4HNBA

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
176
Chain Sequence
MDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
molecule keywords LOV protein
total genus 54
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hnbA00
2KX6A 5HWVA 5IS1A 4I3IA 4JGQA 2J80A 3A0VA 3E4PA 3NOUC 4BBUA 4EESA 2KDKA 3F1NB 4HP9A 5HDSA 4NXBA 4EW7A 4NXEA 3SW1A 2VV8A 1D06A 4GHIB 1LSVA 3G6OA 1S67L 1X0OA 2QHKA 4WF0A 1GSXA 5G4ZA 3F1NA 1V9ZA 2PHYA 3IBRA 4XT2B 5IU1A 1TS7A 4E04A 2VV6A 3LIEA 4R6LA 1BYWA 1DP8A 1Y28A 2W27A 3H9WA 3H7WB 4HQAA 4I38A 3ULFA 4GW9A 3K3CA 3LIBA 3MFXA 5DKLA 4L9GA 4EETB 3F1PA 4HP4A 1S1ZA 3CLOA 4LRZE 4H6JA 3E4QA 1OTAA 3A0SA 3RTYA 1OTEA 3T50A 3ICYA 3KX0X 3H7WA 3C8CA 1N9NA 4HOIA 4L9FA 4PKYA 2INWA 3LIFA 3RH8B 1XFQA 1DRMA 3BWLA 1P0ZA 3MJQA 4R38A 4HH3A 3D72A 1S1YA 1VB6A 4R70A 4F3LA 5HD3A 1S4RA 3IS2A 3NOTC 4GS9B 2EA9A 2A24A 1T1BA 5HZHA 1UWNX 2YKFA 1N9LA 2L4RA 2WKQA 2OOLA 3LICA 3LYXA 1T19A 1UWPX 3P7NA 1G28A 4HI4A 2P7JA 2WKRA 4WLAA 1OJGA 3UB8A 2PD7A 1NWZA 4JGOA 4EEUA 5J7EA 2Z6DA 1S66L 4HJ3A 5I5LA 3UMEA 4HHDA 1S4SA 2JN7A 3NJAA 4H6JB 2V1BA 3UMDA 2ZOIA 4BBTA 1T1AA 5J3WA 3EWKA 2QJ5A 5J4EA 3F1OB 5TBMB 4HNBA 2V9AA 1P97A 1MZUA 1WA9A 2QWSA 4L9EA 3UB7A 3A0RA 3PYPA 1T18A 3MXQA 2WKPA 2V0UA 3LIAA 3MQQA 3FG8A 4HIAA 4JGRA 3MR0A 4GCZA 4MN5A 1OT9A 3K3DA 4R3AA 5HD5A 1OTBA 1T1CA 4WL9A 2M1CA 3C2WA 2CMNA 5HSQA 4NXFA 2V1AA 1ODVA 2L1MA 2PR6A 2QJ7A 3GDIA 2I9VA 1XJ4A 5AVEA 5HWWA 2PD8A 3F1OA 3VE3A 2YKHA 3BY9A 4I3JA 4I3AA 4LLOB 4WUJA 1XJ2A 4I39A 1F9IA 3VOLA 1OJ5A 2HV1A 1F98A 3ZQ5A 1XJ6A 2B02A 2Z6CA 3NHQA 4HJ6A 4RQ9A 1GSWA 2GJ3A 5HDCA 1OTIA 2R78A 3BY8A 3HJIA 2PR5A 2VEAA 4KUKA 3LI8A 4XT2A 2A24B 3CWFA 4WN5A 4EERA 1OT6A 4EQ1A 4EXOA 2L0WA 4EEPA 4F3LB 4HH2A 2OWHA 4MN6A 3LUQA 2V0WA 3CAXA 2VLGA 5HWTA 4LPZA 3UB9A 2D02A 1KOUA 3PHYA 2OWJA 1LSXA 3B33A 3UE6A 3H82A 4NXGA 2PDRA 1TS8A 4LRXC 5DJUA 2K7SA 1OTDA 5AVFA 4KUOA 1LL8A 1V9YA 3GECA 1XFNA 4HY8A 4M4XA 3LIDA 3MQOA 1DP9A 3E4OA 1EW0A 1UGUA 2ZOHA 4K08A 1XJ3A 2ZBBA 3F1PB 1D7EA 5A8BA 3VE4A 2W0NA 3H82B 4PKYG 5F68A 3IS2B 2QKPA 3EEHA 2JHEA 5G4YA 2H28A 3LI9A 4BBVA 4B9OA 4DJ3A 5HDDA 4YWZA 1JNUA 4GS9A 1DP6A 4HJ4A 4LRYC 5DKKA 1TS6A 2VV7A 3NOPC 1LSWA 4GHIA 4I5SA 3FC7A 5F5YA 3UB6A 1TS0A 2BASA 1LT0A 2PYRA 2D01A 4DJ2A 5DJTA 3OLOA 2PYPA 5EFWA 5TBMA 5F69A 3HJKA 4KQDA 4JGPA 1N9OA 5KIZA 1GSVA 5F6AA
chains in the Genus database with same CATH superfamily
2I72A 4X25A 4FD8A 4DXCA 2B5RA 4NXEA 2ZQ9A 1S67L 5G4ZA 1VQQA 4I38A 3ZHHA 1JTGA 3SS3A 3IT9A 1GHIA 1TF1A 4LRZE 3B3XA 3N6IA 4EUVA 1OTEA 1K56D 1GHPA 3QP6A 2LB5A 5CECA 3VP1A 3E0YA 2PD7A 4WEJA 2ZQCA 4S2KA 2QJ5A 4ARZA 4L9EA 5AQBA 4Y0OA 5I5LA 4ESPA 5FL3A 2VZWA 1LL5A 1WYBA 4GD8A 3BRMA 3F1OA 4GLQA 1MWTA 4I39A 2HV1A 3S7NA 3FPVA 4IHQA 3A3EA 3TG9A 5GLDA 3O87A 1OT6A 4UA6A 2OWHA 5EOOA 3CAXA 2XROA 3IF6B 1FCNA 4MDZA 3D3OA 4L0LA 2HP5A 5A93A 1ES4A 3MQOA 2GDNA 2ZL1B 1H3QA 2JKRM 2ZMAA 2WGIA 3W2ZA 4LRYC 1XXMA 3ZG9B 1HVBA 4KZAA 3R7WA 4OQGA 1TD5A 2R9WA 3E2LA 1YLTA 1ERMA 1N9BA 4FH2A 4BBUA 2KDKA 1JTDA 4YOFA 4EW7A 4GKUA 2VV8A 5FQ9A 5L09A 2Z2LB 1SHVA 4C6YA 3PBOA 4Y0TA 4HQAA 4DRTA 3LEQA 3R4KA 3MFXA 3T4SA 3WS5A 5KMWA 3ZNYA 3C8CA 1DJAA 1MC0A 3BWLA 1ONGA 3G32A 4II7A 1I5QA 4R4RA 1S4RA 2EA9A 4IBXA 2YKFA 3FWLA 3Q7VB 1H0MA 2XQZA 3NI9A 1XX2A 2XF3A 4RVAA 5J4EA 2X01A 2VGKA 2BTFP 3AGEA 1D1JA 3T1QB 2V9AA 2Y2PA 2WK0A 1MKMA 3SS5A 3FG8A 2CMNA 1BTLA 1NZUA 4S2IA 4GN2A 5EVIA 4LLOB 1MWRA 4WUJA 5KSCA 4GZBA 3UN7A 3Q07A 1I2WA 4Y7PA 3LGOA 2PR5A 3ZVTA 4ZBEA 5A92A 4WN5A 4N92A 4C75A 4KZ5A 2OWJA 1GHMA 2XH9A 2C5WB 2JKFA 1HD8A 1XFNA 4M4XA 2JCHA 4Y17A 1Z09A 2HF6A 3QP1A 1D7EA 1K4EA 4LCLA 5F68A 4UHUA 2J8YA 2WADA 2XFSA 4HJ4A 3TJZC 3Q7ZA 3S7QA 5I94A 1TS0A 4PAUA 4CQHA 1VETB 1YKDA 1XGIA 5FSRA 2ZC7A 1LL9A 4JGQA 1MWSA 3KYZA 3BLSA 3B47A 5TFQA 3F1NA 3KSFA 4KG6A 1Y28A 5EVEA 4P87A 2WZXA 5HPIA 3CUEC 2NUTC 3EQVA 4FSFA 3BYDA 5AJGA 3G35A 3DTEA 4BLMA 4QJGA 1XFQA 2ZM8A 3D72A 3IWQA 3IF5A 3LICA 3IXHA 1M6KA 3LR5A 5GHZA 4ZJ3A 4Q0JA 2EXBA 3EGXC 2VKSA 2V1ZA 3VP4A 2O0YA 4BBTA 2Y91A 4MN5A 5HD5A 2Y2MA 4GDNA 4KZ4A 3WRTA 2P08A 1ODVA 4Y2FA 4S2NC 3BY9A 5DTKA 1L2SA 1WYCA 1YT4A 4DMZA 4OH0A 4NKPA 4NG2A 3HUNA 4F3LB 4GB7A 5EOEA 4GDBA 5M1AA 4EWFA 2VLGA 3QNCA 2NUPC 1XP4A 3NDEA 4P0MA 3NECA 1XJ3A 3QP5A 2XA7S 3BFCA 5DVAA 4JF5A 4KENB 3G4PA 5HDDA 3JVVA 3G31A 1LI9A 1LSWA 1LT0A 3KSHA 2PYPA 3TOIA 5HW3A 2UWXA 4DDYA 4IVIA 3ZNTA 3JVUA 2Y4AA 4M3KA 4UAAA 1NYYA 1D06A 3QP8A 3MXRA 3S7OA 3C30A 2PHYA 1J3WA 3SZTA 4WM9A 2EX6A 5FQJA 4DN0A 1IOUA 3OPPA 3AGDA 3M2KA 4HP4A 1W5DA 2W3EA 2WAEA 1P0ZA 3IS2A 3O86A 2J9PA 2OOLA 4LRXC 2B95A 1E3UA 5J7EA 4K91A 2W1RA 1PYYA 4KZ8A 4PHTA 1ZG6A 5F82A 3CUEA 5TBMB 3IF6A 3DTIA 3A0RA 3VMAA 4GCZA 4UA7A 1T1CA 2HJEA 2PR6A 1CJFA 2P74A 3KSGA 3UPPA 4G3WA 4I3AA 2P9VB 1YLWA 3HJIA 2ZM0A 4KUKA 3LI8A 3CWFA 3IH8A 1YLJA 1Z6FA 3MMHA 5EVLA 4KZ9A 1E4DA 1QMFA 1XKZA 3L7HA 4NXGA 1NJ4A 5CEBA 5AVFA 3GECA 1MBLA 4QY6A 4K0XA 4K08A 4CPKA 4ZJ2A 4HBTA 1MPLA 3LI9A 2J9OA 5HAIA 1XA7A 3MZDA 3SW1A 5AQAA 1TEMA 1TS6A 5DFXA 4WYYA 4KG5A 4FH4A 2P9VA 5FA7A 3QP4A 2ZQDA 4ETZA 