4HNKA

Crystal structure of an enzyme
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
180
Chain Sequence
PSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGITDVISIVDVINYISSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIIPFNNIEIQNKEIMNTKKKVIEIISKNTEKDTNVISNVLERDKYFNADEAVDFKLIDHILEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Inactive Subunit of the Apicoplast-localized Caseinolytic Protease Complex of Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 60
structure length 180
sequence length 183
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4hnkA00
2PPYA 4U18A 4KWBA 2Q2XA 3Q1TA 2CBYA 3R9SA 4OLQA 4WYOB 3MOYA 3K50A 4NEKA 5DUFA 3H0JA 1N6DA 4B3HA 4K3WA 3WG5A 2X24A 2BZRA 4Q0GA 4LK5A 2VSUE 3M6NA 1EF9A 4QIJA 3HE2A 4JCQA 3ISAA 2FZSA 1RJNA 3PEAA 3ZW8A 1X0UA 3QXIA 4U19A 1SG4A 3PGQA 4JWVA 3VIVA 3OMEA 5C9GA 3U9SB 2FBMA 4EMLA 3R9QA 1TG6A 1K32A 5IKLB 2J5II 3G64A 1EY3A 2ZL0A 3KTGA 3N6RB 3PZKA 3ZW9A 3U9TB 3GKBA 4QFEA 4RYFA 3TLFA 4EMPA 2A81A 3DJAA 2F6QA 3RSTA 5DZKA 4K2NA 3IAVA 3KTJA 3QREA 5INGA 2DUBA 1HZDA 2QQ3A 3Q7HA 3TRRA 4B3JA 5G1QA 5KDRB 3OC7A 1YG6A 1TYFA 3P85A 2ZL3A 3LAOA 3SWXA 5DTPA 5JBWA 1PIXA 4MOUA 3QYRA 1ON9A 1JXZA 4FNDA 1UYSA 3SLLA 3JU1A 1OD2A 4FB8A 3R0OA 5KDRA 3PE8A 4GM2A 2HW5A 5KJPA 2GTRA 3T88A 3MFMA 3KTKA 4FZWC 4U0HA 4OMRA 4JCSA 4ZDCA 2ZL4A 4K29A 5FUSA 2PG8A 2NP9A 3U9RB 3V5EA 3TV5A 5DKPA 2J5GA 2VSSA 4YLHA 5DUCA 5JBXA 5INIA 3Q0GA 4IZBA 4JSBA 3NJDA 4G2RA 5MGBA 3T8BA 4DI1A 2ZQRA 3RSIA 1O8UA 3TT6A 1HNUA 3KTHA 2Q35A 3RRVA 3BEZA 3M6MA 1W2XA 1N6EA 4KPKA 2WTBA 3R6HA 4L6WA 3GMAA 3TVWA 3L3SA 1OD4A 3V5IA 3IBBA 1FCFA 1FC6A 3ZWAA 2VSSE 3GF7A 3Q0JA 4U0GH 2A7SA 5DU4A 1FC9A 5C90A 5DTWA 5DZKH 1WDLA 3QMJA 1Q51A 1RJMA 4IZDA 3T89A 4I42A 1J7XA 2F9IB 2VSUA 3ST9A 4Q1IA 3K8XA 3R9TA 3QXZA 4MXIA 3ZWBA 3QWDA 4HNKA 4FN8A 4RYFH 1UYVA 2J5SA 4OG1A 2X58A 3H02A 1Y7OA 4ELSA 4I52A 2VSUF 2F9YB 2VX2A 1WDMA 4ZDDA 4GHNA 5DL1A 2FW2A 4ZDFA 4Z0MA 3KTIA 2W3PA 4B3IA 3TZ3A 4FN7A 3H0QA 3NJBA 3HINA 2D3TA 2J5IB 3H0UA 1UYTA 2VSUC 1EF8A 4ELWA 2DEOA 1K39A 2F6IA 3IB9A 4JFCA 3T8AA 2Q34A 4JCTA 3TDCA 4ZDBA 3STAA 1NZYA 1XNWA 2C8TA 3P5MA 4I4ZA 2J5GD 1Q52A 