4HOYA

Crystal structure of peptidyl- trna hydrolase from acinetobacter baumannii at 1.78 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
193
structure length
193
Chain Sequence
b'MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
molecule tags Hydrolase
source organism Acinetobacter baumannii
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
total genus 63
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4hoyA00
4QAJA 4FOTA 4JX9A 4QD3A 4YLYA 3OFVA 4JY7A 5IVPA 2PTHA 4DHWA 5IMBA 3V2IA 4JC4A 1RYMA 4FNOA 3KJZA 4LWQA 2LGJA 4ZXPA 5IKEA 1RYNA 4Z86A 4IKOA 4QBKA 3NEAA 2Z2IA 4JWKA 4ERXA 3VJRA 3TCNA 4DJJA 5B6JA 3KK0A 4HOYA 1RYBA 3TCKA 3P2JA 2MJLA 3TD2A 4QT4A 2JRCA 2NAFA 2Z2JA 3TD6A 2Z2KA 4OLJA 4P7BA 5EKTA 4FYJA 4FOPA
chains in the Genus database with same CATH superfamily
3RTEA 3P97A 4ZT2A 2CGEA 1JI3A 1IOVA 1H0RA 1UPUA 2NZJA 2PZJA 1K06A 2BEUA 3D7MA 3IP9A 3PICA 3RT7A 4A0RA 3ANMA 4XX0B 4E5SA 4BNNA 2DEUA 1UKVY 1H0HA 3K9HA 1ID1A 4H7FA 5K51A 3RWBA 3STHA 1CR2A 3BX1A 3O9VA 1I3LA 3AI3A 4JR2A 2FMTA 2HDHA 4HWPA 3R3UA 5DHSA 2P2NA 3VH2A 3GFRA 1DG9A 4HEHA 4IDCA 4NU8X 5C1PA 1RWWA 3KCNA 3QOFA 4BNWA 3TOVA 1ENYA 3EVEA 2OC4A 2Q8PA 3OQ1A 4QGAA 2XCLA 3TQSA 2WPDD 1VC2A 3VBCA 5EJIA 1CZOA 3ICEA 3HP4A 4R3UC 1TJPB 3TZKA 1C9DB 2J9GA 4NVRA 1LC0A 1M2KA 3O91A 5EHGA 3WB1A 3LNTA 2RC5A 3KU1A 1E64A 4HJRA 5ED0A 5HIMA 5A5EA 3ZNQA 3JAWA 2KW5A 5JH7F 5TGDA 1A9SA 3O8OB 3RS8A 3UJNA 1STOA 3OLYA 5AJHA 4KOEC 5A9SA 2MSEB 3BSWA 1SOWA 4I6JA 1JT2A 1ZM4A 2P77A 3F78A 5HR5A 4Q7EA 1XPOA 2JBAA 1L4EA 3GAZA 4AJHA 1PYGA 1EFPB 3IQXA 1S02A 4ONEA 1F12A 4J4BA 2BKAA 2W0MA 2WSLA 3VTAA 2GH1A 3PCTA 1R64A 1J20A 1KP3A 2E87A 2OCXA 1CDOA 3D54D 1NFQA 4ZV7A 3C3AA 5EPUA 2RBEA 2AN1A 4R05A 1ZKMA 4I5GA 2XGSA 3L4BA 3HKDA 1WB9A 2O4CA 3QWBA 5LYJF 4HDSB 3WADA 3MRVA 5FO1A 4ZPJA 2VXCA 1OFHA 4RJKA 2EJUA 3SBDA 2BZ0A 1PR9A 2COEA 2PXAA 2WUGA 3DEZA 5IHXA 2AMLA 5EJ8A 4AB1A 1L8LA 1VLVA 1ZFNA 2RKOA 1M6HA 1E7QA 