4HNBA

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
176
Chain Sequence
MDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 54
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hnbA00
2ZOIA 5G4YA 5J4EA 2ZOHA 1N9OA 3BY9A 4GHIB 2WKRA 3GDIA 4I3IA 3UB6A 1WA9A 2V9AA 1X0OA 4XT2B 1T19A 4HH3A 3NJAA 4WLAA 2PDRA 3UB9A 3LIDA 1D06A 2WKQA 5F6AA 1G28A 3ZQ5A 4LRYC 4BBVA 4F3LB 4H6JB 2KDKA 4I38A 4YWZA 4HY8A 2J80A 1TS7A 1LSXA 3H7WA 3LYXA 4LLOB 3FG8A 4BBUA 3BWLA 3LI9A 2D02A 1UGUA 4EEUA 1BYWA 1V9ZA 2Z6CA 4GHIA 4R6LA 4EW7A 2V0WA 2CMNA 2V1AA 2P7JA 1UWPX 5HWTA 1T1AA 3MFXA 4MN6A 1OTAA 1S4RA 4XT2A 1F9IA 3E4OA 4KUKA 3VOLA 3LIAA 3EWKA 1S67L 3LIFA 2I9VA 3F1NB 1OTEA 2GJ3A 4JGOA 4JGQA 4L9GA 3LIEA 4HJ3A 2L1MA 3NHQA 3G6OA 5HZHA 2V1BA 3LUQA 1OTBA 4LPZA 4HOIA 1DRMA 3KX0X 3CAXA 2A24B 1OJ5A 3PHYA 2W0NA 4F3LA 5DKKA 4H6JA 1ODVA 5TBMB 2VEAA 1XFQA 1DP8A 3T50A 1KOUA 1NWZA 3RH8B 1DP9A 3A0SA 4LRZE 4R3AA 3VE4A 5EFWA 1UWNX 1TS6A 5HDDA 1MZUA 4HIAA 5DJUA 2PYRA 3F1NA 1P0ZA 2K7SA 5G4ZA 5AVFA 5J3WA 4I5SA 2INWA 1GSXA 4HJ6A 1OT9A 2V0UA 2KX6A 1LT0A 1S66L 2HV1A 4M4XA 2R78A 1T1BA 1DP6A 2OWJA 5HDCA 5IS1A 2WKPA 5TBMA 2OWHA 3HJKA 4I3AA 4K08A 4I39A 2L0WA 3CLOA 4WF0A 3C8CA 3VE3A 1LL8A 1OT6A 1OTIA 5J7EA 5HDSA 2QJ5A 3UMDA 1GSWA 3ULFA 1F98A 4WN5A 2QKPA 4EESA 2L4RA 4KUOA 3A0RA 2BASA 1XJ6A 3E4PA 3OLOA 3GECA 5KIZA 3P7NA 3H82B 3NOUC 5HWWA 4NXFA 3BY8A 4GW9A 2YKHA 2JHEA 1JNUA 5F68A 2JN7A 3NOTC 4E04A 4LRXC 1VB6A 5HWVA 3UE6A 4JGRA 3IBRA 4JGPA 4PKYA 4B9OA 4EXOA 2PR5A 3SW1A 3NOPC 2QWSA 3F1PB 2PD8A 1S4SA 5HD3A 5AVEA 1XJ4A 5DJTA 2W27A 1N9NA 4NXBA 1EW0A 2D01A 4L9EA 2QHKA 4EERA 5A8BA 2EA9A 3MQQA 4EETB 4HI4A 1XFNA 2ZBBA 2PHYA 2PYPA 3H9WA 3IS2B 3H82A 4WL9A 1P97A 1OTDA 4RQ9A 4DJ3A 4HHDA 5F5YA 4NXEA 1V9YA 4HJ4A 4GS9B 1OJGA 2A24A 3F1PA 5HD5A 3EEHA 2M1CA 3MXQA 3PYPA 4HQAA 2YKFA 1T1CA 2VLGA 2Z6DA 3E4QA 3MQOA 3MR0A 4MN5A 4BBTA 4HP9A 1N9LA 4EQ1A 3IS2A 4EEPA 3FC7A 3B33A 4R38A 1XJ2A 2VV7A 4HNBA 2B02A 3ICYA 3LI8A 2VV8A 3RTYA 5HSQA 3F1OB 4L9FA 4GS9A 4R70A 5DKLA 2OOLA 5F69A 3MJQA 1T18A 3CWFA 4KQDA 5IU1A 2PR6A 4NXGA 3UB8A 3K3CA 1LSVA 1TS0A 2QJ7A 3UMEA 1S1ZA 1D7EA 3D72A 4HP4A 2H28A 1TS8A 2VV6A 1S1YA 4I3JA 4GCZA 3K3DA 1XJ3A 4PKYG 3HJIA 3A0VA 1Y28A 4HH2A 3LICA 5I5LA 3C2WA 2PD7A 1LSWA 4DJ2A 4WUJA 3H7WB 1GSVA 3LIBA 3F1OA 3UB7A
chains in the Genus database with same CATH superfamily
4WELA 1PYYA 1SKFA 5CERA 3HL9A 3OZHA 3ZVWA 1KE4A 3EQVA 1K0KA 1PFLA 4GHIB 3FV7A 3ZCZA 1IYQA 1K6SA 2DCFA 2O9AA 3IXDA 2ZL1B 5AQ9A 4HH3A 1MWSA 3O5YA 3HLBA 3MFDA 1XP4A 3UN7A 3UB9A 2X02A 3LIDA 1W63M 1D06A 4P6BA 3HLCA 3IBJA 5KSCA 4JXSA 5AQ7A 4BLMA 3N6IA 5EVID 4F3LB 1W79A 4H6JB 2O99A 2KDKA 3LR3A 3FKWA 4IVIA 5GLAA 3H7WA 3LYXA 5AQAA 3VOYA 2WGIA 2ACGA 5F82A 4GD8A 1UGUA 1NZOA 3JYIA 1AXBA 4FCFA 5CRFA 3CMZA 5FQIA 2Z6CA 1TDGA 4EW7A 3IH9A 4OPYA 2W3DA 5FI7A 1CI8A 3MFXA 4ETXA 5FQJA 1RGZA 5HL6A 2OAQ1 1QMFA 2FZ0A 2ZC5B 3DTIA 1M6KA 3VV4A 2JCHA 2GX5A 3C38A 3UB5P 1K4EA 2EFUA 2PAVP 5DTKA 1HZOA 4R3JA 4Z9QA 4Y0OA 2VGJA 2BLSA 1QMEA 3G31A 4MCWA 1L0FA 3NCKA 1DRMA 3CAXA 3UO9A 1FOFA 5DKKA 1L0GA 5EVIA 3T4QA 1NWZA 3RH8B 1IYOA 4O8GA 3HLWA 3NC8A 4LRZE 3Q7VA 4RA7A 1EROA 4PM6A 3VE4A 1Z6FA 4DF6A 4G3VA 4KZ3A 3S7NA 1MZUA 3O86A 5DJUA 2JKTM 2Q0OA 4B93A 1MBLA 4MBFA 5DF7A 5G4ZA 1MKMA 1KE3A 3PBNA 5AVFA 4UQIM 2JKGA 4I5SA 3P09A 1GSXA 2RL3A 4HJ6A 3HUOA 2V0UA 3MBZA 2HV1A 1FIKA 1H8YA 4ARZA 4JF5A 2OWJA 2PT7A 3U2AA 4FTXA 2WGWB 2Z2LB 5TBMA 2OWHA 3I7JA 3QP5A 1CQAA 3VSKA 1SDNA 4I39A 4KQQA 3TG9A 3GRJA 5LBRA 2W1RA 3ZG8B 3QHYA 1NYMA 5CXWA 3JVVA 3NDEA 2HGVA 1OTIA 3PAGA 5HDSA 1BLSA 3UMDA 3ULFA 4MMNA 3VFHA 4JLFA 5GHYA 2J8YA 4FH4A 3A0RA 3E4PA 2Y2LA 3ISGA 3GECA 2IWBA 5KIZA 4BD0A 3H82B 3T4TA 1IELA 2PRFA 1YSQA 3D3OA 4LCMA 5CTMA 1RGYA 4GW9A 3T12B 3DWZA 1JNUA 3PBQA 5L2FA 3O87A 5L09A 3BLMA 4JGRA 3LY4A 5FDSA 1PWCA 4GDNA 4EXOA 5BOHA 3A3DA 3F1PB 2CC1A 5HD3A 3SOIA 1XJ4A 2W27A 1CF0A 5HARA 3MKFA 1EW0A 2HF6A 2E8JA 3VOZA 2QHKA 3NIAA 4P6ZM 4EERA 2WGVA 4OQIA 1TD5A 2I72A 2V1ZA 2FFYA 5HL1A 2ZQ8A 2PHYA 3R7WA 4HESA 1ZC2A 1PW1A 2ZMFA 2W1TB 4WL9A 1P97A 1MXOA 3EQUA 1YM1A 3R4KA 2XK1A 3V3RA 4ZBEA 5FI2A 4CQHA 3W4QA 3VSLA 5GLDA 3OCNA 2K2NA 5E2FA 2A24A 3ITAA 2C6WB 1GCEA 5EOOA 2M1CA 2NUTC 4PM5A 2FFFB 4EBNA 5HPFA 1IKGA 5GHXA 5CTNA 1ZG4A 3N7WA 4ESPA 4X53A 3MZDA 5J8XA 4S2KA 3Q07A 4JKTA 4HBTA 1FILA 3MR0A 5F83A 4CPKA 2P9VA 4BBTA 3PBTA 4EQ1A 3IS2A 4EEPA 1IYSA 2HDRA 5A93A 2VV7A 5D3OA 4PM9A 3SS3A 2B02A 1HTZA 1ES4A 1PZOA 2XLNA 3KSGA 2W3FA 1K4FA 4DE0A 3Q7VB 5HSQA 5DF8A 1ZHHB 3OBFA 4QHCA 1AWIA 2OOLA 4EUZA 1XPBA 3JVUA 2XSSA 4WBGA 2VJWA 2HZ5A 5AJGA 5IU1A 2PR6A 1JWPA 1TS0A 2P74A 3MS6A 2H28A 1TS8A 4GZBA 4I3JA 4B4ZA 3ZNYA 4DKIA 4OH0A 2PU4A 3HJIA 1YMXA 5A91A 3VP1A 1BLPA 1NZUA 1Y28A 4N1XA 2GZAA 5M18A 3T1QB 3HLGA 3KSIA 4OOLA 3C2WA 4LGWA 4UA9A 1LSWA 4EBLA 1P9RA 2HP9A 1GSVA 4EV4A 3LIBA 1L3LA 3OPPA 4JPMA 2Y79A 3AGEA 1RCJA 4JXGA 3M6BA 1TEMA 3WWXA 1PWDA 2VZWA 3ZG0A 1S0WA 2WKRA 3GDIA 4WEJA 1WA9A 4GD6A 2V9AA 2VK3A 4XT2B 4WLAA 2WADA 4GKUA 4JF6A 3IXGA 1PI4A 5CGXA 1NLYA 1G28A 3PR6A 4Q0IA 4BBVA 5EVIC 