3H0SA 4EMMA 3H81A 4JJTA 1UIYA 4IZCA 1XNVA 4FZWA 4NNQA 4L8KA 4RCNA 1MJ3A 2PBPA 4ASIA 2CE3A 1ON3A 3KQFA 3QKAA 4ZU2A 1DCIA 4MI2A 5G1RA 4ZDEA 1N6FA 3T3WA 2UZFA 1PJHA 2VREA 3MT6A 5CTCA 1WDKA 3BPPA 5E0SH 4QIIA 2EJ5A 5DU6A 4JYJA 4JVTA 4JOTA 4WZ8B 2ZL2A 4U0GA 3HP0A 1FC7A 2ZQQA 2J5IA 3TT7A 3P2LA 5CTBA 2F9IA 1VRGA 2A7KA 3I47A 5E0SA 1XO6A 1HNOA 1WZ8A 2IEXA 1YG8A 1UYRA 4FNBA 3QK8A 5FIFA 3ZWCA 3MYBA 2F9YA 5INFA 4ELXA 3FF6A 4F47A 3GLMA 3GF3A 1XX4A 5E0NX 3LKEA 2VSSF 3BF0A 4HC8A 4WCZA 4JCRA 4KNPA 3DORA 1NZYB 3HRXA 4JYLA 5G1SA 4KD6A 3HLN1 3OT6A 4U1AA 1SZOA 3TVUA 4FJWD 1XNYA 3FDUA 1DUBA 5DU8A
chains in the Genus database with same CATH superfamily
2PPYA 4U18A 4KWBA 2Q2XA 3Q1TA 2CBYA 3R9SA 4OLQA 4WYOB 3MOYA 3K50A 4NEKA 5DUFA 3H0JA 1N6DA 4B3HA 4K3WA 3WG5A 2X24A 2BZRA 4Q0GA 4LK5A 2VSUE 3M6NA 1EF9A 4QIJA 4J2UA 3HE2A 4JCQA 3ISAA 2FZSA 1RJNA 3PEAA 3ZW8A 1X0UA 3QXIA 4U19A 1SG4A 3PGQA 4JWVA 3VIVA 3OMEA 5C9GA 3U9SB 2FBMA 4EMLA 3R9QA 1TG6A 1K32A 5IKLB 2J5II 3G64A 1EY3A 2ZL0A 3KTGA 3N6RB 3PZKA 3ZW9A 3U9TB 3GKBA 4QFEA 4RYFA 3TLFA 4EMPA 2A81A 2YJGA 3DJAA 2F6QA 3RSTA 5DZKA 4K2NA 3IAVA 3KTJA 3QREA 5INGA 2DUBA 1HZDA 2QQ3A 3Q7HA 3TRRA 4B3JA 5G1QA 5KDRB 3OC7A 1YG6A 1TYFA 3P85A 2ZL3A 3LAOA 3SWXA 5DTPA 5JBWA 1PIXA 4MOUA 3QYRA 1ON9A 1JXZA 4FNDA 1UYSA 3SLLA 3JU1A 1OD2A 4FB8A 3R0OA 5KDRA 3PE8A 4GM2A 2HW5A 5KJPA 2GTRA 3T88A 3MFMA 3KTKA 4FZWC 4U0HA 4OMRA 4JCSA 4ZDCA 2ZL4A 4K29A 5FUSA 2PG8A 2NP9A 3U9RB 3V5EA 3TV5A 5DKPA 2J5GA 2VSSA 4YLHA 5DUCA 5JBXA 5INIA 3Q0GA 4IZBA 4JSBA 3NJDA 4G2RA 5MGBA 3T8BA 4DI1A 2ZQRA 3RSIA 1O8UA 3TT6A 1HNUA 4HDTA 3KTHA 2Q35A 3RRVA 3BEZA 3M6MA 1W2XA 1N6EA 4KPKA 5HUQA 2WTBA 3R6HA 4L6WA 3GMAA 3TVWA 3L3SA 1OD4A 3V5IA 3IBBA 1FCFA 1FC6A 3ZWAA 2VSSE 3GF7A 3Q0JA 4U0GH 2A7SA 5DU4A 1FC9A 4NARA 5C90A 5DTWA 5DZKH 1WDLA 3QMJA 1Q51A 1RJMA 4IZDA 3T89A 4I42A 1J7XA 2F9IB 2VSUA 3ST9A 4Q1IA 3K8XA 3R9TA 3QXZA 4MXIA 3ZWBA 3QWDA 4HNKA 4FN8A 4RYFH 1UYVA 2J5SA 4OG1A 2X58A 3H02A 1Y7OA 4ELSA 4I52A 2VSUF 2F9YB 2VX2A 1WDMA 4ZDDA 4GHNA 5DL1A 2FW2A 4ZDFA 4Z0MA 3KTIA 2W3PA 4B3IA 3TZ3A 4FN7A 3H0QA 3NJBA 3HINA 2D3TA 2J5IB 3H0UA 1UYTA 2VSUC 1EF8A 4ELWA 2DEOA 1K39A 2F6IA 3IB9A 4JFCA 