4HNKA

Crystal structure of an enzyme
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
180
Chain Sequence
b'PSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGITDVISIVDVINYISSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIIPFNNIEIQNKEIMNTKKKVIEIISKNTEKDTNVISNVLERDKYFNADEAVDFKLIDHILEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structural Insights into the Inactive Subunit of the Apicoplast-localized Caseinolytic Protease Complex of Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 60
structure length 180
sequence length 183
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4hnkA00
1SG4A 3R9TA 4IZDA 1X0UA 3QMJA 3TDCA 1J7XA 4ZDDA 2ZL2A 4RYFA 2IEXA 4FN7A 3OC7A 3K50A 3ZWAA 4Z0MA 2UZFA 3TT6A 4RYFH 4NNQA 4JOTA 1ON9A 3HLN1 2VSSA 5C9GA 2X24A 3Q0GA 1WZ8A 4IZCA 3TVWA 3U9RB 4KD6A 1FC6A 3L3SA 1N6DA 3V5IA 1Q52A 1OD4A 4JCTA 3SLLA 3ZWCA 3GF7A 3STAA 4JCQA 2F9YA 1NZYB 4U18A 1SZOA 2ZL3A 3BEZA 5G1SA 4QIJA 5JBXA 5C90A 3TLFA 5IKLB 3R9SA 1PIXA 2Q2XA 2X58A 3K8XA 3ISAA 3QXIA 1HNOA 1UYRA 3QK8A 4JWVA 4HNKA 4WCZA 2J5II 2J5GD 4U0HA 2DUBA 3IB9A 2D3TA 2ZL0A 4YLHA 1ON3A 2VSSE 1N6EA 1Y7OA 4RCNA 3HRXA 4Q0GA 3DJAA 5KDRB 3M6NA 2F9IA 3TVUA 2EJ5A 3Q1TA 4OMRA 4JYLA 4JJTA 3TZ3A 3R6HA 1XX4A 4B3JA 2BZRA 3JU1A 4MOUA 1XNYA 5MGBA 3HE2A 2W3PA 3MFMA 5DZKA 4FJWD 2ZQRA 3G64A 3P85A 5DTWA 2J5GA 3TT7A 4ZDFA 3HINA 4JCSA 2VSSF 3T3WA 3WG5A 3LAOA 3QWDA 3R9QA 5DZKH 4WYOB 3T8BA 5G1RA 3PGQA 4FZWC 4MXIA 2QQ3A 4ELXA 4KWBA 1EY3A 2ZL4A 3GF3A 3ZW8A 3NJBA 2PBPA 3PEAA 4EMPA 3SWXA 4FN8A 1VRGA 3MYBA 1DCIA 3Q7HA 3T88A 2FZSA 3RSIA 4ASIA 1K39A 3FDUA 1O8UA 1YG8A 4QIIA 3FF6A 1PJHA 2A81A 1FC7A 4KNPA 4KPKA 1FCFA 5INFA 5DKPA 5KJPA 3ZW9A 3I47A 5E0NX 5DU4A 1HZDA 4I4ZA 3DORA 3KTIA 3GLMA 2J5IB 2FW2A 3HP0A 2CE3A 3KTGA 2J5SA 3TV5A 5INGA 5E0SA 2HW5A 3KTHA 3GMAA 2ZQQA 2VSUA 1YG6A 1RJMA 5DTPA 3PZKA 1XNWA 4F47A 4HC8A 3T8AA 2Q34A 5DL1A 3BPPA 1UYTA 4G2RA 3H0UA 3MOYA 1N6FA 1JXZA 5E0SH 4JSBA 5FUSA 3RRVA 2GTRA 2VREA 2FBMA 4K2NA 4ELSA 4FZWA 1WDMA 3MT6A 4FB8A 1K32A 3IAVA 1WDLA 4L8KA 4FNBA 3Q0JA 1XNVA 4LK5A 3V5EA 2A7KA 2F6IA 4IZBA 2VSUC 5CTBA 1DUBA 4B3HA 2WTBA 4K29A 5KDRA 3H02A 4ZDBA 4GHNA 4JVTA 