3FKVA 5EVIC 5HWVA 4E3MA 1EI5A 1VETA 2J7VA 2QHKA 2QYBA 4OP8A 3IBRA 2QPNA 3FYZA 1SKFA 5GHYA 1W7FA 4G3KA 3M2JA 3CJMA 5AQ7A 2Y2LA 4DKIA 1YLYA 1W8QA 3KX0X 3BFFA 4U0TA 4WEKA 4GS9B 3LYXA 1K4FA 3WWXA 3HUOA 1IKGA 4EQ1A 2XDMA 2Y59A 3IBJA 2Z2MB 4R3JA 3PYPA 3UDFA 1T18A 2DMWA 3K3DA 3HLEA 3C2WA 4DF6A 3OCLA 2Q9MA 3OPHA 1MKIA 2IWCA 3IX4A 1F9IA 1JWPA 2RL3A 3C4OA 1H8MA 5CERA 3BFDA 4OVDA 3KYQA 3LUQA 2JKTM 1CEFA 1BSGA 3OZHA 2Y55A 5DJUA 3MZEA 2K7SA 4UA9A 3PBTA 1LL8A 2O99A 1W8YA 1FILA 3LIDA 1DP9A 3E4OA 3CG5A 2EX9A 1LLBA 2EXAA 1YPRA 5GLBA 4S2OA 4JPMA 1YAXA 5FQKA 4ZRRA 1KGGA 4WZ5C 2EX8A 3UB5P 2BLSA 5FQIA 1FCOA 5FAQA 2WGWA 1ES3A 4X1MA 3HLCA 4WMCA 5TR7A 3S1YA 4Y5FA 3K2NA 5JYPA 3ZDJA 3NBLA 4L9FA 5DF7A 3A3IA 2A24A 4JGOA 3BECA 4QD4A 4OOLA 4YNRA 3NJAA 3T12B 5FEFA 2C6WB 5FQMA 4BL3A 1K25A 4CLCB 4E3KA 1IEMA 5KSHA 2XFTA 4BMWA 1K56A 3GDIA 2QJ7A 3MQ0A 3S7PA 4R0QA 4CLCE 3AGFA 3P01A 2FFFB 4EETB 5J8XA 4ZTKA 4F94A 2A24B 3LCEA 5FDHA 4EERA 4LGWA 4R3BA 1KE4A 3N8SA 3EOIA 3T1SA 1BLCA 5EV0A 3MKFA 3VP3A 3RXWA 1V9YA 2XGNA 1UGUA 2WKEA 1JNUA 4GHIA 3HLWA 5F5YA 3TSGA 1SKOB 2EX2A 4DJ2A 4LV2A 3OCNA 4ZJ1A 1VEUB 5F6AA 2HDSA 1ESUA 1A0KA 3E4PA 4KZ3A 2X71A 4EESA 4FCFA 4WF0A 1GSXA 2VK3A 4XT2B 4E3JA 4OKPA 1YMXA 3UE0A 2W27A 1NY0A 3CMZA 1ACFA 1YLPA 4E3OA 3IX3A 1PW8A 1FSYA 1F2KA 4NEED 1IELA 4N9LA 5EECA 3RJUA 4LENA 4WELA 2O9AA 4R70A 1ZG4A 4N1HA 1KVLA 1IYPA 1XPBA 3VP0A 3LY3A 2WGVA 3UB7A 1NLZA 4HIAA 4OQIA 1OT9A 4YFMA 5EM1A 4E6XA 4U0XA 4WL9A 1HLUP 5CHUA 3T4TA 3IXGA 2PD8A 3T1XA 3SH8A 1MXOA 5L2FA 4Q8IA 4RQ9A 2Y79A 1GCEA 2L0WA 4BENA 3EGDC 1H5XA 4LPZA 1KE3A 3M6HA 1K57A 1OTDA 3FKWA 2DCFA 1KE0A 3IQAA 5CHMA 1P9RA 2A2LA 2JKGA 3ZFZA 2GX5A 5G4YA 2H28A 4PM9A 5DKKA 3GVBA 3NOPC 3SH7A 1NZOA 3PAGA 2PYRA 1F5MA 2V8CA 4JGPA 4EU0A 2M7VA 4E3IA 2KX6A 3OBFA 2JC7A 3KO6A 2DNSA 2ZC6B 4GHIB 4H8RA 5A90A 4P85A 3ZVWA 2LB9A 4GD6A 5L10A 1VHMA 3LIEA 2HDUA 2WGWB 4EBPA 4MCWA 1L0DA 3HREA 1K57C 4Y3IA 3T4QA 3OC2A 5DF9A 5F1FA 2E8IA 4QY5A 1STZA 3G2YA 3ZCZA 1T1BA 1UWNX 2WKQA 2Y2NA 1YSPA 3U2AA 5CTNA 1G5UA 2Q9NA 3T4OA 4S2JA 2WYXA 4LFUA 2XSSA 3Q7VA 3CZDA 2W3HA 3NCKA 2OAQ1 3PAEA 3S22A 5HSQA 1Y54A 1YMSA 5HX9A 1BLPA 1XJ6A 4P6BA 3NC8A 5L8MA 4ETXA 3TW8A 1PNEA 4GNUA 2V0WA 4ID4A 1CK3A 4OQHA 1KGEA 5HWTA 1KGFA 1LSXA 3UE6A 4WBGA 5FASA 4MN7A 2P04A 2XD1A 3BJNA 5CRFA 2ZBBA 3BW6A 1L3LA 4EBNA 4GS9A 1NLYA 1NRJA 2H0TA 4IVKA 3HLBA 5F69A 3FZCA 5GHXA 4LV1A 1BUEA 5IS1A 4MLLA 5FI2A 3F1NB 4HP9A 3GQZA 5HDSA 4HBUA 2ZD8A 1X0OA 4OOYA 3GTCA 5IU1A 1TS7A 4R6LA 2Y8HA 1YSQA 3H7WB 5HL1A 5CGWA 2Y2QA 5AQ9A 3LIBA 3C5AA 4JBFA 5CXWA 4PM7A 1ERQA 1PZPA 5DF8A 2WUQA 4Q0HA 2BG1A 3ZG0A 3IF6C 3UB8A 3W8KA 1NWZA 1S4SA 5LBRA 4EUZA 2V1BA 3D9YA 4X55A 4DXBA 3ITAA 1W63M 5FAOA 3VOLA 3D4FA 1S6RA 3NY4A 4QPRA 2K31A 4B88A 5EPHA 1SDEA 2ZM2A 1K54A 5AVEA 2OAP1 3QP2A 1XJ2A 2XR0A 5HDCA 4D2OA 4WZ4A 1OTIA 4WZ5A 1SKOA 4DE2A 3V50A 4E3NA 5CHJA 2HP6A 3DWKA 3IWOA 4EEPA 4HH2A 4MN6A 3V5MA 3UB9A 1RCJA 5FEGA 2PRFA 4OPZA 4Y15A 3N7WA 4MBFA 4S2NA 5A8BA 2W0NA 5EM0A 3BM6A 3LR3A 3DTMA 5L07A 3HUMA 5MC7A 1DP6A 3NULA 2PBDP 3Q82A 3EEAA 1GA9A 2X02A 1HZOA 4ARZB 4MBKA 2WAFA 2G2WA 5KIZA 3GR2A 1N4OA 3LIFA 1G68A 1L0FA 3SH9A 3DTKA 2WKIA 4PMAA 1V9ZA 1K0KA 2ZC5B 3T4LA 3ULFA 2RCXA 2EFXA 2OSUA 3V3RA 1S1ZA 2J3WA 1OTAA 2ZMFA 1L0EA 4PKYA 1SCWA 2Y2KA 4R38A 3MJQA 3CPTA 3NOTC 3O88A 4HI4A 2PT7A 4JLFA 4NETA 4NK3A 1ZC2A 1K54C 4DE1A 3V3SA 5CTMA 3IWIA 2UV0E 3UPOA 5E2HA 2A3UA 2O9BA 3MR0A 1OTBA 4KQQA 5IHVA 3MSHA 4OOMA 2G2UA 5G18A 1YQSA 1FCMA 4I3JA 1VEUA 3LEZA 4Q0IA 4UQIM 4OLDA 3A3JA 1U60A 1PI4A 3B33A 3H82A 1ALQA 2PDRA 1LI0A 3BEBA 3VE4A 1NXYA 2ZLYA 4B9OA 1G6AA 3HCYA 4Z1WA 2WKHA 1G6OA 1RGZA 4Y13A 5M19A 3LR4A 2BASA 2D01A 4N9KA 5DJTA 1TDLA 3VFHA 3VOYA 3ZG8B 1GSVA 1PZOA 4I3IA 4DE0A 3NOUC 3TRCA 4BQMA 3U4LP 4EV4A 2ZC3B 1DP8A 4Y0UA 5DTSA 2AVXA 2Y2HA 2VJWA 4GW9A 4L9GA 3JYIA 1I2SA 2GZAA 1GA0A 4MEZA 5HAPA 3H7WA 3GMWA 4F3LA 1AXBA 1CI8A 3Q81A 1ES2A 1O07A 3ISGA 1T19A 3RFBA 3BQ8A 4A5RA 4X69A 4HJ3A 2E8JA 5J3WA 4BWIA 4HNBA 2V2FF 3PXPA 3CPTB 2W1TB 4R3AA 1FOFA 4QHCA 5F83A 4ZDXA 1XJ4A 1CQAA 3C38A 3OPRA 3UE3A 3G34A 1F98A 1H8YA 2CC1A 2Z6CA 1KVMA 1NRFA 3BFEA 3PBQA 4XT2A 4X1LA 3O3VA 4IJGA 1K55C 2HJ9C 2DRWA 1EWZA 3T4KA 1TS8A 4R4SA 1L0GA 1EW0A 5HARA 1Q2QA 4GOGA 2Y2JA 4LV0A 1IYSA 5U47A 1VM1A 3A3FA 2WZZA 2XRNA 4B93A 3VP2A 3S4XA 3ZGAB 3IX8A 2W3DA 1AWIA 1LSVA 5E43A 2W3FA 1FSWA 3GRJA 2ZQ7A 4H6JA 3WS4A 3E4QA 4XUZA 3RTYA 3VFFA 1C3BA 3PBRA 2XD5A 3VOZA 4HH3A 1DJBA 1XA1A 3P7NA 4O7DA 1ESIA 1YM1A 1OJGA 4YINA 2JN7A 4E3LA 2HZ5A 1YLZA 1JWVA 4DE3A 2GNXA 2Y2OA 3FPWA 1MZUA 1WA9A 3T4JA 5FI6A 1RGYA 3QHYA 2M1CA 4NXFA 4IUKA 4U3TA 1BZAA 4KG2A 5HWWA 4JXWA 2YKHA 2IWBA 1OJ5A 4R23A 5TJJA 3NHQA 5GLAA 4JXVA 4S2LA 1E3UD 5KZHA 4CJNA 2VEAA 3TE8A 5EUAA 5BOHA 5GLCA 5CGXA 1MWUA 3UPNA 1KOUA 4MBHA 1OPXA 4E6WA 4BD1A 2HDQA 5E2FA 5FQQA 4KZBA 4MNRA 3IS2B 4MMNA 3EEHA 3E2KA 4DJ3A 3DW0A 1IYOA 5CGSA 4KZ7A 4I5SA 1BT5A 4R1GA 4JF4A 3OLOA 5TBMA 1TVFA 5FI7A 1ONHA 4KQRA 4O0PA 3IXDA 4XXRA 2ZMVA 4DDSA 2K2NA 3T1RA 2IWDA 4EQIA 5D3OA 3HLGA 1SZVA 3IH9A 1M40A 4B4ZA 3T50A 3ICYA 2PBYA 