4Y3IA 4I38A 5EVEA 4HY8A 1GHMA 5TFQA 3SZTA 4BBUA 3BWLA 4NEED 4OOMA 5L07A 5KMWA 4EEUA 5HAQA 1V9ZA 3BQAA 1ZG6A 1IOUA 2P7JA 1UWPX 3ITBA 2EFXA 1S6RA 4KG2A 3R7WB 1F9IA 3E4OA 4K91A 2ZC4B 2Y2GA 1S67L 2Y2QA 5M19A 3WS2A 2GJ3A 4EQIA 5TR7A 1I2SA 4E3MA 3A3FA 3NHQA 1ACFA 2WK0A 5K5BA 2A24B 4MDZA 1OJ5A 4RYEA 1BZAA 5FQ9A 2HDSA 3GVBA 2QYBA 3LCEA 1ODVA 2ZD8A 2VEAA 1XFQA 1KOUA 4C3QA 2W3HA 4ZJ2A 1YKDA 2JKFA 4WMCD 4LV1A 5CHJA 3V50A 3MXSA 2EXAA 5GLBA 1YLJA 2EWVA 3C5AA 1SHVA 3WRTA 4LFUA 1UWNX 3SS5A 1TS6A 2Y2HA 3EGDC 4RX2A 5TJJA 4HIAA 3RFBA 3F1NA 1GA0A 2Q9MA 3P98A 2XR0A 4R1GA 3K2NA 4YINA 4GN2A 5J3WA 4U0XA 2INWA 3QNBA 3BFCA 3IX4A 4QJGA 2KX6A 4UQIS 3T4LA 3N8RA 1H8MA 4LV2A 2Q9NA 4KG6A 2R78A 1LL5A 1T1BA 3KSFA 4U3TA 3D4FA 4OQHA 2O9BA 4DRTA 3WS0A 2WKPA 3W2ZA 3MQ0A 4KG5A 4MBHA 4K08A 4YOFA 3CLOA 4N9LA 4U0TA 2M7UA 3OPLA 3GMWA 4Y15A 4WMCA 1LL8A 3A3JA 2Z2MB 5J7EA 2G2WA 4QY6A 3Q1FA 2QJ5A 1KDSA 4P0MA 3KSHA 1W5DA 2X01A 2XD5A 4ID4A 2XA7M 3E2LA 2LB5A 2L4RA 3CITA 1K57C 4Y17A 3T4OA 3N8SA 4JXWA 3HLFA 1XJ6A 4X55A 1L0DA 1C3BA 5CEDA 4E3LA 5FEFA 1SKOA 3BRMA 3VP0A 4KZ8A 4WEKA 2NUPC 2JBFA 4LENA 3ZVTA 1H5XA 3RXXA 4WZ5A 4NKPA 5HWWA 2HDQA 4UEYA 5F68A 1KVLA 2J7VA 3NOTC 4HEFA 4A5RA 2ZQAA 4OLGA 5GLCA 3RJUA 2BG1A 3IBRA 1K54A 4YNRA 2PR5A 2VGKA 3ZGAB 1VEUB 4E3NA 4S2OA 2PD8A 5FAQA 4OP8A 3B47A 2JC7A 3S1YA 3IHBA 4WM9A 3EEAA 1W7FA 4NG2A 3PBRA 2J9OA 1KGFA 3G2YA 3O3VA 4MN7A 2VGLM 3FWLA 3BQ8A 3M6HA 4ZTKA 4P6ZS 3MQQA 4KZ9A 4EETB 4HI4A 3Q7ZA 1XFNA 4GB7A 5F1FA 2PYPA 1LI0A 2FH5A 4JXVA 1OTDA 4DJ3A 4HHDA 5DFXA 4DE3A 3JPUA 4QB8A 3BFDA 2G2UA 1MWTA 2EX8A 2R9WA 2ZM8A 5HD5A 2UWXA 4IHQA 3EEHA 5HFOA 1YLWA 4GDBA 4X1MA 3MXQA 5EOEA 4DMZA 4HQAA 2YKFA 4Y0UA 3LEZA 1MWRA 1ALQA 4ZRRA 5G18A 1N9BA 3PAEA 4DDSA 3MQOA 3IF6A 2Y2KA 1PRQA 1GA9A 4MN5A 4DN0A 3IT9A 1N9LA 2G7UA 3FYZA 5EV0A 3V39A 3VP2A 3B33A 1XA1A 5CGWA 1VHMA 3KO6A 4HNBA 4E3OA 1IYPA 5JYOA 4M3KA 4OKPA 3ICYA 3LI8A 1NRFA 5KSHA 5TGFA 1YLYA 4E6WA 1KGGA 3F1OB 4L9FA 4GJ4A 4GS9A 1E25A 1MC0A 1F5MA 3UDXA 4ZJ3A 1BTLA 4C6YA 4MNRA 3OC2A 4FH2A 4C75A 5F69A 4BWIA 1LL9A 1NY0A 2ZMVA 2OAP1 3GV9A 3K3CA 2V20A 3MXRA 3D72A 3G4PA 3UPPA 3S7QA 3K3DA 2V8FA 3S4XA 4PKYG 4OQGA 5DTSA 5DVAA 3A0VA 4XXRA 2XGNA 4G3KA 1E4DA 2XDMA 3Q81A 5HAPA 3BFFA 1PW8A 5EVLA 3H7WB 4S2LA 4S2NA 2O9CA 4BMWA 2ZOIA 4IUKA 5G4YA 1LI9A 3V5MA 1JVJA 3BY9A 1ONHA 3G34A 1BLHA 1YAXA 1F2KA 4Z1WA 3MF0A 3DWKA 1X0OA 1VETA 1SKOB 3T4JA 4OP5A 2WZXA 3CPTA 2PDRA 2ZQDA 1M40A 5MC7A 3U4LP 2ZC6B 3HUNA 4LRYC 4R3BA 5FQKA 4CLCD 1G68A 1WE4A 2V8CA 2RCXA 3WS1A 4YWZA 5EVIB 1XGJA 1Y4OA 1MWUA 4CJNA 3VFFA 3ZG7B 3LI9A 4KQRA 2D02A 4L0LA 2GDNA 3CZDA 4Y5FA 4NETA 4Y13A 1BULA 2XF3A 3LO7A 3BYDA 4QY5A 4GHIA 4R6LA 3QP6A 2V0WA 2CMNA 2V1AA 5HWTA 1T1AA 3SH7A 4MN6A 5E2HA 2AVXA 1OTAA 1S4RA 2GNXA 3S7PA 2WKHA 2ZL1A 3LR0A 2W3EA 4KUKA 3VOLA 1DJCA 2H5SA 1FR1A 4JGQA 3N4IA 3BFEA 3LIEA 4OOYA 5E43A 2Y59A 4KZAA 2J3TD 5GL9A 3M2KA 3LUQA 1OTBA 4P85A 4HOIA 4LV3A 4CLCA 4KZ5A 3PHYA 3BM6A 2W0NA 4ARZB 4F3LA 4HBUA 5FAOA 4H6JA 4QWOA 2ZM2A 2ZJ9A 2V2FF 1E3UD 5TBMB 3QNCA 5DF9A 1DP8A 1IEMA 5EECA 2M7VA 5I94A 1DP9A 2ZQCA 2Y91A 2H0YA 2Y55A 4O01A 3VP3A 3E98A 5FEGA 3HUMA 4R3AA 3TSGA 1U60A 3IX3A 4DE2A 3OOVA 4IBRA 1H0MA 3HREA 5HDDA 4KZ6A 3CHWP 3W4PA 2X71A 3L7HA 4KZ7A 2PYRA 4QD4A 4IBXA 2K7SA 3UDFA 4FOFA 4PMAA 5E2GA 4WZ5C 5FQMA 2IA2A 1ONGA 2OLUA 4S2IA 4Q8IA 1FCMA 1S66L 5F1GA 4M4XA 4S2PA 3UY6A 3PXPA 4PM8A 2B5RA 5HDCA 5IS1A 1NYYA 1ESUA 3VP4A 1K54C 2P08A 4OVDA 4WZ4A 4D60A 1E3UA 3GQZA 5FASA 2Y2IA 3ZG5A 3C8CA 3BW6A 1RP5A 5E2EA 2OLVA 4OPRA 4XUXA 1OT6A 2B18A 2XRNA 3NULA 1FCOA 4Y0TA 4E3IA 4WN5A 2QKPA 3UE1A 3C7UA 3OLOA 2XA7S 4ME4A 3P7NA 5FDHA 2A2LA 1YPRA 1STZA 3BY8A 2XD1A 2XFTA 2JHEA 3UE3A 4E04A 4EBPA 4LRXC 3MZEA 1TVFA 2UV0E 2WGWA 4Y2FA 4JGPA 4S2MA 3SW1A 1YQSA 3V67A 2QWSA 5HW3A 1S4SA 2ZC3B 5AVEA 1K6RA 3IXBA 5EM0A 2MJ6A 2D01A 4L9EA 4ZDXA 3SH9A 1Q2PA 2ZQ7A 1D1JA 1CJFA 3LEQA 3IF6C 1K55A 3LGOA 4PM7A 1GHPA 2JKRM 3AGFA 1ZTUA 2Y2OA 3WS4A 5GHZA 2VGLS 2P9VB 3HLDA 2Y4AA 5JYPA 3IS2B 3H82A 5HAIA 3LR5A 4MLLA 2C5WB 1DY6A 5U47A 2H10A 4K0XA 1JWZA 1V9YA 3D9YA 1HVBA 4R4RA 1ERQA 3G30A 4O0PA 1WYCA 1EI5A 1CEGA 5L10A 3HLEA 1ERMA 1PZPA 1XX2A 3F1PA 1Q2QA 2QPNA 4R4SA 1J3WA 1W8YA 4ZAMA 2BTFP 5L8MA 3PYPA 2JKTI 1SCWA 3A3IA 1H8ZA 2VLGA 3N8LA 3DTKA 1CEFA 3IH8A 3KYZA 2Y2PA 3TJZC 1YSPA 3CUEA 3T1SA 4CLCB 4HP9A 5CEBA 1YLTA 5M1AA 3DTMA 2W1TA 4II7A 4GLQA 4RVAA 3FKVA 4R38A 4S2NC 4KQOA 2PBYA 3G35A 3C4OA 4PAUA 2VV8A 4FUWA 4LCLA 1NRJA 4MEZA 3MKEA 5FL3A 3C30A 4UAAA 3VMAA 5DKLA 4LV0A 4UA6A 1T18A 1VM1A 3CWFA 4KQDA 3CI6A 1LSVA 2HPBA 2QJ7A 3O88A 1ESIA 1D7EA 4BENA 2VV6A 1S1YA 1YT4A 4GCZA 2WKEA 2ZQ9A 2E8IA 1L2SA 2EXBA 1K25A 3DAVA 4OQ0A 1NLZA 4N92A 4PPRA 3NDGA 2WAEA 3NBLA 4IJGA 2QZ6A 4E6XA 1PI5A 3NI9A 4DJ2A 4WUJA 4BJPA 2IWDA 3IWQA 3IXHA 4D2OA 2DRWA 4X6TA 3KYQA 3GR2A 3T4KA 5J4EA 2ZOHA 1N9OA 1YLPA 4NK3A 1W8QA 3ZG9B 3T4SA 4I3IA 3UB6A 1HLUP 4N1HA 1T19A 1MY8A 5CHUA 4EUVA 3NJAA 5A92A 5FA7A 3NECA 4JBFA 3SS4A 2PU2A 2WKQA 5DTTA 5F6AA 3ZQ5A 2J3WA 1DJBA 1MPLA 4CLCC 2EX6A 2PBDP 4IUHA 1GHIA 3LFVA 3HBRA 1KGEA 2ZM0A 