3U9SB 1EF9A 4WZ8B 1Q51A 3PE8A 3KQFA 3IBBA 4QFEA 4MI2A 4Q1IA 5JBWA 1UYVA 3H81A 2F9YB 2VX2A 2VSUE 4I42A 3ZWBA 3H0QA 4ZDCA 3KTKA 1FC9A 4JFCA 3RSTA 3R0OA 1HNUA 1UIYA 3OMEA 4U1AA 3QREA 3P5MA 5DU6A 3T89A 2NP9A 3QYRA 3NJDA 3H0SA 1EF8A 3GKBA 3M6MA 4GM2A 4L6WA 3KTJA 4NEKA 5FIFA 1WDKA 2VSUF 3VIVA 4DI1A 2A7SA 2CBYA 1NZYA 2Q35A 4EMLA 4OG1A 2PPYA 1MJ3A 4B3IA 5DUFA 3BF0A 2F9IB 4U0GA 1XO6A 3TRRA 3ST9A 4JCRA 1UYSA 5DU8A 2F6QA 4JYJA 4OLQA 4FNDA 4K3WA 5CTCA 3N6RB 4ELWA 1W2XA 3U9TB 2PG8A 4U0GH 4ZDEA 3P2LA 2J5IA 5INIA 4EMMA 3QKAA 5G1QA 4I52A 3H0JA 3OT6A 4ZU2A 1TG6A 3LKEA 2DEOA 5DUCA 1OD2A 3QXZA 4U19A 1RJNA 2C8TA 1TYFA
chains in the Genus database with same CATH superfamily
1SG4A 3R9TA 4IZDA 1X0UA 3QMJA 3TDCA 1J7XA 4ZDDA 2ZL2A 4RYFA 2IEXA 4FN7A 3OC7A 3K50A 3ZWAA 4Z0MA 2UZFA 3TT6A 4RYFH 4NNQA 4JOTA 1ON9A 3HLN1 2VSSA 5C9GA 2X24A 3Q0GA 1WZ8A 4IZCA 3TVWA 3U9RB 4KD6A 1FC6A 3L3SA 1N6DA 3V5IA 1Q52A 1OD4A 4JCTA 3SLLA 3ZWCA 3GF7A 3STAA 4JCQA 2F9YA 1NZYB 4U18A 1SZOA 4NARA 2ZL3A 3BEZA 5G1SA 4QIJA 5JBXA 5C90A 3TLFA 5IKLB 3R9SA 1PIXA 2Q2XA 2X58A 3K8XA 3ISAA 3QXIA 1HNOA 1UYRA 3QK8A 4JWVA 4HNKA 4WCZA 2J5II 2J5GD 4U0HA 2DUBA 3IB9A 2D3TA 2ZL0A 4YLHA 1ON3A 5HUQA 2VSSE 1N6EA 1Y7OA 4RCNA 3HRXA 4Q0GA 3DJAA 5KDRB 3M6NA 2F9IA 3TVUA 2EJ5A 3Q1TA 4OMRA 4JYLA 4JJTA 3TZ3A 3R6HA 1XX4A 4B3JA 2BZRA 3JU1A 4MOUA 1XNYA 5MGBA 3HE2A 2W3PA 3MFMA 5DZKA 4FJWD 2ZQRA 3G64A 3P85A 5DTWA 2J5GA 3BPTA 3TT7A 4ZDFA 3HINA 4JCSA 2VSSF 3T3WA 3WG5A 3LAOA 3QWDA 3R9QA 5DZKH 4WYOB 3T8BA 5G1RA 3PGQA 4FZWC 4J2UA 4MXIA 2QQ3A 4ELXA 4KWBA 1EY3A 2ZL4A 3GF3A 3ZW8A 3NJBA 2PBPA 3PEAA 4EMPA 3SWXA 4FN8A 1VRGA 3MYBA 1DCIA 3Q7HA 3T88A 2FZSA 3RSIA 4ASIA 1K39A 3FDUA 1O8UA 1YG8A 4QIIA 3FF6A 1PJHA 2A81A 1FC7A 4KNPA 4KPKA 1FCFA 5INFA 5DKPA 5KJPA 3ZW9A 3I47A 5E0NX 5DU4A 1HZDA 4I4ZA 3DORA 3KTIA 3GLMA 2J5IB 2FW2A 3HP0A 2CE3A 3KTGA 2J5SA 3TV5A 5INGA 5E0SA 2HW5A 3KTHA 3GMAA 2ZQQA 2VSUA 1YG6A 1RJMA 5DTPA 3PZKA 1XNWA 4F47A 4HC8A 3T8AA 2Q34A 5DL1A 3BPPA 1UYTA 4G2RA 3H0UA 3MOYA 1N6FA 1JXZA 5E0SH 4JSBA 5FUSA 3RRVA 2GTRA 2VREA 2FBMA 4K2NA 4ELSA 4FZWA 1WDMA 3MT6A 4FB8A 1K32A 3IAVA 1WDLA 4L8KA 4FNBA 3Q0JA 1XNVA 4LK5A 3V5EA 2A7KA 2F6IA 