4OQ0A 2JE5A 1VB6A 3HLDA 5HZHA 1G28A 3DAVA 2P7JA 1JVJA 4HHDA 4H6JB 3LO7A 5DTTA 5EVIB 3Q1FA 3VV4A 3ZYTA 2HDRA 2WKPA 2V0UA 3MQQA 3SS4A 3C7UA 4UEYA 4QU3A 1PWGA 4X53A 4UQIS 2HP9A 4OPQA 1CEGA 3ZQ5A 2HPBA 2B02A 4HJ6A 4ME4A 4EXOA 4P6ZS 3MBZA 3UDXA 3VSLA 2D02A 3UY6A 3ITBA 1EROA 1FQGA 4PPRA 2ZC4B 3E98A 4KQOA 2KOIA 2QZ6A 3HVFA 3IHBA 4PM5A 1MY8A 5HFOA 4YWZA 2V20A 2VV7A 3NIAA 2H5SA 3WS0A 5HPFA 2VA0A 4JKTA 2QMIA 1FR6A 2J80A 5E2EA 3P09A 4NXBA 4IUHA 1Q2PA 3G6OA 4CLCA 1BLSA 4E04A 2VV6A 1BYWA 2OLUA 3MF0A 4HEFA 2JBFA 1PI5A 2B18A 2H10A 4ZAMA 2KLIA 3VSKA 3DBAA 4HOIA 2INWA 3RH8B 2W1TA 3HLFA 5M18A 1H8ZA 1HTZA 3MS6A 2JKRI 1UWPX 5HL6A 4WLAA 1DJCA 2WKRA 5A91A 4EEUA 1S66L 2ZOIA 1T1AA 1K6RA 2Q0OA 3GSGA 5FATA 2QWSA 3MXQA 3LIAA 4JGRA 4JXSA 5EE8A 3UNWA 2XLNA 1TDGA 2L1MA 4G3VA 3V39A 4OPYA 4BD0A 3VE3A 1P9WA 4RYEA 1FIKA 1DY6A 2PAVP 2G7UA 1J9MA 3PHYA 3CHWP 1KDWA 3G30A 2A49A 2JKTI 2O9CA 3RXXA 3MKEA 3LY4A 4K0WA 1E25A 5DFYA 1IFQA 2JHEA 3CI6A 2ACGA 3W4QA 3LFVA 1XGJA 4WMCD 2EWVA 2XEPA 3L9KA 4CLCD 2Y2IA 3P98A 3WRZA 5CEDA 4EBLA 4KZ6A 4OP5A 4KQDA 1N9OA 2FFYA 2VGLM 5EVID 5F1GA 3A0VA 5K5BA 2VX8A 1PWDA 3W4OA 3H9WA 4P6ZM 4IBRA 3K3CA 2ZL1A 5DKLA 2V8FA 3CLOA 2MJ6A 3A0SA 1K6SA 1K38A 4OLGA 3ZG7B 3OOVA 1S1YA 2J3TD 3FV7A 5HD3A 4JF6A 4X6TA 1ZKJA 3OPLA 2M7UA 1BLHA 1IKIA 3N8LA 1N9LA 1PWCA 1LHYA 3UDIA 3UMEA 1RP5A 3UMDA 3O5YA 3EWKA 1W63Q 1P97A 4QB8A 4RA7A 5GL9A 4OPRA 3HBRA 2J3TC 4XUXA 1PW1A 4HESA 2V1AA 4PM8A 1PRQA 3A3DA 2Y2GA 1GSWA 1QMEA 2GJ3A 5CX7A 1WE4A 5HAQA 4Z9QA 5JYOA 4CLCC 3N8RA 3I7JA 2FH5A 2R9XA 3IHAA 3QNBA 2XA7M 2VGLS 2OLVA 2HGVA 3BQAA 3KSIA 3MFDA 1BULA 2VGJA 4HY8A 3WS1A 3BLMA 2ZOHA 4PM6A 3F1PB 5IT5A 4PKYG 3BFGA 3R7WB 3C4PA 5E2GA 1K55A 4RX3A 5C5KA 3MXSA 4X56A 1KDSA 2ZJ9A 1CI9A 1IYQA 3SOIA 1FR1A 4X68A 4RX2A 4O8GA 3PR6A 3EQUA 3W4PA 2PU4A 1ES5A 4FUWA 5FDSA 3N4IA 3UO9A 3IXBA 4GJ4A 3F1PA 3WS2A 3B42A 1PFLA 4D60A 4OONA 2EFUA 4JXGA 1N9NA 5TGFA 2FZ0A 1DRMA 3C7VA 2L4RA 4BJPA 5FAPA 3V67A 1PIOA 3M6BA 1O7EA 2Z6DA 4LCMA 3F1OB 3PTEA 4FTXA 4O01A 4B4XA 3HL9A 4S2MA 4N1XA 2PU2A 4AFIA 2I9VA 1CF0A 3DWZA 4QWOA 1OMEA 3MZFA 4C3QA 2R78A 3BY8A 3G2ZA 1ZTUA 3JPUA 3KYEA 1W79A 1Y4OA 4LV3A 3ZG5A 3LR0A 1JWZA 3GV9A 4S2PA 1ZHHB 4FOFA 4KUOA 1NYMA 2EWWA 3UE1A 3H82B 2QKPA 3CITA 4BBVA 3PBNA 2ZQAA 2OV5A 1S0WA 2IA2A 2W3GA 2XK1A 3UB6A 1SDNA 2H0YA 2ZQ8A 3NDGA 4IEDA 4BL2A 5EFWA 3HJKA 3FC7A 3PBSA
chains in the Genus database with same CATH topology
5HWVA 5IS1A 3F1NB 4HP9A 4O0PA 5HDSA 4NXEA 1S67L 1X0OA 2QHKA 2QYBA 2ZMVA 5G4ZA 3IBRA 5IU1A 1TS7A 4R6LA 2K2NA 2Y8HA 1YSQA 3H7WB 4I38A 3LIBA 4G3KA 1TF1A 4LRZE 4EUVA 1OTEA 3T50A 3ICYA 3KX0X 4Q0HA 4WEKA 1VB6A 4GS9B 5HZHA 3LYXA 2LB5A 3UB8A 1G28A 4EQ1A 2P7JA 3E0YA 2PD7A 1NWZA 4WEJA 3IBJA 1S4SA 4HHDA 5LBRA 4H6JB 2V1BA 2QJ5A 4ARZA 1W63M 4L9EA 3VV4A 3ZYTA 3PYPA 1T18A 3VOLA 2WKPA 2V0UA 5I5LA 3MQQA 5FL3A 2DMWA 4QPRA 3K3DA 2K31A 2VZWA 4UEYA 3C2WA 3OCLA 4UQIS 5AVEA 4GLQA 3F1OA 2OAP1 1XJ2A 4I39A 1F9IA 3ZQ5A 2HV1A 2B02A 3S7NA 4HJ6A 3FPVA 5HDCA 4IHQA 1OTIA 4ME4A 1H8MA 4EXOA 4P6ZS 1OT6A 4EEPA 3KYQA 4HH2A 2OWHA 4MN6A 3LUQA 2JKTM 3CAXA 2XROA 3UB9A 2D02A 4MDZA 5DJUA 3D3OA 2K7SA 4L0LA 3PBTA 1LL8A 2O99A 3E98A 3LIDA 3MQOA 1DP9A 3E4OA 4KQOA 2KOIA 5A8BA 2W0NA 1H3QA 2JKRM 3LR3A 4YWZA 3W2ZA 1YAXA 5MC7A 4LRYC 1DP6A 2VV7A 4ZRRA 3R7WA 3EEAA 4ARZB 1TD5A 2VA0A 5HPFA 5KIZA 3LIFA 2J80A 4BBUA 2KDKA 4YOFA 4EW7A 4NXBA 4IUHA 2VV8A 3G6OA 4CLCA 1V9ZA 4E04A 3PBOA 2VV6A 1BYWA 4HQAA 4Y5FA 3T4LA 3ULFA 3K2NA 3MF0A 3R4KA 3MFXA 3T4SA 1S1ZA 2B18A 2J3WA 2KLIA 1OTAA 2ZMFA 3DBAA 4HOIA 3C8CA 4L9FA 4PKYA 1MC0A 2INWA 3RH8B 3BWLA 4II7A 4R38A 3MJQA 2W1TA 1S4RA 3NOTC 2EA9A 2A24A 2YKFA 4HI4A 2JKRI 1UWPX 5HL6A 4WLAA 2PT7A 2WKRA 4EEUA 4JGOA 1S66L 4OOLA 3NJAA 4YNRA 2ZOIA 1T1AA 5J4EA 2V9AA 1MKMA 2QWSA 2O9BA 3MXQA 3LIAA 4JGRA 3FG8A 3MR0A 4CLCB 5KSHA 1OTBA 4BMWA 2CMNA 2L1MA 2QJ7A 3GDIA 3MQ0A 4G3VA 4OOMA 3S7PA 4CLCE 3VE3A 4I3JA 4LLOB 1P9WA 3P01A 4WUJA 4EETB 4Q0IA 2PR5A 4UQIM 2A24B 4WN5A 4EERA 2G7UA 3PHYA 2OWJA 3B33A 3H82A 3EOIA 2PDRA 2JKTI 1V9YA 1XFNA 2O9CA 4M4XA 1UGUA 2HF6A 1D7EA 3VE4A 5DFYA 5F68A 1IFQA 2JHEA 3CI6A 4B9OA 3LFVA 2EWVA 1JNUA 3HCYA 4Z1WA 4CLCD 4HJ4A 3TJZC 4GHIA 1G6OA 5F5YA 3S7QA 1TS0A 3LR4A 2BASA 4PAUA 2D01A 4CQHA 4DJ2A 5DJTA 3OCNA 1YKDA 4KQDA 1N9OA 1GSVA 5F6AA 2VGLM 4I3IA 4JGQA 3E4PA 3A0VA 3NOUC 4EESA 5K5BA 3TRCA 2VX8A 3KYZA 3B47A 4WF0A 1GSXA 3F1NA 4XT2B 3KSFA 1DP8A 2W27A 1Y28A 3H9WA 4P6ZM 2VJWA 4GW9A 3K3CA 5DKLA 4L9GA 5HPIA 2GZAA 3CUEC 3CLOA 2NUTC 2MJ6A 3A0SA 4NEED 3EQVA 4FSFA 5AJGA 3H7WA 4WELA 2O9AA 1XFQA 3D72A 3OOVA 1S1YA 2J3TD 4R70A 4F3LA 5HD3A 2M7UA 3LICA 1N9LA 1T19A 3RFBA 3LR5A 3BQ8A 3UMEA 4HJ3A 3UMDA 5J3WA 4BWIA 3O5YA 3EWKA 4Q0JA 3EGXC 1W63Q 4HNBA 2VKSA 1P97A 3UB7A 3PXPA 2O0YA 1NLZA 4BBTA 4HIAA 4MN5A 2W1TB 1OT9A 2J3TC 4R3AA 5HD5A 4WL9A 2P08A 2V1AA 1ODVA 1XJ4A 4Y2FA 3T4TA 2PD8A 3C38A 3BY9A 3UE3A 1F98A 2Z6CA 4RQ9A 1GSWA 2GJ3A 5CX7A 2Y79A 4DMZA 3PBQA 4XT2A 2L0WA 4NKPA 4CLCC 4F3LB 3EGDC 2FH5A 4IJGA 2XA7M 2VLGA 2HJ9C 4LPZA 2NUPC 2VGLS 2HGVA 3T4KA 1TS8A 3BQAA 1OTDA 3KSIA 4HY8A 1EW0A 