3T8AA 2Q34A 4JCTA 3TDCA 4ZDBA 3STAA 1NZYA 1XNWA 2C8TA 3P5MA 4I4ZA 2J5GD 1Q52A 3H0SA 4EMMA 3H81A 4JJTA 1UIYA 4IZCA 1XNVA 4FZWA 4NNQA 4L8KA 4RCNA 1MJ3A 2PBPA 4ASIA 2CE3A 1ON3A 3KQFA 3QKAA 4ZU2A 1DCIA 4MI2A 5G1RA 4ZDEA 1N6FA 3T3WA 2UZFA 1PJHA 2VREA 3MT6A 3BPTA 5CTCA 1WDKA 3BPPA 5E0SH 4QIIA 2EJ5A 5DU6A 4JYJA 4JVTA 4JOTA 4WZ8B 2ZL2A 4U0GA 3HP0A 1FC7A 2ZQQA 2J5IA 3TT7A 3P2LA 5CTBA 2F9IA 1VRGA 2A7KA 3I47A 5E0SA 1XO6A 1HNOA 1WZ8A 2IEXA 1YG8A 1UYRA 4FNBA 3QK8A 5FIFA 3ZWCA 3MYBA 2F9YA 5INFA 4ELXA 3FF6A 4F47A 3GLMA 3GF3A 1XX4A 5E0NX 3LKEA 2VSSF 3BF0A 4HC8A 4WCZA 4JCRA 4KNPA 3DORA 1NZYB 3HRXA 4JYLA 5G1SA 4KD6A 3HLN1 3OT6A 4U1AA 1SZOA 3TVUA 4FJWD 1XNYA 3FDUA 1DUBA 5DU8A
chains in the Genus database with same CATH topology
2PPYA 4U18A 4KWBA 2Q2XA 3Q1TA 2CBYA 3R9SA 4OLQA 4WYOB 3MOYA 3K50A 4NEKA 5DUFA 3H0JA 1N6DA 4B3HA 4K3WA 3WG5A 2X24A 2BZRA 4Q0GA 4LK5A 2VSUE 3M6NA 1EF9A 4QIJA 4J2UA 3HE2A 4JCQA 3ISAA 2FZSA 1RJNA 3PEAA 3ZW8A 1X0UA 3QXIA 4U19A 1SG4A 3PGQA 4JWVA 3VIVA 3OMEA 5C9GA 3U9SB 2FBMA 4EMLA 3R9QA 1TG6A 1K32A 5IKLB 2J5II 3G64A 1EY3A 2ZL0A 3KTGA 3N6RB 3PZKA 3ZW9A 3U9TB 3GKBA 4QFEA 4RYFA 3TLFA 4EMPA 2A81A 2YJGA 3DJAA 2F6QA 3RSTA 5DZKA 4K2NA 3IAVA 3KTJA 3QREA 5INGA 2DUBA 1HZDA 2QQ3A 3Q7HA 3TRRA 4B3JA 5G1QA 5KDRB 3OC7A 1YG6A 1TYFA 3P85A 2ZL3A 3LAOA 3SWXA 5DTPA 5JBWA 1PIXA 4MOUA 3QYRA 1ON9A 1JXZA 4FNDA 1UYSA 3SLLA 3JU1A 1OD2A 4FB8A 3R0OA 5KDRA 3PE8A 4GM2A 2HW5A 5KJPA 2GTRA 3T88A 3MFMA 3KTKA 4FZWC 4U0HA 4OMRA 4JCSA 4ZDCA 2ZL4A 4K29A 5FUSA 2PG8A 2NP9A 3U9RB 3V5EA 3TV5A 5DKPA 2J5GA 2VSSA 4YLHA 5DUCA 5JBXA 5INIA 3Q0GA 4IZBA 4JSBA 3NJDA 4G2RA 5MGBA 3T8BA 4DI1A 2ZQRA 3RSIA 1O8UA 3TT6A 1HNUA 4HDTA 3KTHA 2Q35A 3RRVA 3BEZA 3M6MA 1W2XA 1N6EA 4KPKA 5HUQA 2WTBA 3R6HA 4L6WA 3GMAA 3TVWA 3L3SA 1OD4A 3V5IA 3IBBA 1FCFA 1FC6A 3ZWAA 2VSSE 3GF7A 3Q0JA 4U0GH 2A7SA 5DU4A 1FC9A 4NARA 5C90A 5DTWA 5DZKH 1WDLA 3QMJA 1Q51A 1RJMA 4IZDA 3T89A 4I42A 1J7XA 2F9IB 2VSUA 3ST9A 4Q1IA 3K8XA 3R9TA 3QXZA 4MXIA 3ZWBA 3QWDA 4HNKA 4FN8A 4RYFH 1UYVA 2J5SA 4OG1A 2X58A 3H02A 1Y7OA 4ELSA 4I52A 2VSUF 2F9YB 2VX2A 1WDMA 4ZDDA 4GHNA 5DL1A 2FW2A 4ZDFA 4Z0MA 3KTIA 2W3PA 4B3IA 3TZ3A 4FN7A 3H0QA 