A;  3H82 A;  1TF1 A;  3IXD A;  4CPK A;  5HWW A;  3NY4 A;  3A3D A;  5IHV A;  4BL3 A;  4HY8 A;  3I7J A;  1IYP A;  4MMN A;  2KLI A;  2ZMA A;  1K0K A;  1KE3 A;  2IWB A;  3DTK A;  1ZKJ A;  3C7V A;  2VJW A;  3LUQ A;  2IWC A;  5AJG A;  2H0Y A;  2VV8 A;  2JKR I;  3LIF A;  3WS5 A;  2HDR A;  1KDW A;  2V0W A;  5EUA A;  5FAS A;  3TG9 A;  1VM1 A;  2JHE A;  5A92 A;  2K31 A;  2XF3 A;  1NLZ A;  5HD3 A;  3V67 A;  4E3I A;  5IS1 A;  1Z6F A;  1T1A A;  4HEF A;  4Y0O A;  1SCW A;  4KZ6 A;  1S66 L;  3IWI A;  3LI8 A;  3NHQ A;  2GDN A;  3CPT A;  4PKY A;  1S67 L;  2D01 A;  3E2K A;  1V9Y A;  2H28 A;  3VE4 A;  2PT7 A;  3SH7 A;  3T4O A;  3MFD A;  1ZTU A;  2OWJ A;  5DJU A;  3PAE A;  1ERM A;  4K0W A;  3UB8 A;  3V3R A;  2XR0 A;  1GSW A;  3ZG9 B;  1Y28 A;  3E98 A;  3FYZ A;  1GSX A;  4KUO A;  1XA1 A;  3A0S A;  2PU2 A;  5E2F A;  3ZYT A;  3WS1 A;  1QMF A;  4BLM A;  1KVL A;  2J80 A;  1ONH A;  1BLP A;  1D06 A;  1LL8 A;  3BLS A;  5F1F A;  2ZD8 A;  2WKH A;  1T1C A;  2V20 A;  3OPH A;  4LRY C;  4PKY G;  2ZJ9 A;  4ME4 A;  3V50 A;  4JXW A;  4S2I A;  1DJA A;  2LB9 A;  1KGE A;  3O5Y A;  3CHW P;  2PRF A;  2Y2L A;  5HL6 A;  2UV0 E;  2I72 A;  4O01 A;  4KZ9 A;  1G28 A;  1T1B A;  1OME A;  1IEL A;  3U2A A;  1GA0 A;  1G5U A;  2JKG A;  3UE3 A;  3BFG A;  5CGX A;  2X71 A;  1SHV A;  5HDS A;  4EEU A;  4K08 A;  4ESP A;  2B5R A;  4KZ4 A;  2HV1 A;  4JF5 A;  1L0G A;  3ZG0 A;  3W4O A;  2PU4 A;  1K38 A;  4S2L A;  4I3J A;  1UGU A;  4KG6 A;  3PBO A;  2AVX A;  4OLD A;  4R3A A;  3C7U A;  1OT9 A;  5FSR A;  4A5R A;  2WGV A;  4RX3 A;  4JGQ A;  4RVA A;  4EEP A;  4HJ4 A;  2EX8 A;  4EQ1 A;  3NCK A;  3QP1 A;  3KYE A;  3Q7V B;  3LYX A;  3IX8 A;  3UB9 A;  5CRF A;  1D1J A;  1PFL A;  2WKQ A;  4HP4 A;  4U0T A;  4GDB A;  3VSL A;  3AGE A;  4IUH A;  1HZO A;  3PBQ A;  4Q0J A;  5FDH A;  3C5A A;  5FEF A;  3TJZ C;  3P09 A;  4R1G A;  1YM1 A;  3GMW A;  4BD0 A;  3MQ0 A;  2Y79 A;  1CEG A;  4P6B A;  3MKF A;  1J3W A;  1VB6 A;  5BOH A;  2WZX A;  3EGX C;  5FAO A;  4IBR A;  2E8I A;  2R9X A;  5TFQ A;  4EBN A;  3LCE A;  5FL3 A;  4GB7 A;  1L0D A;  1CI8 A;  2XK1 A;  4LLO B;  3VP2 A;  4S2N C;  1N9B A;  5TR7 A;  5HX9 A;  4OPQ A;  4KZA A;  2CC1 A;  4LV0 A;  5GL9 A;  3KSI A;  4HH3 A;  4RYE A;  2HDQ A;  4JGO A;  2Y2K A;  2W1T B;  4S2J A;  1K55 A;  3BM6 A;  1IYQ A;  2Y4A A;  4WZ5 C;  1NRF A;  4HQA A;  4MEZ A;  3OOV A;  3VSK A;  1BYW A;  1MWS A;  