4IZBA 2VSUC 5CTBA 1DUBA 4B3HA 2WTBA 4K29A 5KDRA 3H02A 4ZDBA 4GHNA 4JVTA 3U9SB 1EF9A 4WZ8B 1Q51A 3PE8A 3KQFA 3IBBA 4QFEA 4MI2A 4Q1IA 5JBWA 1UYVA 3H81A 2F9YB 2VX2A 2VSUE 4I42A 3ZWBA 3H0QA 4ZDCA 3KTKA 1FC9A 4JFCA 3RSTA 3R0OA 1HNUA 1UIYA 3OMEA 4U1AA 3QREA 3P5MA 5DU6A 3T89A 2NP9A 3QYRA 3NJDA 3H0SA 1EF8A 3GKBA 3M6MA 4GM2A 4L6WA 3KTJA 4NEKA 5FIFA 1WDKA 2VSUF 3VIVA 4DI1A 2A7SA 2CBYA 1NZYA 2Q35A 4EMLA 4OG1A 2PPYA 1MJ3A 4B3IA 5DUFA 3BF0A 2F9IB 4U0GA 1XO6A 3TRRA 4HDTA 3ST9A 4JCRA 1UYSA 5DU8A 2F6QA 4JYJA 4OLQA 4FNDA 4K3WA 5CTCA 3N6RB 4ELWA 1W2XA 3U9TB 2PG8A 4U0GH 4ZDEA 3P2LA 2J5IA 5INIA 4EMMA 3QKAA 5G1QA 4I52A 3H0JA 3OT6A 4ZU2A 1TG6A 3LKEA 2DEOA 5DUCA 1OD2A 2YJGA 3QXZA 4U19A 1RJNA 2C8TA 1TYFA
chains in the Genus database with same CATH topology
1SG4A 3R9TA 4IZDA 1X0UA 3QMJA 3TDCA 1J7XA 4ZDDA 2ZL2A 4RYFA 2IEXA 4FN7A 3OC7A 3K50A 3ZWAA 4Z0MA 2UZFA 3TT6A 4RYFH 4NNQA 4JOTA 1ON9A 3HLN1 2VSSA 5C9GA 2X24A 3Q0GA 1WZ8A 4IZCA 3TVWA 3U9RB 4KD6A 1FC6A 3L3SA 1N6DA 3V5IA 1Q52A 1OD4A 4JCTA 3SLLA 3ZWCA 3GF7A 3STAA 4JCQA 2F9YA 1NZYB 4U18A 1SZOA 4NARA 2ZL3A 3BEZA 5G1SA 4QIJA 5JBXA 5C90A 3TLFA 5IKLB 3R9SA 1PIXA 2Q2XA 2X58A 3K8XA 3ISAA 3QXIA 1HNOA 1UYRA 3QK8A 4JWVA 4HNKA 4WCZA 2J5II 2J5GD 4U0HA 2DUBA 3IB9A 2D3TA 2ZL0A 4YLHA 1ON3A 5HUQA 2VSSE 1N6EA 1Y7OA 4RCNA 3HRXA 4Q0GA 3DJAA 5KDRB 3M6NA 2F9IA 3TVUA 2EJ5A 3Q1TA 4OMRA 4JYLA 4JJTA 3TZ3A 3R6HA 1XX4A 4B3JA 2BZRA 3JU1A 4MOUA 1XNYA 5MGBA 3HE2A 2W3PA 3MFMA 5DZKA 4FJWD 2ZQRA 3G64A 3P85A 5DTWA 2J5GA 3BPTA 3TT7A 4ZDFA 3HINA 4JCSA 2VSSF 3T3WA 3WG5A 3LAOA 3QWDA 3R9QA 5DZKH 4WYOB 3T8BA 5G1RA 3PGQA 4FZWC 4J2UA 4MXIA 2QQ3A 4ELXA 4KWBA 1EY3A 2ZL4A 3GF3A 3ZW8A 3NJBA 2PBPA 3PEAA 4EMPA 3SWXA 4FN8A 1VRGA 3MYBA 1DCIA 3Q7HA 3T88A 2FZSA 3RSIA 4ASIA 1K39A 3FDUA 1O8UA 1YG8A 4QIIA 3FF6A 1PJHA 2A81A 1FC7A 4KNPA 4KPKA 1FCFA 5INFA 5DKPA 5KJPA 3ZW9A 3I47A 5E0NX 5DU4A 1HZDA 4I4ZA 3DORA 3KTIA 3GLMA 2J5IB 2FW2A 3HP0A 2CE3A 3KTGA 2J5SA 3TV5A 5INGA 5E0SA 2HW5A 3KTHA 3GMAA 2ZQQA 2VSUA 1YG6A 1RJMA 5DTPA 3PZKA 1XNWA 4F47A 4HC8A 3T8AA 2Q34A 5DL1A 3BPPA 1UYTA 4G2RA 3H0UA 3MOYA 1N6FA 1JXZA 5E0SH 4JSBA 5FUSA 3RRVA 2GTRA 2VREA 2FBMA 4K2NA 4ELSA 4FZWA 1WDMA 