3NJBA 3HINA 2D3TA 2J5IB 3H0UA 1UYTA 2VSUC 1EF8A 4ELWA 2DEOA 1K39A 2F6IA 3IB9A 4JFCA 3T8AA 2Q34A 4JCTA 3TDCA 4ZDBA 3STAA 1NZYA 1XNWA 2C8TA 3P5MA 4I4ZA 2J5GD 1Q52A 3H0SA 4EMMA 3H81A 4JJTA 1UIYA 4IZCA 1XNVA 4FZWA 4NNQA 4L8KA 4RCNA 1MJ3A 2PBPA 4ASIA 2CE3A 1ON3A 3KQFA 3QKAA 4ZU2A 1DCIA 4MI2A 5G1RA 4ZDEA 1N6FA 3T3WA 2UZFA 1PJHA 2VREA 3MT6A 3BPTA 5CTCA 1WDKA 3BPPA 5E0SH 4QIIA 2EJ5A 5DU6A 4JYJA 4JVTA 4JOTA 4WZ8B 2ZL2A 4U0GA 3HP0A 1FC7A 2ZQQA 2J5IA 3TT7A 3P2LA 5CTBA 2F9IA 1VRGA 2A7KA 3I47A 5E0SA 1XO6A 1HNOA 1WZ8A 2IEXA 1YG8A 1UYRA 4FNBA 3QK8A 5FIFA 3ZWCA 3MYBA 2F9YA 5INFA 4ELXA 3FF6A 4F47A 3GLMA 3GF3A 1XX4A 5E0NX 3LKEA 2VSSF 3BF0A 4HC8A 4WCZA 4JCRA 4KNPA 3DORA 1NZYB 3HRXA 4JYLA 5G1SA 4KD6A 3HLN1 3OT6A 4U1AA 1SZOA 3TVUA 4FJWD 1XNYA 3FDUA 1DUBA 5DU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPY A;  4U18 A;  4KWB A;  2Q2X A;  3Q1T A;  2CBY A;  3R9S A;  4OLQ A;  4WYO B;  3MOY A;  3K50 A;  4NEK A;  5DUF A;  3H0J A;  1N6D A;  4B3H A;  4K3W A;  3WG5 A;  2X24 A;  2BZR A;  4Q0G A;  4LK5 A;  2VSU E;  3M6N A;  1EF9 A;  4QIJ A;  3HE2 A;  4JCQ A;  3ISA A;  2FZS A;  1RJN A;  3PEA A;  3ZW8 A;  1X0U A;  3QXI A;  4U19 A;  1SG4 A;  3PGQ A;  4JWV A;  3VIV A;  3OME A;  5C9G A;  3U9S B;  2FBM A;  4EML A;  3R9Q A;  1TG6 A;  1K32 A;  5IKL B;  2J5I I;  3G64 A;  1EY3 A;  2ZL0 A;  3KTG A;  3N6R B;  3PZK A;  3ZW9 A;  3U9T B;  3GKB A;  4QFE A;  4RYF A;  3TLF A;  4EMP A;  2A81 A;  3DJA A;  2F6Q A;  3RST A;  5DZK A;  4K2N A;  3IAV A;  3KTJ A;  3QRE A;  5ING A;  2DUB A;  1HZD A;  2QQ3 A;  3Q7H A;  3TRR A;  4B3J A;  5G1Q A;  5KDR B;  3OC7 A;  1YG6 A;  1TYF A;  3P85 A;  2ZL3 A;  3LAO A;  3SWX A;  5DTP A;  5JBW A;  1PIX A;  4MOU A;  3QYR A;  1ON9 A;  1JXZ A;  4FND A;  1UYS A;  3SLL A;  3JU1 A;  1OD2 A;  4FB8 A;  3R0O A;  5KDR A;  3PE8 A;  4GM2 A;  2HW5 A;  5KJP A;  2GTR A;  3T88 A;  3MFM A;  3KTK A;  4FZW C;  4U0H A;  4OMR A;  4JCS A;  4ZDC A;  2ZL4 A;  4K29 A;  5FUS A;  2PG8 A;  2NP9 A;  3U9R B;  3V5E A;  3TV5 A;  5DKP A;  2J5G A;  2VSS A;  4YLH A;  5DUC A;  5JBX A;  5INI A;  3Q0G A;  4IZB A;  4JSB A;  3NJD A;  4G2R A;  5MGB A;  3T8B A;  4DI1 A;  2ZQR A;  3RSI A;  