4HOYA

Crystal structure of peptidyl- trna hydrolase from acinetobacter baumannii at 1.78 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 63
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4hoyA00
3TCKA 4HOYA 4OLJA 2Z2IA 4ZXPA 3OFVA 3NEAA 4Z86A 2JRCA 5EKTA 3TD6A 2Z2KA 3V2IA 4FNOA 4P7BA 5IKEA 1RYMA 4YLYA 2PTHA 2MJLA 4QBKA 4FOTA 4QT4A 4DJJA 4LWQA 4FOPA 4IKOA 5IVPA 2NAFA 4JY7A 3TD2A 4QAJA 1RYBA 1RYNA 2LGJA 4QD3A 3TCNA 4JC4A 2Z2JA 4DHWA 3KK0A 5B6JA 5IMBA 4FYJA 4JWKA 3P2JA 4JX9A 4ERXA 3VJRA 3KJZA
chains in the Genus database with same CATH superfamily
4HB2A 3CZPA 4DQ0A 3DOEA 1Y8ZA 1NAIA 2JLQA 4V1CI 3JZDA 3ME5A 1KF0A 3M9XA 1GPMA 4H9GA 4QICA 5GJBA 5AI4A 3TF5A 1W34A 3HI6A 3IMEA 1FP2A 2NXNA 1QAOA 5SYAA 1JHZA 2CXNA 4PFSA 3HCOA 4YX9A 5L6LB 1YQTA 4DV6B 2XIJA 4ZPJA 3P45A 2FWMX 1LNZA 2A7QA 4BLVA 2XDWA 1EBUA 1ISMA 2HBYA 4MS3B 3K0BA 3MCVA 1TQ6A 5HBGA 4K6CA 2NV0A 1MW9X 1U02A 4CZ2A 3EXHA 4HSEA 1I24A 5HX7A 2VNAA 2P2SA 3CRRA 2FWBA 1I0ZA 5HK8A 1MGOA 2Z98A 3CJQA 3PWTA 3C87A 3CZQA 1EH5A 1WW8A 3KTFA 4U9IS 5JADA 2MINA 2I78A 4XWGA 1S2GA 2HEIA 2FEKA 3QNUA 2RGUA 4YCLA 4IF6A 3SC6A 3GLGE 2QY9A 1U6IA 2DR3A 2WYHA 2G76A 4G81A 5H9VA 2Y66A 3GJXC 3QPVA 1KK0A 4CT5A 2R5FA 2C4WA 2WWVD 1ZMRA 2Q8QA 1ST3A 3HVKA 2GO7A 1C8VB 2R00A 2RGYA 2I4LA 5F1PA 1W8DA 2VVTA 2HIMA 3DZIA 2QD1A 1R8SA 3N2KA 4LXUA 1I3KA 2VSOA 2ID4A 3KNZA 1CIJA 1JLMA 3ICPA 2A5FA 2C5EA 4TT8A 2ATIA 3KCNA 4HN9A 1MJNA 1F6DA 1LDNA 2Q3CA 3GLUA 3P4UA 1OI7A 4G4SP 2PMBA 2X0FA 5A1JA 4AKSA 2P9GA 3B1VA 2WYUA 2ZSFA 3ZZ0A 2GLXA 1ADCA 2C5SA 4C2UA 3C0KA 3DV9A 1A1VA 1GUYA 4I5EA 3KQOA 2H2IA 4XPIB 3UATA 4G0WA 3B78A 3ZWXA 5D3QA 1LUAA 2GDZA 4NZOA 1H2AS 4UOZA 4YCNA 2HRBA 1CULC 2PKXA 5GIPE 4CEHA 3THYA 3SXUB 1XMPA 3HO6A 3E15A 1HC7A 4FQ7A 1H4VB 4XIYA 4C0KA 1AS2A 3TXAA 1VI5A 2JBWA 1H0RA 4JH0A 3W1EA 3L7IA 1CVRA 4XIJA 2PX2A 1KEEA 1KIAA 3O4IA 4J3NA 3UYLA 4ED9A 3RSFA 3DPSA 4C4RA 3OICA 1RZRA 1UPFA 1X7ZB 1LQ2A 5C8YF 4ZARA 3BGSA 1KFEB 4PZPA 4MWBA 4NEHB 4PPNA 4Y2SA 4BGUA 1DJMA 2AZ4A 9GPBA 2Q4OA 1YK1A 3LBIA 3ET4A 3LY7A 2XDYA 1Q0PA 1RMQA 3H13A 4MUMA 4HC4A 2BEVA 2RBKA 3DAPA 1WOMA 2D0PB 3JR7A 2X76A 1QZ3A 5FRDA 3BXEA 3CPHA 3SKVA 3BXZA 3WWZA 3E9NA 5K8TA 2NO0A 2PZMA 3S2IA 2Q7OE 1G3IA 1TTPB 2QYHA 1NPYA 5DTJA 4EMTA 5K3EA 4CF4A 4MROA 1XDDA 4HDSB 5FO1A 4NXNB 1EM8B 1HDOA 1C7ZA 4HPXB 2AC2A 4ASUD 4YLGA 1NRIA 3O5AA 3PEUA 4MUEA 3WRYC 3D1LA 3IELA 3AL2A 3ODPA 3Q88A 3BM5A 1ZL0A 4YJ3F 3GJQA 5BRAA 3JVEA 1WF6A 2FN3A 3ZH2A 3AQ4A 2I4NA 1P1BA 1TM7E 1HT1E 2WB4A 4PSDA 4BAZA 4PQEA 4EJ6A 3F3MA 3QWAA 3DJFA 2JAOA 1IATA 5LDDC 1BD3A 1C8LA 1SKYE 3VAZA 4BMVA 1G16A 1F8XA 2JI6A 3BL6A 1Z82A 4ZT4A 4YBZA 2AD1A 3ICOA 5FBZA 3B70A 2GTIA 1OGJA 2ADFA 1YU6A 4OHPA 1E5XA 2W58A 3DLTA 3TSZA 5HF5A 1DOAA 1FX0A 3GHYA 3IV7A 4I55A 4MXDA 1RVDA 1VIYA 1YAHA 4J7UA 4RA6B 5LB2A 2NMVA 1H9CA 4BAGA 5ITSA 1E3IA 5A4DA 3V8BA 4AAYA 5F2KA 4PTZA 4TQAA 3UMRA 1CZKA 4N76A 4HGZA 3PPXA 1F6BA 4TQUS 5ICFA 2BJVA 1P9OA 3LUPA 2PNFA 4F5ZA 3L5KA 4M1WA 5LJLA 2VHZA 5TSDA 3E3OA 1BU8A 1XAGA 4NPAA 4MKIA 5ESDA 3BB4A 1D2NA 1XDSA 4RL6A 4D41A 2AWNA 2QNIA 5KREA 3WFJA 1IIBA 1DEOA 5JI2E 1LWOA 1JJBA 4AO6A 2MSCB 4NH0A 4TYMA 1P7YA 2B69A 1QHEA 2NTJA 4ZZ1A 1MJGA 1M1XB 1UAGA 3RSCA 1M6VB 1USVA 3GJYA 4GOKA 1UOEA 3PPVA 4Z2YA 3AX6A 5EHGA 2H2AA 1KIFA 2LWIA 4YQFA 5CVDA 3AKZA 5BPHA 2CSUA 2J3LA 2J7KA 4YFVA 4MDFA 4RSHA 2NZJA 1K27A 1FQWA 4MYHA 4CKYA 1Z9BA 3DCIA 4WOJA 3VSCA 3K70C 4IYJA 1XHEA 5JDCC 1UBUS 2V74B 3I4FA 4NMMA 1GT91 4EMBA 3HO8A 1ITZA 2BT4A 3GZ4A 5B64A 2CSXA 5FWAA 2BSAA 1MO4A 1B76A 3WGKA 1VE6A 3EAFA 3EOBI 1W76A 4OH7A 5DCWA 3IEMA 2F4NA 1U9IA 1U1FA 4NNJA 1RJEA 4RQTA 3SMQA 4L5CA 4U6NA 2ZYDA 1EX1A 1F48A 3LX6A 2PXCA 1I13A 4ITRC 3OESA 5IHPA 5KYUB 3RW9A 2O3QA 3CNOA 3E70C 3HVJA 4D3XA 5HFNA 2RCNA 3HABA 1B6RA 3EB9A 3ESDA 2FKAA 4OJQA 1WL8A 3QM1A 2MMCA 3DM9B 3SM3A 3A70A 3K9WA 2PT9A 5EIAA 5BSMA 1NUTA 1X87A 2HD4A 3TOSA 5AI5A 4BFCA 2J6IA 3E3AA 3GRAA 2IQIA 1G60A 4FN5A 3WVNA 2DUMA 4DA7A 5IVDA 2CF6A 3MWDA 2AJCA 1PR0A 3E8SA 4OAQA 1NXXA 3IX7A 3CH5A 3DZHA 3C7CB 2E4UA 3GMDA 4RKEA 2JANA 2I7CA 4ALKA 521PA 1F9EA 1BGWA 1IPEA 1L4YA 3PTZA 2E6KA 3R3VA 1F38A 4WWHA 2ORVA 4JI2B 4DL9A 1ODLA 2QD5A 1R6TA 4AN4A 3UFBA 4F7WA 1MNQA 1AHPA 4IDCA 4MMZB 4GPAA 4BZWA 2NYUA 4LWQA 1ZICA 4M0DA 5T4FA 2C61A 4LV6A 3AEUB 4PF1A 2BR3A 3V9PA 5LN1A 1T43A 4WNIA 3OPYA 3FPCA 1D1TA 3CHYA 3L01A 4GBGA 3S44A 2O0KA 3IHLA 3KSZO 3W5HA 3HRIA 1FB5A 3AFHA 3OOJA 4TYNA 3NIFB 4TL7A 1ECCA 4NBWA 5E1MA 4TMYA 2FVYA 2QTHA 3WOVA 4D8YA 1R3DA 5BYJA 2R85A 2WAOA 3MWEB 3N1UA 4GPZA 4TRJA 1UMBA 2BGNA 1KYZA 1RE0A 2B5OA 2CL0X 3FCSB 1B16A 3HBNA 3O4FA 4PQRA 1QGUB 3K0SA 2XF2A 4PNHA 3KD3A 3OQVA 1BMFA 1P5HA 2LCFA 1SN7A 2MR6A 3B52X 2QYTA 3NDJA 4UVEA 1M7GA 1KO8A 5JEEA 1YB6A 4I1SA 4CLDA 2AFHA 1T2NA 3PGXA 2PY6A 4QECA 1D0VA 2QUHA 4QGBA 3OE4A 4CTOA 5T7BA 3NTLA 2P90A 3P52A 4Z49A 3MC1A 4QRHA 3N07A 3ZVLA 3AJ8A 1QIJA 4QJ3A 5KHLB 3B9QA 1DQRA 1U0BB 3AFOA 4Y2RA 4RD2A 3UKDA 5MGNA 4ZYXA 4EYKA 1DIHA 2DWCA 2DPGA 5E1DA 2W2KB 3THSA 1N3IA 2II6A 2R11A 4WV3A 4UUAA 3RRMA 3VC3A 4AWXA 4F3NA 1EXVA 2DWUA 