2W3H A;  3O87 A;  2VGL M;  2XA7 S;  2J7V A;  2X02 A;  3WS0 A;  4QY5 A;  3WS4 A;  4M4X A;  1SDN A;  3UDX A;  4OP8 A;  2HDS A;  3JYI A;  3QP6 A;  5G18 A;  4R0Q A;  5J7E A;  3OC2 A;  1ES4 A;  4JLF A;  4KZ5 A;  1TS7 A;  2EX6 A;  2FZ0 A;  1YQS A;  2HF6 A;  3GEC A;  5J4E A;  3ZVW A;  2Y2G A;  4HOI A;  3T4L A;  3EWK A;  1YLZ A;  3UO9 A;  2ZLY A;  3NI9 A;  3VE3 A;  1DRM A;  2V8F A;  2W3F A;  1Z09 A;  4ARZ A;  4EBP A;  5A91 A;  4CLC D;  3UME A;  2HJ9 C;  3G31 A;  3VMA A;  2DMW A;  5DJT A;  1CI9 A;  2V2F F;  2V1Z A;  4MBF A;  4X1L A;  2DNS A;  4ZDX A;  3MZD A;  5HZH A;  1RP5 A;  3NUL A;  4XXR A;  1JWV A;  1FQG A;  3HJK A;  3HVF A;  3FKV A;  1XX2 A;  2EFX A;  4LV1 A;  2XSS A;  4QB8 A;  2HJE A;  2GNX A;  2Y59 A;  3MZE A;  5TBM B;  1STZ A;  3FC7 A;  1LL9 A;  1C3B A;  2J3T C;  2ZMV A;  4R38 A;  4Y0T A;  4Y3I A;  4BD1 A;  2ZOI A;  5M18 A;  1GHP A;  3RH8 B;  2Y2M A;  2XQZ A;  4HES A;  3HUM A;  4D2O A;  4BQM A;  5LBR A;  1XPB A;  5G4Y A;  2PYP A;  3L7H A;  3T4S A;  3DTM A;  4OPY A;  3UPO A;  5A90 A;  2ZQC A;  2YKH A;  1FSY A;  2FFY A;  4I39 A;  2QJ5 A;  5GHX A;  2WK0 A;  3F1N A;  1V9Z A;  3D72 A;  4QU3 A;  4WF0 A;  3FZC A;  1G6O A;  4KQQ A;  1ONG A;  4OKP A;  3S7O A;  1HD8 A;  1XFQ A;  3FPV A;  2P7J A;  3UPP A;  3CUE A;  4Y13 A;  1G68 A;  2DCF A;  3H7W A;  3KSH A;  1UWP X;  3JPU A;  1H8Z A;  5KZH A;  5FI2 A;  3RXX A;  5GHZ A;  3MQO A;  3FG8 A;  3A0R A;  2JKT M;  3HJI A;  1JVJ A;  4MNR A;  1P97 A;  4DKI A;  2JKF A;  4R4R A;  4YNR A;  4R4S A;  1I2S A;  5DTK A;  1K57 A;  2Q9M A;  1S1Y A;  5F69 A;  1OTA A;  1W5D A;  5L09 A;  2PD7 A;  4GKU A;  1FIK A;  4GNU A;  2PBY A;  3R4K A;  2QHK A;  3BJN A;  4ZBE A;  1ALQ A;  5HL1 A;  3TE8 A;  4H6J B;  4AFI A;  1JNU A;  2NUP C;  4NET A;  2OOL A;  4FOF A;  4YIN A;  1E4D A;  5U47 A;  3DW0 A;  4QJG A;  4E3L A;  1ZG4 A;  4N92 A;  1LI0 A;  1K54 C;  2HZ5 A;  3LEZ A;  4P85 A;  1MBL A;  4K0X A;  4DN0 A;  3GQZ A;  4WMC D;  5KSC A;  2HP6 A;  3OBF A;  3MMH A;  1DP8 A;  2QPN A;  4EQI A;  2HGV A;  2ACG A;  3Q81 A;  2BLS A;  3IBJ A;  3HLB A;  2P08 A;  1UWN X;  1Q2P A;  4FD8 A;  3O3V A;  5K5B A;  4OQG A;  3UB5 P;  5C5K A;  5A93 A;  2J9P A;  3EGD C;  2XD5 A;  4ZJ3 A;  4Y7P A;  4GLQ A;  1H5X A;  3LEQ A;  3FPW A;  1MWR A;  2H10 A;  1MKI A;  4IJG A;  1RCJ A;  4KQR A;  3NOU C;  4F94 A;  2PD8 A;  4UAA A;  3EQU A;  3IX3 A;  1H8M A;  3SS5 A;  5F83 A;  