3MT6A 4FB8A 1K32A 3IAVA 1WDLA 4L8KA 4FNBA 3Q0JA 1XNVA 4LK5A 3V5EA 2A7KA 2F6IA 4IZBA 2VSUC 5CTBA 1DUBA 4B3HA 2WTBA 4K29A 5KDRA 3H02A 4ZDBA 4GHNA 4JVTA 3U9SB 1EF9A 4WZ8B 1Q51A 3PE8A 3KQFA 3IBBA 4QFEA 4MI2A 4Q1IA 5JBWA 1UYVA 3H81A 2F9YB 2VX2A 2VSUE 4I42A 3ZWBA 3H0QA 4ZDCA 3KTKA 1FC9A 4JFCA 3RSTA 3R0OA 1HNUA 1UIYA 3OMEA 4U1AA 3QREA 3P5MA 5DU6A 3T89A 2NP9A 3QYRA 3NJDA 3H0SA 1EF8A 3GKBA 3M6MA 4GM2A 4L6WA 3KTJA 4NEKA 5FIFA 1WDKA 2VSUF 3VIVA 4DI1A 2A7SA 2CBYA 1NZYA 2Q35A 4EMLA 4OG1A 2PPYA 1MJ3A 4B3IA 5DUFA 3BF0A 2F9IB 4U0GA 1XO6A 3TRRA 4HDTA 3ST9A 4JCRA 1UYSA 5DU8A 2F6QA 4JYJA 4OLQA 4FNDA 4K3WA 5CTCA 3N6RB 4ELWA 1W2XA 3U9TB 2PG8A 4U0GH 4ZDEA 3P2LA 2J5IA 5INIA 4EMMA 3QKAA 5G1QA 4I52A 3H0JA 3OT6A 4ZU2A 1TG6A 3LKEA 2DEOA 5DUCA 1OD2A 2YJGA 3QXZA 4U19A 1RJNA 2C8TA 1TYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG4 A;  3R9T A;  4IZD A;  1X0U A;  3QMJ A;  3TDC A;  1J7X A;  4ZDD A;  2ZL2 A;  4RYF A;  2IEX A;  4FN7 A;  3OC7 A;  3K50 A;  3ZWA A;  4Z0M A;  2UZF A;  3TT6 A;  4RYF H;  4NNQ A;  4JOT A;  1ON9 A;  3HLN 1;  2VSS A;  5C9G A;  2X24 A;  3Q0G A;  1WZ8 A;  4IZC A;  3TVW A;  3U9R B;  4KD6 A;  1FC6 A;  3L3S A;  1N6D A;  3V5I A;  1Q52 A;  1OD4 A;  4JCT A;  3SLL A;  3ZWC A;  3GF7 A;  3STA A;  4JCQ A;  2F9Y A;  1NZY B;  4U18 A;  1SZO A;  2ZL3 A;  3BEZ A;  5G1S A;  4QIJ A;  5JBX A;  5C90 A;  3TLF A;  5IKL B;  3R9S A;  1PIX A;  2Q2X A;  2X58 A;  3K8X A;  3ISA A;  3QXI A;  1HNO A;  1UYR A;  3QK8 A;  4JWV A;  4HNK A;  4WCZ A;  2J5I I;  2J5G D;  4U0H A;  2DUB A;  3IB9 A;  2D3T A;  2ZL0 A;  4YLH A;  1ON3 A;  2VSS E;  1N6E A;  1Y7O A;  4RCN A;  3HRX A;  4Q0G A;  3DJA A;  5KDR B;  3M6N A;  2F9I A;  3TVU A;  2EJ5 A;  3Q1T A;  4OMR A;  4JYL A;  4JJT A;  3TZ3 A;  3R6H A;  1XX4 A;  4B3J A;  2BZR A;  3JU1 A;  4MOU A;  1XNY A;  5MGB A;  3HE2 A;  2W3P A;  3MFM A;  5DZK A;  4FJW D;  2ZQR A;  3G64 A;  3P85 A;  5DTW A;  2J5G A;  3TT7 A;  4ZDF A;  3HIN A;  4JCS A;  2VSS F;  3T3W A;  3WG5 A;  3LAO A;  3QWD A;  3R9Q A;  5DZK H;  4WYO B;  3T8B A;  5G1R A;  3PGQ A;  4FZW C;  4MXI A;  2QQ3 A;  4ELX A;  4KWB A;  1EY3 A;  2ZL4 A;  3GF3 A;  3ZW8 A;  3NJB A;  2PBP A;  3PEA