2ZOHA 1XJ3A 3F1PB 2XA7S 5IT5A 4PKYG 1P9RA 2A2LA 3R7WB 2GX5A 5G4YA 2H28A 5HDDA 3JVVA 5C5KA 5DKKA 3NOPC 1LSWA 1LT0A 2PYRA 2XRNA 3KSHA 2PYPA 1F5MA 4B93A 4JGPA 4EU0A 2M7VA 2KX6A 3OBFA 3JVUA 3KO6A 4O8GA 3PR6A 3EQUA 2W3DA 4GHIB 1D06A 1LSVA 2LB9A 3S7OA 3C30A 1VHMA 2W3FA 2PHYA 3LIEA 4MCWA 4DN0A 1IOUA 4GJ4A 3F1PA 4HP4A 3B42A 4H6JA 4Y3IA 3E4QA 3T4QA 3RTYA 2W3EA 3OC2A 1N9NA 3PBRA 5DF9A 2FZ0A 1DRMA 1P0ZA 4HH3A 1STZA 3IS2A 1T1BA 1UWNX 2L4RA 2WKQA 2OOLA 1YSPA 3P7NA 4LRXC 3U2AA 4BJPA 3V67A 1OJGA 5J7EA 2Z6DA 2W1RA 4PHTA 2JN7A 3T4OA 3CUEA 3F1OB 2GNXA 5TBMB 4O01A 3FPWA 1MZUA 1WA9A 2XSSA 3T4JA 3A0RA 2W3HA 4GCZA 2OAQ1 4AFIA 1T1CA 2HJEA 2M1CA 5HSQA 4NXFA 2PR6A 4IUKA 2I9VA 5HWWA 2YKHA 3KSGA 4G3WA 4I3AA 1OJ5A 1XJ6A 5TJJA 3NHQA 2R78A 3HJIA 3BY8A 1ZTUA 2VEAA 4KUKA 3LI8A 5L8MA 3TE8A 3CWFA 4ETXA 3TW8A 3MMHA 3LR0A 2V0WA 5HWTA 1KOUA 3UE6A 1LSXA 1OPXA 4NXGA 1ZHHB 4FOFA 5AVFA 4KUOA 4MN7A 3GECA 2P04A 3BJNA 2EWWA 4K08A 2ZBBA 3BW6A 3H82B 3IS2B 2QKPA 3EEHA 4MMNA 3CITA 3LI9A 4BBVA 3PBNA 4DJ3A 2IA2A 4GS9A 1NLYA 2W3GA 3SW1A 1NRJA 1TS6A 3UB6A 5DFXA 4I5SA 3OLOA 5EFWA 5TBMA 5F69A 3HJKA 3FC7A 3PBSA 4ETZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KX6 A;  5HWV A;  5IS1 A;  4I3I A;  4JGQ A;  2J80 A;  3A0V A;  3E4P A;  3NOU C;  4BBU A;  4EES A;  2KDK A;  3F1N B;  4HP9 A;  5HDS A;  4NXB A;  4EW7 A;  4NXE A;  3SW1 A;  2VV8 A;  1D06 A;  4GHI B;  1LSV A;  3G6O A;  1S67 L;  1X0O A;  2QHK A;  4WF0 A;  1GSX A;  5G4Z A;  3F1N A;  1V9Z A;  2PHY A;  3IBR A;  4XT2 B;  5IU1 A;  1TS7 A;  4E04 A;  2VV6 A;  3LIE A;  4R6L A;  1BYW A;  1DP8 A;  1Y28 A;  2W27 A;  3H9W A;  3H7W B;  4HQA A;  4I38 A;  3ULF A;  4GW9 A;  3K3C A;  3LIB A;  3MFX A;  5DKL A;  4L9G A;  4EET B;  3F1P A;  4HP4 A;  1S1Z A;  3CLO A;  4LRZ E;  4H6J A;  3E4Q A;  1OTA A;  3A0S A;  3RTY A;  1OTE A;  3T50 A;  3ICY A;  3KX0 X;  3H7W A;  3C8C A;  1N9N A;  4HOI A;  4L9F A;  4PKY A;  2INW A;  3LIF A;  3RH8 B;  1XFQ A;  1DRM A;  3BWL A;  1P0Z A;  3MJQ A;  4R38 A;  4HH3 A;  3D72 A;  1S1Y A;  1VB6 A;  4R70 A;  4F3L A;  5HD3 A;  1S4R A;  3IS2 A;  3NOT C;  4GS9 B;  2EA9 A;  2A24 A;  1T1B A;  5HZH A;  1UWN X;  2YKF A;  1N9L A;  2L4R A;  2WKQ A;  2OOL A;  3LIC A;  3LYX A;  1T19 A;  1UWP X;  3P7N A;  1G28 A;  4HI4 A;  2P7J A;  2WKR A;  4WLA A;  1OJG A;  3UB8 A;  2PD7 A;  1NWZ A;  4JGO A;  4EEU A;  5J7E A;  2Z6D A;  1S66 L;  4HJ3 A;  5I5L A;  3UME A;  4HHD A;  1S4S A;  2JN7 A;  3NJA A;  4H6J B;  2V1B A;  3UMD A;  2ZOI A;  4BBT A;  1T1A A;  5J3W A;  3EWK A;  2QJ5 A;  5J4E A;  3F1O B;  5TBM B;  4HNB A;  2V9A A;  1P97 A;  1MZU A;  1WA9 A;  2QWS A;  4L9E A;  3UB7 A;  3A0R A;  3PYP A;  1T18 A;  3MXQ A;  2WKP A;  2V0U A;  3LIA A;  3MQQ A;  3FG8 A;  4HIA A;  4JGR A;  3MR0 A;  4GCZ A;  4MN5 A;  1OT9 A;  3K3D A;  4R3A A;  5HD5 A;  1OTB A;  1T1C A;  4WL9 A;  2M1C A;  3C2W A;  2CMN A;  5HSQ A;  4NXF A;  2V1A A;  1ODV A;  2L1M A;  2PR6 A;  2QJ7 A;  3GDI A;  2I9V A;  1XJ4 A;  5AVE A;  5HWW A;  2PD8 A;  3F1O A;  3VE3 A;  2YKH A;  3BY9 A;  4I3J A;  4I3A A;  4LLO B;  4WUJ A;  1XJ2 A;  4I39 A;  1F9I A;  3VOL A;  1OJ5 A;  2HV1 A;  1F98 A;  3ZQ5 A;  1XJ6 A;  2B02 A;  2Z6C A;  3NHQ A;  4HJ6 A;  4RQ9 A;  1GSW A;  2GJ3 A;  5HDC A;  1OTI A;  2R78 A;  3BY8 A;  3HJI A;  2PR5 A;  2VEA A;  4KUK A;  3LI8 A;  4XT2 A;  2A24 B;  3CWF A;  4WN5 A;  4EER A;  1OT6 A;  4EQ1 A;  4EXO A;  2L0W A;  4EEP A;  4F3L B;  4HH2 A;  2OWH A;  4MN6 A;  3LUQ A;  2V0W A;  3CAX A;  2VLG A;  5HWT A;  4LPZ A;  3UB9 A;  2D02 A;  1KOU A;  3PHY A;  2OWJ A;  1LSX A;  3B33 A;  3UE6 A;  3H82 A;  4NXG A;  2PDR A;  1TS8 A;  4LRX C;  5DJU A;  2K7S A;  1OTD A;  5AVF A;  4KUO A;  1LL8 A;  1V9Y A;  3GEC A;  1XFN A;  4HY8 A;  4M4X A;  3LID A;  3MQO A;  1DP9 A;  3E4O A;  1EW0 A;  1UGU A;  2ZOH A;  4K08 A;  1XJ3 A;  2ZBB A;  3F1P B;  1D7E A;  5A8B A;  3VE4 A;  2W0N A;  3H82 B;  4PKY G;  5F68 A;  3IS2 B;  2QKP A;  3EEH A;  2JHE A;  5G4Y A;  2H28 A;  3LI9 A;  4BBV A;  4B9O A;  4DJ3 A;  5HDD A;  4YWZ A;  1JNU A;  4GS9 A;  1DP6 A;  4HJ4 A;  4LRY C;  5DKK A;  1TS6 A;  2VV7 A;  3NOP C;  1LSW A;  4GHI A;  4I5S A;  3FC7 A;  5F5Y A;  3UB6 A;  1TS0 A;  2BAS A;  1LT0 A;  2PYR A;  2D01 A;  4DJ2 A;  5DJT A;  3OLO A;  2PYP A;  5EFW A;  5TBM A;  5F69 A;  3HJK A;  4KQD A;  4JGP A;  1N9O A;  5KIZ A;  1GSV A;  5F6A A; 
#chains in the Genus database with same CATH topology