4ID4 A;  4GOG A;  5GLC A;  4EET B;  4UEY A;  1NYM A;  3GV9 A;  2ZMF A;  5EOE A;  4FH2 A;  4L9F A;  3MF0 A;  3OPP A;  1S4R A;  4WUJ A;  4XUX A;  3FKW A;  1TVF A;  3BFC A;  4YWZ A;  3IT9 A;  1CJF A;  4PM7 A;  2VV6 A;  3GVB A;  4GJ4 A;  4MN7 A;  2EWW A;  4MBH A;  4OQ0 A;  4UQI M;  5HPF A;  4F3L A;  3LR3 A;  3TW8 A;  2J3T D;  3LFV A;  4FCF A;  4G3K A;  4JXS A;  1PIO A;  1P9R A;  3MBZ A;  5FAQ A;  3BFE A;  2V9A A;  3UMD A;  5F82 A;  4XT2 A;  4HP9 A;  3PHY A;  4BJP A;  4OPZ A;  4WEL A;  5E2E A;  1HLU P;  1TS8 A;  4PM9 A;  2VGL S;  4WL9 A;  4KQD A;  3DTI A;  1PW1 A;  1F2K A;  4WN5 A;  4XUZ A;  4WYY A;  5EOO A;  5I5L A;  3ICY A;  1ERQ A;  3T4T A;  4L0L A;  3UY6 A;  3MKE A;  1EW0 A;  2WKP A;  4E6X A;  1PWD A;  1YLJ A;  3ZDJ A;  4Q0I A;  2ZQ9 A;  4KG2 A;  4M3K A;  2IWD A;  1I2W A;  1JTD A;  4KQO A;  1ZC2 A;  5FQI A;  3LIE A;  3V39 A;  3R7W A;  2KOI A;  1NYY A;  3VP0 A;  3F1O A;  2PAV P;  1MWT A;  4X56 A;  5EVE A;  3GRJ A;  3FWL A;  3IS2 A;  3UPN A;  3B33 A;  4Y5F A;  2I9V A;  1FCN A;  3Q7Z A;  4BWI A;  3GTC A;  2Y2P A;  4I5S A;  4X25 A;  2EFU A;  1E3U D;  4QPR A;  3MXQ A;  4KG5 A;  2V1B A;  4C3Q A;  3W4P A;  1VEU B;  4NK3 A;  1XA7 A;  1SDE A;  3IQA A;  3S7P A;  4QHC A;  2A2L A;  4IUK A;  5CGS A;  4OVD A;  5EFW A;  2VLG A;  2ZL1 A;  2HPB A;  1PZO A;  4GW9 A;  5HAR A;  5GLB A;  3G4P A;  5G4Z A;  5HWT A;  4FSF A;  4PM8 A;  3RFB A;  3TSG A;  5KIZ A;  3GR2 A;  4I38 A;  3H7W B;  3K3D A;  3WRZ A;  5AQ7 A;  4CLC A;  1LI9 A;  4N1H A;  3IH8 A;  4NG2 A;  2Y91 A;  1YMX A;  1ES3 A;  5FQJ A;  3E4P A;  2DRW A;  3BY8 A;  1BUL A;  1OTD A;  5HW3 A;  2UWX A;  3NDG A;  3A3E A;  3PBS A;  1H0M A;  4OPR A;  2JCH A;  2V1A A;  1WYC A;  4EUV A;  2Y2O A;  4PM6 A;  3WWX A;  4ETZ A;  5CHJ A;  1LSV A;  1ERO A;  4GD6 A;  1K56 A;  3F1P B;  3UDF A;  4EW7 A;  5EM1 A;  3BQ8 A;  2XRN A;  2PR6 A;  4CJN A;  2VEA A;  4ZJ2 A;  2O9B A;  4N9L A;  1J9M A;  3AGD A;  2GJ3 A;  1VET B;  1Q2Q A;  2Z6D A;  2Q9N A;  1IFQ A;  2NUT C;  4L9E A;  4S2O A;  3T50 A;  4E3K A;  3T4K A;  3NC8 A;  2Z6C A;  4B4Z A;  1ACF A;  1K55 C;  5L8M A;  2R78 A;  5FA7 A;  1W63 M;  5M19 A;  3TOI A;  3UE0 A;  1A0K A;  1K6R A;  1FOF A;  3M6B A;  5CX7 A;  4MLL A;  5DFY A;  4FH4 A;  4IED A;  2CMN A;  2WGW A;  4EUZ A;  4JPM A;  4BEN A;  4EER A;  1N4O A;  4LRX C;  5FEG A;  2QYB A;  4ZRR A;  3IH9 A;  1RGZ A;  2W0N A;  4U3T A;  1WE4 