A;  4EMP A;  3SWX A;  4FN8 A;  1VRG A;  3MYB A;  1DCI A;  3Q7H A;  3T88 A;  2FZS A;  3RSI A;  4ASI A;  1K39 A;  3FDU A;  1O8U A;  1YG8 A;  4QII A;  3FF6 A;  1PJH A;  2A81 A;  1FC7 A;  4KNP A;  4KPK A;  1FCF A;  5INF A;  5DKP A;  5KJP A;  3ZW9 A;  3I47 A;  5E0N X;  5DU4 A;  1HZD A;  4I4Z A;  3DOR A;  3KTI A;  3GLM A;  2J5I B;  2FW2 A;  3HP0 A;  2CE3 A;  3KTG A;  2J5S A;  3TV5 A;  5ING A;  5E0S A;  2HW5 A;  3KTH A;  3GMA A;  2ZQQ A;  2VSU A;  1YG6 A;  1RJM A;  5DTP A;  3PZK A;  1XNW A;  4F47 A;  4HC8 A;  3T8A A;  2Q34 A;  5DL1 A;  3BPP A;  1UYT A;  4G2R A;  3H0U A;  3MOY A;  1N6F A;  1JXZ A;  5E0S H;  4JSB A;  5FUS A;  3RRV A;  2GTR A;  2VRE A;  2FBM A;  4K2N A;  4ELS A;  4FZW A;  1WDM A;  3MT6 A;  4FB8 A;  1K32 A;  3IAV A;  1WDL A;  4L8K A;  4FNB A;  3Q0J A;  1XNV A;  4LK5 A;  3V5E A;  2A7K A;  2F6I A;  4IZB A;  2VSU C;  5CTB A;  1DUB A;  4B3H A;  2WTB A;  4K29 A;  5KDR A;  3H02 A;  4ZDB A;  4GHN A;  4JVT A;  3U9S B;  1EF9 A;  4WZ8 B;  1Q51 A;  3PE8 A;  3KQF A;  3IBB A;  4QFE A;  4MI2 A;  4Q1I A;  5JBW A;  1UYV A;  3H81 A;  2F9Y B;  2VX2 A;  2VSU E;  4I42 A;  3ZWB A;  3H0Q A;  4ZDC A;  3KTK A;  1FC9 A;  4JFC A;  3RST A;  3R0O A;  1HNU A;  1UIY A;  3OME A;  4U1A A;  3QRE A;  3P5M A;  5DU6 A;  3T89 A;  2NP9 A;  3QYR A;  3NJD A;  3H0S A;  1EF8 A;  3GKB A;  3M6M A;  4GM2 A;  4L6W A;  3KTJ A;  4NEK A;  5FIF A;  1WDK A;  2VSU F;  3VIV A;  4DI1 A;  2A7S A;  2CBY A;  1NZY A;  2Q35 A;  4EML A;  4OG1 A;  2PPY A;  1MJ3 A;  4B3I A;  5DUF A;  3BF0 A;  2F9I B;  4U0G A;  1XO6 A;  3TRR A;  3ST9 A;  4JCR A;  1UYS A;  5DU8 A;  2F6Q A;  4JYJ A;  4OLQ A;  4FND A;  4K3W A;  5CTC A;  3N6R B;  4ELW A;  1W2X A;  3U9T B;  2PG8 A;  4U0G H;  4ZDE A;  3P2L A;  2J5I A;  5INI A;  4EMM A;  3QKA A;  5G1Q A;  4I52 A;  3H0J A;  3OT6 A;  4ZU2 A;  1TG6 A;  3LKE A;  2DEO A;  5DUC A;  1OD2 A;  3QXZ A;  4U19 A;  1RJN A;  2C8T A;  1TYF A; 
#chains in the Genus database with same CATH topology