2JLSA 3U4DA 4AJPA 4AQDA 1GY8A 3BB1A 5AVRA 3CJRA 2CHUA 3F97A 3FLAA 3IBTA 1UQTA 5D6OA 1NSYA 2AOWA 3N2IA 1Y3HA 3TVTA 1S3GA 3BHMA 2FH5B 4DG5A 4N9WA 4ENPA 1T8RA 3DMFA 4MW5A 2K7ZA 2R84A 3KJGA 1C0IA 1WZCA 4L28A 2ZYVX 1EMDA 1G8PA 1T2DA 1Z5VA 1SCNE 4OQ4A 4BUZA 3UICA 1THZA 3FTQA 4JOSA 4M6WA 4F3KA 1Z7BA 2Z3WA 2YYAA 2F1RA 2HCTA 2FMHA 4N3GA 5G1OA 3UJDA 4O2AB 3H42B 2V1XA 3JASB 2V4UA 2AF4C 4GU5A 2H31A 4HYYA 4YYZA 1FQOA 1G7CA 1Q15A 3EZYA 3AO0B 3V8VA 4DLTA 2XXBA 2ZIUB 4AZ3A 3H17A 1OHHA 1E9BA 3CNHA 2B2NA 3E1GA 4CT0A 3VAYA 1ZZEA 1AKYA 1EA7A 3HP7A 2HJ9A 4TZKA 3OZRA 3UAXA 5BPFA 3M8KA 5HZHA 2I3DA 2J9FA 3DUFA 2ZR7A 2APJA 5LCXA 1QM5A 4UNRA 2BKUA 1CQXA 4HNQA 4UBNA 1OYOA 1JI0A 2O20A 1XKTA 1C7IA 4OCZA 5ABPA 2R87A 2COKA 4HQFA 1GU1A 1L7EA 3OM1A 1KI9A 2I2XB 3SF0A 3W5CA 1ZY2A 1M8JA 3HA7A 1J2JA 5JNRA 1BEZA 4RZ3A 2GK7A 3ONWA 4YK7A 1MA3A 3VR5A 3L3BA 1IHXA 1VCOA 2Z1DA 3G7SA 4QODA 5DNAA 3RPEA 1LI5A 1P2UA 2NOAA 4A36A 3HB5X 2VYND 4JVNA 1HZJA 3VYUB 1Y7PA 3MRVA 1CWUA 1VJ1A 5SY4A 3TSCA 1T9GS 4KE9A 1HNZB 4ZA2A 3A4IA 5U4QA 2EKLA 1AKMA 2YZGA 4KO2S 2VPXA 3L1IA 2CHQA 5A2QA 5REQA 4JDUA 5DCLA 1HBJA 3HY3A 2RGGA 4QEKA 4WECA 2C88A 3GFGA 3EF1A 1LK5A 1YQ9A 3FLBA 3C5EA 1AQNA 4N0QA 3AHGA 4I8IA 5L4NA 2IKQA 4AICA 3OZXA 4RFSA 2DFLA 1A5BB 4IHJF 1R8YA 2F55A 4NAVA 4IYRA 4JI3B 3PNQA 1NRJB 1YMUA 1JHPA 1QGED 1VP9A 3QU4A 4REMA 4YLEA 5DASA 1SCBA 3M83A 4AG5A 3MUEA 5BWBA 1AQYA 4GMKA 2ID9A 3G0BA 4L0MA 2A14A 1FP4B 3FOCA 2GPYA 1K7EB 2QVGA 1E4VA 2ONYA 3KU1A 1C1YA 2VWQA 2PUTA 3E27A 2Q62A 4J16C 1EDOA 3D0KA 3U7EB 1OMOA 1FSFA 4JLDA 1DO8A 2EERA 1P29A 1SU4A 1Z47A 4YC7A 1LU9A 2V7QD 3TFQA 3AILA 3ENKA 3A1NA 4KL8S 1II8B 3IBYA 4EO4A 1A8HA 3IAUA 4BHTA 4GHWA 2ZI3A 3UT6A 4QJIA 2F8SA 4II7A 4PZYA 3BHIA 3L7JA 3WKEA 3HSSA 1J33A 4MNTA 2RKOA 4MRNA 2Z6UA 3H2YA 1B8UA 1A4XA 5G4LA 2H5IA 3HUEA 5K3FB 3EHEA 1ULZA 3HJNA 2AR9A 2CXXA 1XPUA 1FY2A 5JY1A 3HYSA 1XVLA 1VJCA 2HHJA 5H83A 1L7VC 2CBGA 1MABB 2RGCA 3SDBA 3ZZNA 2UUCB 2QAIA 2JI9A 5AK0A 1EYZA 1OASA 1W2WB 1YU9A 2WHPB 3LKDA 2DEUA 3L7MA 2CWWA 1TD1A 1B0ZA 3WGMA 2I54A 1CSEE 3VC1A 1NWCA 1Z7YA 4F4IA 1JMYA 4B73A 1GDTA 4MLPA 1N7HA 1ZVKA 2W2LA 2LD4A 4Q9DA 4O2BF 1ECBA 3T52A 2XYVA 3ISVA 1DBQA 1KZ9A 3NGXA 4PRYA 5F5NA 4IDGA 1IN6A 3SE0A 1JXMA 1G5IA 1PHPA 1NNLA 4QTTB 1B8VA 3TO5A 4A26A 1N1DA 3I83A 4LF4B 1EP1B 1UJNA 1MIOB 2COEA 3ISJA 4OQZA 2ZI5A 1IEVA 1DQSA 2DQ4A 2Q5HA 2Q0XA 3JAWB 5BMVF 4DDKA 2VPZA 4G1BA 4IDDA 4QUIA 2J3QA 4HZGA 3EIHA 4MA5A 2P7HA 1U5CA 4Q3BA 2QZ4A 1R3UA 1LBSA 4C7BA 4DJTA 4MZXA 3I1JA 1IEXA 4DM3A 4R81A 3ZDQA 3KM0A 2N46A 3UJ3X 1GXSB 5KNBD 2G0AA 4QHSA 2XT9A 4RCVA 1C0KA 1MQ8B 3T5MA 5ALRA 3ZQ6A 1IZZA 1FSZA 4S35A 5HCIA 2XE8A 4ARBA 3DTVA 4GRIA 4X7MA 5DIFA 4B7UA 1MEEA 4LTDA 1JU9A 1NW3A 2BGRA 2GXUA 3CUWA 4JBLA 4D0GA 4W8GA 1VL2A 1NI5A 1Q1GA 1J8VA 1KZ1A 4F04A 2DP4E 1KAMA 3UO8B 3UM9A 4BLPA 3W5DA 3T4UA 4ZOQI 1RR6A 1QFXA 4JQZA 2R7MA 1JAZA 2C5GA 1YO6A 2HV9A 3KX2A 2ODAA 4NYMQ 4OBEA 5TARA 3T99A 3UQZA 4ZD6A 5B7GA 4YMSA 3V48A 2BFWA 3TG8A 4C4ZA 4URFA 4PAWA 4KAXA 3SSMA 1ACJA 5ENVA 4RDCA 4U7HA 5EI5A 3WADA 5K3BA 4D9CA 5BR4A 4YRKA 3SFVA 1ZK1A 3FPLA 3UAZA 2QAGC 1QZTA 1F6WA 2IYAA 2V7TA 2WQZA 4KKXB 4Q9JA 1CERA 4BL5A 1Y1QA 8ATCA 1FDWA 1XCOA 3ZWMA 4RA9A 2D1SA 3ZV4A 5AKYA 4DXHA 3ANMA 4I1IA 5CH8A 5IYZB 1YMQA 3KWJA 1NSFA 2CF5A 1OXKB 1NVKA 3PNPA 3CWZA 3VR5H 2P4SA 4LYHA 2K5UA 3SVTA 1FDTA 3KVOA 1V45E 4GKAA 3N2EA 1M8FA 4UMDA 5LOVA 2ZIEA 5T8KA 3ZZ1A 4AYXA 3T41A 3OPMA 4HDCA 4G0OA 4HSGA 5LMNB 1P1CA 1MC4A 2XXAA 2PQMA 2OYRA 3ZHCA 4REQB 5LQRA 1T29A 3C98A 5D84A 1XQWA 2P35A 1II0A 3L6EA 3WDKA 3KLNA 4XUCA 3VA7A 1XD8A 3HBJA 2G8LA 4B7ZA 3B36A 3N5CA 5CURA 3RCBA 4MITA 3S2FA 4EVIA 1MU0A 3GLKA 4NABA 3ZZMA 1SXHA 1XD2B 2X42A 2ILTA 4ZQCB 5JO0A 2G9ZA 5BNZA 3ZNQA 1TYAE 2WJ4A 2DJ5A 3R24A 4MRVA 1V1JA 5LQJA 2GZ2A 2VP6A 2I67A 1Q92A 4FI3F 3Q0EA 4J0IA 5CNKA 1M1YE 4IM7A 2R6FA 3PKZA 1A82A 2WAMA 3OOSA 4LZLA 3BFJA 3G2PA 4DR5B 3O03A 5H7XA 5DIZA 3CR8A 5JG7A 3NTRA 4KN8A 3G7UA 1PKEA 3U4IA 4MUGA 3RHZA 3H5RA 4C7KA 2XGSA 1QRTA 1B7GO 2Z2XA 4JZKA 3U62A 1VIMA 1NBHA 2AFIE 3OQIA 1FDVA 4RE5A 5IP5A 4MEJA 2C7GA 1KARA 3B38A 4WK6A 2LR0A 2Y99A 3IOCA 4OK5A 3OJCA 4ZXFA 3R6GA 3R9WA 1X8XA 3HEBA 3B3FA 1N4DA 4BFTA 2PGAA 5DN6D 1OFUA 5EIXA 2BKXA 1MOQA 1MUUA 4MZDA 1EUCA 3C7AA 4UEOA 4ND6A 2Q5EA 1PR3A 4U39A 4YFYA 4HKTA 4YB8A 3ZJYA 1YJCA 2QMEA 4TXHA 1A88A 3DYVA 4IGIA 3P0FA 4NMXB 1OZGA 1ZXLA 4PC2A 2WV9A 5GJVC 4Q6BA 3R74A 1G8AA 2ZRLA 4CYMA 4DQVA 1ZCJA 2ZR9A 3EDRA 1UFQA 1L5LA 3EA4A 1QTRA 1ZMOA 3EUEA 4K8RB 5A6SA 1UC8A 5JCZA 4PQYA 1PFKA 4YUAA 5JYDA 1CE8B 3IAS1 4DCNA 3FGZA 1HE2A 3V3KA 2XRFA 2XA1A 4LF6B 4HNTA 4IGEA 4DSOA 3RTCA 5KC9A 3QKRA 3B53X 1CY6A 2BKLA 1ZH4A 1N77A 4MI6A 4Q7KA 1TIBA 5A0TA 2O14A 1LBEA 3NALA 2NNWB 4QXAA 1VA5A 1E0KA 1J1ZA 1SQGA 3RODA 1SVLA 4KH0A 1IN4A 1UJCA 3NRCA 4QUEA 3RHFA 4WINA 2AJ8A 4TXMA 1O6CA 1IE3A 4TT3D 5B53A 1L6RA 4P83A 1YKFA 1V2HE 4PLCA 3CE6A 4KE8A 2YH2A 1BS2A 1RT9A 1B0UA 3BMXA 5KKNB 2QTAA 1FRNA 3CLRC 3GMIA 1VOTA 1IBRA 2ZIGA 3M70A 4WVFA 2R1TB 3R09A 5ALUA 3KE9A 6REQB 1QRSA 4EYQA 1I1OA 2PLNA 3EY4A 5AK3A 4F56A 3SF8A 