1O8U A;  3TT6 A;  1HNU A;  3KTH A;  2Q35 A;  3RRV A;  3BEZ A;  3M6M A;  1W2X A;  1N6E A;  4KPK A;  2WTB A;  3R6H A;  4L6W A;  3GMA A;  3TVW A;  3L3S A;  1OD4 A;  3V5I A;  3IBB A;  1FCF A;  1FC6 A;  3ZWA A;  2VSS E;  3GF7 A;  3Q0J A;  4U0G H;  2A7S A;  5DU4 A;  1FC9 A;  5C90 A;  5DTW A;  5DZK H;  1WDL A;  3QMJ A;  1Q51 A;  1RJM A;  4IZD A;  3T89 A;  4I42 A;  1J7X A;  2F9I B;  2VSU A;  3ST9 A;  4Q1I A;  3K8X A;  3R9T A;  3QXZ A;  4MXI A;  3ZWB A;  3QWD A;  4HNK A;  4FN8 A;  4RYF H;  1UYV A;  2J5S A;  4OG1 A;  2X58 A;  3H02 A;  1Y7O A;  4ELS A;  4I52 A;  2VSU F;  2F9Y B;  2VX2 A;  1WDM A;  4ZDD A;  4GHN A;  5DL1 A;  2FW2 A;  4ZDF A;  4Z0M A;  3KTI A;  2W3P A;  4B3I A;  3TZ3 A;  4FN7 A;  3H0Q A;  3NJB A;  3HIN A;  2D3T A;  2J5I B;  3H0U A;  1UYT A;  2VSU C;  1EF8 A;  4ELW A;  2DEO A;  1K39 A;  2F6I A;  3IB9 A;  4JFC A;  3T8A A;  2Q34 A;  4JCT A;  3TDC A;  4ZDB A;  3STA A;  1NZY A;  1XNW A;  2C8T A;  3P5M A;  4I4Z A;  2J5G D;  1Q52 A;  3H0S A;  4EMM A;  3H81 A;  4JJT A;  1UIY A;  4IZC A;  1XNV A;  4FZW A;  4NNQ A;  4L8K A;  4RCN A;  1MJ3 A;  2PBP A;  4ASI A;  2CE3 A;  1ON3 A;  3KQF A;  3QKA A;  4ZU2 A;  1DCI A;  4MI2 A;  5G1R A;  4ZDE A;  1N6F A;  3T3W A;  2UZF A;  1PJH A;  2VRE A;  3MT6 A;  5CTC A;  1WDK A;  3BPP A;  5E0S H;  4QII A;  2EJ5 A;  5DU6 A;  4JYJ A;  4JVT A;  4JOT A;  4WZ8 B;  2ZL2 A;  4U0G A;  3HP0 A;  1FC7 A;  2ZQQ A;  2J5I A;  3TT7 A;  3P2L A;  5CTB A;  2F9I A;  1VRG A;  2A7K A;  3I47 A;  5E0S A;  1XO6 A;  1HNO A;  1WZ8 A;  2IEX A;  1YG8 A;  1UYR A;  4FNB A;  3QK8 A;  5FIF A;  3ZWC A;  3MYB A;  2F9Y A;  5INF A;  4ELX A;  3FF6 A;  4F47 A;  3GLM A;  3GF3 A;  1XX4 A;  5E0N X;  3LKE A;  2VSS F;  3BF0 A;  4HC8 A;  4WCZ A;  4JCR A;  4KNP A;  3DOR A;  1NZY B;  3HRX A;  4JYL A;  5G1S A;  4KD6 A;  3HLN 1;  3OT6 A;  4U1A A;  1SZO A;  3TVU A;  4FJW D;  1XNY A;  3FDU A;  1DUB A;  5DU8 A; 
#chains in the Genus database with same CATH topology