 2I72 A;  4X25 A;  4FD8 A;  4DXC A;  2B5R A;  4NXE A;  2ZQ9 A;  1S67 L;  5G4Z A;  1VQQ A;  4I38 A;  3ZHH A;  1JTG A;  3SS3 A;  3IT9 A;  1GHI A;  1TF1 A;  4LRZ E;  3B3X A;  3N6I A;  4EUV A;  1OTE A;  1K56 D;  1GHP A;  3QP6 A;  2LB5 A;  5CEC A;  3VP1 A;  3E0Y A;  2PD7 A;  4WEJ A;  2ZQC A;  4S2K A;  2QJ5 A;  4ARZ A;  4L9E A;  5AQB A;  4Y0O A;  5I5L A;  4ESP A;  5FL3 A;  2VZW A;  1LL5 A;  1WYB A;  4GD8 A;  3BRM A;  3F1O A;  4GLQ A;  1MWT A;  4I39 A;  2HV1 A;  3S7N A;  3FPV A;  4IHQ A;  3A3E A;  3TG9 A;  5GLD A;  3O87 A;  1OT6 A;  4UA6 A;  2OWH A;  5EOO A;  3CAX A;  2XRO A;  3IF6 B;  1FCN A;  4MDZ A;  3D3O A;  4L0L A;  2HP5 A;  5A93 A;  1ES4 A;  3MQO A;  2GDN A;  2ZL1 B;  1H3Q A;  2JKR M;  2ZMA A;  2WGI A;  3W2Z A;  4LRY C;  1XXM A;  3ZG9 B;  1HVB A;  4KZA A;  3R7W A;  4OQG A;  1TD5 A;  2R9W A;  3E2L A;  1YLT A;  1ERM A;  1N9B A;  4FH2 A;  4BBU A;  2KDK A;  1JTD A;  4YOF A;  4EW7 A;  4GKU A;  2VV8 A;  5FQ9 A;  5L09 A;  2Z2L B;  1SHV A;  4C6Y A;  3PBO A;  4Y0T A;  4HQA A;  4DRT A;  3LEQ A;  3R4K A;  3MFX A;  3T4S A;  3WS5 A;  5KMW A;  3ZNY A;  3C8C A;  1DJA A;  1MC0 A;  3BWL A;  1ONG A;  3G32 A;  4II7 A;  1I5Q A;  4R4R A;  1S4R A;  2EA9 A;  4IBX A;  2YKF A;  3FWL A;  3Q7V B;  1H0M A;  2XQZ A;  3NI9 A;  1XX2 A;  2XF3 A;  4RVA A;  5J4E A;  2X01 A;  2VGK A;  2BTF P;  3AGE A;  1D1J A;  3T1Q B;  2V9A A;  2Y2P A;  2WK0 A;  1MKM A;  3SS5 A;  3FG8 A;  2CMN A;  1BTL A;  1NZU A;  4S2I A;  4GN2 A;  5EVI A;  4LLO B;  1MWR A;  4WUJ A;  5KSC A;  4GZB A;  3UN7 A;  3Q07 A;  1I2W A;  4Y7P A;  3LGO A;  2PR5 A;  3ZVT A;  4ZBE A;  5A92 A;  4WN5 A;  4N92 A;  4C75 A;  4KZ5 A;  2OWJ A;  1GHM A;  2XH9 A;  2C5W B;  2JKF A;  1HD8 A;  1XFN A;  4M4X A;  2JCH A;  4Y17 A;  1Z09 A;  2HF6 A;  3QP1 A;  1D7E A;  1K4E A;  4LCL A;  5F68 A;  4UHU A;  2J8Y A;  2WAD A;  2XFS A;  4HJ4 A;  3TJZ C;  3Q7Z A;  3S7Q A;  5I94 A;  1TS0 A;  4PAU A;  4CQH A;  1VET B;  1YKD A;  1XGI A;  5FSR A;  2ZC7 A;  1LL9 A;  4JGQ A;  1MWS A;  3KYZ A;  3BLS A;  3B47 A;  5TFQ A;  3F1N A;  3KSF A;  4KG6 A;  1Y28 A;  5EVE A;  4P87 A;  2WZX A;  5HPI A;  3CUE C;  2NUT C;  3EQV A;  4FSF A;  3BYD A;  5AJG A;  3G35 A;  3DTE A;  4BLM A;  4QJG A;  1XFQ A;  2ZM8 A;  3D72 A;  3IWQ A;  3IF5 A;  3LIC A;  3IXH A;  1M6K A;  3LR5 A;  5GHZ A;  4ZJ3 A;  4Q0J A;  2EXB A;  3EGX C;  2VKS A;  2V1Z A;  3VP4 A;  2O0Y A;  4BBT A;  2Y91 A;  4MN5 A;  5HD5 A;  2Y2M A;  4GDN A;  4KZ4 A;  3WRT A;  2P08 A;  1ODV A;  4Y2F A;  4S2N C;  3BY9 A;  5DTK A;  1L2S A;  1WYC A;  1YT4 A;  4DMZ A;  4OH0 A;  4NKP A;  4NG2 A;  3HUN A;  4F3L B;  4GB7 A;  5EOE A;  4GDB A;  5M1A A;  4EWF A;  2VLG A;  3QNC A;  2NUP C;  1XP4 A;  3NDE A;  4P0M A;  3NEC A;  1XJ3 A;  3QP5 A;  2XA7 S;  3BFC A;  5DVA A;  4JF5 A;  4KEN B;  3G4P A;  5HDD A;  3JVV A;  3G31 A;  1LI9 A;  1LSW A;  1LT0 A;  3KSH A;  2PYP A;  3TOI A;  5HW3 A;  2UWX A;  4DDY A;  4IVI A;  3ZNT A;  3JVU A;  2Y4A A;  4M3K A;  4UAA A;  1NYY A;  1D06 A;  3QP8 A;  3MXR A;  3S7O A;  3C30 A;  2PHY A;  1J3W A;  3SZT A;  4WM9 A;  2EX6 A;  5FQJ A;  4DN0 A;  1IOU A;  3OPP A;  3AGD A;  3M2K A;  4HP4 A;  1W5D A;  2W3E A;  2WAE A;  1P0Z A;  3IS2 A;  3O86 A;  2J9P A;  2OOL A;  4LRX C;  2B95 A;  1E3U A;  5J7E A;  4K91 A;  2W1R A;  1PYY A;  4KZ8 A;  4PHT A;  1ZG6 A;  5F82 A;  3CUE A;  5TBM B;  3IF6 A;  3DTI A;  3A0R A;  3VMA A;  4GCZ A;  4UA7 A;  1T1C A;  2HJE A;  2PR6 A;  1CJF A;  2P74 A;  3KSG A;  3UPP A;  4G3W A;  4I3A A;  2P9V B;  1YLW A;  3HJI A;  2ZM0 A;  4KUK A;  3LI8 A;  3CWF A;  3IH8 A;  1YLJ A;  1Z6F A;  3MMH A;  5EVL A;  4KZ9 A;  1E4D A;  1QMF A;  1XKZ A;  3L7H A;  4NXG A;  1NJ4 A;  5CEB A;  5AVF A;  3GEC A;  1MBL A;  4QY6 A;  4K0X A;  4K08 A;  4CPK A;  4ZJ2 A;  4HBT A;  1MPL A;  3LI9 A;  2J9O A;  5HAI A;  1XA7 A;  3MZD A;  3SW1 A;  5AQA A;  1TEM A;  1TS6 A;  5DFX A;  4WYY A;  4KG5 A;  4FH4 A;  2P9V A;  5FA7 A;  3QP4 A;  2ZQD A;  4ETZ A;  3FKV A;  5EVI C;  5HWV A;  4E3M A;  1EI5 A;  1VET A;  2J7V A;  2QHK A;  2QYB A;  4OP8 A;  3IBR A;  2QPN A;  3FYZ A;  1SKF A;  5GHY A;  1W7F A;  4G3K A;  3M2J A;  3CJM A;  5AQ7 A;  2Y2L A;  4DKI A;  1YLY A;  1W8Q A;  3KX0 X;  3BFF A;  4U0T A;  4WEK A;  4GS9 B;  3LYX A;  1K4F A;  3WWX A;  3HUO A;  1IKG A;  4EQ1 A;  2XDM A;  2Y59 A;  3IBJ A;  2Z2M B;  4R3J A;  3PYP A;  3UDF A;  1T18 A;  2DMW A;  3K3D A;  3HLE A;  3C2W A;  4DF6 A;  3OCL A;  2Q9M A;  3OPH A;  1MKI A;  2IWC A;  3IX4 A;  1F9I A;  1JWP A;  2RL3 A;  3C4O A;  1H8M A;  5CER A;  3BFD A;  4OVD A;  3KYQ A;  3LUQ A;  2JKT M;  1CEF A;  1BSG A;  3OZH A;  2Y55 A;  5DJU A;  3MZE A;  2K7S A;  4UA9 A;  3PBT A;  1LL8 A;  2O99 A;  1W8Y A;  1FIL A;  3LID A;  1DP9 A;  3E4O A;  3CG5 A;  2EX9 A;  1LLB A;  2EXA A;  1YPR A;  5GLB A;  4S2O A;  4JPM A;  1YAX A;  5FQK A;  4ZRR A;  1KGG A;  4WZ5 C;  2EX8 A;  3UB5 P;  2BLS A;  5FQI A;  1FCO A;  5FAQ A;  2WGW A;  1ES3 A;  4X1M A;  3HLC A;  4WMC A;  5TR7 A;  3S1Y A;  4Y5F A;  3K2N A;  5JYP A;  3ZDJ A;  3NBL A;  4L9F A;  5DF7 A;  3A3I A;  2A24 A;  4JGO A;  3BEC A;  4QD4 A;  4OOL A;  4YNR A;  3NJA A;  3T12 B;  5FEF A;  2C6W B;  5FQM A;  4BL3 A;  1K25 A;  4CLC B;  4E3K A;  1IEM A;  5KSH A;  2XFT A;  4BMW A;  1K56 A;  3GDI A;  2QJ7 A;  3MQ0 A;  3S7P A;  4R0Q A;  4CLC E;  3AGF A;  3P01 A;  2FFF B;  4EET B;  5J8X A;  4ZTK A;  4F94 A;  2A24 B;  3LCE A;  5FDH A;  4EER A;  4LGW A;  4R3B A;  1KE4 A;  3N8S A;  3EOI A;  3T1S A;  1BLC A;  5EV0 A;  3MKF A;  3VP3 A;  3RXW A;  1V9Y A;  2XGN A;  1UGU A;  2WKE A;  1JNU A;  4GHI A;  3HLW A;  5F5Y A;  3TSG A;  1SKO B;  2EX2 A;  4DJ2 A;  4LV2 A;  3OCN A;  4ZJ1 A;  1VEU B;  5F6A A;  2HDS A;  1ESU A;  1A0K A;  