2AXQA 3DOIA 1XP8A 1IQPA 1FFEA 3G9TA 2XD9A 1PV1A 3AR2A 3OEHD 5E8RA 1L5GB 4OV6B 1ENYA 3DW3X 2JHCA 2IEBA 1QCDA 2FW6A 2ZDQA 3D4LA 3IR5A 1CB7A 2V03A 1EWTA 3NIGB 3OPVA 4ND8A 4ZAFA 4IDEA 5TJHA 1YVUA 1ZJ6A 3DCJA 2I4IA 3MILA 2ACKA 5I7EA 4BXOB 4XEUA 3U5TA 4HDQB 4C0QC 2Q6TA 1FDRA 1LSOA 2CLIB 4C08A 2SCUA 2RJNA 4K6HA 5DXAA 2OGSA 1QVVA 3OTGA 3EBLA 2F6RA 4G4IA 5TGTA 4BP8A 5JYEA 2AXNA 4IXNA 4A1FA 4DDMA 3NFYA 1ZJZA 3I9KA 3Q3HA 2Z4RA 3GT0A 4Q16A 3QGMA 1M7HA 1A8SA 2SKEA 2D1QA 2REBA 2JFUA 3OA2A 4TXJA 3VR2D 2AZTA 2OHVA 4ZHSA 1VE1A 2XUPA 3IAS6 1PT6A 3ICEA 3DC2A 3VZCA 1YB2A 3BFVA 4M38A 2OGTA 4K9NA 2EYUA 2GCEA 2IBMA 5TGDA 4D3YA 4HAZA 4ITVA 3HA2A 2G28A 3WISA 1H1DA 2R62A 5DSXA 2SKCA 4B46A 4G9EA 2DQZA 1IZ8A 3R20A 5AHXA 1DRKA 4IJQA 2B4YA 1RRPA 1EVLA 2WQ7A 3D6VA 4WXEA 2ZYSA 2QLMA 1KRWA 4BFYA 1YS6A 1WPXA 3IPXA 3L7LA 1XSEA 4TV9A 5AIAA 3R2JA 2BL4A 4D8UA 1C8BA 1EEHA 1GQ2A 3ZHTA 1IBLB 1TFRA 2OZLA 1FNSA 1RYNA 4PR3A 1FS5A 1UDCA 5K5EA 2F2TA 4FU0A 1T2UA 1MAWA 5JATA 4E3WA 4BPBA 3HI4A 5CLGA 2ZJOA 3T9FA 4ZK6A 4G3XA 4NFHA 1GQSA 4NZPA 4EKEA 4U3JA 4CN8A 2VQEB 3T4PA 5T3YA 1YD7A 4G5SA 4C0LA 1WZ2A 4RVNA 3V4FA 2ZULA 2VEDA 1SKYB 2F1KA 4OHXA 3VKFA 3ZIAA 3DBHB 4RJJA 5BNTA 5F77A 4MO2A 1T2FA 1IOZA 2D2EA 1KJQA 3AFMA 4MS1A 1U3DA 5AW1A 1AA9A 3U56A 1JMKC 1K8XB 5AI9A 5M3BA 3UXYA 3PE4A 3HCCA 4UD2A 3NPAA 4FMCF 4PYJA 4CKEA 4FGLA 4B0OA 4PBSA 4ARSA 5B1YA 2ZTVA 2XNHA 3KZCA 4IXDA 4D9EA 5EWLA 5F21A 4OI0A 3HTXA 1GR0A 3DKIA 3F6PA 3LU1A 1BDJA 4JQOA 4P80A 3FDZB 1UOOA 3UY4A 3VJRA 4YTEA 5HMMA 3MOIA 1QYVA 1EK6A 2X6TA 1XHLA 2GCOB 3DPUA 4EHKA 4U8GA 5DYWA 1JIXA 1NUHA 4GH5A 2HFJA 1E6UA 3P9ZA 4MP6A 3SHVA 2NTVA 5CA0F 1RXVA 3PEWA 1KFBB 1HE4A 2AF3C 1Y1TA 2YHSA 3V7WA 4WXMA 1T5LA 2PSFA 2IHKA 4LJLA 3W5UA 3ANNA 4AQ7A 1E1YA 1I3OA 4H3VA 3MOGA 1ZSYA 3M1AA 5EP2A 3OKPA 4EVQA 2FFRA 4B4KA 4Z3OA 1GNPA 1FP1D 1F3LA 4QTXA 4K0KB 2VRNA 2G36A 4OU4A 4PONA 3TOXA 4BEWA 1S2LA 1UDWA 3BIOA 4TKZA 1M33A 1GRVA 1DELA 4QBGB 3JAMA 2AXPA 3V5NA 1FNDA 1MNAA 5KHOC 2P2ZA 4B85A 1R8QA 4QHTA 4R1LA 3HN7A 4ESOA 1FTGA 3MJEA 5D01A 3WTBA 5IAAA 5B12A 3ENQA 2UUBB 2NYVA 2MYPA 5J1SB 3G2KA 2FMUA 4H17A 2RI1A 3PHLA 3DDZX 3IQHX 1L9KA 3L8DA 4A8JB 4BO6A 1CB0A 1GVHA 4R0MA 3PQ6A 1DXHA 2VG8A 1ZJ5A 3D8NA 4AUMA 2WSMA 1GSIA 4C6TA 4KLZA 3BSYA 3DYBA 2EVWX 3JWHA 3OQNA 4QELA 3ASZA 1Q57A 3ETDA 4IGAA 4LZNA 4NMLA 4QDOA 3KLMX 4Q1AA 5CLQA 2Z4SA 4FFRA 4YJHB 3FCEA 4KLRA 1XCGB 4RQAA 4DLXA 2OQVA 1DAMA 3ZCPA 1GCUA 3QTTA 2C07A 1RHQA 2CCKA 1I7PA 2IOYA 4BVLA 3HKCB 4Q9NA 4QGAA 1ZQ1A 1EXWA 1C9YA 1W29A 2W0MA 1L6IA 1JDBC 1H6CA 2VSYA 2IWRA 1KO7A 1Y4DE 3TQFA 1BDIA 5A4KA 3UV6A 1H3NA 1LJLA 5AT1A 3ETHA 2HHAA 3KRTA 3C16C 2XMRA 2H1LA 4UJ3A 4L1KA 4D80A 5TB5A 2D3WA 2V8BA 2VAWA 3HYLA 3OTQA 5ANRB 2FSIA 3VO1A 5DO9A 3X1KA 4ARVA 2WU1A 4BYMA 4LF7B 2ZREA 5KTOA 4N03A 1SXPA 3PYLA 3TSAA 4X1IB 4UM5A 4I99A 2BMVA 1L5NA 4O4LF 4Z4QA 4YCMA 1RJ9A 3B82A 3F9CA 5IEJA 1R0BA 1MX3A 5D3ZA 3FSGA 5EKTA 1WUTA 3ZW9A 4IIDA 5HDBB 1FXWA 4B44A 2Z2ZA 1O4WA 3D5QA 5J40A 4BMCA 1DRUA 3R8FA 1KAHA 5E9JA 4FP9A 2GPAA 1GRCA 5BN3B 1RYYA 1HT3A 4JP2A 1PGJA 2ROQA 2W98A 4R8MA 3KLPX 5MDHA 5AJHA 1ZNYA 2CNDA 3W3AD 3M6MD 4NDNE 5C8DA 1BCSB 1SB9A 5MHTA 1OYWA 3GK3A 4PZUA 2HHCA 5FOSA 4QUBA 4AJ4A 4K86A 1XMXA 3BH6A 4BTVA 6YASA 1OWPA 1KI8A 1TGVA 1TUBA 2RC6A 4KLNA 3H9BA 5CA0A 1V37A 1V4BA 2GN0A 3RT7A 1DG9A 1R37A 2P2DA 3SNHA 2H8GA 2OCAA 3FNBA 2P77A 8LDHA 2IYUA 2FZVA 2M2IA 4MVJF 3X1YA 2WD7A 1C29B 1V2GA 3L7KA 2AFHE 1OKKA 2BEUA 2HF7A 2X9QA 2ZRFA 5KJEA 5KCMA 1F4PA 2A35A 1NVDA 2VDVE 5DT9A 1PJ4A 3IBCA 3VU8A 4YP1A 1RRGA 4B0PA 4MQEA 4P3PA 3VZQA 5KVVA 3DVQX 3BXFA 3D7NA 3ZHBA 4POAA 3U3XA 5IAEA 1SGWA 4BC1A 4CMKA 1AQUA 1WR8A 1R0XA 1A3CA 4KW7A 2GBPA 2J59A 4CKWB 5LKRA 4Z3KA 1MXHA 1O97C 1L3BA 4MV6A 3VKVA 1X80B 1LFDB 1OBVA 4CLEA 4F6RA 1KVTA 4IV8A 2NZ2A 2EW1A 3F6EX 2JVIA 3D7LA 2IU3A 3RIMA 2V55B 1LEHA 1NPDA 3QKUA 4AZ0A 4Y0VA 2KSQA 3NBKA 2NX2A 1T9CA 3FGOA 2EJWA 2Q2OA 4OJTA 5HHTA 2HJGA 4OHMA 1U3TA 3TFWA 2O7VA 3PZRA 5JYCA 2FGKA 4D4KA 4NE7A 5BSHA 2WQ6A 5DYGA 3PXGA 1YE5A 1VE9A 3F0TA 3RNLA 3ZI4A 4FZVA 1NOKA 4EAAA 3GN1A 2Z1NA 1MP0A 3HR4A 3KKMA 1QQ5A 2TYSB 2VNKA 4G4GA 4KQWA 1NBWB 1LVHA 5DBHX 2QT1A 4MWOA 3UUFA 4FR2A 1QORA 1JIJA 2UXDB 3TTXA 1AS3A 1NM5C 4AKIA 4UBMA 5K0NA 1AKWA 3HNOA 3QPAA 4IDBA 4XLLA 3B5IA 4I14A 4YWHA 1M83A 1XJ5A 4EITA 2PX0A 5BNWA 4ZGWA 3DR3A 2R66A 2JASA 4FHGA 4NICA 5BUZA 2GPTA 2LKCA 4GXTA 3C3WA 4V2IA 5LR6A 2ETXA 1W4RA 3AVUA 4LYYA 3OZTA 5GADl 1O6FA 2CVQA 1XZDA 2V7VA 3C15C 3RBAA 4IDQA 1EK5A 1DLJA 1J42A 1HEIA 2KLBA 5CX1B 4CL0A 4DNPA 1DHRA 4RD6A 3TSYA 3AVWA 5LD2C 4CGZA 1USUA 5ALXA 1M6YA 1TLTA 3R8XA 3KLOA 3VISA 5LQMA 1AQJA 2WNHA 3WGGA 1IOVA 3NRJA 4D42A 1U98A 4MV8A 1A98A 3IV9A 1EIZA 1SZDA 4OXQA 1ZG3A 4K3VA 4RJLA 1RDFA 3PF9A 1MN6A 5DW0A 2GAIA 5CTJA 2EJBA 3MTGA 3PXXA 3X1ZA 1CQIB 4DFDA 3IE2A 1T24A 2G17A 2WMDA 4JROA 3ZNPA 1YBFA 2OAGA 5AIBA 1KI7A 4EMUA 5AVKA 5LIRA 2GJ9A 4CE6A 3TRKA 2C31A 1AXEA 2VJQA 2GZSA 2CV2A 1FDSA 4KMRA 4C04A 2YCBA 1OFTA 1QMGA 4JBHA 4CF5A 5I3CA 4MQ4A 1R50A 3AUFA 1VCIA 2WLSA 3DDUA 2W42A 5EQDA 4ZKDA 2HM7A 3S1AA 3N8NA 