 2PPY A;  4U18 A;  4KWB A;  2Q2X A;  3Q1T A;  2CBY A;  3R9S A;  4OLQ A;  4WYO B;  3MOY A;  3K50 A;  4NEK A;  5DUF A;  3H0J A;  1N6D A;  4B3H A;  4K3W A;  3WG5 A;  2X24 A;  2BZR A;  4Q0G A;  4LK5 A;  2VSU E;  3M6N A;  1EF9 A;  4QIJ A;  4J2U A;  3HE2 A;  4JCQ A;  3ISA A;  2FZS A;  1RJN A;  3PEA A;  3ZW8 A;  1X0U A;  3QXI A;  4U19 A;  1SG4 A;  3PGQ A;  4JWV A;  3VIV A;  3OME A;  5C9G A;  3U9S B;  2FBM A;  4EML A;  3R9Q A;  1TG6 A;  1K32 A;  5IKL B;  2J5I I;  3G64 A;  1EY3 A;  2ZL0 A;  3KTG A;  3N6R B;  3PZK A;  3ZW9 A;  3U9T B;  3GKB A;  4QFE A;  4RYF A;  3TLF A;  4EMP A;  2A81 A;  2YJG A;  3DJA A;  2F6Q A;  3RST A;  5DZK A;  4K2N A;  3IAV A;  3KTJ A;  3QRE A;  5ING A;  2DUB A;  1HZD A;  2QQ3 A;  3Q7H A;  3TRR A;  4B3J A;  5G1Q A;  5KDR B;  3OC7 A;  1YG6 A;  1TYF A;  3P85 A;  2ZL3 A;  3LAO A;  3SWX A;  5DTP A;  5JBW A;  1PIX A;  4MOU A;  3QYR A;  1ON9 A;  1JXZ A;  4FND A;  1UYS A;  3SLL A;  3JU1 A;  1OD2 A;  4FB8 A;  3R0O A;  5KDR A;  3PE8 A;  4GM2 A;  2HW5 A;  5KJP A;  2GTR A;  3T88 A;  3MFM A;  3KTK A;  4FZW C;  4U0H A;  4OMR A;  4JCS A;  4ZDC A;  2ZL4 A;  4K29 A;  5FUS A;  2PG8 A;  2NP9 A;  3U9R B;  3V5E A;  3TV5 A;  5DKP A;  2J5G A;  2VSS A;  4YLH A;  5DUC A;  5JBX A;  5INI A;  3Q0G A;  4IZB A;  4JSB A;  3NJD A;  4G2R A;  5MGB A;  3T8B A;  4DI1 A;  2ZQR A;  3RSI A;  1O8U A;  3TT6 A;  1HNU A;  4HDT A;  3KTH A;  2Q35 A;  3RRV A;  3BEZ A;  3M6M A;  1W2X A;  1N6E A;  4KPK A;  5HUQ A;  2WTB A;  3R6H A;  4L6W A;  3GMA A;  3TVW A;  3L3S A;  1OD4 A;  3V5I A;  3IBB A;  1FCF A;  1FC6 A;  3ZWA A;  2VSS E;  3GF7 A;  3Q0J A;  4U0G H;  2A7S A;  5DU4 A;  1FC9 A;  4NAR A;  5C90 A;  5DTW A;  5DZK H;  1WDL A;  3QMJ A;  1Q51 A;  1RJM A;  4IZD A;  3T89 A;  4I42 A;  1J7X A;  2F9I B;  2VSU A;  3ST9 A;  4Q1I A;  3K8X A;  3R9T A;  3QXZ A;  4MXI A;  3ZWB A;  3QWD A;  4HNK A;  4FN8 A;  4RYF H;  1UYV A;  2J5S A;  4OG1 A;  2X58 A;  3H02 A;  1Y7O A;  4ELS A;  4I52 A;  2VSU F;  2F9Y B;  2VX2 A;  1WDM A;  4ZDD A;  4GHN A;  5DL1 A;  2FW2 A;  4ZDF A;  4Z0M A;  3KTI A;  2W3P A;  4B3I A;  3TZ3 A;  4FN7 A;  3H0Q A;  3NJB A;  3HIN A;  2D3T A;  2J5I B;  3H0U A;  1UYT A;  2VSU C;  1EF8 A;  4ELW A;  2DEO A;  1K39 A;  2F6I A;  3IB9 A;  4JFC A;  3T8A A;  2Q34 A;  4JCT A;  3TDC A;  4ZDB A;  3STA A;  1NZY A;  1XNW A;  2C8T A;  3P5M A;  4I4Z A;  2J5G D;  1Q52 A;  