4DDYA 2HJEA 3B3XA 3L9KA 2J80A 1TS7A 1LSXA 1H3QA 4LLOB 3FG8A 1K38A 4BD1A 1CI9A 2Y8HA 5FSRA 3DTEA 2LB9A 4IVKA 1BYWA 1Y54A 3ZYTA 3TE8A 3E2KA 2JE5A 3BJNA 4XT2A 2XEPA 2DMWA 4FSFA 3OPRA 4F94A 4OPQA 5HPIA 3W8KA 4Q0JA 3LIAA 1XKZA 3EWKA 3LIFA 2I9VA 3F1NB 4DXBA 1OTEA 4O7DA 3MMHA 1SZVA 4JGOA 3QP4A 4L9GA 4JF4A 1O7EA 4HJ3A 1TDLA 2L1MA 3LR4A 2J3TC 4H8RA 3G6OA 5HZHA 2V1BA 4R0QA 1XGIA 3G2ZA 3IF5A 4LPZA 3KX0X 4N9KA 4RX3A 2HP6A 3WS5A 1JTDA 1ES2A 4X1LA 3T50A 5IHVA 1TF1A 1FSYA 5EE8A 2VKSA 1G5UA 1ZKJA 2H0TA 2WKIA 3A0SA 5CECA 1LHYA 3ZFZA 2HP5A 3GSGA 4OONA 2OSUA 3OCLA 1YLZA 1KVMA 4BL3A 1IFQA 3BEBA 5EFWA 1K57A 1FCNA 4PHTA 1I2WA 4B88A 5A90A 1FQGA 5CHMA 3IQAA 2P04A 2W3GA 3BECA 3S22A 4X25A 4WYYA 1P0ZA 2VA0A 1P9WA 3SH8A 4E3KA 4YFMA 2R9XA 4S2JA 4UA7A 2XROA 4AFIA 1L0EA 2ZMAA 4G3WA 3C7VA 1OT9A 4P87A 1LT0A 4QPRA 1LLBA 3FPWA 3B42A 2EX9A 1DP6A 1ES3A 4GOGA 4FD8A 3HJKA 4KZ4A 4I3AA 4KZBA 4IEDA 1ES5A 3GTCA 1IKIA 1I5QA 5CGSA 2L0WA 4WF0A 1PWGA 3MZFA 3VE3A 4KENB 3EGXC 2HJ9C 4K0WA 1KDWA 2HDUA 1FSWA 4X56A 3C4PA 1GSWA 1K55C 5HX9A 5FATA 1F98A 2XQZA 1KE0A 4EESA 4KUOA 2BASA 3W4OA 1MKIA 2OV5A 1BT5A 4EWFA 5KZHA 3IWOA 2Y2JA 5IT5A 3P01A 2QMIA 3NOUC 4Q0HA 5CX7A 2K31A 4NXFA 3NY4A 1W63Q 2YKHA 1N4OA 1JTGA 2JN7A 5EM1A 1VB6A 3IX8A 5HWVA 4OPZA 5EUAA 3UE6A 1XXMA 4PKYA 3EOIA 4B9OA 1NJ4A 3Q82A 3FPVA 3NOPC 2EX2A 1JWVA 2XFSA 5DJTA 1BSGA 3QP2A 2A49A 2ZC7A 4X69A 1BUEA 1SDEA 4NXBA 1N9NA 3DBAA 2XH9A 3M2JA 3WRZA 1K56D 3CUEC 5A8BA 2EA9A 4X68A 3KYEA 3TRCA 3HVFA 3IF6B 1BLCA 3BLSA 3E0YA 2KOIA 4GNUA 1OMEA 2ZBBA 3AGDA 3PBSA 3H9WA 3IHAA 3UNWA 4MBKA 5C5KA 5EPHA 2J9PA 1A0KA 1XA7A 3G32A 2WZZA 1HD8A 1PIOA 4RQ9A 4BQMA 3TOIA 5F5YA 4NXEA 3TW8A 2O0YA 4HJ4A 2EWWA 4GS9B 1OJGA 4QU3A 4R23A 3UPOA 3PTEA 2VX8A 2JKRI 3RXWA 1VEUA 2DNSA 3T1XA 2A3UA 1EWZA 1OPXA 4DE1A 4BL2A 1T1CA 2Z6DA 3DW0A 2Y2MA 2KLIA 3V3SA 4ETZA 3E4QA 1K56A 1YMSA 1WYBA 3QP1A 3S7OA 4EU0A 4Y7PA 3UPNA 2Y2NA 3FC7A 5AQBA 3ZDJA 3CJMA 1XJ2A 5FAPA 4E3JA 1FR6A 4CLCE 3RTYA 4R70A 4OLDA 3IWIA 3ZNTA 3BFGA 2WYXA 3MJQA 2WUQA 2B95A 1J9MA 3MSHA 3T1RA 3HCYA 3UB8A 4NXGA 3LY3A 1O07A 1NXYA 3UMEA 1CK3A 1S1ZA 4HP4A 3UE0A 1VETB 3ZHHA 1Z09A 3CPTB 3OPHA 1PNEA 4XUZA 4B4XA 1G6AA 1XJ3A 3A3EA 3QP8A 2ZLYA 4ZJ1A 5DFYA 1G6OA 3PBOA 4HH2A 3LICA 5FI6A 2WAFA 3CG5A 5I5LA 4UHUA 2PD7A 1VQQA 3UDIA 3F1OA 3UB7A 1DJAA 5FQQA 4DXCA 3FZCA 2IWCA
chains in the Genus database with same CATH topology
4WELA 2Y79A 3KYQA 2ZOIA 4IUKA 3T4KA 5G4YA 5J4EA 2ZOHA 3EQVA 1N9OA 3BY9A 4GHIB 1YAXA 4Z1WA 2VZWA 2WKRA 3T4SA 2O9AA 3GDIA 3MF0A 4I3IA 3UB6A 4WEJA 1WA9A 2V9AA 1X0OA 4XT2B 3T4JA 1T19A 4HH3A 3O5YA 4EUVA 3NJAA 4WLAA 2PDRA 3UB9A 5MC7A 3LIDA 1W63M 1D06A 2WKQA 5F6AA 1NLYA 1G28A 3IBJA 3PR6A 4Q0IA 3ZQ5A 2J3WA 4LRYC 4CLCD 4CLCC 4BBVA 4IUHA 4Y3IA 3LFVA 4F3LB 4H6JB 2O99A 2KDKA 3LR3A 4I38A 4YWZA 2HJEA 4HY8A 2J80A 1TS7A 1LSXA 3H7WA 1H3QA 3LYXA 4LLOB 3FG8A 4BBUA 3BWLA 3LI9A 4NEED 2D02A 4L0LA 4OOMA 4Y5FA 1UGUA 2Y8HA 4EEUA 2LB9A 1BYWA 1V9ZA 2Z6CA 3BQAA 4GHIA 4R6LA 4BMWA 4EW7A 3ZYTA 1IOUA 2W3DA 2V0WA 2CMNA 2V1AA 2P7JA 1UWPX 3TE8A 5HWTA 1T1AA 3MFXA 4MN6A 4ETXA 1OTAA 1S4RA 2GNXA 3S7PA 3LR0A 3BJNA 4XT2A 2W3EA 1F9IA 2DMWA 3E4OA 4FSFA 4KUKA 5HL6A 3R7WB 5HPIA 4Q0JA 2OAQ1 3VOLA 2FZ0A 3EWKA 3LIAA 1S67L 3VV4A 2GX5A 3LIFA 2I9VA 3F1NB 1OTEA 3C38A 3MMHA 2GJ3A 4JGOA 4JGQA 4L9GA 3LIEA 4HJ3A 2L1MA 3LR4A 2J3TD 2J3TC 3NHQA 3G6OA 4MCWA 5HZHA 2V1BA 3LUQA 1OTBA 4LPZA 4HOIA 1DRMA 3KX0X 5K5BA 3CAXA 2A24B 4MDZA 4CLCA 1OJ5A 3PHYA 2W0NA 4ARZB 4F3LA 5DKKA 4H6JA 2QYBA 1ODVA 5TBMB 2VEAA 1XFQA 5DF9A 1DP8A 3T50A 3T4QA 1KOUA 2M7VA 1NWZA 2W3HA 3RH8B 1YKDA 4O8GA 1TF1A 1DP9A 2VKSA 3A0SA 4LRZE 4O01A 3E98A 3OCLA 4R3AA 3VE4A 1IFQA 2EWVA 5EFWA 1UWNX 3OOVA 1TS6A 3EGDC 4G3VA 4PHTA 5TJJA 5HDDA 3S7NA 1MZUA 2P04A 2W3GA 4HIAA 5DJUA 2JKTM 3RFBA 4B93A 2PYRA 3F1NA 1P0ZA 2VA0A 2K7SA 1P9WA 4FOFA 5G4ZA 1MKMA 3K2NA 3PBNA 5AVFA 2IA2A 4UQIM 5J3WA 4I5SA 2XROA 2INWA 1GSXA 4AFIA 4HJ6A 4G3WA 1OT9A 2V0UA 2KX6A 4UQIS 3T4LA 1H8MA 1LT0A 4QPRA 3FPWA 1S66L 3B42A 2HV1A 4M4XA 2R78A 1T1BA 1DP6A 3PXPA 4ARZA 3KSFA 2OWJA 2PT7A 5HDCA 5IS1A 3U2AA 2O9BA 2P08A 2WKPA 5TBMA 3W2ZA 2OWHA 3MQ0A 3HJKA 4I3AA 4K08A 4I39A 4YOFA 2L0WA 3CLOA 4WF0A 5LBRA 2M7UA 2W1RA 3C8CA 3BW6A 3VE3A 1LL8A 3JVVA 3EGXC 1OT6A 2HJ9C 2HGVA 1OTIA 5J7EA 2B18A 2XRNA 5HDSA 2QJ5A 3UMDA 1GSWA 3ULFA 3KSHA 4MMNA 1F98A 2XA7M 4WN5A 2QKPA 4EESA 2LB5A 2L4RA 3CITA 3T4OA 4KUOA 3A0RA 2BASA 1XJ6A 3E4PA 3OLOA 2XA7S 3GECA 5KIZA 4ME4A 3P7NA 4WEKA 2NUPC 5IT5A 3H82B 3P01A 2A2LA 3NOUC 3T4TA 4Q0HA 1STZA 4NKPA 5HWWA 1YSQA 5CX7A 3D3OA 2K31A 4NXFA 3BY8A 4UEYA 1W63Q 4GW9A 2YKHA 2JHEA 1JNUA 5F68A 2JN7A 3PBQA 3NOTC 3UE3A 4E04A 4LRXC 1VB6A 4Y2FA 5HWVA 3UE6A 4JGRA 3IBRA 4JGPA 3EOIA 4PKYA 4B9OA 4YNRA 4EXOA 2PR5A 3FPVA 3NOPC 3SW1A 3V67A 2QWSA 3F1PB 2PD8A 1S4SA 5HD3A 3B47A 5AVEA 1XJ4A 5DJTA 2W27A 2MJ6A 3EEAA 1N9NA 3DBAA 4NXBA 1EW0A 2D01A 2HF6A 4L9EA 2QHKA 4P6ZM 3PBRA 4EERA 1TD5A 4MN7A 2VGLM 3BQ8A 3CUEC 5A8BA 2EA9A 4P6ZS 3MQQA 2JKRM 3TRCA 4EETB 1ZTUA 4HI4A 1XFNA 3E0YA 2VGLS 2KOIA 2ZBBA 2PHYA 3PBSA 3R7WA 2PYPA 3H9WA 