2Y1WA 2FUNB 4IMJB 3RVJA 1ODCA 1O89A 5JDIC 2D2VA 4J2OA 1V3UA 3GD5A 4FE4A 3ELUA 1RKQA 1GGFA 4FFBA 5DN9A 5F4BA 5FP0A 4A15A 3NVKI 2ONZA 2XJ9A 2XUAA 2L18A 4NBKA 3GVPA 1X2EA 2ZAYA 1JI3A 1FA9A 3PC7A 2PUHA 3WL4A 2FCRA 1H0HA 4M1QA 2I62A 2AVNA 1QHGA 2H9YA 2DQSA 2KJQA 4XPZA 4GGOA 1ST2A 1LPMA 3QBEA 3QRWA 2NVUB 3F96A 1D03A 3NHBA 3V4LA 3RF6A 5IN4A 3V00A 3F73A 4Y6LA 3KVNA 5FPYA 4C4XA 4MV5A 2AOUA 4EY5A 2RAUA 3GDFA 4UQLA 1L5QA 2XB9A 4UASA 3P0HA 2QL7A 2Q1TA 2GGSA 3W04A 2WYOA 4D4GA 4RNDB 1A71A 5C34B 5A7FA 3C3DA 5DLDA 3SZMA 2VP3A 2AYXA 4TZ0A 4GECA 4G6ZA 4PAGA 2YIDA 1Z5ZA 3L07A 1WXIA 3MS2A 3PWKA 4POOA 1GKUB 1RRKA 3B1ZA 4ZK2A 3HDTA 3LHSA 3R5JA 1ZA2A 1PL7A 3ANYB 1DUIA 2VYFA 1HE3A 2OBBA 3S7ZA 4B71A 3G3EA 4QPNA 2IP4A 5CB0A 2QL6A 3CEJA 3GEMA 1UMKA 3K53A 3W6PA 1B4DA 2W93A 3SQDA 1WCV1 1J21A 3ZGOA 3U4GA 2VTEA 4AZTA 4E5DA 4CLRA 2JAQA 4AN1A 1MHTA 2IY8A 4EO7A 2VHQA 2NADA 2IPMA 3CLTC 2FJ0A 1L8AA 3KXIA 5AH0A 2F3TA 2ZK7A 1PT5A 3IAEA 4F2PA 3TLJA 3ZH9B 4GBMA 1OFIA 4DTIA 4DM4A 3DMHA 4HHEA 3TJZA 3EWSA 4DR3B 2WTXA 1TKRA 3QF7A 3PD0A 2IHTA 3GUUA 4KRGA 5TPZD 4DC9A 2I99A 3CRVA 3PUHA 5HDQA 5KSZA 2G7ZA 2JGMA 3BERA 1TT5B 1GL6A 3L7AA 3QLUC 1NLMA 1UADA 4B80A 3FZQA 2XE7A 1GT6A 3S2ZA 1WUIS 2GA9A 4H7IA 3I9NA 5CTAA 3UOAB 3WZLA 4D4IA 4E09A 2EBWA 2QM8A 4Z0NA 3TI7A 3UF0A 3H0KA 4LZWA 3C1UA 3UN1A 1DGQA 4X71A 5G4KA 1QF9A 4CKXA 4DIEA 3TZ6A 4MAFA 1JZSA 1P2TA 2XTZA 3C74A 5DLPA 1U1CA 3O75A 4I7EA 1CJSA 4J2TA 5IDQA 1NVAA 3NT4A 6ADHA 4F3RA 2E21A 2D8MA 3EIWA 2ZYUX 1VSTA 1PLKA 1GPJA 2H4JA 4AJ9A 2ISSD 2CFCA 4LE1A 3ZLTA 3ZWAA 5JCXA 2G08A 3FMOB 3U49A 5HZKA 1PYGA 1TM5E 4A0SA 1K5DA 3AFIA 3PUIA 1GA4A 4ZQBA 4E70A 5KOJB 3ETCA 1SC9A 3OQBA 2W83A 3WO0A 2Z3VA 1YRLA 4OHUA 3BBLA 2EV9A 1HRKA 2AUNA 4JA0A 3ZLUA 1RKVA 1QVRA 4TWAA 5CYGA 1GAJA 3KEQA 1C14A 2WOJA 3GGCA 4DCPA 3Q5DA 1R9JA 5JD4A 5I9SA 2Y1XA 2NO7A 1ICEA 4TZ6A 1EVYA 2XUHA 1E6KA 1IWOA 2HNAA 3AEQB 3U7IA 5KYTA 2PL5A 1FEZA 4KI0A 2B61A 3Q85A 5CM8B 1N2XA 2ODTX 4EHAA 4FSXA 4AMGA 3AB3A 3AJRA 4I5GA 3G0GA 1JJ7A 3H9CA 3EZGA 3SP1A 2PX8A 4AF6A 1K6IA 2C58A 4IIEA 4L5YA 4ZVRA 5E0OA 3FNEA 2R44A 2REQB 3KWMA 4Z9AA 3CVYA 1M54A 1ZH8A 1I1HA 3AGPA 1VG1A 4BVFA 4WD3A 1BE8A 4EB0A 1RAEA 4M86A 3C70A 5EZ6B 3OI7A 3W5BA 2CZCA 3G1WA 3L5OA 5KEIA 3FBTA 3O90A 4H7KA 4QAQA 1PFWA 2RGDA 4Y98A 2HU7A 4MUJA 2GHQA 2FMKA 4ZYZA 2C97A 5BSWA 2QR2A 3DZCA 3LQ2A 1NJSA 4X6XA 1VBNA 1M1YB 1TF7A 3OZBA 3QSGA 1P9LA 2A0KA 3TRIA 2VZ9A 2VXOA 5BO5A 4O33A 3HFJA 3EGDA 1SUAA 4X44A 1Q0TA 5D86A 1UKEA 4P7FA 3LUAA 1LWNA 4RBNA 5DLYA 4MGYR 2AD5A 2FRXA 3S2EA 4CKCB 4HL6A 5KMGB 3EEYA 2AFIB 2V98A 3E7WA 1Z74A 2CJYA 4NMHA 2FW8A 3GAFA 3KT3A 2XCTB 2OKGA 4KNYA 4DT1A 2HFKA 1CF9A 5TVGA 2J5KA 1KDYA 3T3GA 3G23A 1NP6A 4JVMA 1GLGA 4RXMA 2AQHA 4DE5A 1XDWA 3HLYA 2FDXA 2ZIXA 4P81A 4HQLA 3TLCA 1DO2A 1I94B 2NAPA 1S1CA 1FDIA 2FNAA 1OBHA 2AMLA 4FMBB 4NXMB 1YZLA 4COOA 1ZD5A 3U09A 4B1FA 3NIWA 2R2GA 4BX2A 2PO7A 3N8KA 4JJ8A 3R7WA 1QE0A 3ZWQA 1O6GA 2PGOA 4FYVA 5HM6A 2IE8A 3H1EA 4BRUA 3F4BA 4UDXX 5HTKA 5AXAA 4OUDA 5C2JB 1HUQA 1RAAA 3MFYA 3TQTA 1PCXA 3DMYA 3OJFA 2YUTA 4B3BA 1PK7A 3RROA 3ADDA 1KZYC 1RXCA 2ATVA 2C29D 2QM0A 1XU9A 2VJBA 4AFNA 3T6KA 4E7PA 1P4JA 1AGRA 1JDUA 2BFDA 2OOKA 2ZSAA 3ESRA 4HGNA 4P2GA 5FQNA 5B5SA 2GHRA 3EXHB 1ZMXA 5K3CA 3RJMA 3B7WA 1W5FA 5A04A 2I4RA 2TMYA 5FI0B 5KVCA 1D1SA 1QO7A 1OW3B 4IHAA 4P7JA 2O2EA 3CC8A 1TU3A 3NWJA 1X92A 2NU9B 4KGVA 5DTMA 2MINB 4BVBA 4LJYA 4B82A 3TG2A 2GK6A 3T5BA 1WP9A 1RAGA 2F9LA 2A67A 4Q3NA 3WQBA 5JXJA 5E4TA 3TLKA 1AURA 1N9GA 1JSRA 2I87A 3TLGA 5FWYA 1WDMA 4DNFA 2WK1A 3RC7A 4BO2A 5AHRA 1EHIA 1GZ6A 4B9AA 4LDRA 4WZAA 1UM9A 4DKJA 4DR7B 2A1TR 3RFCA 2EKZA 3N2KB 3LT2A 1C1XA 4O6VA 3WE7A 4YWJA 3LX8A 5U9CA 4KGZA 3I6BA 2XJ4A 1QFJA 1SOWA 3I2HA 3LW8A 2EQ5A 2YXLA 5GQSA 4CIXA 5LBUA 4TN1A 4DDWA 1AB6A 1EZ1A 1BIFA 5LP6A 4NBVA 2ANBA 2MDTA 4N7MA 3OCUA 5FBVB 2WIAA 3A1DA 1Q0LA 1KFCB 4DA0A 2OM6A 3QXCA 4C6SA 1NSTA 3QXXA 2R8ZA 4CV1A 4EYOA 5JBIA 4DIOA 4E1AA 4H15A 5J2TB 5CXXA 3KAPA 3II6X 3PQ8A 2I65A 1MF7A 1YGYA 3UK1A 1AGXA 4YRIA 5CVEA 2GYWA 3LYAA 4NOKA 2QSUA 4JGGA 3CCCA 2AGVA 4CEHB 1HEUA 2VT7A 2FDRA 5GGYA 2Y93A 1DT3A 1UBFA 4LGMA 2EP8A 1SXJA 2MSDB 3ZE6A 2FQWA 1NBMA 5H02A 2IZZA 3V46A 3B6ZA 3PNSA 1CNEA 5CCBA 3RT1A 1KEEB 3KPUA 1NHWA 3S7TA 4EQ6A 1NC3A 3QPCA 3LWDA 3LE8A 4CFSA 5KJ1A 2H3EA 2OXRA 2FTKE 3RYIA 4PBRA 4UHHA 2Q1UA 2WDPA 4JT8A 3WK9A 1ZGCA 4BLTA 4XIFA 1CBUA 4A8PA 2H3HA 1E7RA 3QU7A 3C1OA 4YCSA 1FYVA 1ZN8A 1GEEA 4YAOA 3RR2A 3Q8LA 3J7TA 1EK0A 2SNIE 3R7LA 1VKZA 4FFMA 4GWGA 2C98A 2WIKA 1F8UA 3GPDG 1ECGA 5AWFC 2PS1A 1AT1A 4YHBA 1B93A 1GZVA 2D59A 3PDWA 3RC9A 5CHYA 3N86A 5DOVA 4PG8A 2H1HA 2GJSA 3FLEA 1E96A 5DGHA 4Q3LA 3W2HA 1GEGA 1LC0A 1TMYA 4ZQHA 4DJJA 4GXQA 2XXJA 1ADBA 1HT0A 3AVPA 5ALIA 2VZLA 5KSWB 3OIWA 4MKXA 1TLFA 4NATA 4TMVA 4CFYA 3SZGA 3GWGA 4CQMB 4R1UA 5CJPA 2EZUA 4WAUA 1IWPB 2D8AA 5AOCA 3PX2A 2CLDX 4RELA 4JP3A 2CB0A 1ESZA 3P8ZA 1SHTX 2NU7A 1XROA 2Q0QA 4DQKA 5L6MB 3GLFE 4KFSA 2HUNA 2P6OA 1KPIA 4HATA 1P1FA 1QIEA 1G4AE 2QUZA 2Z8XA 4Z4EA 1QF7A 5IZ4A 4GUAA 5INTA 5M29A 4J0HA 3WICA 4X94A 1EX9A 1K89A 