3H0S A;  4EMM A;  3H81 A;  4JJT A;  1UIY A;  4IZC A;  1XNV A;  4FZW A;  4NNQ A;  4L8K A;  4RCN A;  1MJ3 A;  2PBP A;  4ASI A;  2CE3 A;  1ON3 A;  3KQF A;  3QKA A;  4ZU2 A;  1DCI A;  4MI2 A;  5G1R A;  4ZDE A;  1N6F A;  3T3W A;  2UZF A;  1PJH A;  2VRE A;  3MT6 A;  3BPT A;  5CTC A;  1WDK A;  3BPP A;  5E0S H;  4QII A;  2EJ5 A;  5DU6 A;  4JYJ A;  4JVT A;  4JOT A;  4WZ8 B;  2ZL2 A;  4U0G A;  3HP0 A;  1FC7 A;  2ZQQ A;  2J5I A;  3TT7 A;  3P2L A;  5CTB A;  2F9I A;  1VRG A;  2A7K A;  3I47 A;  5E0S A;  1XO6 A;  1HNO A;  1WZ8 A;  2IEX A;  1YG8 A;  1UYR A;  4FNB A;  3QK8 A;  5FIF A;  3ZWC A;  3MYB A;  2F9Y A;  5INF A;  4ELX A;  3FF6 A;  4F47 A;  3GLM A;  3GF3 A;  1XX4 A;  5E0N X;  3LKE A;  2VSS F;  3BF0 A;  4HC8 A;  4WCZ A;  4JCR A;  4KNP A;  3DOR A;  1NZY B;  3HRX A;  4JYL A;  5G1S A;  4KD6 A;  3HLN 1;  3OT6 A;  4U1A A;  1SZO A;  3TVU A;  4FJW D;  1XNY A;  3FDU A;  1DUB A;  5DU8 A; 
#chains in the Genus database with same CATH homology
 2PPY A;  4U18 A;  4KWB A;  2Q2X A;  3Q1T A;  2CBY A;  3R9S A;  4OLQ A;  4WYO B;  3MOY A;  3K50 A;  4NEK A;  5DUF A;  3H0J A;  1N6D A;  4B3H A;  4K3W A;  3WG5 A;  2X24 A;  2BZR A;  4Q0G A;  4LK5 A;  2VSU E;  3M6N A;  1EF9 A;  4QIJ A;  4J2U A;  3HE2 A;  4JCQ A;  3ISA A;  2FZS A;  1RJN A;  3PEA A;  3ZW8 A;  1X0U A;  3QXI A;  4U19 A;  1SG4 A;  3PGQ A;  4JWV A;  3VIV A;  3OME A;  5C9G A;  3U9S B;  2FBM A;  4EML A;  3R9Q A;  1TG6 A;  1K32 A;  5IKL B;  2J5I I;  3G64 A;  1EY3 A;  2ZL0 A;  3KTG A;  3N6R B;  3PZK A;  3ZW9 A;  3U9T B;  3GKB A;  4QFE A;  4RYF A;  3TLF A;  4EMP A;  2A81 A;  2YJG A;  3DJA A;  2F6Q A;  3RST A;  5DZK A;  4K2N A;  3IAV A;  3KTJ A;  3QRE A;  5ING A;  2DUB A;  1HZD A;  2QQ3 A;  3Q7H A;  3TRR A;  4B3J A;  5G1Q A;  5KDR B;  3OC7 A;  1YG6 A;  1TYF A;  3P85 A;  2ZL3 A;  3LAO A;  3SWX A;  5DTP A;  5JBW A;  1PIX A;  4MOU A;  3QYR A;  1ON9 A;  1JXZ A;  4FND A;  1UYS A;  3SLL A;  3JU1 A;  1OD2 A;  4FB8 A;  3R0O A;  5KDR A;  3PE8 A;  4GM2 A;  2HW5 A;  5KJP A;  2GTR A;  3T88 A;  3MFM A;  3KTK A;  4FZW C;  4U0H A;  4OMR A;  4JCS A;  4ZDC A;  2ZL4 A;  4K29 A;  5FUS A;  2PG8 A;  2NP9 A;  3U9R B;  3V5E A;  