 1SG4 A;  3R9T A;  4IZD A;  1X0U A;  3QMJ A;  3TDC A;  1J7X A;  4ZDD A;  2ZL2 A;  4RYF A;  2IEX A;  4FN7 A;  3OC7 A;  3K50 A;  3ZWA A;  4Z0M A;  2UZF A;  3TT6 A;  4RYF H;  4NNQ A;  4JOT A;  1ON9 A;  3HLN 1;  2VSS A;  5C9G A;  2X24 A;  3Q0G A;  1WZ8 A;  4IZC A;  3TVW A;  3U9R B;  4KD6 A;  1FC6 A;  3L3S A;  1N6D A;  3V5I A;  1Q52 A;  1OD4 A;  4JCT A;  3SLL A;  3ZWC A;  3GF7 A;  3STA A;  4JCQ A;  2F9Y A;  1NZY B;  4U18 A;  1SZO A;  4NAR A;  2ZL3 A;  3BEZ A;  5G1S A;  4QIJ A;  5JBX A;  5C90 A;  3TLF A;  5IKL B;  3R9S A;  1PIX A;  2Q2X A;  2X58 A;  3K8X A;  3ISA A;  3QXI A;  1HNO A;  1UYR A;  3QK8 A;  4JWV A;  4HNK A;  4WCZ A;  2J5I I;  2J5G D;  4U0H A;  2DUB A;  3IB9 A;  2D3T A;  2ZL0 A;  4YLH A;  1ON3 A;  5HUQ A;  2VSS E;  1N6E A;  1Y7O A;  4RCN A;  3HRX A;  4Q0G A;  3DJA A;  5KDR B;  3M6N A;  2F9I A;  3TVU A;  2EJ5 A;  3Q1T A;  4OMR A;  4JYL A;  4JJT A;  3TZ3 A;  3R6H A;  1XX4 A;  4B3J A;  2BZR A;  3JU1 A;  4MOU A;  1XNY A;  5MGB A;  3HE2 A;  2W3P A;  3MFM A;  5DZK A;  4FJW D;  2ZQR A;  3G64 A;  3P85 A;  5DTW A;  2J5G A;  3BPT A;  3TT7 A;  4ZDF A;  3HIN A;  4JCS A;  2VSS F;  3T3W A;  3WG5 A;  3LAO A;  3QWD A;  3R9Q A;  5DZK H;  4WYO B;  3T8B A;  5G1R A;  3PGQ A;  4FZW C;  4J2U A;  4MXI A;  2QQ3 A;  4ELX A;  4KWB A;  1EY3 A;  2ZL4 A;  3GF3 A;  3ZW8 A;  3NJB A;  2PBP A;  3PEA A;  4EMP A;  3SWX A;  4FN8 A;  1VRG A;  3MYB A;  1DCI A;  3Q7H A;  3T88 A;  2FZS A;  3RSI A;  4ASI A;  1K39 A;  3FDU A;  1O8U A;  1YG8 A;  4QII A;  3FF6 A;  1PJH A;  2A81 A;  1FC7 A;  4KNP A;  4KPK A;  1FCF A;  5INF A;  5DKP A;  5KJP A;  3ZW9 A;  3I47 A;  5E0N X;  5DU4 A;  1HZD A;  4I4Z A;  3DOR A;  3KTI A;  3GLM A;  2J5I B;  2FW2 A;  3HP0 A;  2CE3 A;  3KTG A;  2J5S A;  3TV5 A;  5ING A;  5E0S A;  2HW5 A;  3KTH A;  3GMA A;  2ZQQ A;  2VSU A;  1YG6 A;  1RJM A;  5DTP A;  3PZK A;  1XNW A;  4F47 A;  4HC8 A;  3T8A A;  2Q34 A;  5DL1 A;  3BPP A;  1UYT A;  4G2R A;  3H0U A;  3MOY A;  1N6F A;  1JXZ A;  5E0S H;  4JSB A;  5FUS A;  3RRV A;  2GTR A;  2VRE A;  2FBM A;  4K2N A;  4ELS A;  4FZW A;  1WDM A;  3MT6 A;  4FB8 A;  1K32 A;  3IAV A;  1WDL A;  4L8K A;  4FNB A;  3Q0J A;  1XNV A;  4LK5 A;  3V5E A;  2A7K A;  2F6I A;  4IZB A;  2VSU C;  5CTB A;  1DUB A;  4B3H A;  2WTB A;  4K29 A;  5KDR A;  3H02 A;  4ZDB A;  4GHN A;  4JVT A;  3U9S B;  1EF9 A;  4WZ8 B;  1Q51 A;  