2Y1EA 3K72B 4OSOA 5ICFA 1D4OA 3AESB 4K6OA 3VR2A 4D98A 2GJ8A 4JVSB 5T67A 4TTVA 3O7WA 3X43A 1XVVA 1G38A 3LUPA 3V9AA 1EGAA 3SR3A 2PUVA 4MVWA 3QG5A 2Z30A 2GLTA 2FUNB 3KYJB 5IHPA 2ZJ0A 1NPDA 1OB2A 3OX4A 3TQOA 4YJ3B 4YT2A 1G2QA 2X1VA 1NXWA 2VHJA 3F4BA 1HYHA 1E2PA 4Y6LA 1XQ9A 1N2CB 2BL4A 2OOSA 5LR6A 4XVUA 1USWA 2VKQA 1NI4A 3HJTA 4EMBA 4LZOA 4HRAA 1Y8ZA 3A6LA 3HJUA 3RVLA 5K0CA 2QI9C 1MDFA 3OE4A 1VYTA 2HH9A 1RI3A 3TRJA 2RHBA 2V58A 9ABPA 4LFAB 4C7JA 2IOHA 3QTLA 4HJXA 3EVDA 4R7GA 1K7EB 1WEHA 3U4CA 2ZJ5A 3EPKA 3ZE8A 4DM7A 4LJSA 1XZMA 4DYVA 4BMOB 4FGWA 1P1HA 4BLUA 3EFOA 4AWXA 1EUCB 4H77A 2GZ2A 4US1R 3RDPA 3I09A 3LIIA 1TQ6A 4UDNA 4LECA 1EQUA 2ODNA 3NG1A 3A4LA 5AJUA 5LKAA 2RBKA 4MUAA 3WQRA 3QPWA 5GGYA 3RF7A 3E1GA 5A71A 5DHTA 1MAAA 3GBSA 1KYZA 1JNXX 3KXIA 4CEHB 4M87A 4FEGA 2UVQA 3OJWA 3CEHA 5DHPA 2CHQA 2HIAA 4IDNA 1GUFA 2CZQA 1JUDA 3ISJA 4S05A 3CEPB 3AZOA 2XVYA 5LCXA 5B6PA 3PLNA 3WXMA 5EA2A 4GEGA 2GK4A 1QVAA 4NPAA 4I1VA 3C7KA 4AYXA 2ODAA 1Y37A 2Y77A 2XW6A 3GH3A 5K0EA 2QD1A 3KSUA 2JJ2D 5COBA 3DQZA 4O63O 4IUBS 1QPBA 2J3EA 3DFKA 1QOQB 2AI3A 1A4XA 1KY5A 4I1YA 4EJ0A 2Z2ZA 1CUUA 2QZSA 2V4UA 2PA0A 1EDOA 5FRDA 4PC7A 1W5FA 3U13A 3P27A 4MGKR 1R6VA 1GL7A 1DKMA 4JB2A 2ZVQX 1MIOA 1VSQA 1GRCA 1H2HA 4MUJA 5I5EA 1V16B 1ZI9A 2ZT7A 1Z47A 3L6EA 1QXSA 3NB0A 4XIGS 4Z4HA 1IEVA 3HJHA 2BTEA 3KT8A 5LP6F 2FGKA 3IP8A 5FXMA 3A9TA 3VHXB 3WKEA 5AW1A 3FPGA 4R9VA 4PSAA 2AHOA 1ZK4A 4TLAA 1P7VA 1U2ZA 2NTVA 3QJ5A 2I66A 3CA8A 2IYTA 3RASA 3DDWA 4MO2A 1OFIA 4YH1A 1ZMOA 1YI8A 4YRNA 3RU7A 4YT4A 3ZNNA 3HFGA 4M0EA 2ZSAA 2YFKA 7MDHA 4IH9A 1DTSA 3ASVA 2BTOA 2B1IA 1AURA 2ZWMA 5DLPA 4C08A 1XYGA 2PSSA 1MVLA 2WTNA 4FYHA 3UUGA 4DV3B 2I6FA 4P81A 4RMJA 3G8BA 5IUNC 1ILEA 1X86B 3VNRA 2QMOA 4G07A 5EWMB 4I8DA 2C3PA 1YASA 2VH2A 1LDYA 3IIIA 1YV9A 1A27A 5FIUA 4DLSA 1IIRA 4JP2A 5SYAA 2JI8A 1V41E 3W4IA 1F0YA 1WIWA 4HGZA 1NMYA 4WKCA 2AKYA 3K9CA 2QAJA 3OT5A 1F2VA 2CDNA 4H7KA 3BA6A 4QFMA 5D2CA 4QUAA 4BFZA 2CMHA 