A;  3UN7 A;  4CLC E;  3NBL A;  1P0Z A;  2PR5 A;  4I3A A;  4ZJ1 A;  4KZ7 A;  4GS9 A;  4JGR A;  4RQ9 A;  3ULF A;  2M7U A;  4UA6 A;  5HFO A;  4JBF A;  1BZA A;  3IWQ A;  1M40 A;  3MQQ A;  2G2U A;  3AGF A;  4IVI A;  4X69 A;  2EA9 A;  5EVI A;  3A0V A;  1OTE A;  2J9O A;  4DJ3 A;  2K7S A;  1K6S A;  4N9K A;  3H82 B;  3C4O A;  1HTZ A;  2Q0O A;  3D4F A;  5HPI A;  3U4L P;  5HAQ A;  4KZB A;  4EWF A;  2ZC6 B;  5FDS A;  1HVB A;  2JN7 A;  4BMW A;  3C8C A;  3S7Q A;  4FTX A;  2VX8 A;  1K4E A;  4WMC A;  1WYB A;  1NY0 A;  1KDS A;  5J3W A;  5MC7 A;  4HNB A;  3EEH A;  4LFU A;  5HDD A;  3C30 A;  4KUK A;  5CED A;  4XT2 B;  3CI6 A;  1JTG A;  1W63 Q;  3VFF A;  3P7N A;  4LPZ A;  3Q07 A;  2EXA A;  1NRJ A;  3N8L A;  1PWC A;  4RA7 A;  3W8K A;  3DWK A;  4NKP A;  1GHI A;  4DE3 A;  3ZFZ A;  3DBA A;  3G35 A;  1BLS A;  1OTB A;  3CJM A;  4CQH A;  1FR6 A;  4NXE A;  5JYO A;  3LR5 A;  2L1M A;  4R6L A;  5L10 A;  2PBD P;  1EWZ A;  3CPT B;  5FQQ A;  4B88 A;  1TDL A;  4HHD A;  2QMI A;  3DAV A;  4UQI S;  4JGP A;  2W3E A;  2ZC4 B;  5AQA A;  1EI5 A;  2M7V A;  3CUE C;  3UE1 A;  2ZQD A;  4S2K A;  4S2M A;  3R7W B;  3T12 B;  1OJ5 A;  3A3J A;  3F1O B;  3A3I A;  3OCN A;  1OTI A;  3OPR A;  2E8J A;  2BG1 A;  2EX9 A;  2YKF A;  3LY3 A;  2EWV A;  1L3L A;  4PHT A;  4R70 A;  3BFD A;  3N6I A;  5FI7 A;  1K57 C;  2Y8H A;  4Z9Q A;  3B47 A;  3EQV A;  4WEJ A;  3EOI A;  3SZT A;  3N8S A;  1MPL A;  3QHY A;  3MR0 A;  3CAX A;  3CLO A;  1CQA A;  4EES A;  5IU1 A;  1DP9 A;  2ZBB A;  1IYO A;  3LR4 A;  4Y2F A;  2XGN A;  4UHU A;  3T1R A;  3MZF A;  1XJ3 A;  2ZQ7 A;  3S22 A;  3LO7 A;  5FAP A;  5HWV A;  5AQ9 A;  5HAI A;  3BWL A;  3HLD A;  4Q8I A;  1LSW A;  4X53 A;  3HUN A;  2C5W B;  1N9L A;  2ZQ8 A;  1YMS A;  3BLM A;  2HDU A;  3E0Y A;  2K2N A;  4PM5 A;  4E3J A;  1NLY A;  1WA9 A;  3RXW A;  4Y17 A;  3SH8 A;  4DXB A;  2B18 A;  3QNB A;  4HBU A;  3G32 A;  3H9W A;  4OON A;  3HLF A;  3NDE A;  4DMZ A;  1YT4 A;  3RTY A;  3MJQ A;  3IWO A;  3ZVT A;  5EM0 A;  3KYQ A;  1MZU A;  3T1S A;  1YSP A;  1FIL A;  2H0T A;  1XKZ A;  4FUW A;  4EU0 A;  3VOL A;  3B42 A;  2INW A;  3KO6 A;  3VP1 A;  2L4R A;  3MXS A;  3G34 A;  4EBL A;  2WYX A;  1O07 A;  4HBT A;  4Q0H A;  2WAE A;  1IKG A;  2A24 A;  2RL3 A;  2ZC3 B;  2XDM A;  3Q82 A;  5FQK A;  5DTT A;  3BQA A;  5F68 A;  2Z2M B;  3QP5 A;  5DKK A;  1E3U A;  4YFM A;  3BW6 A;  4ZAM A;  3LIC A;  1CK3 A;  