3IS2B 2FH5A 5C5KA 3H82A 2ZMFA 2W1TB 4WL9A 3LR5A 1P97A 1OTDA 3EQUA 4RQ9A 3R4KA 4DJ3A 4HHDA 5F5YA 4NXEA 4CQHA 3TW8A 5DFXA 1V9YA 2O0YA 4HJ4A 3OCNA 4O0PA 2K2NA 2EWWA 4GS9B 1OJGA 2A24A 2VX8A 2JKRI 3F1PA 5HD5A 4IHQA 3EEHA 2M1CA 2NUTC 1OPXA 4DMZA 3MXQA 5L8MA 5HPFA 3PYPA 2JKTI 4HQAA 2YKFA 1T1CA 2VLGA 2Z6DA 2KLIA 4ZRRA 4ETZA 3E4QA 3KYZA 3MQOA 3TJZC 1YSPA 3CUEA 3MR0A 4MN5A 4CLCB 4DN0A 4BBTA 4HP9A 3PBTA 3S7OA 1N9LA 2G7UA 4EQ1A 3IS2A 4EU0A 4EEPA 3FC7A 2W1TA 4II7A 3B33A 4GLQA 4R38A 1XJ2A 1VHMA 2VV7A 3KO6A 4HNBA 4KQOA 2B02A 3ICYA 3LI8A 3KSGA 4PAUA 5KSHA 2W3FA 2VV8A 4CLCE 3RTYA 5HSQA 3F1OB 4L9FA 4GJ4A 1NRJA 1MC0A 4GS9A 1F5MA 4R70A 5FL3A 3C30A 1ZHHB 3OC2A 3OBFA 5DKLA 2OOLA 5F69A 3JVUA 2XSSA 3MJQA 4BWIA 1T18A 2VJWA 2ZMVA 3CWFA 2OAP1 4KQDA 3CI6A 5AJGA 5IU1A 3HCYA 2PR6A 4NXGA 3UB8A 3K3CA 1LSVA 1TS0A 2QJ7A 3UMEA 1S1ZA 1D7EA 3D72A 4HP4A 2H28A 1TS8A 2VV6A 1S1YA 4I3JA 4GCZA 3S7QA 3K3DA 1XJ3A 4PKYG 3HJIA 1NLZA 3A0VA 1Y28A 2GZAA 5DFYA 1G6OA 3PBOA 4HH2A 3LICA 4G3KA 3KSIA 4OOLA 4IJGA 5I5LA 3C2WA 2PD7A 1LSWA 4DJ2A 4WUJA 4BJPA 1P9RA 3H7WB 1GSVA 3LIBA 3F1OA 3UB7A 2O9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOI A;  5G4Y A;  5J4E A;  2ZOH A;  1N9O A;  3BY9 A;  4GHI B;  2WKR A;  3GDI A;  4I3I A;  3UB6 A;  1WA9 A;  2V9A A;  1X0O A;  4XT2 B;  1T19 A;  4HH3 A;  3NJA A;  4WLA A;  2PDR A;  3UB9 A;  3LID A;  1D06 A;  2WKQ A;  5F6A A;  1G28 A;  3ZQ5 A;  4LRY C;  4BBV A;  4F3L B;  4H6J B;  2KDK A;  4I38 A;  4YWZ A;  4HY8 A;  2J80 A;  1TS7 A;  1LSX A;  3H7W A;  3LYX A;  4LLO B;  3FG8 A;  4BBU A;  3BWL A;  3LI9 A;  2D02 A;  1UGU A;  4EEU A;  1BYW A;  1V9Z A;  2Z6C A;  4GHI A;  4R6L A;  4EW7 A;  2V0W A;  2CMN A;  2V1A A;  2P7J A;  1UWP X;  5HWT A;  1T1A A;  3MFX A;  4MN6 A;  1OTA A;  1S4R A;  4XT2 A;  1F9I A;  3E4O A;  4KUK A;  3VOL A;  3LIA A;  3EWK A;  1S67 L;  3LIF A;  2I9V A;  3F1N B;  1OTE A;  2GJ3 A;  4JGO A;  4JGQ A;  4L9G A;  3LIE A;  4HJ3 A;  2L1M A;  3NHQ A;  3G6O A;  5HZH A;  2V1B A;  3LUQ A;  1OTB A;  4LPZ A;  4HOI A;  1DRM A;  3KX0 X;  3CAX A;  2A24 B;  1OJ5 A;  3PHY A;  2W0N A;  4F3L A;  5DKK A;  4H6J A;  1ODV A;  5TBM B;  2VEA A;  1XFQ A;  1DP8 A;  3T50 A;  1KOU A;  1NWZ A;  3RH8 B;  1DP9 A;  3A0S A;  4LRZ E;  4R3A A;  3VE4 A;  5EFW A;  1UWN X;  1TS6 A;  5HDD A;  1MZU A;  4HIA A;  5DJU A;  2PYR A;  3F1N A;  1P0Z A;  2K7S A;  5G4Z A;  5AVF A;  5J3W A;  4I5S A;  2INW A;  1GSX A;  4HJ6 A;  1OT9 A;  2V0U A;  2KX6 A;  1LT0 A;  1S66 L;  2HV1 A;  4M4X A;  2R78 A;  1T1B A;  1DP6 A;  2OWJ A;  5HDC A;  5IS1 A;  2WKP A;  5TBM A;  2OWH A;  3HJK A;  4I3A A;  4K08 A;  4I39 A;  2L0W A;  3CLO A;  4WF0 A;  3C8C A;  3VE3 A;  1LL8 A;  1OT6 A;  1OTI A;  5J7E A;  5HDS A;  2QJ5 A;  3UMD A;  1GSW A;  3ULF A;  1F98 A;  4WN5 A;  2QKP A;  4EES A;  2L4R A;  4KUO A;  3A0R A;  2BAS A;  1XJ6 A;  3E4P A;  3OLO A;  3GEC A;  5KIZ A;  3P7N A;  3H82 B;  3NOU C;  5HWW A;  4NXF A;  3BY8 A;  4GW9 A;  2YKH A;  2JHE A;  1JNU A;  5F68 A;  2JN7 A;  3NOT C;  4E04 A;  4LRX C;  1VB6 A;  5HWV A;  3UE6 A;  4JGR A;  3IBR A;  4JGP A;  4PKY A;  4B9O A;  4EXO A;  2PR5 A;  3SW1 A;  3NOP C;  2QWS A;  3F1P B;  2PD8 A;  1S4S A;  5HD3 A;  5AVE A;  1XJ4 A;  5DJT A;  2W27 A;  1N9N A;  4NXB A;  1EW0 A;  2D01 A;  4L9E A;  2QHK A;  4EER A;  5A8B A;  2EA9 A;  3MQQ A;  4EET B;  4HI4 A;  1XFN A;  2ZBB A;  2PHY A;  2PYP A;  3H9W A;  3IS2 B;  3H82 A;  4WL9 A;  1P97 A;  1OTD A;  4RQ9 A;  4DJ3 A;  4HHD A;  5F5Y A;  4NXE A;  1V9Y A;  4HJ4 A;  4GS9 B;  1OJG A;  2A24 A;  3F1P A;  5HD5 A;  3EEH A;  2M1C A;  3MXQ A;  3PYP A;  4HQA A;  2YKF A;  1T1C A;  2VLG A;  2Z6D A;  3E4Q A;  3MQO A;  3MR0 A;  4MN5 A;  4BBT A;  4HP9 A;  1N9L A;  4EQ1 A;  3IS2 A;  4EEP A;  3FC7 A;  3B33 A;  4R38 A;  1XJ2 A;  2VV7 A;  4HNB A;  2B02 A;  3ICY A;  3LI8 A;  2VV8 A;  3RTY A;  5HSQ A;  3F1O B;  4L9F A;  4GS9 A;  4R70 A;  5DKL A;  2OOL A;  5F69 A;  3MJQ A;  1T18 A;  3CWF A;  4KQD A;  5IU1 A;  2PR6 A;  4NXG A;  3UB8 A;  3K3C A;  1LSV A;  1TS0 A;  2QJ7 A;  3UME A;  1S1Z A;  1D7E A;  3D72 A;  4HP4 A;  2H28 A;  1TS8 A;  2VV6 A;  1S1Y A;  4I3J A;  4GCZ A;  3K3D A;  1XJ3 A;  4PKY G;  3HJI A;  3A0V A;  1Y28 A;  4HH2 A;  3LIC A;  5I5L A;  3C2W A;  2PD7 A;  1LSW A;  4DJ2 A;  4WUJ A;  3H7W B;  1GSV A;  3LIB A;  3F1O A;  3UB7 A; 
#chains in the Genus database with same CATH topology