5H5JA 2EL9A 1T9ZA 1V37A 2XXBA 2R5FA 3C4QA 2A3NA 3BCRA 5CRIA 2PANA 3EXHC 3GFOA 4NDNE 4RIFA 4FN4A 1QLJA 5HXAA 3S8EA 3SZMA 1FMJA 2G08A 1PO7A 1NI5A 2Q3LA 4G89A 1C9KA 1U1DA 2WUWE 3WJAA 5A7HA 1V8BA 1ZJ4A 1QV7A 2HPAA 3INYA 5ALGA 4EYOA 1R3UA 3CXUA 1FC0A 4XAQA 2IU3A 3TI9A 1Y5NA 1HYEA 2CJXA 2YUIA 3AQ4A 5ELMA 1LFDB 2XGMA 3OICA 2G07A 1V1JA 1F7UA 1N36B 3O4FA 5DH9A 1A4RA 1OFGA 1SHTX 3JQAA 2IXAA 1NI4B 4RY8A 1EWVA 1PBTA 2D4AA 2ZAOA 1DWQA 1I7PA 1P2TA 5ECDA 4E7PA 3VZSA 3NPMA 1N2HA 1PWZA 2PGJA 3BMQA 3PUJA 1A9XB 5IAAA 1GU1A 4BVJA 2O8EB 1M76A 3KAPA 3BICA 4RVOA 3LDAA 2HMUA 2IW3A 1UIRA 5EQTA 4LHZA 4CLDA 2P5TB 2WLTA 3WNQA 2J0QA 3R6LA 4JYCA 4W63A 1XTIA 1PZNA 2FUKA 3UCXA 3IRVA 1UWLA 1UJ5A 2SBTA 3NBYC 4DQVA 1XTPA 2HLNA 3MT8A 2YWDA 1EZ1A 3O0TA 3OOSA 2HU5A 3PZBA 1DEKA 1NRWA 3T7IA 1F1BA 1LBEA 2ZCJA 2QVXX 4H7EA 1BU5A 1GPYA 3HG7A 2C00A 4QSMA 4M8KA 3HCFA 3SFZA 3WLRA 3TVYA 4EH1A 4OA5A 1SRRA 3GYBA 2PV0A 2BMFA 1KPIA 3KSBC 2QTBA 2YVQA 3HBNA 1K86A 2QENA 2Z58A 3LKVA 1XJQA 4LXQA 1KO8A 1SNYA 4YDSA 3F0TA 1DJQA 1VI6A 1E66A 4RTPA 2HWYA 4QFDA 5DSXA 3GGGA 1QYXA 4QBFA 3L7MA 3UV7A 3HRIA 4ZVQA 4PYOA 4Q37A 5JDCA 3K9FC 3QVXA 2EHJA 4X3CA 1PZHA 1N3YA 4F5DA 2ZYTX 3ZPXA 3ZE2B 4D0GA 3OZGA 4IVNA 3QEOA 5FAKA 1SKYB 1R4MA 3GU3A 3IRUA 3K92A 3F3MA 4ZXPA 3KEFA 4WXRA 2Z8XA 4YCLA 3BE6A 3BREA 4M86A 4WACA 4R71A 3BRSA 2Q6KA 3LGSA 5LLSA 1NMQA 1VL8A 3ZHCA 3ZS9A 2IDMA 3GEDA 1KEKA 3UPDA 3RU9A 2JFFA 1YZQA 4E70A 2J4DA 1T9KA 1PGQA 2G09A 2I3AA 3BMOA 3HCAA 4L8WB 1HT2E 3SZGA 2PUGA 4U6SA 3L4SO 3FE2A 4IV8A 4B35A 4R8VA 4UMEA 3KR0A 3CNEA 3VKGA 5REQA 4M9CA 1HH4A 2FRDA 2Y0CA 1QB7A 3CB4A 4KFRA 5T5QA 2A8YA 2NZUG 3WZMA 2HA7A 2W4MA 2HJWA 3AIIA 2VHWA 3KL2A 3RUFA 2BP7A 1Z5PA 3VSCA 5ADHA 5KWJA 1PQUA 1VJRA 4C6TB 4EJSB 3L9WA 3H84A 4ZK6A 4E5PA 1GG9A 4P4SB 3L2OB 4C30A 1CUZA 2HK8A 1U31A 4GOND 5K6AA 4COKA 3N5CA 1MO6A 3TTSA 3B3JA 3L9XA 3WX0A 1EHIA 2JGFA 3IP1A 4UM5A 2OCBA 5HF8A 4MHTA 3ZY4A 3LKDA 2WLSA 2WSSA 3OCCA 4NJMA 3BFVA 4AJNA 