3PE8 A;  3KQF A;  3IBB A;  4QFE A;  4MI2 A;  4Q1I A;  5JBW A;  1UYV A;  3H81 A;  2F9Y B;  2VX2 A;  2VSU E;  4I42 A;  3ZWB A;  3H0Q A;  4ZDC A;  3KTK A;  1FC9 A;  4JFC A;  3RST A;  3R0O A;  1HNU A;  1UIY A;  3OME A;  4U1A A;  3QRE A;  3P5M A;  5DU6 A;  3T89 A;  2NP9 A;  3QYR A;  3NJD A;  3H0S A;  1EF8 A;  3GKB A;  3M6M A;  4GM2 A;  4L6W A;  3KTJ A;  4NEK A;  5FIF A;  1WDK A;  2VSU F;  3VIV A;  4DI1 A;  2A7S A;  2CBY A;  1NZY A;  2Q35 A;  4EML A;  4OG1 A;  2PPY A;  1MJ3 A;  4B3I A;  5DUF A;  3BF0 A;  2F9I B;  4U0G A;  1XO6 A;  3TRR A;  4HDT A;  3ST9 A;  4JCR A;  1UYS A;  5DU8 A;  2F6Q A;  4JYJ A;  4OLQ A;  4FND A;  4K3W A;  5CTC A;  3N6R B;  4ELW A;  1W2X A;  3U9T B;  2PG8 A;  4U0G H;  4ZDE A;  3P2L A;  2J5I A;  5INI A;  4EMM A;  3QKA A;  5G1Q A;  4I52 A;  3H0J A;  3OT6 A;  4ZU2 A;  1TG6 A;  3LKE A;  2DEO A;  5DUC A;  1OD2 A;  2YJG A;  3QXZ A;  4U19 A;  1RJN A;  2C8T A;  1TYF A; 
#chains in the Genus database with same CATH homology
 1SG4 A;  3R9T A;  4IZD A;  1X0U A;  3QMJ A;  3TDC A;  1J7X A;  4ZDD A;  2ZL2 A;  4RYF A;  2IEX A;  4FN7 A;  3OC7 A;  3K50 A;  3ZWA A;  4Z0M A;  2UZF A;  3TT6 A;  4RYF H;  4NNQ A;  4JOT A;  1ON9 A;  3HLN 1;  2VSS A;  5C9G A;  2X24 A;  3Q0G A;  1WZ8 A;  4IZC A;  3TVW A;  3U9R B;  4KD6 A;  1FC6 A;  3L3S A;  1N6D A;  3V5I A;  1Q52 A;  1OD4 A;  4JCT A;  3SLL A;  3ZWC A;  3GF7 A;  3STA A;  4JCQ A;  2F9Y A;  1NZY B;  4U18 A;  1SZO A;  4NAR A;  2ZL3 A;  3BEZ A;  5G1S A;  4QIJ A;  5JBX A;  5C90 A;  3TLF A;  5IKL B;  3R9S A;  1PIX A;  2Q2X A;  2X58 A;  3K8X A;  3ISA A;  3QXI A;  1HNO A;  1UYR A;  3QK8 A;  4JWV A;  4HNK A;  4WCZ A;  2J5I I;  2J5G D;  4U0H A;  2DUB A;  3IB9 A;  2D3T A;  2ZL0 A;  4YLH A;  1ON3 A;  5HUQ A;  2VSS E;  1N6E A;  1Y7O A;  4RCN A;  3HRX A;  4Q0G A;  3DJA A;  5KDR B;  3M6N A;  2F9I A;  3TVU A;  2EJ5 A;  3Q1T A;  4OMR A;  4JYL A;  4JJT A;  3TZ3 A;  3R6H A;  1XX4 A;  4B3J A;  2BZR A;  3JU1 A;  4MOU A;  1XNY A;  5MGB A;  3HE2 A;  2W3P A;  3MFM A;  5DZK A;  4FJW D;  2ZQR A;  3G64 A;  3P85 A;  5DTW A;  2J5G A;  3BPT A;  3TT7 A;  4ZDF A;  3HIN A;  4JCS A;  2VSS F;  3T3W A;  3WG5 A;  3LAO A;  3QWD