 4WEL A;  1PYY A;  1SKF A;  5CER A;  3HL9 A;  3OZH A;  3ZVW A;  1KE4 A;  3EQV A;  1K0K A;  1PFL A;  4GHI B;  3FV7 A;  3ZCZ A;  1IYQ A;  1K6S A;  2DCF A;  2O9A A;  3IXD A;  2ZL1 B;  5AQ9 A;  4HH3 A;  1MWS A;  3O5Y A;  3HLB A;  3MFD A;  1XP4 A;  3UN7 A;  3UB9 A;  2X02 A;  3LID A;  1W63 M;  1D06 A;  4P6B A;  3HLC A;  3IBJ A;  5KSC A;  4JXS A;  5AQ7 A;  4BLM A;  3N6I A;  5EVI D;  4F3L B;  1W79 A;  4H6J B;  2O99 A;  2KDK A;  3LR3 A;  3FKW A;  4IVI A;  5GLA A;  3H7W A;  3LYX A;  5AQA A;  3VOY A;  2WGI A;  2ACG A;  5F82 A;  4GD8 A;  1UGU A;  1NZO A;  3JYI A;  1AXB A;  4FCF A;  5CRF A;  3CMZ A;  5FQI A;  2Z6C A;  1TDG A;  4EW7 A;  3IH9 A;  4OPY A;  2W3D A;  5FI7 A;  1CI8 A;  3MFX A;  4ETX A;  5FQJ A;  1RGZ A;  5HL6 A;  2OAQ 1;  1QMF A;  2FZ0 A;  2ZC5 B;  3DTI A;  1M6K A;  3VV4 A;  2JCH A;  2GX5 A;  3C38 A;  3UB5 P;  1K4E A;  2EFU A;  2PAV P;  5DTK A;  1HZO A;  4R3J A;  4Z9Q A;  4Y0O A;  2VGJ A;  2BLS A;  1QME A;  3G31 A;  4MCW A;  1L0F A;  3NCK A;  1DRM A;  3CAX A;  3UO9 A;  1FOF A;  5DKK A;  1L0G A;  5EVI A;  3T4Q A;  1NWZ A;  3RH8 B;  1IYO A;  4O8G A;  3HLW A;  3NC8 A;  4LRZ E;  3Q7V A;  4RA7 A;  1ERO A;  4PM6 A;  3VE4 A;  1Z6F A;  4DF6 A;  4G3V A;  4KZ3 A;  3S7N A;  1MZU A;  3O86 A;  5DJU A;  2JKT M;  2Q0O A;  4B93 A;  1MBL A;  4MBF A;  5DF7 A;  5G4Z A;  1MKM A;  1KE3 A;  3PBN A;  5AVF A;  4UQI M;  2JKG A;  4I5S A;  3P09 A;  1GSX A;  2RL3 A;  4HJ6 A;  3HUO A;  2V0U A;  3MBZ A;  2HV1 A;  1FIK A;  1H8Y A;  4ARZ A;  4JF5 A;  2OWJ A;  2PT7 A;  3U2A A;  4FTX A;  2WGW B;  2Z2L B;  5TBM A;  2OWH A;  3I7J A;  3QP5 A;  1CQA A;  3VSK A;  1SDN A;  4I39 A;  4KQQ A;  3TG9 A;  3GRJ A;  5LBR A;  2W1R A;  3ZG8 B;  3QHY A;  1NYM A;  5CXW A;  3JVV A;  3NDE A;  2HGV A;  1OTI A;  3PAG A;  5HDS A;  1BLS A;  3UMD A;  3ULF A;  4MMN A;  3VFH A;  4JLF A;  5GHY A;  2J8Y A;  4FH4 A;  3A0R A;  3E4P A;  2Y2L A;  3ISG A;  3GEC A;  2IWB A;  5KIZ A;  4BD0 A;  3H82 B;  3T4T A;  1IEL A;  2PRF A;  1YSQ A;  3D3O A;  4LCM A;  5CTM A;  1RGY A;  4GW9 A;  3T12 B;  3DWZ A;  1JNU A;  3PBQ A;  5L2F A;  3O87 A;  5L09 A;  3BLM A;  4JGR A;  3LY4 A;  5FDS A;  1PWC A;  4GDN A;  4EXO A;  5BOH A;  3A3D A;  3F1P B;  2CC1 A;  5HD3 A;  3SOI A;  1XJ4 A;  2W27 A;  1CF0 A;  5HAR A;  3MKF A;  1EW0 A;  2HF6 A;  2E8J A;  3VOZ A;  2QHK A;  3NIA A;  4P6Z M;  4EER A;  2WGV A;  4OQI A;  1TD5 A;  2I72 A;  2V1Z A;  2FFY A;  5HL1 A;  2ZQ8 A;  2PHY A;  3R7W A;  4HES A;  1ZC2 A;  1PW1 A;  2ZMF A;  2W1T B;  4WL9 A;  1P97 A;  1MXO A;  3EQU A;  1YM1 A;  3R4K A;  2XK1 A;  3V3R A;  4ZBE A;  5FI2 A;  4CQH A;  3W4Q A;  3VSL A;  5GLD A;  3OCN A;  2K2N A;  5E2F A;  2A24 A;  3ITA A;  2C6W B;  1GCE A;  5EOO A;  2M1C A;  2NUT C;  4PM5 A;  2FFF B;  4EBN A;  5HPF A;  1IKG A;  5GHX A;  5CTN A;  1ZG4 A;  3N7W A;  4ESP A;  4X53 A;  3MZD A;  5J8X A;  4S2K A;  3Q07 A;  4JKT A;  4HBT A;  1FIL A;  3MR0 A;  5F83 A;  4CPK A;  2P9V A;  4BBT A;  3PBT A;  4EQ1 A;  3IS2 A;  4EEP A;  1IYS A;  2HDR A;  5A93 A;  2VV7 A;  5D3O A;  4PM9 A;  3SS3 A;  2B02 A;  1HTZ A;  1ES4 A;  1PZO A;  2XLN A;  3KSG A;  2W3F A;  1K4F A;  4DE0 A;  3Q7V B;  5HSQ A;  5DF8 A;  1ZHH B;  3OBF A;  4QHC A;  1AWI A;  2OOL A;  4EUZ A;  1XPB A;  3JVU A;  2XSS A;  4WBG A;  2VJW A;  2HZ5 A;  5AJG A;  5IU1 A;  2PR6 A;  1JWP A;  1TS0 A;  2P74 A;  3MS6 A;  2H28 A;  1TS8 A;  4GZB A;  4I3J A;  4B4Z A;  3ZNY A;  4DKI A;  4OH0 A;  2PU4 A;  3HJI A;  1YMX A;  5A91 A;  3VP1 A;  1BLP A;  1NZU A;  1Y28 A;  4N1X A;  2GZA A;  5M18 A;  3T1Q B;  3HLG A;  3KSI A;  4OOL A;  3C2W A;  4LGW A;  4UA9 A;  1LSW A;  4EBL A;  1P9R A;  2HP9 A;  1GSV A;  4EV4 A;  3LIB A;  1L3L A;  3OPP A;  4JPM A;  2Y79 A;  3AGE A;  1RCJ A;  4JXG A;  3M6B A;  1TEM A;  3WWX A;  1PWD A;  2VZW A;  3ZG0 A;  1S0W A;  2WKR A;  3GDI A;  4WEJ A;  1WA9 A;  4GD6 A;  2V9A A;  2VK3 A;  4XT2 B;  4WLA A;  2WAD A;  4GKU A;  4JF6 A;  3IXG A;  1PI4 A;  5CGX A;  1NLY A;  1G28 A;  3PR6 A;  4Q0I A;  4BBV A;  5EVI C;  4Y3I A;  4I38 A;  5EVE A;  4HY8 A;  1GHM A;  5TFQ A;  3SZT A;  4BBU A;  3BWL A;  4NEE D;  4OOM A;  5L07 A;  5KMW A;  4EEU A;  5HAQ A;  1V9Z A;  3BQA A;  1ZG6 A;  1IOU A;  2P7J A;  1UWP X;  3ITB A;  2EFX A;  1S6R A;  4KG2 A;  3R7W B;  1F9I A;  3E4O A;  4K91 A;  2ZC4 B;  2Y2G A;  1S67 L;  2Y2Q A;  5M19 A;  3WS2 A;  2GJ3 A;  4EQI A;  5TR7 A;  1I2S A;  4E3M A;  3A3F A;  3NHQ A;  1ACF A;  2WK0 A;  5K5B A;  2A24 B;  4MDZ A;  1OJ5 A;  4RYE A;  1BZA A;  5FQ9 A;  2HDS A;  3GVB A;  2QYB A;  3LCE A;  1ODV A;  2ZD8 A;  2VEA A;  1XFQ A;  1KOU A;  4C3Q A;  2W3H A;  4ZJ2 A;  1YKD A;  2JKF A;  4WMC D;  4LV1 A;  5CHJ A;  3V50 A;  3MXS A;  2EXA A;  5GLB A;  1YLJ A;  2EWV A;  3C5A A;  1SHV A;  3WRT A;  4LFU A;  1UWN X;  3SS5 A;  1TS6 A;  2Y2H A;  3EGD C;  4RX2 A;  5TJJ A;  4HIA A;  3RFB A;  3F1N A;  1GA0 A;  2Q9M A;  3P98 A;  2XR0 A;  4R1G A;  3K2N A;  4YIN A;  4GN2 A;  5J3W A;  4U0X A;  2INW A;  3QNB A;  3BFC A;  3IX4 A;  4QJG A;  2KX6 A;  4UQI S;  3T4L A;  3N8R A;  1H8M A;  4LV2 A;  2Q9N A;  4KG6 A;  2R78 A;  1LL5 A;  1T1B A;  3KSF A;  4U3T A;  3D4F A;  4OQH A;  2O9B A;  4DRT A;  3WS0 A;  2WKP A;  3W2Z A;  3MQ0 A;  4KG5 A;  4MBH A;  4K08 A;  4YOF A;  3CLO A;  4N9L A;  4U0T A;  2M7U A;  3OPL A;  3GMW A;  4Y15 A;  4WMC A;  1LL8 A;  3A3J A;  2Z2M B;  5J7E A;  2G2W A;  4QY6 A;  3Q1F A;  2QJ5 A;  1KDS A;  4P0M A;  3KSH A;  1W5D A;  2X01 A;  2XD5 A;  4ID4 A;  2XA7 M;  3E2L A;  2LB5 A;  2L4R A;  3CIT A;  1K57 C;  4Y17 A;  3T4O A;  3N8S A;  4JXW A;  3HLF A;  1XJ6 A;  4X55 A;  1L0D A;  1C3B A;  5CED A;  4E3L A;  5FEF A;  1SKO A;  3BRM A;  3VP0 A;  4KZ8 A;  4WEK A;  2NUP C;  2JBF A;  4LEN A;  3ZVT A;  1H5X A;  