3E4P A;  4KZ3 A;  2X71 A;  4EES A;  4FCF A;  4WF0 A;  1GSX A;  2VK3 A;  4XT2 B;  4E3J A;  4OKP A;  1YMX A;  3UE0 A;  2W27 A;  1NY0 A;  3CMZ A;  1ACF A;  1YLP A;  4E3O A;  3IX3 A;  1PW8 A;  1FSY A;  1F2K A;  4NEE D;  1IEL A;  4N9L A;  5EEC A;  3RJU A;  4LEN A;  4WEL A;  2O9A A;  4R70 A;  1ZG4 A;  4N1H A;  1KVL A;  1IYP A;  1XPB A;  3VP0 A;  3LY3 A;  2WGV A;  3UB7 A;  1NLZ A;  4HIA A;  4OQI A;  1OT9 A;  4YFM A;  5EM1 A;  4E6X A;  4U0X A;  4WL9 A;  1HLU P;  5CHU A;  3T4T A;  3IXG A;  2PD8 A;  3T1X A;  3SH8 A;  1MXO A;  5L2F A;  4Q8I A;  4RQ9 A;  2Y79 A;  1GCE A;  2L0W A;  4BEN A;  3EGD C;  1H5X A;  4LPZ A;  1KE3 A;  3M6H A;  1K57 A;  1OTD A;  3FKW A;  2DCF A;  1KE0 A;  3IQA A;  5CHM A;  1P9R A;  2A2L A;  2JKG A;  3ZFZ A;  2GX5 A;  5G4Y A;  2H28 A;  4PM9 A;  5DKK A;  3GVB A;  3NOP C;  3SH7 A;  1NZO A;  3PAG A;  2PYR A;  1F5M A;  2V8C A;  4JGP A;  4EU0 A;  2M7V A;  4E3I A;  2KX6 A;  3OBF A;  2JC7 A;  3KO6 A;  2DNS A;  2ZC6 B;  4GHI B;  4H8R A;  5A90 A;  4P85 A;  3ZVW A;  2LB9 A;  4GD6 A;  5L10 A;  1VHM A;  3LIE A;  2HDU A;  2WGW B;  4EBP A;  4MCW A;  1L0D A;  3HRE A;  1K57 C;  4Y3I A;  3T4Q A;  3OC2 A;  5DF9 A;  5F1F A;  2E8I A;  4QY5 A;  1STZ A;  3G2Y A;  3ZCZ A;  1T1B A;  1UWN X;  2WKQ A;  2Y2N A;  1YSP A;  3U2A A;  5CTN A;  1G5U A;  2Q9N A;  3T4O A;  4S2J A;  2WYX A;  4LFU A;  2XSS A;  3Q7V A;  3CZD A;  2W3H A;  3NCK A;  2OAQ 1;  3PAE A;  3S22 A;  5HSQ A;  1Y54 A;  1YMS A;  5HX9 A;  1BLP A;  1XJ6 A;  4P6B A;  3NC8 A;  5L8M A;  4ETX A;  3TW8 A;  1PNE A;  4GNU A;  2V0W A;  4ID4 A;  1CK3 A;  4OQH A;  1KGE A;  5HWT A;  1KGF A;  1LSX A;  3UE6 A;  4WBG A;  5FAS A;  4MN7 A;  2P04 A;  2XD1 A;  3BJN A;  5CRF A;  2ZBB A;  3BW6 A;  1L3L A;  4EBN A;  4GS9 A;  1NLY A;  1NRJ A;  2H0T A;  4IVK A;  3HLB A;  5F69 A;  3FZC A;  5GHX A;  4LV1 A;  1BUE A;  5IS1 A;  4MLL A;  5FI2 A;  3F1N B;  4HP9 A;  3GQZ A;  5HDS A;  4HBU A;  2ZD8 A;  1X0O A;  4OOY A;  3GTC A;  5IU1 A;  1TS7 A;  4R6L A;  2Y8H A;  1YSQ A;  3H7W B;  5HL1 A;  5CGW A;  2Y2Q A;  5AQ9 A;  3LIB A;  3C5A A;  4JBF A;  5CXW A;  4PM7 A;  1ERQ A;  1PZP A;  5DF8 A;  2WUQ A;  4Q0H A;  2BG1 A;  3ZG0 A;  3IF6 C;  3UB8 A;  3W8K A;  1NWZ A;  1S4S A;  5LBR A;  4EUZ A;  2V1B A;  3D9Y A;  4X55 A;  4DXB A;  3ITA A;  1W63 M;  5FAO A;  3VOL A;  3D4F A;  1S6R A;  3NY4 A;  4QPR A;  2K31 A;  4B88 A;  5EPH A;  1SDE A;  2ZM2 A;  1K54 A;  5AVE A;  2OAP 1;  3QP2 A;  1XJ2 A;  2XR0 A;  5HDC A;  4D2O A;  4WZ4 A;  1OTI A;  4WZ5 A;  1SKO A;  4DE2 A;  3V50 A;  4E3N A;  5CHJ A;  2HP6 A;  3DWK A;  3IWO A;  4EEP A;  4HH2 A;  4MN6 A;  3V5M A;  3UB9 A;  1RCJ A;  5FEG A;  2PRF A;  4OPZ A;  4Y15 A;  3N7W A;  4MBF A;  4S2N A;  5A8B A;  2W0N A;  5EM0 A;  3BM6 A;  3LR3 A;  3DTM A;  5L07 A;  3HUM A;  5MC7 A;  1DP6 A;  3NUL A;  2PBD P;  3Q82 A;  3EEA A;  1GA9 A;  2X02 A;  1HZO A;  4ARZ B;  4MBK A;  2WAF A;  2G2W A;  5KIZ A;  3GR2 A;  1N4O A;  3LIF A;  1G68 A;  1L0F A;  3SH9 A;  3DTK A;  2WKI A;  4PMA A;  1V9Z A;  1K0K A;  2ZC5 B;  3T4L A;  3ULF A;  2RCX A;  2EFX A;  2OSU A;  3V3R A;  1S1Z A;  2J3W A;  1OTA A;  2ZMF A;  1L0E A;  4PKY A;  1SCW A;  2Y2K A;  4R38 A;  3MJQ A;  3CPT A;  3NOT C;  3O88 A;  4HI4 A;  2PT7 A;  4JLF A;  4NET A;  4NK3 A;  1ZC2 A;  1K54 C;  4DE1 A;  3V3S A;  5CTM A;  3IWI A;  2UV0 E;  3UPO A;  5E2H A;  2A3U A;  2O9B A;  3MR0 A;  1OTB A;  4KQQ A;  5IHV A;  3MSH A;  4OOM A;  2G2U A;  5G18 A;  1YQS A;  1FCM A;  4I3J A;  1VEU A;  3LEZ A;  4Q0I A;  4UQI M;  4OLD A;  3A3J A;  1U60 A;  1PI4 A;  3B33 A;  3H82 A;  1ALQ A;  2PDR A;  1LI0 A;  3BEB A;  3VE4 A;  1NXY A;  2ZLY A;  4B9O A;  1G6A A;  3HCY A;  4Z1W A;  2WKH A;  1G6O A;  1RGZ A;  4Y13 A;  5M19 A;  3LR4 A;  2BAS A;  2D01 A;  4N9K A;  5DJT A;  1TDL A;  3VFH A;  3VOY A;  3ZG8 B;  1GSV A;  1PZO A;  4I3I A;  4DE0 A;  3NOU C;  3TRC A;  4BQM A;  3U4L P;  4EV4 A;  2ZC3 B;  1DP8 A;  4Y0U A;  5DTS A;  2AVX A;  2Y2H A;  2VJW A;  4GW9 A;  4L9G A;  3JYI A;  1I2S A;  2GZA A;  1GA0 A;  4MEZ A;  5HAP A;  3H7W A;  3GMW A;  4F3L A;  1AXB A;  1CI8 A;  3Q81 A;  1ES2 A;  1O07 A;  3ISG A;  1T19 A;  3RFB A;  3BQ8 A;  4A5R A;  4X69 A;  4HJ3 A;  2E8J A;  5J3W A;  4BWI A;  4HNB A;  2V2F F;  3PXP A;  3CPT B;  2W1T B;  4R3A A;  1FOF A;  4QHC A;  5F83 A;  4ZDX A;  1XJ4 A;  1CQA A;  3C38 A;  3OPR A;  3UE3 A;  3G34 A;  1F98 A;  1H8Y A;  2CC1 A;  2Z6C A;  1KVM A;  1NRF A;  3BFE A;  3PBQ A;  4XT2 A;  4X1L A;  3O3V A;  4IJG A;  1K55 C;  2HJ9 C;  2DRW A;  1EWZ A;  3T4K A;  1TS8 A;  4R4S A;  1L0G A;  1EW0 A;  5HAR A;  1Q2Q A;  4GOG A;  2Y2J A;  4LV0 A;  1IYS A;  5U47 A;  1VM1 A;  3A3F A;  2WZZ A;  2XRN A;  4B93 A;  3VP2 A;  3S4X A;  3ZGA B;  3IX8 A;  2W3D A;  1AWI A;  1LSV A;  5E43 A;  2W3F A;  1FSW A;  3GRJ A;  2ZQ7 A;  4H6J A;  3WS4 A;  3E4Q A;  4XUZ A;  3RTY A;  3VFF A;  1C3B A;  3PBR A;  2XD5 A;  3VOZ A;  4HH3 A;  1DJB A;  1XA1 A;  3P7N A;  4O7D A;  1ESI A;  1YM1 A;  1OJG A;  4YIN A;  2JN7 A;  4E3L A;  2HZ5 A;  1YLZ A;  1JWV A;  4DE3 A;  2GNX A;  2Y2O