1T4MA 3S99A 2DLCX 4MPJA 5JAHA 4D4JA 3PEEA 4XQ0A 2E5WA 1YS9A 3IUJA 1GHTA 2PAFA 4V2UA 2PANA 4XAQA 4XYEA 2NLOA 3D9QX 1KR2A 2F3UA 4XD7D 5DX1A 1BW9B 1FX0B 1GARA 1WXXA 5D1HA 3VU0A 1NZJA 1GQRA 3ZBUA 3I53A 1SHUX 4TUYF 4FEAA 3LOUA 5FTLA 1L0BA 4E22A 3UXHA 2C8LA 3M2PA 1AZSC 3TZLA 3WYEA 1THTA 4PNPA 2QX8A 4XSGA 2K87A 4Y1EA 3R6TA 1WCYA 4XWOA 2Q28A 1GPUA 2ZRKA 4MHOA 4L6CA 3EHDA 5HE9A 1Z6QA 3STHA 1BNCA 3P0IA 2PZEA 3ZOZA 3CF4A 4B6FA 3TJMA 4LI3X 1ETHA 3ENWA 4RC9A 2WJAA 3UQYS 1SUPA 3LO8A 1GTL1 3LYLA 4MLDA 4NJMB 1IFXA 1GUFA 3HJGA 3LFUA 2CUKA 3EQ6A 4B2IA 2V6MA 3L0PA 3OZFA 5HRAA 1L4UA 1NXOA 1UKVY 4M0FA 3OEYA 5K3AA 4V39A 2X3FA 1EFRA 4GSLA 4KR9A 4R5MA 4WX2B 4D5GA 2HHLA 1ZINA 4AJJA 4F6LA 5BWLA 1QC5A 4OB8A 5CRIA 3WGLA 4MKHA 4FFDA 3K9GA 2DG2A 2VBFA 3LQ4A 4IOLA 2QL5A 3HB9A 4LIPD 4YRNA 7REQB 3HJFA 1U5BB 3GCGA 1TGYA 1HZZC 3GLIA 2HV8A 1JEQA 2YXPX 3IVCA 4PTYA 1MAAA 1ND6A 1YVDA 1FLVA 1G2QA 3KPWA 1YFLA 1RLTA 3H05A 4RF5A 1GDHA 3DZDA 2OKCA 1T1SA 3I76A 4L4XA 3V55A 1SUWA 4QU5A 2HSZA 3CF2A 3RVNA 2RB5A 1CEEA 3QMMA 4HP8A 4ZOLA 4M0LA 4KVFA 3H2GA 2HXYA 3OOEA 1O5OA 4FSHA 3GW8A 4QQFA 5DW3A 5SZKB 3VDXA 721PA 4JLVA 3AM3A 3COPA 4HZIA 4U00A 1TI7A 1LPOA 2HL6A 2FXIA 3T4XA 3TD2A 4ETIA 2CJWA 3H1PA 2UAGA 4MUXA 4Y2HA 5TQJA 1IRXA 3TM4A 4N12A 3WJ2A 3E1KA 3JWJA 3FOZA 3E4CA 1F4LA 3GARA 5HGXA 4PEVA 3M5CA 5E4JA 2FW0A 4ZQGA 4QJBA 1BU5A 1WZUA 4TM8A 4DIKA 4URYR 3T7TA 5CYPA 3Q9SA 1K1EA 3CTMA 4IDFA 1LNSA 1NW5A 4G09A 3RVOA 4HAVA 2FZCA 3SX2A 2ZS9A 1H9AA 1AZWA 2VJCA 4KRXA 3ORQA 4UAVA 4F7DA 3ELBA 2V6GA 2X15A 5AXBA 4MI1A 3AC0A 1LZKA 3BWEA 4MH0R 3VV2A 3PQ5A 1RLOA 4NFYA 2EG5A 1PS0A 3QEJA 3H6HA 2IU6A 3HZZA 3TZKA 1YZHA 1NURA 2QP4A 4I5IA 3A1FA 2AMFA 2QIOA 1AXGA 3JYQA 2AI1A 4WH0A 1AUQA 1GN9A 3MXTA 1ZL2A 3ZGVA 2Q4EA 3JV7A 1YF3A 3FR8A 2YHUA 3OPYB 1MVNA 4GKVA 3HUTA 4NX2A 3AXSA 1VE7A 3R6WA 2IHZA 4M9SA 5DM70 1VMAA 1Q0HA 3DTYA 5D3MB 1B6SA 5IAKA 2X0EA 3PXCX 4JR1A 2CXQA 1FPMA 4LGVA 4Y30A 3MXOA 4L9RA 3P26A 2QRKA 4OK6A 4G5QA 1Z4JA 3OM8A 4FZRA 3EH2A 4P2BA 5ELXA 3PXUA 1ZVJA 3HGMA 4D0NA 1JE1A 1Y33E 4RVUA 2C7PA 2UYGA 4QDZA 4Y6QA 5FEMA 4MUHA 1CY1A 4P34A 5JLAA 3U2QA 1YR9A 3QNMA 4F4FA 1MCZA 1UP6A 1Z6AA 2Z43A 4U2EA 1ZM3A 2H16A 1FMTA 2GZ1A 2XB6A 2DWOA 1T4GA 5FPTA 1NVVQ 1GUZA 3KOMA 1A69A 1Z36A 4A6XA 2C03A 4LXYA 3ZLVA 4JVLA 3AB7A 2MMGA 1PWEA 3EGWA 4QYMA 3PRJA 4DMUB 1Z35A 5J47A 2MYTA 2FMIA 1L5KA 1BOOA 1RYMA 3QBVA 2HIAA 3K30A 3L0ZA 2V9PA 3U48A 2FPXA 4ZDKA 2WP8J 3AETA 3I9MA 3IKJA 1N3BA 4HQNA 4K46A 1JWAB 2EWMA 2P1RA 3IT1A 3L79A 1QLHA 4M36A 4RH3A 3UXMA 3JQ8A 4C05A 1RZRD 3F5MA 5JAUA 4Y1RA 1J56A 2YVKA 1ZKDA 2AZDA 1P0FA 1M0WA 4H4CA 4ONEA 2PT6A 1YHZA 2RHBA 3LP6A 1CEXA 2BGLA 1TNDA 1ZLYA 2GJKA 4RPCA 4RZUA 1IONA 3ND8A 4WI1A 4WJLA 4ZMRA 5L9AA 3EE6A 1CUHA 1YKSA 1E2BA 2FR8A 1VRCA 5KYXA 2AV6A 3L41A 4AULA 3EK2A 4ZHQF 2JD1A 4M6WB 4P7GA 3S0JA 2HI0A 3TLAA 4WKOA 1H69A 4OKSA 1VFPA 3ELWA 1K68A 3MWLA 4ZCMA 1FNNA 2HRDA 2G9RA 3LHFA 4G0MA 1X9HA 2FN8A 4OLFA 1KDVA 1UKCA 3TZEA 1HR0B 5FDFA 5ALOA 2A7XA 2AOVA 4H4DA 3IP9A 1RFGE 3QKWA 3AIOA 4ENRA 3QA3E 4HEA1 3SS7X 4AZ3B 2WP0A 4NPCA 2P75A 2WF6A 4QQNA 1QP4A 2CK3A 2O3RA 4O4JF 3QKTA 1P1HA 3A1WA 1HETA 1K66A 3DUFB 1EFKA 3H5NA 5JAMA 4NOMA 3B6JA 1EQ2A 1QFZA 1RWWA 4O4JA 4OO3A 4LWPA 5DGIA 1L7XA 5AKLA 2IV2X 4CQMD 1R6XA 4DARA 3IVAA 5BWNA 4N7RA 3P9RA 1BN6A 1HFEL 4PSKA 5CCDA 4OQXA 4LBVA 1K5HA 3E35A 5C1IA 1AKNA 2OK8A 1T6YA 4PCLA 4TTJA 5JJ5A 2FSVA 3R23A 1B3BA 2IYZA 3VTKA 5C3UA 1C3OA 3KKLA 2RGBA 1I3MA 4K88A 1YR7A 5J58A 4OGLA 5I8ZA 3VUEA 1DIRA 1L7OA 3V8PA 4L4YA 4NDAA 1NVWQ 3R0ZA 4R9NA 1TJPB 1NFRA 2C5HA 3HUFA 3HWSA 4P1ZA 5KNBA 1JWLA 4WHMA 4B6EA 5K0TA 3QVVA 2W9XA 3RNOA 4X93A 2HK6A 5DX8A 1YRQA 1NXTA 2DXIA 3WV5A 3D8HA 4LKOA 4AP6A 2E1PA 1A5AB 2PGXA 2Y67A 1AO3A 1DKMA 5REQB 1NLUA 2FY8A 1HKHA 5MGBA 5GMOA 2W5UA 5E4YA 5F5LA 2VQFB 5IABA 1ZOIA 3R7AA 1EUQA 3NMUF 3MJHA 4RH1A 4IUYA 2H63A 1G3RA 3H2JA 1WQ4A 1T1RA 3CT6A 2TRSB 1WABA 4J9VA 4AURA 4X65B 3AKYA 3DEZA 5KZMB 3BFXA 2GVNA 1KAOA 3T7IA 3UGJA 2HSWA 1PTKA 4ZAVA 2QK4A 3Q7PA 1JDZA 2XECA 5IDVA 1TXGA 3GQVA 4WBSA 3QPBA 3LUKA 2XQKA 3N28A 2AIRA 1ISHA 2ZSBA 3DVLA 3FOBA 1I3CA 3IQWA 2FE1A 1REQA 1YBVA 4HEA6 2Q50A 1F51E 3FR7A 2DPMA 2YOHA 3ROXA 1HNNA 1WEKA 3BF7A 2P2YA 2QTWB 2VF7A 5CYOA 3WBFA 4NU8X 1K98A 2A59A 1P2GA 1O94A 1XTQA 3G8CA 2XVZA 3HG7A 3INNA 4IMIB 4Z9YA 4MW1A 1MG0A 3OECA 1BWQA 1SUBA 4A1OA 3DDWA 2W22A 3ZHZA 4MKGA 5HIIA 4HMPA 1Z2DA 3ROFA 2I4MA 1XQ9A 2XYGA 3ZGNA 2A84A 1FFXA 1SBZA 3LLMA 4BLOA 2WYVA 5BV1A 4EFDA 4PZAA 4IZHA 4BNIA 4QQRA 1XCJA 1N0WA 4PZDA 1RBQA 1K3UB 1GG2A 1DQPA 4PVDA 1FIUA 3VZPA 1PNRA 7ABPA 4BMSA 5D3KA 1VG9B 5AMXA 3W0LB 3FUTA 5KWSA 1Z2NX 1RWKA 3NX4A 2I8LA 1E3LA 3FMIA 2X0KA 3IHWA 4CIAA 1HE8B 3ZNNA 4QKQA 1NQVA 1NVGA 2VNHA 2C5AA 4I4TA 3PSHA 3UUEA 1XIVA 3FPGA 3HCBA 4Q6WA 4NE9A 3KG2A 4OHVA 1HV8A 4C7OA 1W96A 1PVOA 1P2BA 1COWA 2IIVA 2ZYTX 3LXUX 1NXWA 2B1JA 3SZOA 2W48A 3GRVA 4AMYA 4S05A 2FWRA 5ICEA 4AG6A 4BATA 1UUFA 2QLNA 3LKVA 3DA8A 3PQ2A 4L57A 4OFBA 3UWMA 3IUNA 3IE1A 3PD1A 1W85B 1NIPA 2X14A 4ZCQA 2GJ8A 2WMNB 3KB2A 4D43A 2TS1A 1CUIA 2FN4A 4H6PA 5CNJA 