3RXX A;  4WZ5 A;  4NKP A;  5HWW A;  2HDQ A;  4UEY A;  5F68 A;  1KVL A;  2J7V A;  3NOT C;  4HEF A;  4A5R A;  2ZQA A;  4OLG A;  5GLC A;  3RJU A;  2BG1 A;  3IBR A;  1K54 A;  4YNR A;  2PR5 A;  2VGK A;  3ZGA B;  1VEU B;  4E3N A;  4S2O A;  2PD8 A;  5FAQ A;  4OP8 A;  3B47 A;  2JC7 A;  3S1Y A;  3IHB A;  4WM9 A;  3EEA A;  1W7F A;  4NG2 A;  3PBR A;  2J9O A;  1KGF A;  3G2Y A;  3O3V A;  4MN7 A;  2VGL M;  3FWL A;  3BQ8 A;  3M6H A;  4ZTK A;  4P6Z S;  3MQQ A;  4KZ9 A;  4EET B;  4HI4 A;  3Q7Z A;  1XFN A;  4GB7 A;  5F1F A;  2PYP A;  1LI0 A;  2FH5 A;  4JXV A;  1OTD A;  4DJ3 A;  4HHD A;  5DFX A;  4DE3 A;  3JPU A;  4QB8 A;  3BFD A;  2G2U A;  1MWT A;  2EX8 A;  2R9W A;  2ZM8 A;  5HD5 A;  2UWX A;  4IHQ A;  3EEH A;  5HFO A;  1YLW A;  4GDB A;  4X1M A;  3MXQ A;  5EOE A;  4DMZ A;  4HQA A;  2YKF A;  4Y0U A;  3LEZ A;  1MWR A;  1ALQ A;  4ZRR A;  5G18 A;  1N9B A;  3PAE A;  4DDS A;  3MQO A;  3IF6 A;  2Y2K A;  1PRQ A;  1GA9 A;  4MN5 A;  4DN0 A;  3IT9 A;  1N9L A;  2G7U A;  3FYZ A;  5EV0 A;  3V39 A;  3VP2 A;  3B33 A;  1XA1 A;  5CGW A;  1VHM A;  3KO6 A;  4HNB A;  4E3O A;  1IYP A;  5JYO A;  4M3K A;  4OKP A;  3ICY A;  3LI8 A;  1NRF A;  5KSH A;  5TGF A;  1YLY A;  4E6W A;  1KGG A;  3F1O B;  4L9F A;  4GJ4 A;  4GS9 A;  1E25 A;  1MC0 A;  1F5M A;  3UDX A;  4ZJ3 A;  1BTL A;  4C6Y A;  4MNR A;  3OC2 A;  4FH2 A;  4C75 A;  5F69 A;  4BWI A;  1LL9 A;  1NY0 A;  2ZMV A;  2OAP 1;  3GV9 A;  3K3C A;  2V20 A;  3MXR A;  3D72 A;  3G4P A;  3UPP A;  3S7Q A;  3K3D A;  2V8F A;  3S4X A;  4PKY G;  4OQG A;  5DTS A;  5DVA A;  3A0V A;  4XXR A;  2XGN A;  4G3K A;  1E4D A;  2XDM A;  3Q81 A;  5HAP A;  3BFF A;  1PW8 A;  5EVL A;  3H7W B;  4S2L A;  4S2N A;  2O9C A;  4BMW A;  2ZOI A;  4IUK A;  5G4Y A;  1LI9 A;  3V5M A;  1JVJ A;  3BY9 A;  1ONH A;  3G34 A;  1BLH A;  1YAX A;  1F2K A;  4Z1W A;  3MF0 A;  3DWK A;  1X0O A;  1VET A;  1SKO B;  3T4J A;  4OP5 A;  2WZX A;  3CPT A;  2PDR A;  2ZQD A;  1M40 A;  5MC7 A;  3U4L P;  2ZC6 B;  3HUN A;  4LRY C;  4R3B A;  5FQK A;  4CLC D;  1G68 A;  1WE4 A;  2V8C A;  2RCX A;  3WS1 A;  4YWZ A;  5EVI B;  1XGJ A;  1Y4O A;  1MWU A;  4CJN A;  3VFF A;  3ZG7 B;  3LI9 A;  4KQR A;  2D02 A;  4L0L A;  2GDN A;  3CZD A;  4Y5F A;  4NET A;  4Y13 A;  1BUL A;  2XF3 A;  3LO7 A;  3BYD A;  4QY5 A;  4GHI A;  4R6L A;  3QP6 A;  2V0W A;  2CMN A;  2V1A A;  5HWT A;  1T1A A;  3SH7 A;  4MN6 A;  5E2H A;  2AVX A;  1OTA A;  1S4R A;  2GNX A;  3S7P A;  2WKH A;  2ZL1 A;  3LR0 A;  2W3E A;  4KUK A;  3VOL A;  1DJC A;  2H5S A;  1FR1 A;  4JGQ A;  3N4I A;  3BFE A;  3LIE A;  4OOY A;  5E43 A;  2Y59 A;  4KZA A;  2J3T D;  5GL9 A;  3M2K A;  3LUQ A;  1OTB A;  4P85 A;  4HOI A;  4LV3 A;  4CLC A;  4KZ5 A;  3PHY A;  3BM6 A;  2W0N A;  4ARZ B;  4F3L A;  4HBU A;  5FAO A;  4H6J A;  4QWO A;  2ZM2 A;  2ZJ9 A;  2V2F F;  1E3U D;  5TBM B;  3QNC A;  5DF9 A;  1DP8 A;  1IEM A;  5EEC A;  2M7V A;  5I94 A;  1DP9 A;  2ZQC A;  2Y91 A;  2H0Y A;  2Y55 A;  4O01 A;  3VP3 A;  3E98 A;  5FEG A;  3HUM A;  4R3A A;  3TSG A;  1U60 A;  3IX3 A;  4DE2 A;  3OOV A;  4IBR A;  1H0M A;  3HRE A;  5HDD A;  4KZ6 A;  3CHW P;  3W4P A;  2X71 A;  3L7H A;  4KZ7 A;  2PYR A;  4QD4 A;  4IBX A;  2K7S A;  3UDF A;  4FOF A;  4PMA A;  5E2G A;  4WZ5 C;  5FQM A;  2IA2 A;  1ONG A;  2OLU A;  4S2I A;  4Q8I A;  1FCM A;  1S66 L;  5F1G A;  4M4X A;  4S2P A;  3UY6 A;  3PXP A;  4PM8 A;  2B5R A;  5HDC A;  5IS1 A;  1NYY A;  1ESU A;  3VP4 A;  1K54 C;  2P08 A;  4OVD A;  4WZ4 A;  4D60 A;  1E3U A;  3GQZ A;  5FAS A;  2Y2I A;  3ZG5 A;  3C8C A;  3BW6 A;  1RP5 A;  5E2E A;  2OLV A;  4OPR A;  4XUX A;  1OT6 A;  2B18 A;  2XRN A;  3NUL A;  1FCO A;  4Y0T A;  4E3I A;  4WN5 A;  2QKP A;  3UE1 A;  3C7U A;  3OLO A;  2XA7 S;  4ME4 A;  3P7N A;  5FDH A;  2A2L A;  1YPR A;  1STZ A;  3BY8 A;  2XD1 A;  2XFT A;  2JHE A;  3UE3 A;  4E04 A;  4EBP A;  4LRX C;  3MZE A;  1TVF A;  2UV0 E;  2WGW A;  4Y2F A;  4JGP A;  4S2M A;  3SW1 A;  1YQS A;  3V67 A;  2QWS A;  5HW3 A;  1S4S A;  2ZC3 B;  5AVE A;  1K6R A;  3IXB A;  5EM0 A;  2MJ6 A;  2D01 A;  4L9E A;  4ZDX A;  3SH9 A;  1Q2P A;  2ZQ7 A;  1D1J A;  1CJF A;  3LEQ A;  3IF6 C;  1K55 A;  3LGO A;  4PM7 A;  1GHP A;  2JKR M;  3AGF A;  1ZTU A;  2Y2O A;  3WS4 A;  5GHZ A;  2VGL S;  2P9V B;  3HLD A;  2Y4A A;  5JYP A;  3IS2 B;  3H82 A;  5HAI A;  3LR5 A;  4MLL A;  2C5W B;  1DY6 A;  5U47 A;  2H10 A;  4K0X A;  1JWZ A;  1V9Y A;  3D9Y A;  1HVB A;  4R4R A;  1ERQ A;  3G30 A;  4O0P A;  1WYC A;  1EI5 A;  1CEG A;  5L10 A;  3HLE A;  1ERM A;  1PZP A;  1XX2 A;  3F1P A;  1Q2Q A;  2QPN A;  4R4S A;  1J3W A;  1W8Y A;  4ZAM A;  2BTF P;  5L8M A;  3PYP A;  2JKT I;  1SCW A;  3A3I A;  1H8Z A;  2VLG A;  3N8L A;  3DTK A;  1CEF A;  3IH8 A;  3KYZ A;  2Y2P A;  3TJZ C;  1YSP A;  3CUE A;  3T1S A;  4CLC B;  4HP9 A;  5CEB A;  1YLT A;  5M1A A;  3DTM A;  2W1T A;  4II7 A;  4GLQ A;  4RVA A;  3FKV A;  4R38 A;  4S2N C;  4KQO A;  2PBY A;  3G35 A;  3C4O A;  4PAU A;  2VV8 A;  4FUW A;  4LCL A;  1NRJ A;  4MEZ A;  3MKE A;  5FL3 A;  3C30 A;  4UAA A;  3VMA A;  5DKL A;  4LV0 A;  4UA6 A;  