3TV5 A;  5DKP A;  2J5G A;  2VSS A;  4YLH A;  5DUC A;  5JBX A;  5INI A;  3Q0G A;  4IZB A;  4JSB A;  3NJD A;  4G2R A;  5MGB A;  3T8B A;  4DI1 A;  2ZQR A;  3RSI A;  1O8U A;  3TT6 A;  1HNU A;  4HDT A;  3KTH A;  2Q35 A;  3RRV A;  3BEZ A;  3M6M A;  1W2X A;  1N6E A;  4KPK A;  5HUQ A;  2WTB A;  3R6H A;  4L6W A;  3GMA A;  3TVW A;  3L3S A;  1OD4 A;  3V5I A;  3IBB A;  1FCF A;  1FC6 A;  3ZWA A;  2VSS E;  3GF7 A;  3Q0J A;  4U0G H;  2A7S A;  5DU4 A;  1FC9 A;  4NAR A;  5C90 A;  5DTW A;  5DZK H;  1WDL A;  3QMJ A;  1Q51 A;  1RJM A;  4IZD A;  3T89 A;  4I42 A;  1J7X A;  2F9I B;  2VSU A;  3ST9 A;  4Q1I A;  3K8X A;  3R9T A;  3QXZ A;  4MXI A;  3ZWB A;  3QWD A;  4HNK A;  4FN8 A;  4RYF H;  1UYV A;  2J5S A;  4OG1 A;  2X58 A;  3H02 A;  1Y7O A;  4ELS A;  4I52 A;  2VSU F;  2F9Y B;  2VX2 A;  1WDM A;  4ZDD A;  4GHN A;  5DL1 A;  2FW2 A;  4ZDF A;  4Z0M A;  3KTI A;  2W3P A;  4B3I A;  3TZ3 A;  4FN7 A;  3H0Q A;  3NJB A;  3HIN A;  2D3T A;  2J5I B;  3H0U A;  1UYT A;  2VSU C;  1EF8 A;  4ELW A;  2DEO A;  1K39 A;  2F6I A;  3IB9 A;  4JFC A;  3T8A A;  2Q34 A;  4JCT A;  3TDC A;  4ZDB A;  3STA A;  1NZY A;  1XNW A;  2C8T A;  3P5M A;  4I4Z A;  2J5G D;  1Q52 A;  3H0S A;  4EMM A;  3H81 A;  4JJT A;  1UIY A;  4IZC A;  1XNV A;  4FZW A;  4NNQ A;  4L8K A;  4RCN A;  1MJ3 A;  2PBP A;  4ASI A;  2CE3 A;  1ON3 A;  3KQF A;  3QKA A;  4ZU2 A;  1DCI A;  4MI2 A;  5G1R A;  4ZDE A;  1N6F A;  3T3W A;  2UZF A;  1PJH A;  2VRE A;  3MT6 A;  3BPT A;  5CTC A;  1WDK A;  3BPP A;  5E0S H;  4QII A;  2EJ5 A;  5DU6 A;  4JYJ A;  4JVT A;  4JOT A;  4WZ8 B;  2ZL2 A;  4U0G A;  3HP0 A;  1FC7 A;  2ZQQ A;  2J5I A;  3TT7 A;  3P2L A;  5CTB A;  2F9I A;  1VRG A;  2A7K A;  3I47 A;  5E0S A;  1XO6 A;  1HNO A;  1WZ8 A;  2IEX A;  1YG8 A;  1UYR A;  4FNB A;  3QK8 A;  5FIF A;  3ZWC A;  3MYB A;  2F9Y A;  5INF A;  4ELX A;  3FF6 A;  4F47 A;  3GLM A;  3GF3 A;  1XX4 A;  5E0N X;  3LKE A;  2VSS F;  3BF0 A;  4HC8 A;  4WCZ A;  4JCR A;  4KNP A;  3DOR A;  1NZY B;  3HRX A;  4JYL A;  5G1S A;  4KD6 A;  3HLN 1;  3OT6 A;  4U1A A;  1SZO A;  3TVU A;  4FJW D;  1XNY A;  3FDU A;  1DUB A;  5DU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...