A;  3FPW A;  1MZU A;  1WA9 A;  3T4J A;  5FI6 A;  1RGY A;  3QHY A;  2M1C A;  4NXF A;  4IUK A;  4U3T A;  1BZA A;  4KG2 A;  5HWW A;  4JXW A;  2YKH A;  2IWB A;  1OJ5 A;  4R23 A;  5TJJ A;  3NHQ A;  5GLA A;  4JXV A;  4S2L A;  1E3U D;  5KZH A;  4CJN A;  2VEA A;  3TE8 A;  5EUA A;  5BOH A;  5GLC A;  5CGX A;  1MWU A;  3UPN A;  1KOU A;  4MBH A;  1OPX A;  4E6W A;  4BD1 A;  2HDQ A;  5E2F A;  5FQQ A;  4KZB A;  4MNR A;  3IS2 B;  4MMN A;  3EEH A;  3E2K A;  4DJ3 A;  3DW0 A;  1IYO A;  5CGS A;  4KZ7 A;  4I5S A;  1BT5 A;  4R1G A;  4JF4 A;  3OLO A;  5TBM A;  1TVF A;  5FI7 A;  1ONH A;  4KQR A;  4O0P A;  3IXD A;  4XXR A;  2ZMV A;  4DDS A;  2K2N A;  3T1R A;  2IWD A;  4EQI A;  5D3O A;  3HLG A;  1SZV A;  3IH9 A;  1M40 A;  4B4Z A;  3T50 A;  3ICY A;  2PBY A;  4OQ0 A;  2JE5 A;  1VB6 A;  3HLD A;  5HZH A;  1G28 A;  3DAV A;  2P7J A;  1JVJ A;  4HHD A;  4H6J B;  3LO7 A;  5DTT A;  5EVI B;  3Q1F A;  3VV4 A;  3ZYT A;  2HDR A;  2WKP A;  2V0U A;  3MQQ A;  3SS4 A;  3C7U A;  4UEY A;  4QU3 A;  1PWG A;  4X53 A;  4UQI S;  2HP9 A;  4OPQ A;  1CEG A;  3ZQ5 A;  2HPB A;  2B02 A;  4HJ6 A;  4ME4 A;  4EXO A;  4P6Z S;  3MBZ A;  3UDX A;  3VSL A;  2D02 A;  3UY6 A;  3ITB A;  1ERO A;  1FQG A;  4PPR A;  2ZC4 B;  3E98 A;  4KQO A;  2KOI A;  2QZ6 A;  3HVF A;  3IHB A;  4PM5 A;  1MY8 A;  5HFO A;  4YWZ A;  2V20 A;  2VV7 A;  3NIA A;  2H5S A;  3WS0 A;  5HPF A;  2VA0 A;  4JKT A;  2QMI A;  1FR6 A;  2J80 A;  5E2E A;  3P09 A;  4NXB A;  4IUH A;  1Q2P A;  3G6O A;  4CLC A;  1BLS A;  4E04 A;  2VV6 A;  1BYW A;  2OLU A;  3MF0 A;  4HEF A;  2JBF A;  1PI5 A;  2B18 A;  2H10 A;  4ZAM A;  2KLI A;  3VSK A;  3DBA A;  4HOI A;  2INW A;  3RH8 B;  2W1T A;  3HLF A;  5M18 A;  1H8Z A;  1HTZ A;  3MS6 A;  2JKR I;  1UWP X;  5HL6 A;  4WLA A;  1DJC A;  2WKR A;  5A91 A;  4EEU A;  1S66 L;  2ZOI A;  1T1A A;  1K6R A;  2Q0O A;  3GSG A;  5FAT A;  2QWS A;  3MXQ A;  3LIA A;  4JGR A;  4JXS A;  5EE8 A;  3UNW A;  2XLN A;  1TDG A;  2L1M A;  4G3V A;  3V39 A;  4OPY A;  4BD0 A;  3VE3 A;  1P9W A;  4RYE A;  1FIK A;  1DY6 A;  2PAV P;  2G7U A;  1J9M A;  3PHY A;  3CHW P;  1KDW A;  3G30 A;  2A49 A;  2JKT I;  2O9C A;  3RXX A;  3MKE A;  3LY4 A;  4K0W A;  1E25 A;  5DFY A;  1IFQ A;  2JHE A;  3CI6 A;  2ACG A;  3W4Q A;  3LFV A;  1XGJ A;  4WMC D;  2EWV A;  2XEP A;  3L9K A;  4CLC D;  2Y2I A;  3P98 A;  3WRZ A;  5CED A;  4EBL A;  4KZ6 A;  4OP5 A;  4KQD A;  1N9O A;  2FFY A;  2VGL M;  5EVI D;  5F1G A;  3A0V A;  5K5B A;  2VX8 A;  1PWD A;  3W4O A;  3H9W A;  4P6Z M;  4IBR A;  3K3C A;  2ZL1 A;  5DKL A;  2V8F A;  3CLO A;  2MJ6 A;  3A0S A;  1K6S A;  1K38 A;  4OLG A;  3ZG7 B;  3OOV A;  1S1Y A;  2J3T D;  3FV7 A;  5HD3 A;  4JF6 A;  4X6T A;  1ZKJ A;  3OPL A;  2M7U A;  1BLH A;  1IKI A;  3N8L A;  1N9L A;  1PWC A;  1LHY A;  3UDI A;  3UME A;  1RP5 A;  3UMD A;  3O5Y A;  3EWK A;  1W63 Q;  1P97 A;  4QB8 A;  4RA7 A;  5GL9 A;  4OPR A;  3HBR A;  2J3T C;  4XUX A;  1PW1 A;  4HES A;  2V1A A;  4PM8 A;  1PRQ A;  3A3D A;  2Y2G A;  1GSW A;  1QME A;  2GJ3 A;  5CX7 A;  1WE4 A;  5HAQ A;  4Z9Q A;  5JYO A;  4CLC C;  3N8R A;  3I7J A;  2FH5 A;  2R9X A;  3IHA A;  3QNB A;  2XA7 M;  2VGL S;  2OLV A;  2HGV A;  3BQA A;  3KSI A;  3MFD A;  1BUL A;  2VGJ A;  4HY8 A;  3WS1 A;  3BLM A;  2ZOH A;  4PM6 A;  3F1P B;  5IT5 A;  4PKY G;  3BFG A;  3R7W B;  3C4P A;  5E2G A;  1K55 A;  4RX3 A;  5C5K A;  3MXS A;  4X56 A;  1KDS A;  2ZJ9 A;  1CI9 A;  1IYQ A;  3SOI A;  1FR1 A;  4X68 A;  4RX2 A;  4O8G A;  3PR6 A;  3EQU A;  3W4P A;  2PU4 A;  1ES5 A;  4FUW A;  5FDS A;  3N4I A;  3UO9 A;  3IXB A;  4GJ4 A;  3F1P A;  3WS2 A;  3B42 A;  1PFL A;  4D60 A;  4OON A;  2EFU A;  4JXG A;  1N9N A;  5TGF A;  2FZ0 A;  1DRM A;  3C7V A;  2L4R A;  4BJP A;  5FAP A;  3V67 A;  1PIO A;  3M6B A;  1O7E A;  2Z6D A;  4LCM A;  3F1O B;  3PTE A;  4FTX A;  4O01 A;  4B4X A;  3HL9 A;  4S2M A;  4N1X A;  2PU2 A;  4AFI A;  2I9V A;  1CF0 A;  3DWZ A;  4QWO A;  1OME A;  3MZF A;  4C3Q A;  2R78 A;  3BY8 A;  3G2Z A;  1ZTU A;  3JPU A;  3KYE A;  1W79 A;  1Y4O A;  4LV3 A;  3ZG5 A;  3LR0 A;  1JWZ A;  3GV9 A;  4S2P A;  1ZHH B;  4FOF A;  4KUO A;  1NYM A;  2EWW A;  3UE1 A;  3H82 B;  2QKP A;  3CIT A;  4BBV A;  3PBN A;  2ZQA A;  2OV5 A;  1S0W A;  2IA2 A;  2W3G A;  2XK1 A;  3UB6 A;  1SDN A;  2H0Y A;  2ZQ8 A;  3NDG A;  4IED A;  4BL2 A;  5EFW A;  3HJK A;  3FC7 A;  3PBS A; 
#chains in the Genus database with same CATH homology