1T18 A;  1VM1 A;  3CWF A;  4KQD A;  3CI6 A;  1LSV A;  2HPB A;  2QJ7 A;  3O88 A;  1ESI A;  1D7E A;  4BEN A;  2VV6 A;  1S1Y A;  1YT4 A;  4GCZ A;  2WKE A;  2ZQ9 A;  2E8I A;  1L2S A;  2EXB A;  1K25 A;  3DAV A;  4OQ0 A;  1NLZ A;  4N92 A;  4PPR A;  3NDG A;  2WAE A;  3NBL A;  4IJG A;  2QZ6 A;  4E6X A;  1PI5 A;  3NI9 A;  4DJ2 A;  4WUJ A;  4BJP A;  2IWD A;  3IWQ A;  3IXH A;  4D2O A;  2DRW A;  4X6T A;  3KYQ A;  3GR2 A;  3T4K A;  5J4E A;  2ZOH A;  1N9O A;  1YLP A;  4NK3 A;  1W8Q A;  3ZG9 B;  3T4S A;  4I3I A;  3UB6 A;  1HLU P;  4N1H A;  1T19 A;  1MY8 A;  5CHU A;  4EUV A;  3NJA A;  5A92 A;  5FA7 A;  3NEC A;  4JBF A;  3SS4 A;  2PU2 A;  2WKQ A;  5DTT A;  5F6A A;  3ZQ5 A;  2J3W A;  1DJB A;  1MPL A;  4CLC C;  2EX6 A;  2PBD P;  4IUH A;  1GHI A;  3LFV A;  3HBR A;  1KGE A;  2ZM0 A;  4DDY A;  2HJE A;  3B3X A;  3L9K A;  2J80 A;  1TS7 A;  1LSX A;  1H3Q A;  4LLO B;  3FG8 A;  1K38 A;  4BD1 A;  1CI9 A;  2Y8H A;  5FSR A;  3DTE A;  2LB9 A;  4IVK A;  1BYW A;  1Y54 A;  3ZYT A;  3TE8 A;  3E2K A;  2JE5 A;  3BJN A;  4XT2 A;  2XEP A;  2DMW A;  4FSF A;  3OPR A;  4F94 A;  4OPQ A;  5HPI A;  3W8K A;  4Q0J A;  3LIA A;  1XKZ A;  3EWK A;  3LIF A;  2I9V A;  3F1N B;  4DXB A;  1OTE A;  4O7D A;  3MMH A;  1SZV A;  4JGO A;  3QP4 A;  4L9G A;  4JF4 A;  1O7E A;  4HJ3 A;  1TDL A;  2L1M A;  3LR4 A;  2J3T C;  4H8R A;  3G6O A;  5HZH A;  2V1B A;  4R0Q A;  1XGI A;  3G2Z A;  3IF5 A;  4LPZ A;  3KX0 X;  4N9K A;  4RX3 A;  2HP6 A;  3WS5 A;  1JTD A;  1ES2 A;  4X1L A;  3T50 A;  5IHV A;  1TF1 A;  1FSY A;  5EE8 A;  2VKS A;  1G5U A;  1ZKJ A;  2H0T A;  2WKI A;  3A0S A;  5CEC A;  1LHY A;  3ZFZ A;  2HP5 A;  3GSG A;  4OON A;  2OSU A;  3OCL A;  1YLZ A;  1KVM A;  4BL3 A;  1IFQ A;  3BEB A;  5EFW A;  1K57 A;  1FCN A;  4PHT A;  1I2W A;  4B88 A;  5A90 A;  1FQG A;  5CHM A;  3IQA A;  2P04 A;  2W3G A;  3BEC A;  3S22 A;  4X25 A;  4WYY A;  1P0Z A;  2VA0 A;  1P9W A;  3SH8 A;  4E3K A;  4YFM A;  2R9X A;  4S2J A;  4UA7 A;  2XRO A;  4AFI A;  1L0E A;  2ZMA A;  4G3W A;  3C7V A;  1OT9 A;  4P87 A;  1LT0 A;  4QPR A;  1LLB A;  3FPW A;  3B42 A;  2EX9 A;  1DP6 A;  1ES3 A;  4GOG A;  4FD8 A;  3HJK A;  4KZ4 A;  4I3A A;  4KZB A;  4IED A;  1ES5 A;  3GTC A;  1IKI A;  1I5Q A;  5CGS A;  2L0W A;  4WF0 A;  1PWG A;  3MZF A;  3VE3 A;  4KEN B;  3EGX C;  2HJ9 C;  4K0W A;  1KDW A;  2HDU A;  1FSW A;  4X56 A;  3C4P A;  1GSW A;  1K55 C;  5HX9 A;  5FAT A;  1F98 A;  2XQZ A;  1KE0 A;  4EES A;  4KUO A;  2BAS A;  3W4O A;  1MKI A;  2OV5 A;  1BT5 A;  4EWF A;  5KZH A;  3IWO A;  2Y2J A;  5IT5 A;  3P01 A;  2QMI A;  3NOU C;  4Q0H A;  5CX7 A;  2K31 A;  4NXF A;  3NY4 A;  1W63 Q;  2YKH A;  1N4O A;  1JTG A;  2JN7 A;  5EM1 A;  1VB6 A;  3IX8 A;  5HWV A;  4OPZ A;  5EUA A;  3UE6 A;  1XXM A;  4PKY A;  3EOI A;  4B9O A;  1NJ4 A;  3Q82 A;  3FPV A;  3NOP C;  2EX2 A;  1JWV A;  2XFS A;  5DJT A;  1BSG A;  3QP2 A;  2A49 A;  2ZC7 A;  4X69 A;  1BUE A;  1SDE A;  4NXB A;  1N9N A;  3DBA A;  2XH9 A;  3M2J A;  3WRZ A;  1K56 D;  3CUE C;  5A8B A;  2EA9 A;  4X68 A;  3KYE A;  3TRC A;  3HVF A;  3IF6 B;  1BLC A;  3BLS A;  3E0Y A;  2KOI A;  4GNU A;  1OME A;  2ZBB A;  3AGD A;  3PBS A;  3H9W A;  3IHA A;  3UNW A;  4MBK A;  5C5K A;  5EPH A;  2J9P A;  1A0K A;  1XA7 A;  3G32 A;  2WZZ A;  1HD8 A;  1PIO A;  4RQ9 A;  4BQM A;  3TOI A;  5F5Y A;  4NXE A;  3TW8 A;  2O0Y A;  4HJ4 A;  2EWW A;  4GS9 B;  1OJG A;  4QU3 A;  4R23 A;  3UPO A;  3PTE A;  2VX8 A;  2JKR I;  3RXW A;  1VEU A;  2DNS A;  3T1X A;  2A3U A;  1EWZ A;  1OPX A;  4DE1 A;  4BL2 A;  1T1C A;  2Z6D A;  3DW0 A;  2Y2M A;  2KLI A;  3V3S A;  4ETZ A;  3E4Q A;  1K56 A;  1YMS A;  1WYB A;  3QP1 A;  3S7O A;  4EU0 A;  4Y7P A;  3UPN A;  2Y2N A;  3FC7 A;  5AQB A;  3ZDJ A;  3CJM A;  1XJ2 A;  5FAP A;  4E3J A;  1FR6 A;  4CLC E;  3RTY A;  4R70 A;  4OLD A;  3IWI A;  3ZNT A;  3BFG A;  2WYX A;  3MJQ A;  2WUQ A;  2B95 A;  1J9M A;  3MSH A;  3T1R A;  3HCY A;  3UB8 A;  4NXG A;  3LY3 A;  1O07 A;  1NXY A;  3UME A;  1CK3 A;  1S1Z A;  4HP4 A;  3UE0 A;  1VET B;  3ZHH A;  1Z09 A;  3CPT B;  3OPH A;  1PNE A;  4XUZ A;  4B4X A;  1G6A A;  1XJ3 A;  3A3E A;  3QP8 A;  2ZLY A;  4ZJ1 A;  5DFY A;  1G6O A;  3PBO A;  4HH2 A;  3LIC A;  5FI6 A;  2WAF A;  3CG5 A;  5I5L A;  4UHU A;  2PD7 A;  1VQQ A;  3UDI A;  3F1O A;  3UB7 A;  1DJA A;  5FQQ A;  4DXC A;  3FZC A;  2IWC A; 
#chains in the Genus database with same CATH homology