2ZM2 A;  2KDK A;  1TD5 A;  3BY9 A;  4JKT A;  1ZG6 A;  3DTE A;  3LR0 A;  4NXG A;  1PNE A;  2LB5 A;  3CMZ A;  2JKT I;  1YSQ A;  1L2S A;  3CWF A;  2R9W A;  2JKR M;  5AQB A;  3IF6 C;  3VV4 A;  2W3G A;  3G30 A;  1XGJ A;  3UB7 A;  2W1T A;  1ODV A;  3ZG8 B;  1BTL A;  1GHM A;  1OJG A;  4DE2 A;  3NEC A;  3SOI A;  2Y2I A;  2O0Y A;  1SKF A;  1YLY A;  5J8X A;  4ETX A;  4OOL A;  3PTE A;  3HUO A;  5DF7 A;  4KZ8 A;  1IEM A;  3N7W A;  4E6W A;  5HAP A;  4Y0U A;  3LID A;  5CTN A;  3IF6 A;  5L07 A;  3K2N A;  4DRT A;  5CGW A;  3ISG A;  3W4Q A;  2JBF A;  3HLC A;  3HL9 A;  4LV2 A;  3UDI A;  3SS4 A;  1W8Y A;  1DP6 A;  1F5M A;  4WM9 A;  1YLW A;  1T18 A;  1BLH A;  1Y4O A;  1KVM A;  1GA9 A;  2A3U A;  2KX6 A;  1DJB A;  3ZG5 A;  4I3I A;  4OQI A;  1QME A;  1TS0 A;  4ARZ B;  4O8G A;  2JE5 A;  1FSW A;  2P9V A;  4BBU A;  1U60 A;  1OPX A;  1XJ2 A;  1XP4 A;  2D02 A;  3BEB A;  1XJ4 A;  1MKM A;  3MSH A;  4BL2 A;  2VV7 A;  4WLA A;  2ZC7 A;  4DJ2 A;  2OLU A;  2BAS A;  1RGY A;  3O86 A;  4P0M A;  2X01 A;  4R3J A;  4ZTK A;  4H8R A;  5TBM A;  2VA0 A;  3OPL A;  1H8Y A;  1GCE A;  3GDI A;  3T1Q B;  3ZNY A;  1PZP A;  3PXP A;  5DF8 A;  3ZGA B;  5FI6 A;  4JXV A;  3RJU A;  2OV5 A;  5CTM A;  5GLD A;  2XFS A;  5DVA A;  1XJ6 A;  3NJA A;  3LIB A;  5I94 A;  3SW1 A;  1Y54 A;  1KOU A;  4E3O A;  3C2W A;  3QNC A;  2RCX A;  2BTF P;  4II7 A;  4CLC C;  1XXM A;  2WKR A;  2ZM0 A;  1PI4 A;  3TRC A;  5L2F A;  3HCY A;  2OAQ 1;  3WRT A;  1G6A A;  1N9N A;  3BYD A;  5AVE A;  4B4X A;  1TDG A;  1NZU A;  3OLO A;  1S1Z A;  1KE4 A;  1I5Q A;  3F1N B;  3DWZ A;  3K3C A;  1YPR A;  5A8B A;  3BFF A;  3PR6 A;  4RX2 A;  3P98 A;  3CIT A;  4X1M A;  4S2P A;  2Y55 A;  3QP8 A;  5CEB A;  2ZM8 A;  2O9A A;  3IXH A;  3PBR A;  4PAU A;  3HLG A;  3HRE A;  4P6Z M;  3IHB A;  3O88 A;  4OOY A;  2VK3 A;  3S1Y A;  5IT5 A;  2QKP A;  5EEC A;  4U0X A;  2O99 A;  4GCZ A;  1GSV A;  4P87 A;  3ITB A;  2WGI A;  3S4X A;  1LSX A;  1S0W A;  4C6Y A;  3T4Q A;  2EXB A;  4WBG A;  4K91 A;  4B9O A;  3IXB A;  3IBR A;  4H6J A;  2XFT A;  1IOU A;  2C6W B;  2PYR A;  3G2Y A;  4HJ3 A;  1NJ4 A;  1N9O A;  1SKO A;  3PYP A;  1BLC A;  3JVV A;  3HLE A;  1NXY A;  5EPH A;  5JYP A;  4GHI A;  4QWO A;  4E3N A;  4JF6 A;  1XGI A;  3PBT A;  5GLA A;  3KSF A;  3NOT C;  3UB6 A;  1PI5 A;  4KZ3 A;  3WS2 A;  1BUE A;  5D3O A;  2A24 B;  4YOF A;  5CHU A;  2WAF A;  1YLT A;  3NIA A;  2PHY