A;  3R9Q A;  5DZK H;  4WYO B;  3T8B A;  5G1R A;  3PGQ A;  4FZW C;  4J2U A;  4MXI A;  2QQ3 A;  4ELX A;  4KWB A;  1EY3 A;  2ZL4 A;  3GF3 A;  3ZW8 A;  3NJB A;  2PBP A;  3PEA A;  4EMP A;  3SWX A;  4FN8 A;  1VRG A;  3MYB A;  1DCI A;  3Q7H A;  3T88 A;  2FZS A;  3RSI A;  4ASI A;  1K39 A;  3FDU A;  1O8U A;  1YG8 A;  4QII A;  3FF6 A;  1PJH A;  2A81 A;  1FC7 A;  4KNP A;  4KPK A;  1FCF A;  5INF A;  5DKP A;  5KJP A;  3ZW9 A;  3I47 A;  5E0N X;  5DU4 A;  1HZD A;  4I4Z A;  3DOR A;  3KTI A;  3GLM A;  2J5I B;  2FW2 A;  3HP0 A;  2CE3 A;  3KTG A;  2J5S A;  3TV5 A;  5ING A;  5E0S A;  2HW5 A;  3KTH A;  3GMA A;  2ZQQ A;  2VSU A;  1YG6 A;  1RJM A;  5DTP A;  3PZK A;  1XNW A;  4F47 A;  4HC8 A;  3T8A A;  2Q34 A;  5DL1 A;  3BPP A;  1UYT A;  4G2R A;  3H0U A;  3MOY A;  1N6F A;  1JXZ A;  5E0S H;  4JSB A;  5FUS A;  3RRV A;  2GTR A;  2VRE A;  2FBM A;  4K2N A;  4ELS A;  4FZW A;  1WDM A;  3MT6 A;  4FB8 A;  1K32 A;  3IAV A;  1WDL A;  4L8K A;  4FNB A;  3Q0J A;  1XNV A;  4LK5 A;  3V5E A;  2A7K A;  2F6I A;  4IZB A;  2VSU C;  5CTB A;  1DUB A;  4B3H A;  2WTB A;  4K29 A;  5KDR A;  3H02 A;  4ZDB A;  4GHN A;  4JVT A;  3U9S B;  1EF9 A;  4WZ8 B;  1Q51 A;  3PE8 A;  3KQF A;  3IBB A;  4QFE A;  4MI2 A;  4Q1I A;  5JBW A;  1UYV A;  3H81 A;  2F9Y B;  2VX2 A;  2VSU E;  4I42 A;  3ZWB A;  3H0Q A;  4ZDC A;  3KTK A;  1FC9 A;  4JFC A;  3RST A;  3R0O A;  1HNU A;  1UIY A;  3OME A;  4U1A A;  3QRE A;  3P5M A;  5DU6 A;  3T89 A;  2NP9 A;  3QYR A;  3NJD A;  3H0S A;  1EF8 A;  3GKB A;  3M6M A;  4GM2 A;  4L6W A;  3KTJ A;  4NEK A;  5FIF A;  1WDK A;  2VSU F;  3VIV A;  4DI1 A;  2A7S A;  2CBY A;  1NZY A;  2Q35 A;  4EML A;  4OG1 A;  2PPY A;  1MJ3 A;  4B3I A;  5DUF A;  3BF0 A;  2F9I B;  4U0G A;  1XO6 A;  3TRR A;  4HDT A;  3ST9 A;  4JCR A;  1UYS A;  5DU8 A;  2F6Q A;  4JYJ A;  4OLQ A;  4FND A;  4K3W A;  5CTC A;  3N6R B;  4ELW A;  1W2X A;  3U9T B;  2PG8 A;  4U0G H;  4ZDE A;  3P2L A;  2J5I A;  5INI A;  4EMM A;  3QKA A;  5G1Q A;  4I52 A;  3H0J A;  3OT6 A;  4ZU2 A;  1TG6 A;  3LKE A;  2DEO A;  5DUC A;  1OD2 A;  2YJG A;  3QXZ A;  4U19 A;  1RJN A;  2C8T A;  1TYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...