 4WEL A;  2Y79 A;  3KYQ A;  2ZOI A;  4IUK A;  3T4K A;  5G4Y A;  5J4E A;  2ZOH A;  3EQV A;  1N9O A;  3BY9 A;  4GHI B;  1YAX A;  4Z1W A;  2VZW A;  2WKR A;  3T4S A;  2O9A A;  3GDI A;  3MF0 A;  4I3I A;  3UB6 A;  4WEJ A;  1WA9 A;  2V9A A;  1X0O A;  4XT2 B;  3T4J A;  1T19 A;  4HH3 A;  3O5Y A;  4EUV A;  3NJA A;  4WLA A;  2PDR A;  3UB9 A;  5MC7 A;  3LID A;  1W63 M;  1D06 A;  2WKQ A;  5F6A A;  1NLY A;  1G28 A;  3IBJ A;  3PR6 A;  4Q0I A;  3ZQ5 A;  2J3W A;  4LRY C;  4CLC D;  4CLC C;  4BBV A;  4IUH A;  4Y3I A;  3LFV A;  4F3L B;  4H6J B;  2O99 A;  2KDK A;  3LR3 A;  4I38 A;  4YWZ A;  2HJE A;  4HY8 A;  2J80 A;  1TS7 A;  1LSX A;  3H7W A;  1H3Q A;  3LYX A;  4LLO B;  3FG8 A;  4BBU A;  3BWL A;  3LI9 A;  4NEE D;  2D02 A;  4L0L A;  4OOM A;  4Y5F A;  1UGU A;  2Y8H A;  4EEU A;  2LB9 A;  1BYW A;  1V9Z A;  2Z6C A;  3BQA A;  4GHI A;  4R6L A;  4BMW A;  4EW7 A;  3ZYT A;  1IOU A;  2W3D A;  2V0W A;  2CMN A;  2V1A A;  2P7J A;  1UWP X;  3TE8 A;  5HWT A;  1T1A A;  3MFX A;  4MN6 A;  4ETX A;  1OTA A;  1S4R A;  2GNX A;  3S7P A;  3LR0 A;  3BJN A;  4XT2 A;  2W3E A;  1F9I A;  2DMW A;  3E4O A;  4FSF A;  4KUK A;  5HL6 A;  3R7W B;  5HPI A;  4Q0J A;  2OAQ 1;  3VOL A;  2FZ0 A;  3EWK A;  3LIA A;  1S67 L;  3VV4 A;  2GX5 A;  3LIF A;  2I9V A;  3F1N B;  1OTE A;  3C38 A;  3MMH A;  2GJ3 A;  4JGO A;  4JGQ A;  4L9G A;  3LIE A;  4HJ3 A;  2L1M A;  3LR4 A;  2J3T D;  2J3T C;  3NHQ A;  3G6O A;  4MCW A;  5HZH A;  2V1B A;  3LUQ A;  1OTB A;  4LPZ A;  4HOI A;  1DRM A;  3KX0 X;  5K5B A;  3CAX A;  2A24 B;  4MDZ A;  4CLC A;  1OJ5 A;  3PHY A;  2W0N A;  4ARZ B;  4F3L A;  5DKK A;  4H6J A;  2QYB A;  1ODV A;  5TBM B;  2VEA A;  1XFQ A;  5DF9 A;  1DP8 A;  3T50 A;  3T4Q A;  1KOU A;  2M7V A;  1NWZ A;  2W3H A;  3RH8 B;  1YKD A;  4O8G A;  1TF1 A;  1DP9 A;  2VKS A;  3A0S A;  4LRZ E;  4O01 A;  3E98 A;  3OCL A;  4R3A A;  3VE4 A;  1IFQ A;  2EWV A;  5EFW A;  1UWN X;  3OOV A;  1TS6 A;  3EGD C;  4G3V A;  4PHT A;  5TJJ A;  5HDD A;  3S7N A;  1MZU A;  2P04 A;  2W3G A;  4HIA A;  5DJU A;  2JKT M;  3RFB A;  4B93 A;  2PYR A;  3F1N A;  1P0Z A;  2VA0 A;  2K7S A;  1P9W A;  4FOF A;  5G4Z A;  1MKM A;  3K2N A;  3PBN A;  5AVF A;  2IA2 A;  4UQI M;  5J3W A;  4I5S A;  2XRO A;  2INW A;  1GSX A;  4AFI A;  4HJ6 A;  4G3W A;  1OT9 A;  2V0U A;  2KX6 A;  4UQI S;  3T4L A;  1H8M A;  1LT0 A;  4QPR A;  3FPW A;  1S66 L;  3B42 A;  2HV1 A;  4M4X A;  2R78 A;  1T1B A;  1DP6 A;  3PXP A;  4ARZ A;  3KSF A;  2OWJ A;  2PT7 A;  5HDC A;  5IS1 A;  3U2A A;  2O9B A;  2P08 A;  2WKP A;  5TBM A;  3W2Z A;  2OWH A;  3MQ0 A;  3HJK A;  4I3A A;  4K08 A;  4I39 A;  4YOF A;  2L0W A;  3CLO A;  4WF0 A;  5LBR A;  2M7U A;  2W1R A;  3C8C A;  3BW6 A;  3VE3 A;  1LL8 A;  3JVV A;  3EGX C;  1OT6 A;  2HJ9 C;  2HGV A;  1OTI A;  5J7E A;  2B18 A;  2XRN A;  5HDS A;  2QJ5 A;  3UMD A;  1GSW A;  3ULF A;  3KSH A;  4MMN A;  1F98 A;  2XA7 M;  4WN5 A;  2QKP A;  4EES A;  2LB5 A;  2L4R A;  3CIT A;  3T4O A;  4KUO A;  3A0R A;  2BAS A;  1XJ6 A;  3E4P A;  3OLO A;  2XA7 S;  3GEC A;  5KIZ A;  4ME4 A;  3P7N A;  4WEK A;  2NUP C;  5IT5 A;  3H82 B;  3P01 A;  2A2L A;  3NOU C;  3T4T A;  4Q0H A;  1STZ A;  4NKP A;  5HWW A;  1YSQ A;  5CX7 A;  3D3O A;  2K31 A;  4NXF A;  3BY8 A;  4UEY A;  1W63 Q;  4GW9 A;  2YKH A;  2JHE A;  1JNU A;  5F68 A;  2JN7 A;  3PBQ A;  3NOT C;  3UE3 A;  4E04 A;  4LRX C;  1VB6 A;  4Y2F A;  5HWV A;  3UE6 A;  4JGR A;  3IBR A;  4JGP A;  3EOI A;  4PKY A;  4B9O A;  4YNR A;  4EXO A;  2PR5 A;  3FPV A;  3NOP C;  3SW1 A;  3V67 A;  2QWS A;  3F1P B;  2PD8 A;  1S4S A;  5HD3 A;  3B47 A;  5AVE A;  1XJ4 A;  5DJT A;  2W27 A;  2MJ6 A;  3EEA A;  1N9N A;  3DBA A;  4NXB A;  1EW0 A;  2D01 A;  2HF6 A;  4L9E A;  2QHK A;  4P6Z M;  3PBR A;  4EER A;  1TD5 A;  4MN7 A;  2VGL M;  3BQ8 A;  3CUE C;  5A8B A;  2EA9 A;  4P6Z S;  3MQQ A;  2JKR M;  3TRC A;  4EET B;  1ZTU A;  4HI4 A;  1XFN A;  3E0Y A;  2VGL S;  2KOI A;  2ZBB A;  2PHY A;  3PBS A;  3R7W A;  2PYP A;  3H9W A;  3IS2 B;  2FH5 A;  5C5K A;  3H82 A;  2ZMF A;  2W1T B;  4WL9 A;  3LR5 A;  1P97 A;  1OTD A;  3EQU A;  4RQ9 A;  3R4K A;  4DJ3 A;  4HHD A;  5F5Y A;  4NXE A;  4CQH A;  3TW8 A;  5DFX A;  1V9Y A;  2O0Y A;  4HJ4 A;  3OCN A;  4O0P A;  2K2N A;  2EWW A;  4GS9 B;  1OJG A;  2A24 A;  2VX8 A;  2JKR I;  3F1P A;  5HD5 A;  4IHQ A;  3EEH A;  2M1C A;  2NUT C;  1OPX A;  4DMZ A;  3MXQ A;  5L8M A;  5HPF A;  3PYP A;  2JKT I;  4HQA A;  2YKF A;  1T1C A;  2VLG A;  2Z6D A;  2KLI A;  4ZRR A;  4ETZ A;  3E4Q A;  3KYZ A;  3MQO A;  3TJZ C;  1YSP A;  3CUE A;  3MR0 A;  4MN5 A;  4CLC B;  4DN0 A;  4BBT A;  4HP9 A;  3PBT A;  3S7O A;  1N9L A;  2G7U A;  4EQ1 A;  3IS2 A;  4EU0 A;  4EEP A;  3FC7 A;  2W1T A;  4II7 A;  3B33 A;  4GLQ A;  4R38 A;  1XJ2 A;  1VHM A;  2VV7 A;  3KO6 A;  4HNB A;  4KQO A;  2B02 A;  3ICY A;  3LI8 A;  3KSG A;  4PAU A;  5KSH A;  2W3F A;  2VV8 A;  4CLC E;  3RTY A;  5HSQ A;  3F1O B;  4L9F A;  4GJ4 A;  1NRJ A;  1MC0 A;  4GS9 A;  1F5M A;  4R70 A;  5FL3 A;  3C30 A;  1ZHH B;  3OC2 A;  3OBF A;  5DKL A;  2OOL A;  5F69 A;  3JVU A;  2XSS A;  3MJQ A;  4BWI A;  1T18 A;  2VJW A;  2ZMV A;  3CWF A;  2OAP 1;  4KQD A;  3CI6 A;  5AJG A;  5IU1 A;  3HCY A;  2PR6 A;  4NXG A;  3UB8 A;  3K3C A;  1LSV A;  1TS0 A;  2QJ7 A;  3UME A;  1S1Z A;  1D7E A;  3D72 A;  4HP4 A;  2H28 A;  1TS8 A;  2VV6 A;  1S1Y A;  4I3J A;  4GCZ A;  3S7Q A;  3K3D A;  1XJ3 A;  4PKY G;  3HJI A;  1NLZ A;  3A0V A;  1Y28 A;  2GZA A;  5DFY A;  1G6O A;  3PBO A;  4HH2 A;  3LIC A;  4G3K A;  3KSI A;  4OOL A;  4IJG A;  5I5L A;  3C2W A;  2PD7 A;  1LSW A;  4DJ2 A;  4WUJ A;  4BJP A;  1P9R A;  3H7W B;  1GSV A;  3LIB A;  3F1O A;  3UB7 A;  2O9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...