A;  5EVI C;  3GSG A;  3M2K A;  2QWS A;  4R23 A;  3OZH A;  3IXG A;  1YLP A;  1M6K A;  5CER A;  1X0O A;  2V0U A;  4O7D A;  2ZOH A;  5F6A A;  1ESI A;  1K4F A;  2OAP 1;  3L9K A;  3VP4 A;  2WAD A;  4X68 A;  4G3W A;  3IHA A;  1AWI A;  4HJ6 A;  1JWZ A;  4LCM A;  5TJJ A;  1LLB A;  2WKE A;  4GDN A;  3VOZ A;  2O9C A;  5EVL A;  1LHY A;  4UA9 A;  4R3B A;  3PBN A;  3HBR A;  3E2L A;  4GN2 A;  4S2N A;  5CEC A;  3S7N A;  3QP2 A;  4EV4 A;  1L0F A;  5E2G A;  1DY6 A;  2ZQA A;  4DDS A;  3IF6 B;  3ZHH A;  3T1X A;  2M1C A;  1W8Q A;  3HLW A;  4WZ4 A;  3EEA A;  5F5Y A;  2J3W A;  1TEM A;  3M2J A;  2W27 A;  4JF4 A;  2P74 A;  2HP5 A;  2OWH A;  4WZ5 A;  1ES5 A;  5E43 A;  4F3L B;  1MY8 A;  1O7E A;  3BRM A;  2XH9 A;  3ZQ5 A;  4NXB A;  3LI9 A;  5FQ9 A;  3LY4 A;  3VOY A;  5KSH A;  1PWG A;  1OT6 A;  2WUQ A;  1DJC A;  2Y2Q A;  1SZV A;  2MJ6 A;  1NZO A;  5DKL A;  4MBK A;  1IKI A;  2W3D A;  2XLN A;  4LCL A;  1KE0 A;  3CZD A;  5HD5 A;  3FV7 A;  4LV3 A;  3Q1F A;  4X6T A;  2VZW A;  2P9V B;  3P01 A;  3MFX A;  5GHY A;  2QJ7 A;  3D9Y A;  4N1X A;  3D3O A;  3UE6 A;  2J8Y A;  5EE8 A;  1MWU A;  2B95 A;  3V5M A;  5HSQ A;  2Y2N A;  2VKS A;  2XD1 A;  3SS3 A;  1K56 D;  1T19 A;  2ZC5 B;  4OLG A;  4QD4 A;  3N8R A;  4GD8 A;  4LEN A;  4D60 A;  4BBT A;  3OCL A;  1KGF A;  3KYZ A;  1F9I A;  1BSG A;  3ITA A;  4L9G A;  3ZNT A;  1F98 A;  5M1A A;  4MN5 A;  2IA2 A;  3MXR A;  3KSG A;  5FAT A;  4EXO A;  3IS2 B;  2A49 A;  3C4P A;  1CEF A;  1LT0 A; 
#chains in the Genus database with same CATH homology
 3E4Q A;  4BWI A;  4G3V A;  3UB7 A;  4I5S A;  2W1T A;  1XFN A;  2W1T B;  4WEK A;  3T4J A;  1ODV A;  4QPR A;  3MXQ A;  4HH2 A;  2V1B A;  4HI4 A;  1OJG A;  2GZA A;  4HQA A;  3OOV A;  1BYW A;  2O0Y A;  2W3H A;  3G6O A;  3S7P A;  2B02 A;  2A2L A;  4ETX A;  4OOL A;  4IUK A;  1H3Q A;  2VGL M;  2XA7 S;  5EFW A;  2VLG A;  3LID A;  4GW9 A;  1ZHH B;  3K2N A;  4M4X A;  5G4Z A;  5HWT A;  4FSF A;  3RFB A;  5KIZ A;  2PDR A;  4I38 A;  3H7W B;  3K3D A;  2L0W A;  4CLC A;  4CLC B;  5J7E A;  4HIA A;  4OOM A;  3OC2 A;  3E4O A;  1DP6 A;  1F5M A;  3E4P A;  1YKD A;  3C38 A;  3BY8 A;  4NEE D;  1OTD A;  4LRZ E;  1T18 A;  1TS7 A;  3PBS A;  1D7E A;  2FZ0 A;  2HF6 A;  3KX0 X;  3GEC A;  5J4E A;  2KX6 A;  2FH5 A;  2V1A A;  4MCW A;  4HOI A;  3T4L A;  3EWK A;  4E04 A;  4EUV A;  2GX5 A;  4I3I A;  4ETZ A;  1TS6 A;  1LSV A;  3F1P A;  3VE3 A;  