3ZEIA 2DX7A 5HZGA 1FYWA 1HG0A 3T5GA 3U5TA 3R1IA 4JL5A 2EJWA 3MMXA 1G5HA 1SQFA 3A0RB 5CIQA 4I46A 3HYNA 2RHTA 1OH6A 1SUFA 1TX4B 1MGOA 3MMZA 4A2QA 5K8JB 1AT1A 1GZDA 2XTZA 3EFEA 2QTHA 3AHGA 3PYXA 1PNVA 3T3GA 1FW8A 1G21B 1ZW1A 3JXEA 2HX1A 1XRJA 5CDFE 2QPLA 5CA0A 1PR4A 2ZUVA 4YIKA 4ZVLA 3WO1A 4DFDA 3GGOA 3C8UA 1AIPA 4NU6A 2GJKA 3AOGA 3DLAA 5DSZA 4MTLA 3RS7A 3HP1A 3FGOA 5BRNA 5K8TA 1QGYA 1I9GA 3H3JA 3PNSA 1LFAA 4F4FA 3K6SB 1W59A 3BSFA 3IE2A 4HDNB 4Q4LA 3R9KA 1QH9A 4CM6A 3C98A 4UHDA 3NIBA 2PX5A 3SAJA 3W7BA 1U3FA 3H2HA 3PX3A 4JA0A 3A6PC 1OE0A 1YDHA 1V43A 2H5IA 4Z9YA 5K5EA 1BYIA 2O2EA 4ZMRA 3PJFA 4O4HB 3NZEA 4Q1FA 1Z8NA 3ED5A 2F1HA 4GI2A 4AP9A 5K8LA 3M49A 3UB4A 5HIIA 1MC4A 5HUHA 1NPYA 5J1TB 3ZC3A 3KKEA 2C5AA 1E7YA 5DCYA 3UBMA 1VZ3A 3O6VA 2XMRA 4B6RA 3FRHA 4B3RB 1O6FA 2CNLA 3ER8A 1ODJA 1G8KA 2GUWA 1L4BA 2NUBA 4KNYA 3NDRA 5ALSA 4AZVA 1ZK2A 3SHVA 1Q2UA 5ALUA 1C7IA 2OYRA 3PXUA 1CZHA 3NOXA 3DZFA 5F23A 1QQ7A 4HAZA 5FA6A 4EYKA 2P75A 2H2FA 3EOBI 5C31A 1GPUA 3W1EA 2ACVA 1CULC 3IB6A 4FOPA 3LQYA 4FUQA 3PA6A 2G8LA 3O8QA 4AJ1A 1WY7A 2QHXA 3GR6A 3HB4X 2Y1KA 4URHA 2GCNA 1J0CA 4XWGA 3GW8A 4KXYA 1UWKA 1XT6A 2V74B 2VQFB 1SQ6A 3U1TA 1UKZA 4XXHA 4AQYB 5DGDA 1OYWA 3NEJA 3QHAA 4C87A 2NXEA 4CV0A 1N2EA 1BIFA 4XFJA 4YAJA 3C3BA 3DWIA 4JUFA 4WXHA 1JJIA 1MEEA 2A94A 3DT9A 3G6WA 4KE6A 4L6AA 4X1IA 5AK4A 4ZVMA 4WKPA 4NZYA 5BVHA 5JXIA 5LWHA 2RHCA 4CKEA 1QIGA 2X2OA 2JLVA 3ZDCA 3OZWA 3QH4A 4KVZA 4QPPA 1Q1AA 3HDGA 6REQB 1ZNWA 1K6EA 1TDJA 5JE8A 2BGRA 4IIEA 2CF5A 2IXGA 4O0LA 3B2EA 4OQLA 4UAVA 4UNQA 1EZ4A 2L69A 5HZMA 2YJ4A 5JV5A 1ULUA 2H07A 5AM2A 1N6NA 4HDRA 5BURA 1L5GB 5A9SB 1JDPA 2R6CA 5DE3A 2EBUA 3F9RA 1GV0A 4QICA 1WUTA 4KGZA 4IUCS 5HJ2A 4YRKA 4V03A 3NCTA 3WLLA 3AI2A 2D06A 4BFSA 2FSHA 2PQ2A 2ZTSA 2CUNA 2D2EA 3V8NA 5L4LA 5BQ5A 2JKZA 2N1BA 3W05A 2TMGA 1L4FA 2A5YB 2P1ZA 5BMOA 5DJ5A 3TUZC 1MO2A 2GEJA 1L5MA 2NAFA 4PLGA 3A1UA 5ADVA 4OQMA 1JFFB 1KK2A 1DRJA 3FHOA 3KZCA 3L7LA 5TPWA 3V8EA 