4GI2A 3U4QA 1P73A 1WUHS 3AUSA 3K5PA 3WLNA 1T8TA 2DRIA 3ZWCA 5IHXA 4FYIA 1OX4A 2BFEA 2AG0A 2GERA 3F3KA 3I8SA 1J5PA 3WZMA 4Z7NB 2EGGA 3L4EA 1H3EA 3DTVB 5JAQA 1ZNWA 1W47A 1YRBA 1QQBA 1GZDA 2ASEA 1T25A 4HQKA 3C3MA 1S8FA 4RY9A 1CQPA 1CETA 4R3WA 1UT5A 1AK9A 2IHNA 2R47A 3E9CA 1CPYA 2OORA 2Q9CA 4CCAA 2GKSA 2X9GA 4MEBA 1BMFD 3FLMA 4B84A 1YASA 1M2KA 1W4BA 3CXRA 1FP6A 3Q0IA 2C2YA 4TLAA 1IZYA 3VHQA 4Z8YA 1KP2A 3MELA 3OZWA 4QARA 3ZD6A 2W6JA 3PC8C 4MIEA 2VKQA 4MGZR 5JJLA 4CMCA 3DMTC 2XYRA 1FVXA 1O77A 3CIOA 1SU6A 4YXWA 5GY7A 2QTMA 2VHXA 1H4QA 3MUFA 4R6XA 1FVFA 4XSVA 2WKSA 4WY2A 4J0GA 3FWHA 3U17A 4RA9B 1W5TA 1HFWA 3BFKA 1X14A 4BCCA 4UTNA 1T6XA 4JI0B 1E8DA 3I8XA 1P44A 5CW2A 2O8DA 1QKJA 3CNLA 4GOLD 2I6XA 5EJ9A 1B8PA 1ZJ4A 4B4VA 4HLNA 4ECEA 3IOYA 4FNAA 4IIJF 3WL7A 5KNBH 3NM5A 5IJ9A 3M82A 3LECA 3HN6A 16PKA 4B3CA 1HDZA 1OAKA 2H52A 4CNQA 4ETWA 4EGQA 2ZOSA 1U94A 1W5EA 1RKUA 2CMHA 3VDQA 2XXAB 4WLVA 3A6JA 3TTUA 1E7WA 1GPH1 4ZEMA 1MEOA 4QWWA 3H65A 5A9SB 4G24A 3MHPA 3GUVA 3UHOA 4AUEA 4N0DA 5A3SA 1GCAA 2WUGA 3D7KA 5EN4A 3MUOA 4B3RB 1CX9B 5ARDA 1VRWA 2R2AA 2WPDA 3RUHA 4LJSA 3HFRA 1V5WA 4PYRA 1MVLA 2BEWB 1D7AA 3HBLA 3JRNA 3NORA 3UG6A 4CEJA 3JWGA 1WNTA 2YHIA 2ZSIA 3BGDA 3GG9A 3URMA 5DI3A 1ZHOA 3E18A 1V43A 3E0XA 1OHHD 1A50B 4GZMA 4PC7A 1I5OA 5L3ZA 4V1CA 4F46A 3SY8A 5E1BA 1OV6A 3HKDA 4ZU1X 1X1RA 5ARBA 3ZCUA 5B58C 3T12A 3OX4A 1SBHA 5IAGA 3VBEA 1RPZA 3GFQA 4OF4A 4QOHA 1MGPA 2W6OA 4LE0A 5KU1A 3H4MA 3OQIB 2PVPA 621PA 2PD4A 3BTVA 3CUSA 3F5SA 3OIVA 3CN9A 4IX9A 4BMYA 1FFWA 5K01A 3CEPB 3RAJA 1K4KA 1P72A 1QGOA 5FUQA 3K70B 1UZLA 2WUEA 2HCRA 4Y2UA 2JIBA 2CE7A 2Z4TA 1Q84A 5FI3A 3GFOA 2QLFA 2WJYA 1ZM7A 3N75A 4J0EA 1KYWA 3PPYA 3DZGA 1YQXA 1XXLA 4G23A 4IH9A 4L8FA 3H8SA 2A9QA 5TNXA 3DKKA 1EUCB 1HDGO 2PH5A 5HQTA 3IPYA 3UWKA 2WF9A 2X9VA 3WNCA 2AB0A 2QX4A 1UKAA 3QUBA 1PHRA 3K73O 2J3JA 2MSLA 2WIGA 4JGBA 3CZMA 3T0IA 5F7XA 1W75A 3JQFC 3IDOA 4L95C 2Z8ZA 4Z7OB 2J41A 2O3SA 3ESYA 4Z4IA 3JVVA 3DT9A 3G89A 4LXHA 4CG3A 1FXSA 4LF5B 1ND5A 2TMGA 3VU9A 3KEGA 4GP6A 2NZ8A 4JYPA 2BBTA 5IMBA 5C4MA 3TQSA 1R00A 5A6SB 3R1IA 5G02A 3PQEA 4X95A 2AA3A 2PUJA 3FF4A 3WGYA 1DBSA 3D5EA 1C2YA 1HDRA 3NH9A 1P5RA 4JT2A 4NLLA 5BP7A 3D8SA 4A0HA 3VR3A 2OHHA 5ITVA 4D2IA 4V3CA 2NSLA 3QKRB 4IV5A 4YJ2F 4HAIA 4RTRA 2OOSA 3Q7SA 3EZLA 2PTHA 4ZDJA 1WSBA 5E7IA 4FR0A 3UB2A 2ZPUA 5G1PA 4ZN6A 5HS4A 3IIMA 3JWEA 2QL9A 2PU5A 2R4QA 3TW8A 4HV4A 3QWBA 4R2XA 5EWJA 3W78A 1S7CA 2QT9A 1O95A 2DY1A 1C7EA 1CLEA 1QV7A 1Q17A 3BL5A 3D31A 4LDJA 1JJFA 3GJTA 3WKDA 4BNHA 5BSEA 3KR0A 1WSWA 3DMDA 4BMDA 3ABRB 4V02A 2WA2A 3I6IA 3MVEA 1L4FA 1G4HA 1G8YA 3JD0A 1E3SA 4HEHA 4WZAE 4X8OA 1SKUA 1DLIA 1EP3B 4N5IX 1P8AA 2R96A 4UQOA 5ARCA 1J5XA 5F51A 3SF8B 2VQDA 1U2DA 3IQIX 4K6FA 4BN0A 3TECE 5HCUA 1PAUA 1IHYA 1A2KC 3H19A 1YR2A 2O1XA 4QBTA 3FFBA 2WWTA 2G1KA 3FMFA 2OEPA 4BGVA 2FUG1 1WB9A 3ZTWA 1YZVA 1ZR4A 1GV0A 3HUUA 2Z5GA 4UVHA 5HIAA 5JNUA 1M5RA 2A78A 3CWQA 1MTZA 3KAQA 1UT8A 2I6QA 1NRWA 1SCIA 5JZMA 1MRNA 1KJJA 1MH1A 1YB5A 2W2LD 3HVHA 3D0RA 3IP5A 1M2EA 1T9GR 2I33A 5IPFA 3O8RA 2A6PA 3WBJA 2D2XA 1X3LA 3VKWA 3FSRA 3MB5A 2RHHA 2X1HA 1YVEI 1ACLA 5DHQA 4LJ8A 2RD2A 4N4AA 3WMWA 1PJBA 1SXJE 2X23A 3H8JA 2P6UA 5B1DA 3V7FA 1NBME 4YAKA 4CETA 1U80A 1DAGA 4FD3A 6PFKA 9LDTA 1AUVA 1ZSNA 1EVZA 2I22A 1IB0A 4PAMA 2G9NA 4BE9A 2WY2D 1QRAA 5K2OA 2O0MA 1P7WA 5NULA 2A0FA 4FILA 2Q4RA 2WFLA 5CDSA 3ZJ5A 4WK2B 1DHTA 3RKUA 4RE6A 4HZUA 5G1NA 3RUAA 5CFZA 1JAHA 3O2SB 3OQMA 3K8QA 1BKSB 3VPFA 2XRMA 1QG0A 2A1IA 3GRPA 4FFSA 4JELA 1PJQA 3FVTA 4KO1S 3NHFA 2IV3A 3SVZA 3TTTA 4BVJA 4ZTUB 4TV9B 1RWNA 3IP1A 4R51A 2AG6A 2XB4A 4M76B 4QNMA 4GRDA 4MCAA 3BORA 3ISTA 1ZCBA 2OZLB 2ZE7A 2GZDA 3F7NA 3IAXA 3DTVD 4QTUB 1OF1A 3TB6A 1G98A 3Q15C 3GJ8A 3PHIA 2VP2A 3OPYI 3BB3A 4MGIR 3WBBA 5IM4F 4D9MA 4MW2A 3AERB 4A9AA 3GLFB 5LLSA 3L04A 1FW6A 2YVUA 4R1MA 1WUKS 4KXYA 2Y27A 1JQEA 4WZBA 4LYAA 1LD3A 1CR1A 1PL8A 3A9VA 4PIMA 2BTOA 3REQB 1ORRA 5EERA 4JCOA 2HLHA 4MS1B 4D1YA 5I45A 1JIUA 1YT5A 5ALKA 1PZMA 3RVPA 3WIDA 5LYJF 3B9PA 2G07A 5K6AC 4IDOA 2H2WA 1X7GA 2PZKA 4BV2A 5IF3A 1BWSA 1QFMA 10MHA 4DYHA 3TOVA 4DUYB 1R5OA 3PPIA 2G5TA 4I50F 4P22A 2ZYWX 5EWLB 1YFJA 3PEFA 2QRVA 1VQ1A 3M6WA 2QN3A 5AJWA 3GFTA 1B15A 2EKBA 1N7JA 3C6MA 2DCMA 4KODA 4NK5A 4OATA 5F3RA 1JJVA 2FEAA 3L6DA 2IHVA 1I6MA 2MOKA 4XX1A 4UFPA 1OBCA 5H59A 1N2JA 4CF3A 1Z13A 1Z5PA 2J30A 1A7KA 2BTQA 4EVSA 1YB1A 4DA9A 4HR7A 1GITA 1ZHFA 1MQSA 1EFCA 2GS9A 4FUQA 1QHNA 1Y8QA 1SHLA 1UC5B 2J0UB 2GM9A 3BF8A 3KOUA 4R2LA 5L7TA 1XCPA 2QTTA 2XT0A 5FTJA 5FLEX 2B5VA 1KERA 1E3EA 1BFDA 2HA6A 2PIAA 2QS9A 4HNRA 4OHKA 5KWVA 4YAJA 1MORA 3N39C 5FF9A 5G0TA 4BKUA 1YNOA 4DUZB 5DFAA 1SG9A 2BGWA 1K63A 5KWIA 1Y3AA 1GA1A 3E9DA 4RADA 1BROA 4E5NA 1O5TA 3QWIA 5F2NA 1NYLA 2R5WA 3QENA 1EFPB 1M6EX 4RYLA 2CVFA 3F6RA 4WCFC 2FGJA 3U60B 2J9XB 1J0DA 3DL2A 1NMZA 1UBJS 2I5PO 2D5BA 3EIQA 3TCXB 4YPVA 3VSAA 1QOPB 2G3YA 2VXYA 4Y6PA 2A1UA 3DDNA 5BYKA 1NUPA 4J1TA 1CDZA 2JAXA 3OUZA 2FJUA 2CVZA 3P4YA 4LPSA 3SBOA 3VH3A 2F67A 3OLQA 3CX4A 3MJTA 3DQZA 4XB6B 2RHJA 4WASA 3WBKA 5IUJC 3UA3A 1QS0A 