1DRM A;  3F1P B;  2W3F A;  4ARZ A;  1TS0 A;  4CLC D;  4EW7 A;  3BQ8 A;  2HJ9 C;  3UME A;  4O8G A;  4ARZ B;  2XRN A;  2PR6 A;  2DMW A;  5DJT A;  2VEA A;  4BBU A;  2O9B A;  1OPX A;  1XJ2 A;  2GJ3 A;  2D02 A;  1XJ4 A;  1MKM A;  2Z6D A;  1NWZ A;  1IFQ A;  2VV7 A;  4WLA A;  5HZH A;  2NUT C;  4L9E A;  3T50 A;  4DJ2 A;  3HJK A;  4GHI B;  2BAS A;  4P6Z S;  3T4K A;  2Z6C A;  4BBV A;  2XA7 M;  2XSS A;  5L8M A;  2R78 A;  2HJE A;  2GNX A;  4MN6 A;  5TBM A;  1W63 M;  5TBM B;  1STZ A;  3FC7 A;  2VA0 A;  3GDI A;  2J3T C;  2ZMV A;  3PXP A;  4R38 A;  5CX7 A;  4Y3I A;  5DFY A;  2ZOI A;  4NXF A;  2CMN A;  4EER A;  1XJ6 A;  4LRX C;  3NJA A;  1P9W A;  4MDZ A;  1YAX A;  3LIB A;  3SW1 A;  1KOU A;  2QYB A;  3RH8 B;  3C2W A;  4ZRR A;  5DFX A;  2W0N A;  4II7 A;  5LBR A;  1VHM A;  4CLC C;  4CLC E;  5G4Y A;  5AVF A;  1P0Z A;  2PYP A;  2WKR A;  2PR5 A;  4I3A A;  3TRC A;  3T4S A;  5HDC A;  3HCY A;  2OAQ 1;  1MC0 A;  2YKH A;  4GS9 A;  3JVU A;  1N9N A;  4JGR A;  5AVE A;  4GS9 B;  4I39 A;  2QJ5 A;  4RQ9 A;  3ULF A;  3OLO A;  1S1Z A;  2M7U A;  3F1N A;  1V9Z A;  3D72 A;  3F1N B;  4WF0 A;  3K3C A;  3LIA A;  1G6O A;  5A8B A;  3PR6 A;  2P04 A;  3CIT A;  3S7O A;  1XFQ A;  3MQQ A;  4IHQ A;  4B93 A;  3FPV A;  4Z1W A;  2P7J A;  1S4S A;  3CUE A;  2G7U A;  2EA9 A;  2W1R A;  3NOP C;  3W2Z A;  3A0V A;  1OTE A;  4DJ3 A;  4O0P A;  2XRO A;  5DF9 A;  2K7S A;  3H7W A;  3H82 A;  3KSH A;  1UWP X;  2O9A A;  1TF1 A;  3H82 B;  3PBR A;  4PAU A;  4P6Z M;  3MQO A;  3FG8 A;  5HWW A;  3A0R A;  5HPI A;  2JKT M;  3HJI A;  1P97 A;  4YNR A;  5IT5 A;  2QKP A;  4HY8 A;  2O99 A;  4GCZ A;  1GSV A;  1S1Y A;  5F69 A;  4MMN A;  1LSX A;  2KLI A;  4BMW A;  2JN7 A;  1OTA A;  3T4Q A;  2PD7 A;  3C8C A;  4B9O A;  3S7Q A;  3R4K A;  2VJW A;  2VX8 A;  3IBR A;  2QHK A;  3BJN A;  3LUQ A;  4H6J A;  5J3W A;  1IOU A;  3TE8 A;  4H6J B;  4HNB A;  5AJG A;  5MC7 A;  4AFI A;  2PYR A;  2VV8 A;  3EEH A;  1JNU A;  4HJ3 A;  1N9O A;  2JKR I;  3LIF A;  2NUP C;  5HDD A;  3C30 A;  2OOL A;  4KUK A;  3PYP A;  4FOF A;  4XT2 B;  3CI6 A;  1W63 Q;  3JVV A;  2V0W A;  3P7N A;  4LPZ A;  1NRJ A;  2JHE A;  4Y5F A;  2K31 A;  1NLZ A;  4GHI A;  5HD3 A;  4NKP A;  3V67 A;  3DBA A;  5IS1 A;  1T1A A;  1OTB A;  4CQH A;  4NXE A;  4DN0 A;  1S66 L;  3PBT A;  3LI8 A;  3NHQ A;  3LR5 A;  2L1M A;  3KSF A;  4R6L A;  4PKY A;  3NOT C;  1S67 L;  3UB6 A;  2D01 A;  3OBF A;  