 5HWV A;  5IS1 A;  3F1N B;  4HP9 A;  4O0P A;  5HDS A;  4NXE A;  1S67 L;  1X0O A;  2QHK A;  2QYB A;  2ZMV A;  5G4Z A;  3IBR A;  5IU1 A;  1TS7 A;  4R6L A;  2K2N A;  2Y8H A;  1YSQ A;  3H7W B;  4I38 A;  3LIB A;  4G3K A;  1TF1 A;  4LRZ E;  4EUV A;  1OTE A;  3T50 A;  3ICY A;  3KX0 X;  4Q0H A;  4WEK A;  1VB6 A;  4GS9 B;  5HZH A;  3LYX A;  2LB5 A;  3UB8 A;  1G28 A;  4EQ1 A;  2P7J A;  3E0Y A;  2PD7 A;  1NWZ A;  4WEJ A;  3IBJ A;  1S4S A;  4HHD A;  5LBR A;  4H6J B;  2V1B A;  2QJ5 A;  4ARZ A;  1W63 M;  4L9E A;  3VV4 A;  3ZYT A;  3PYP A;  1T18 A;  3VOL A;  2WKP A;  2V0U A;  5I5L A;  3MQQ A;  5FL3 A;  2DMW A;  4QPR A;  3K3D A;  2K31 A;  2VZW A;  4UEY A;  3C2W A;  3OCL A;  4UQI S;  5AVE A;  4GLQ A;  3F1O A;  2OAP 1;  1XJ2 A;  4I39 A;  1F9I A;  3ZQ5 A;  2HV1 A;  2B02 A;  3S7N A;  4HJ6 A;  3FPV A;  5HDC A;  4IHQ A;  1OTI A;  4ME4 A;  1H8M A;  4EXO A;  4P6Z S;  1OT6 A;  4EEP A;  3KYQ A;  4HH2 A;  2OWH A;  4MN6 A;  3LUQ A;  2JKT M;  3CAX A;  2XRO A;  3UB9 A;  2D02 A;  4MDZ A;  5DJU A;  3D3O A;  2K7S A;  4L0L A;  3PBT A;  1LL8 A;  2O99 A;  3E98 A;  3LID A;  3MQO A;  1DP9 A;  3E4O A;  4KQO A;  2KOI A;  5A8B A;  2W0N A;  1H3Q A;  2JKR M;  3LR3 A;  4YWZ A;  3W2Z A;  1YAX A;  5MC7 A;  4LRY C;  1DP6 A;  2VV7 A;  4ZRR A;  3R7W A;  3EEA A;  4ARZ B;  1TD5 A;  2VA0 A;  5HPF A;  5KIZ A;  3LIF A;  2J80 A;  4BBU A;  2KDK A;  4YOF A;  4EW7 A;  4NXB A;  4IUH A;  2VV8 A;  3G6O A;  4CLC A;  1V9Z A;  4E04 A;  3PBO A;  2VV6 A;  1BYW A;  4HQA A;  4Y5F A;  3T4L A;  3ULF A;  3K2N A;  3MF0 A;  3R4K A;  3MFX A;  3T4S A;  1S1Z A;  2B18 A;  2J3W A;  2KLI A;  1OTA A;  2ZMF A;  3DBA A;  4HOI A;  3C8C A;  4L9F A;  4PKY A;  1MC0 A;  2INW A;  3RH8 B;  3BWL A;  4II7 A;  4R38 A;  3MJQ A;  2W1T A;  1S4R A;  3NOT C;  2EA9 A;  2A24 A;  2YKF A;  4HI4 A;  2JKR I;  1UWP X;  5HL6 A;  4WLA A;  2PT7 A;  2WKR A;  4EEU A;  4JGO A;  1S66 L;  4OOL A;  3NJA A;  4YNR A;  2ZOI A;  1T1A A;  5J4E A;  2V9A A;  1MKM A;  2QWS A;  2O9B A;  3MXQ A;  3LIA A;  4JGR A;  3FG8 A;  3MR0 A;  4CLC B;  5KSH A;  1OTB A;  4BMW A;  2CMN A;  2L1M A;  2QJ7 A;  3GDI A;  3MQ0 A;  4G3V A;  4OOM A;  3S7P A;  4CLC E;  3VE3 A;  4I3J A;  4LLO B;  1P9W A;  3P01 A;  4WUJ A;  4EET B;  4Q0I A;  2PR5 A;  4UQI M;  2A24 B;  4WN5 A;  4EER A;  2G7U A;  3PHY A;  2OWJ A;  3B33 A;  3H82 A;  3EOI A;  2PDR A;  2JKT I;  1V9Y A;  1XFN A;  2O9C A;  4M4X A;  1UGU A;  2HF6 A;  1D7E A;  3VE4 A;  5DFY A;  5F68 A;  1IFQ A;  2JHE A;  3CI6 A;  4B9O A;  3LFV A;  2EWV A;  1JNU A;  3HCY A;  4Z1W A;  4CLC D;  4HJ4 A;  3TJZ C;  4GHI A;  1G6O A;  5F5Y A;  3S7Q A;  1TS0 A;  3LR4 A;  2BAS A;  4PAU A;  2D01 A;  4CQH A;  4DJ2 A;  5DJT A;  3OCN A;  1YKD A;  4KQD A;  1N9O A;  1GSV A;  5F6A A;  2VGL M;  4I3I A;  4JGQ A;  3E4P A;  3A0V A;  3NOU C;  4EES A;  5K5B A;  3TRC A;  2VX8 A;  3KYZ A;  3B47 A;  4WF0 A;  1GSX A;  3F1N A;  4XT2 B;  3KSF A;  1DP8 A;  2W27 A;  1Y28 A;  3H9W A;  4P6Z M;  2VJW A;  4GW9 A;  3K3C A;  5DKL A;  4L9G A;  5HPI A;  2GZA A;  3CUE C;  3CLO A;  2NUT C;  2MJ6 A;  3A0S A;  4NEE D;  3EQV A;  4FSF A;  5AJG A;  3H7W A;  4WEL A;  2O9A A;  1XFQ A;  3D72 A;  3OOV A;  1S1Y A;  2J3T D;  4R70 A;  4F3L A;  5HD3 A;  2M7U A;  3LIC A;  1N9L A;  1T19 A;  3RFB A;  3LR5 A;  3BQ8 A;  3UME A;  4HJ3 A;  3UMD A;  5J3W A;  4BWI A;  3O5Y A;  3EWK A;  4Q0J A;  3EGX C;  1W63 Q;  4HNB A;  2VKS A;  1P97 A;  3UB7 A;  3PXP A;  2O0Y A;  1NLZ A;  4BBT A;  4HIA A;  4MN5 A;  2W1T B;  1OT9 A;  2J3T C;  4R3A A;  5HD5 A;  4WL9 A;  2P08 A;  2V1A A;  1ODV A;  1XJ4 A;  4Y2F A;  3T4T A;  2PD8 A;  3C38 A;  3BY9 A;  3UE3 A;  1F98 A;  2Z6C A;  4RQ9 A;  1GSW A;  2GJ3 A;  5CX7 A;  2Y79 A;  4DMZ A;  3PBQ A;  4XT2 A;  2L0W A;  4NKP A;  4CLC C;  4F3L B;  3EGD C;  2FH5 A;  4IJG A;  2XA7 M;  2VLG A;  2HJ9 C;  4LPZ A;  2NUP C;  2VGL S;  2HGV A;  3T4K A;  1TS8 A;  3BQA A;  1OTD A;  3KSI A;  4HY8 A;  1EW0 A;  2ZOH A;  1XJ3 A;  3F1P B;  2XA7 S;  5IT5 A;  4PKY G;  1P9R A;  2A2L A;  3R7W B;  2GX5 A;  5G4Y A;  2H28 A;  5HDD A;  3JVV A;  5C5K A;  5DKK A;  3NOP C;  1LSW A;  1LT0 A;  2PYR A;  2XRN A;  3KSH A;  2PYP A;  1F5M A;  4B93 A;  4JGP A;  4EU0 A;  2M7V A;  2KX6 A;  3OBF A;  3JVU A;  3KO6 A;  4O8G A;  3PR6 A;  3EQU A;  2W3D A;  4GHI B;  1D06 A;  1LSV A;  2LB9 A;  3S7O A;  3C30 A;  1VHM A;  2W3F A;  2PHY A;  3LIE A;  4MCW A;  4DN0 A;  1IOU A;  4GJ4 A;  3F1P A;  4HP4 A;  3B42 A;  4H6J A;  4Y3I A;  3E4Q A;  3T4Q A;  3RTY A;  2W3E A;  3OC2 A;  1N9N A;  3PBR A;  5DF9 A;  2FZ0 A;  1DRM A;  1P0Z A;  4HH3 A;  1STZ A;  3IS2 A;  1T1B A;  1UWN X;  2L4R A;  2WKQ A;  2OOL A;  1YSP A;  3P7N A;  4LRX C;  3U2A A;  4BJP A;  3V67 A;  1OJG A;  5J7E A;  2Z6D A;  2W1R A;  4PHT A;  2JN7 A;  3T4O A;  3CUE A;  3F1O B;  2GNX A;  5TBM B;  4O01 A;  3FPW A;  1MZU A;  1WA9 A;  2XSS A;  3T4J A;  3A0R A;  2W3H A;  4GCZ A;  2OAQ 1;  4AFI A;  1T1C A;  2HJE A;  2M1C A;  5HSQ A;  4NXF A;  2PR6 A;  4IUK A;  2I9V A;  5HWW A;  2YKH A;  3KSG A;  4G3W A;  4I3A A;  1OJ5 A;  1XJ6 A;  5TJJ A;  3NHQ A;  2R78 A;  3HJI A;  3BY8 A;  1ZTU A;  2VEA A;  4KUK A;  3LI8 A;  5L8M A;  3TE8 A;  3CWF A;  4ETX A;  3TW8 A;  3MMH A;  3LR0 A;  2V0W A;  5HWT A;  1KOU A;  3UE6 A;  1LSX A;  1OPX A;  4NXG A;  1ZHH B;  4FOF A;  5AVF A;  4KUO A;  4MN7 A;  3GEC A;  2P04 A;  3BJN A;  2EWW A;  4K08 A;  2ZBB A;  3BW6 A;  3H82 B;  3IS2 B;  2QKP A;  3EEH A;  4MMN A;  3CIT A;  3LI9 A;  4BBV A;  3PBN A;  4DJ3 A;  2IA2 A;  4GS9 A;  1NLY A;  2W3G A;  3SW1 A;  1NRJ A;  1TS6 A;  3UB6 A;  5DFX A;  4I5S A;  3OLO A;  5EFW A;  5TBM A;  5F69 A;  3HJK A;  3FC7 A;  3PBS A;  4ETZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...