3L77A 5EESA 3K70D 3C97A 3MLAA 4FNMA 2P78A 4C6TB 1V5EA 2EBUA 4I9UA 1E2JA 4UUBA 3IUBA 1NJFA 3PI7A 2GBLC 4I1UA 2ECOA 1E58A 2GSDA 1XTKA 3SSOA 2IH2A 4NS1A 3D64A 3A3NA 2J6BA 2B0CA 3GFFA 3N9IA 1GTMA 4WXHA 3ZLBA 2B4AA 2R8XA 3OCXA 4DLBA 1XFDA 2Q9BA 4UHKA 3T1HB 4PNEA 2P4EA 4NBRA 2HGZA 3A0UA 3CNEA 1TZKA 4GLJA 1G9XA 1XMSA 4ZT6A 2BKVA 1JQBA 3ASUA 4FSDA 3A06A 1ODTC 2DWQA 2YRFA 4F4UA 1DBWA 4BNTA 5ALMA 4EEXA 3N5KA 3L4JA 2QMZA 1KMMA 4INAA 1WMSA 1IN5A 3PRYA 3TZHA 1Y0BA 1NYQA 1Z6PA 1ENOA 4GDMA 1BKYA 3E23A 1XTVA 1Z06A 3S40A 1MV5A 5LZ9A 2IS1A 2PMKA 3N8HA 4G1EB 2I7XA 5BW8A 4KGDA 5JMWA 3RUFA 3F90A 5CAEB 4DPLA 4G0QA 1PTJA 1F0NA 2WW8A 2G4LA 2XOXA 1KJYA 3BTUA 1UJBA 2CGEA 3I2YX 4KQEA 1T9AA 2VDJA 3FKSD 4LN1A 5FUYA 1EXMA 3UMFA 5KAPA 4EIWA 2FU5C 3U1TA 4FKBA 4U2GA 1SCUA 3U3JA 5D2CA 2TMDA 3ZY6A 5CFQA 1SK9A 3QOXA 3K0FB 5HYVA 1U8ZA 1Z8DA 4G67A 1VLLA 4UVGA 3GT7A 3N53A 1PGOA 3IP3A 1I7DA 2QNRA 1PS9A 2YWCA 4WA7A 1YTLA 4UBKA 4LW8A 3USZA 2R0QC 1K8ZB 2X6RA 3V7UA 5DNEA 5JS2A 1D5WA 3DL7A 5KYYA 3AF6A 1YIAA 2GWRA 2WM9B 4Z9XA 5CA0B 2ZIWB 1Z8FA 4NHEA 2PL1A 3PR1A 2JCXA 4D45A 1FK8A 2HNBA 3OF5A 1EGQA 2WD7B 3WHKA 4AMBA 1DV2A 1YQGA 3NJ8A 4Q9AA 3UXEA 5MN5A 2ONCA 4IRXA 4EF5A 4RTPA 2RHMA 1NG1A 2AG1A 2FRDC 2IT1A 4I1RA 1O6BA 1BEUB 1Z5WA 3BRWA 1BVYF 3F2VA 3W90A 2KPOA 3DMTA 2C2GA 3PNKA 3CF6R 3IEIA 1H3FA 2QTRA 1A9XA 2GN6A 1L3IA 3M5WA 2QAGB 2H59A 2MSEB 2GN1A 2IY9A 2QGFA 2XEXA 4J6EA 3R0VA 3E3MA 4MQEB 4YIKA 1JTVA 4HGQA 3NZEA 5BV2P 5FBQB 1SR8A 2XMSA 3NFRA 1P0IA 5B3KA 2V4ZA 1OLOA 3S5JA 3W3ZB 2H4WA 2YFYA 4MLCA 2IYVA 4EGFA 4OBXA 3F9IA 3QEMA 4F6RB 3BJIC 4CRWB 2XCQA 3C8MA 3UJNA 2VCEA 1BQ4A 1Z5OA 1A77A 3DKVA 5FYQA 2YY5A 1I10A 2OM2A 4G8DA 4J9UE 4UTPA 2B99A 3RS0A 4AZ0B 1LJ8A 4Q4AA 4L27A 1KYXA 3A25A 1Y3IA 4R41A 2RG1A 4ZEOA 2I1VB 2OYSA 1PT8A 4F45A 3K8ZA 4ASUA 4KKVA 3QE4A 1XEFA 2FOLA 5AK5A 4BQRA 1QNLA 2ZWPA 6Q21A 3RS7A 5IZCC 2CB9A 2WABA 3TKAA 1O96B 3O84A 2JKVA 1RHRA 3U4CA 3ZK9A 4PYKA 2AR0A 3JQBA 5HJ5A 1U0RA 1VPDA 5J2UF 2X2PA 2IVFA 2AE2A 3NETA 2HLPA 2ORED 1FFGA 1NBAA 3Q3GE 4RCYA 4Y0NA 1ZNZA 1TKAA 3K16A 1ZUIA 4DCVA 2X7HA 2W2TA 3T3IA 1Z5NA 1YRYE 4TV8F 2XUOA 4MRMA 1Z2PX 4YVFA 4YP6A 2HDWA 3ZIAD 1XRLA 4GWLA 3ZE1B 3JCZA 1QCCA 2P9BA 3EGEA 5ALEA 5IW8A 4F92B 5F1YA 2JLZA 2C99A 2JK0A 3ZU2A 4C6RA 4CU5A 2ZIVB 3V8QA 1LPAB 2DR0A 3DBOB 1N9KA 4XQGA 2ID8A 2A9RA 3B1JA 1LLFA 1NJ5A 2XUFA 3EJ6A 1IXRC 1YDMA 4NZMA 3WIUA 4LF8B 1U8YA 3Q2IA 4FYXA 4O4LB 1DSSG 4QUJA 3QMPA 3ITEA 1TAHA 3T3EA 2HMAA 3TX6A 2AX4A 2HWUA 3KHKA 3NCHA 5JHHB 13PKA 2LDXA 1FU8A 4ARAA 4XVRA 4AUKA 1Y3FE 3B2EA 4ZCSA 1KS2A 1RXUA 2ORYA 4P31A 3BGOS 3OJWA 4XB1A 1V5FA 1GYQA 2XTNA 1Q21A 1ZGHA 4H1TA 2P79A 1X39A 2DECA 4LXGA 4E2WA 3W06A 1JA1A 2IXDA 4IDHA 2QI9C 2C4MA 3ID6C 1NQ5A 1SA0B 4ICIA 3G8YA 2O23A 4ZAGA 1E8MA 2Y0CA 1QO9A 3HDHA 4UPVA 4DSZA 3AHJA 1M6NA 4DCJA 1AZTA 1E2PA 3M6VA 2HSDA 4HX5A 3O7MA 4KWIA 4FZ3A 3PHHA 3Q8WA 4ZJZA 2JFXA 2J9GA 2IOHA 5EWMA 4DRZA 5B1HA 3I09A 4Q19A 1I3NA 1TIKA 1X1EA 1Z33A 2M6SA 2OPBA 3LK7A 5IUKC 4AWBA 1C9MA 2Q5OA 5PNTA 1XMIA 2JIRA 4E03A 2PWZA 1A7AA 1X8KA 4HGOA 2RH5A 2HW8A 3S1AB 3MAAC 3VYWA 1KP3A 4E1BA 1XAJA 4J1SA 1R6UA 3ESBA 1DE0A 1QIMA 4E2FA 4X64B 3FYUC 5DK4A 5FYDA 5EE0A 4FFBB 1NATA 1I7QB 1Q1BA 1C0EA 4UUQA 4ZOBA 1I5RA 4ZEVA 3W6ZA 1AF7A 2A5JA 4QA9A 4Q1FA 1VJDA 2AN5A 1E5LA 1U7XA 4G37A 5IBRA 4L16A 1LSUA 1XBTA 1ZIOA 4BNNA 1U2EA 1GAXA 2YY7A 1HFJA 1M8KA 3ZDRA 2ZQYA 4F72A 5J4KA 5LZ8A 3R0IA 2AOUB 4YACA 3CS3A 4GZ3A 5DF1A 4E4YA 3LHKA 4YJFB 2OE2A 3PUKA 4NARA 2GEKA 5ISMA 5DGXA 4PYLA 4MS3A 1J20A 3TSWA 5CNMA 3E7DA 3COZA 2WI8A 2WFZA 4X7PA 3W9UA 2OHGA 3Q1KA 1TIPA 1JQKA 3MK31 3PJGA 2HJHA 2KQUA 2OB2A 1NVXQ 3TE7A 4MUYA 1KEPA 4OB7A 2W37A 1VG0B 1K8RA 1E5DA 3ASYA 1V5IA 4F91B 3QYJA 4TOIA 3OQPA 4CLRB 3VYVA 1ZNXA 3LPMA 1WEHA 4BVHA 1N2CA 4LHEA 3WB2A 2O3JA 2PUDA 4IIFA 3KT6A 1BGVA 2MR5A 2GF2A 1RJWA 2DULA 5I7UA 2BF4A 2GBIA 3BGWA 2PH7A 1SOMA 4GLFA 2I3ZA 4H1WA 2ZIFA 1NVFA 4XYGA 3CH6A 3ONDA 4LZZA 2A86A 4GLBA 3ZQUA 3GMTA 4XGKA 1YRAA 4PLPA 3VNVA 4MA4A 3D2BA 3A3YA 3FSGD 1YAJA 4HXYA 3THXA 4D97A 1OI3A 4RPLA 2V6FA 1VLQA 3EASA 4A2QA 4X90A 2CV1A 3VPSA 1Z2AA 5AP9A 2OC4A 4NS4A 1KZHA 3SGLA 5KTPA 3WV4A 3UJCA 4DMRA 2PMFA 1W46A 5LMCA 3NIDB 3Q7RA 4CCYB 1T36A 4FKZA 1GP2A 2FF5A 3DOHA 3QFTA 3AIIA 4QYIA 5ILQA 3REFA 2ZJZA 3X1MA 5E38A 2GEUA 1L8LA 2PHZA 4MICA 1H85A 2ZBVA 1TM4E 3Q5EA 1GPDG 3RWBA 2V7WA 4MQLA 2O8VA 4E32A 4FYKA 1XUOA 1UBOS 4RM2A 2BMEA 3K2BA 5TY0A 3SEFA 3SXUA 4CLHA 1AM4D 3RVLA 1C80A 4DIUA 5IANA 5JCPA 2UYYA 2WIDA 2GFQA 3KQVA 5L53A 3L06A 2EZ4A 2EP5A 5A3VA 4DABA 1LJUA 1OKKD 2ICAA 2XE6A 3A2MA 3OZSA 3QLJA 4NESA 2OG2A 3WYNA 3PXDA 4Y9RA 2OCKA 2AI2A 3DLAA 1DKQA 5BN1A 2XD4A 1QIGA 3WI7A 2C3YA 1EFTA 1X7ZA 2YUIA 3NO4A 4ZI7A 1TTHA 4ME6A 1WZEA 2UZ4A 3F98A 4GYJA 1NP3A 1NIJA 1CJMA 3KSAC 1LLCA 4LWOA 3HR8A 4DCMA 5KOIA 2Z6QA 4MGKR 1LLQA 4URXR 4XDHA 5FL7A 2ZBDA 4ER6A 4NV0A 3ZS9A 4M8KA 1KVUA 4D8WA 1FDUA 2VUHB 5A03A 3EVGA 2QHXA 1JP7A 4HD8A 2OCDA 3CQ9A 2XNDA 1C9EA 1Z0FA 1HA3A 4X5OA 2B9VA 4PHTA 3SHFA 4H6XA 4KYVA 1J2UA 1EM8A 2FG7C 4JIMA 4JYCA 1CYEA 3UWDA 1YWGO 4EYGA 2CNWA 