4HHD A;  3MMH A;  1DP8 A;  1V9Y A;  2H28 A;  3VE4 A;  2A24 B;  2PT7 A;  4YOF A;  2HGV A;  4UQI S;  3T4O A;  1ZTU A;  4JGP A;  2OWJ A;  2W3E A;  5DJU A;  3IBJ A;  2PHY A;  2M7V A;  3UB8 A;  3CUE C;  2P08 A;  1UWN X;  1GSW A;  1Y28 A;  2QWS A;  3E98 A;  1GSX A;  4KUO A;  5K5B A;  3R7W B;  3A0S A;  1OJ5 A;  5C5K A;  1X0O A;  3F1O B;  3ZYT A;  2V0U A;  3EGD C;  3OCN A;  2ZOH A;  5F6A A;  2J80 A;  4GLQ A;  1OTI A;  3FPW A;  2OAP 1;  2YKF A;  2EWV A;  1D06 A;  4PHT A;  4R70 A;  1LL8 A;  4IJG A;  4G3W A;  2Y8H A;  3NOU C;  3B47 A;  1T1C A;  3EQV A;  4HJ6 A;  5TJJ A;  4LRY C;  4PKY G;  4WEJ A;  2PD8 A;  2O9C A;  3EOI A;  4ME4 A;  3EQU A;  2LB9 A;  1H8M A;  3MR0 A;  3CAX A;  3O5Y A;  3CLO A;  3PBN A;  4EES A;  5IU1 A;  4EET B;  1DP9 A;  5HL6 A;  4UEY A;  2ZMF A;  2ZBB A;  4O01 A;  1G28 A;  3S7N A;  1T1B A;  3LR4 A;  4L9F A;  3U2A A;  3MF0 A;  4Y2F A;  3UE3 A;  1S4R A;  1XJ3 A;  4WUJ A;  2M1C A;  4YWZ A;  5HDS A;  3EEA A;  5F5Y A;  2J3W A;  5HWV A;  4EEU A;  4K08 A;  3BWL A;  1LSW A;  2W27 A;  2VV6 A;  4GJ4 A;  2HV1 A;  4MN7 A;  2EWW A;  4UQI M;  5HPF A;  2OWH A;  1N9L A;  4F3L A;  3LR3 A;  4F3L B;  4I3J A;  1UGU A;  3TW8 A;  2J3T D;  3E0Y A;  3PBO A;  2K2N A;  3LFV A;  4G3K A;  1NLY A;  3ZQ5 A;  1P9R A;  1WA9 A;  3LI9 A;  4NXB A;  4R3A A;  5KSH A;  1OT9 A;  1OT6 A;  2MJ6 A;  2V9A A;  3UMD A;  4JGQ A;  2B18 A;  4XT2 A;  5DKL A;  4HP9 A;  3PHY A;  3H9W A;  4BJP A;  4WEL A;  4DMZ A;  4EEP A;  4HJ4 A;  4EQ1 A;  1TS8 A;  2W3D A;  3RTY A;  2VGL S;  3MJQ A;  4WL9 A;  4KQD A;  5HD5 A;  3KYQ A;  1MZU A;  1YSP A;  3LYX A;  3UB9 A;  4WN5 A;  4EU0 A;  2VZW A;  2WKQ A;  3P01 A;  4HP4 A;  3VOL A;  3B42 A;  3MFX A;  2INW A;  5I5L A;  2QJ7 A;  3ICY A;  3KO6 A;  4IUH A;  2L4R A;  3T4T A;  3PBQ A;  4L0L A;  3D3O A;  1EW0 A;  2WKP A;  4Q0J A;  3TJZ C;  4Q0H A;  2A24 A;  3UE6 A;  3MQ0 A;  2Y79 A;  4Q0I A;  3BQA A;  5F68 A;  5DKK A;  5HSQ A;  4KQO A;  2VKS A;  3BW6 A;  3LIC A;  1VB6 A;  3EGX C;  3LIE A;  1T19 A;  5FL3 A;  3R7W A;  2KOI A;  2KDK A;  1TD5 A;  3BY9 A;  3F1O A;  4LLO B;  4BBT A;  3OCL A;  3LR0 A;  4NXG A;  3KYZ A;  1F9I A;  2LB5 A;  4L9G A;  1F98 A;  2JKT I;  1YSQ A;  4MN5 A;  2IA2 A;  3CWF A;  3IS2 A;  2JKR M;  3KSG A;  3KSI A;  4HH3 A;  4EXO A;  3IS2 B;  3VV4 A;  2W3G A;  3B33 A;  2I9V A;  4JGO A;  1LT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...