4CNBA 4IDNA 2IE0A 1P4SA 2ZRNA 3KEFA 3EGDB 5CT9A 2ZIAA 3OT1B 2QVLA 4ZOEA 2ETVA 4NFLA 3JW8A 2GA8A 2B34A 1G1AA 3G9UA 4KB5A 3WFIA 4C3OB 2P9ZA 1IG0A 4C03A 3QV2A 3MA0A 2WEKA 1RQXA 1A27A 1G0NA 2LW7A 2XWQA 3TNJA 4DT1B 2HNKA 3B7PA 5FHRA 1UXOA 4ITUA 3KZVA 4TSRA 3UK0A 5A4MS 1ARZA 2G82A 4KR0A 4QM7A 1W2HA 1CKEA 4QLAA 5LPNA 4PW0A 2ZIXB 5AJTA 1JR6A 1E9AA 2FN9A 1AOXA 1FFBA 1GKIA 1I9CA 3H1FA 3EZXA 2AEJA 3K6JA 4RQUA 1YJ5A 4EI9A 3UMCA 1JHUA 3TOZA 2BSXA 3O93A 2KX7A 4HCJA 3KD2A 3SQNA 1Z12A 3R7WB 1M6HA 3JS5A 1SIWA 1L5YA 1TYZA 1R4AA 4RA6A 1VL0A 1LLDA 2JFQA 1PJCA 1CR2A 4KDEA 4JB3A 3UMJA 4OUDB 4C3UA 4MYRA 1LSJA 4UHFA 3A1UA 4GBJA 4X0EA 4RMGA 4X3OA 3M6AA 3RVMA 1UBNA 4OOEA 1PJTA 3GJ4A 4WKGA 3IV6A 3UC9A 4KXLA 3BTSA 1F2DA 4O4HF 3VJKA 5BSTA 2VJOA 3TLZA 4IWXA 5IT0A 3RJTA 1JDBB 4LF9B 4ZAXA 2JIOA 4FVTA 4ZQIA 3WQSB 1UOPA 2V5AA 3V4PB 3M4XA 1NQXA 4IJMA 3HP4A 4EB8A 1WCWA 1RACA 2IHYA 2YDYA 3U7QB 2H00A 4F4CA 1ZBQA 2OMEA 5F3DA 1YA8A 1HI9A 4B7XA 1ZCFA 1NXVA 2AJLI 3K0AB 1VCMA 2GTHA 1U0EA 3AM1A 5FTMA 1G8KA 3FHOA 3RB8A 2F3PA 1ORDA 1ZGJA 3CZ5A 3EBPA 4W1QA 4JT4A 5FWYB 4W5QA 4OJNA 1U8EA 3VH2A 5D5HA 4BQQA 3BH0A 3TLXA 1JT2A 4WZAB 1UM9B 4KTTE 4PCUA 4W5JA 1JXAA 5M2QA 2ZBEA 1Z5UA 4TGLA 1GPAA 3BX1A 1JLLB 3FDXA 4OI2A 5B2ZA 4PC3A 4B3TB 3K31A 3AJEA 4G5YA 4BX0A 2BM8A 4HMQA 2XEDA 1E5VA 2VNIA 1OH8A 1WLYA 1U0OC 1KBQA 1U81A 2WSIA 5LP6B 3IA2A 3MCZA 1RCUA 1QZUA 2VATA 3AEKA 1S2NA 3HE3A 5EJ2A 3SOZA 3QG5A 4FINA 4CTMA 2EF1A 3CEHA 1BX0A 1K8QA 2JRLA 4ZT7A 5AW9A 5EMMA 4LY9A 5CG1A 2I2DA 2X5JO 4GOJA 2ENUA 2Z9BA 4FHDA 3I9JA 1DRJA 2HADA 1NQOA 3SC2B 3SXPA 4M88A 3UHFA 1QH0A 1CXZA 4D26A 3UOGA 5BVHA 2WZDA 5E9WA 1N1GA 1QMPA 1BSVA 1FUIA 1SXJB 3I45A 3LC1O 3P2MA 3PFHA 1CUJA 4AX8A 2B7BA 4BO3A 2IYPA 1TKBA 5EE5B 3IXLA 4KYUA 1ENZA 5KX5A 4NF2A 1K6XA 2F4VB 1P74A 3EXG2 5HM8A 5IC5A 5JTTA 2HTFA 4MRAA 1GQQA 1QDEA 3I05A 3IIKA 4RACA 4C7XA 2NZWA 4QBHA 4DRYA 5BOSA 2AUMA 4YAEA 2XDQB 1CZLA 3LPCA 3RYIB 3ESQA 1IK6A 5EJFA 1G17A 4RETA 4CTKA 5I5GA 1BFKA 4YGYA 1K92A 1KDTA 3U4MA 4GI3A 2NM0A 1SBQA 4C0WA 4L4RA 3AEUA 3L05A 3H5AA 3FUCA 3U6BA 3LP5A 1RWVA 2BFBA 3GY0A 4TWZA 2D5AA 3NIBA 4E6PA 5J59A 2IYRA 3NTOA 3F74A 1Y37A 4A92A 4BNDB 2IZ0A 2I1QA 1V9SA 3SS9X 5B6PA 5BURA 3VYTB 3D6UA 4IJVA 1G21E 1Q20A 2Q29A 3LQ1A 1VKNA 4PSVA 1WM1A 1NDHA 4YMGA 2JGDA 5C7YA 5L4LA 4R01A 2NZYA 5B37A 4OHZA 3ZV7A 3L1UA 5BV8A 1G63A 4HF7A 3ZV6A 2E5LB 1I0LA 3T7SA 4XFKA 3TR5A 1RBYA 2QJFA 1CU1A 4GI5A 4N8DA 4D9FA 3ZVKA 2AOXA 4KNWA 5LB4A 3KQLA 3KUCA 5IMSA 1QFSA 4HTAA 4JI7B 3Q12A 1POXA 2NU7B 4GGMX 2PSDA 4YDQA 3UWPA 3D2CA 3PVSA 3GVHA 3TINA 1L5OA 2HH9A 2HB6A 4KRYA 4MDYA 1WVGA 2Q0HA 3LAWA 1E4EA 4PAOA 2HPVA 4PGGA 4V38A 4WZBE 2F00A 2IBTA 1WW2A 4U6SA 1IY8A 5FUVA 3JXEA 1QYXA 3EZ7A 4C0HA 4JBYA 1UFVA 1OY1A 2A30A 1SH7A 4OXKA 4E4TA 2UYCA 2PNJA 3TCNA 4K7JA 4N82A 1V4NA 4M1TA 2QD4A 2F90A 1XXHE 2CFSA 2XPCA 3DEJA 3FW1A 4CF7A 1BXGA 4WPGA 3X2EA 5B6JA 2O5RA 2YWEA 2VP4A 4ESEA 1FC0A 1L8QA 3DLBA 5FKJA 1TEZA 3ZHYA 5L40A 1CF4A 2IUTA 1KHHA 5LD2B 1DXYA 4FM9A 1HQDA 4UBJA 1MVOA 4C2AA 4O0LA 5JNSA 5I7OA 3ESZA 1Y7LA 2OBYA 2Q1WA 3THWA 1LS1A 1SUEA 5I48A 3CRNA 1N2SA 5JS7A 1C4OA 3KUDA 3LBHA 4FOLA 4G84A 4NL4H 1IBCA 1UR5A 2BW0A 2PFGA 2R6ZA 1AGPA 4O2AA 3L4SO 3JASA 1KY5A 3TD9A 3TEMA 3DWEX 1VECA 1UXGA 3OTHA 3PNYA 4R8SA 1SURA 2YMPA 2Z83A 2BP7A 2GJ4A 2GF0A 3K09A 4US1R 5DYIA 4OMFG 4DV4B 5JANA 1FTQA 4XJSA 5F3WB 5JNLA 2A0XA 1JALA 3QI2A 2WAXA 4GVXA 2ZATA 1IMOA 1UXKA 3NAZA 1QV6A 4R0VA 4O59O 5AK4A 1E7YA 3NGMA 3VTAA 3DNFA 3D7MA 4JLNA 1YJQA 1GFSA 2P9EA 1CHNA 4JT9A 1RPAA 1XFAA 2YVQA 4WKPA 1Z6XA 2W2OA 2O0LA 4WJZA 3DMRA 4NCBA 5ALJA 2JIPA 4TS1A 2JGNA 5KTRA 4M9RA 2H6EA 2Z56A 1J1UA 5BUSA 3EXFA 2EGHA 1JEQB 2XYPA 3GUYA 3OM9A 1G5FA 1HT2E 1ZC3A 3MM4A 1L8OA 3OJEA 4X20B 4ERNA 3GA7A 3VTFA 2GN9A 4RL4A 3WLEA 6GPBA 3MJRA 3WXMA 2JIZA 2OWEA 4FKMA 1ACMA 1KI2A 2NU8A 4C20A 4ESHA 1DARA 5DULA 3ZKAA 2QU8A 3WWOA 4ZOLB 1T13A 4GL4A 4KXXA 1HOXA 2WWFA 3I04M 3CPSA 4AZVA 1P19A 4Q37A 4P3OA 4B40A 2ADOA 4C0SA 3EAQA 5JOQA 5DYTA 2GN4A 1XDGA 2C0QA 5JXHA 3W2IA 2G72A 5THXA 2CJWB 2VHYA 1JLSA 4TLLB 4G65A 3RO7A 4PHGA 2AXEA 3OE1A 2BDTA 4HVAA 4TL6A 4A6EA 6LDHA 5HS6A 3UT0A 3ABQB 2BCEA 3HWRA 1YZFA 4JN6B 2GVDC 4CQLB 4B2LA 4LX8A 4V0QA 3UW1A 4MIKA 2HDOA 2X5OA 3N2ZB 4MGHA 3HY6A 1TADA 1KE2A 4N6GA 1MDFA 4EKGA 3HZOA 2EIXA 4IKOA 2ZUSA 4NZYA 4WNAA 3E3NA 3STXA 1FP4A 3ILYA 2PV0A 1AC5A 2V59A 3LRXA 4FDVA 3CO0S 1SVWA 2ZCJA 4P0QB 1ESMA 1OXUA 2D54A 4DC1A 1K4YA 2H0QA 2H9AA 2O0HA 3K9FC 1Y9AA 4KQIA 2XUZA 3DV2A 3L9WA 4EHDA 3CF4G 1CJCA 1NBIA 2PVCA 2X8AA 3GEBA 3MTAA 1SO8A 1ZESA 2R8EA 2P3OA 2WILA 4IQGA 4LMBA 4OREX 4QUGA 4R4JA 3RHTA 1L4LA 1E2DA 1QBKC 3FVRA 3OSUA 4E21A 3OPXA 3EGVA 3VOAA 4TWJA 2BHLA 5F73A 4JJEA 1QLWA 2KB0A 2HQRA 3SJZA 3OEHA 4B34A 3Q5GA 1A9PA 9ATCA 2MT9A 2XIQA 3FZGA 2YY6A 2BBOA 2D4HA 5BQPA 5IXYA 5KB3A 1ESDA 1MABA 3QQPA 4JWTA 4P0TA 5A05A 4F9TA 5IG2A 1FRQA 1GWNA 2WHPA 2WWHA 3F8SA 3V1LA 2ZG6A 2N1BA 3OPQA 3VI4B 3ELYA 2Y1CA 2HX1A 1GNVA 5SZIA 3ZDYB 3AF1A 5ICGA 2QX7A 2WKWA 2B8EA 1LBHA 3N0WA 3DL0A 1QK5A 2O52A 1BE1A 2CJFA 2VPPA 2XVMA 4RSGA 421PA