3TQTA 4F2WA 5AD1A 1XDGA 2ZJ4A 3V8QA 3C8DA 4BQIA 4JKYA 4LXHA 4B7AA 3VNUA 2HD4A 3C16C 1V0JA 4IWNA 3ROTA 2QL9A 1M6VA 3W2GA 3BK7A 5F1PA 3B1YA 1AXRA 1S3SA 1Z56C 2Z9DA 4KHZA 5GQSA 4EZIA 2DMRA 3E84A 3RJTA 4EI9A 3FUTA 3BFJA 3PB3A 5EKSA 4EG8A 2EJTA 1A71A 3UMVA 1L4YA 3O4IA 3K8OE 5LZ2A 1WA5A 4K88A 4TXNA 2B6NA 3DT6A 3FPFA 3LM8A 1FNCA 5B7NA 3GUYA 5BWMA 5LYYA 1V26A 1MIOB 1XTJA 4MWDA 3JRNA 1S2OA 4L0MA 1G41A 4JWTA 4BFVA 1FDUA 4TV9B 2OQRA 1RHJA 4QIHA 4C03A 1SD5A 5EWJA 4LJ6A 3I28A 2I4NA 5FF9A 4GNKA 4N12A 1KOFA 2JJ1D 4RPHA 1TTQB 1WNTA 5THKA 4UW9A 4QDJA 4Z4CA 4D3ZA 4E5DA 1I2AA 3HNPA 4YIHA 3EUFA 3K6SA 3Q5GA 4JVNA 4RV9A 3JSXA 3VRHA 1DXOA 1BWSA 1CUHA 5L51A 2QBYB 1II0A 3A1SA 3K4HA 5E6RA 4R01A 1ZUWA 3QQ5A 3JTMA 2POCA 1E9DA 4FBLA 3RJ5A 1KU6A 1Q22A 3EJ6A 1FYDA 1U9IC 2VDPB 5TQVA 5CB0A 3HCPA 3OJXA 5KQSA 4PC2A 3V7WA 2PFKA 5LQNA 2YZNA 3GROA 4GMDA 3FGNA 5CEJA 1XTSA 3UAYA 4YUWA 2PS1A 2NU7A 4GRDA 1TYEB 1P17A 4YP9A 4CF4A 1B0AA 2AOVA 3OIVA 2ABWA 3PXXA 4JUCA 1KMQA 2I0FA 3ICCA 4EJSC 1UJNA 5C7IO 1T15A 4LJYA 5KNCD 1HY3A 4S1TA 4TN5A 3RSSA 1GNRA 5CPBA 4ILEA 3EVGA 4JX9A 4ER3A 1O3YA 1BX0A 1OB5A 3KQHA 4UUMA 4TVKA 4P92A 2G6BA 3E3OA 1X7DA 1N32B 4HI0E 4BVHA 3OX2A 1OYOA 1ZY2A 4UZFA 4D9JA 2O5RA 4DKXA 4EHDA 1T34A 4EA8A 1U5AA 3AF1A 1EFCA 3E8XA 2PT5A 2WJ4A 3N8DA 3WNCA 4QRIA 2O5EA 2H5LA 2K2QB 4GH5A 4XQ0A 4B44A 2GK7A 4HEJA 3G9UA 3P2IA 4NCNA 1YK1A 2DPHA 2IHBA 4BBZA 1Y1KE 3G9ZA 2WAOA 1HDZA 2HWKA 1BCSA 4V0NA 3TNLA 5A03A 3MBIA 3SEAA 4OMFG 1TTTA 4QA9A 2VYVA 1KDOA 1OWNA 2PZGA 2QLFA 1S7CA 1YB4A 4PYRA 4RDCA 3PC7A 2N3ZA 2V5UA 1M1YA 5IDXA 1MOZA 2OZPA 1Z0JA 4UUQA 3JVVA 2Y76A 3BGOS 10MHA 4OY3A 4HPJB 2J3KA 3HJBA 1U9JA 3O3CA 3HUDA 3FVRA 2PGOA 3T5MA 3TZCA 4AICA 4WA8A 2PWPA 2VG8A 1N2ZA 3J7TA 3U3KA 2N47A 1UANA 1ISJA 4XEHA 1RYDA 1XOIA 1A8HA 3PNBA 5CFQA 2WT8A 3GFGA 4PLWA 3V4ZA 3QUTA 2FEMA 3VDQA 2ZCUA 1OH5A 4GR4A 4FS3A 1K4KA 3BEOA 1QZ3A 4A0GA 5HRAA 1UZAA 4M0MA 2OC9A 3LK6A 4OU4A 1F9AA 1ANKA 1CQZA 1QKIA 3JD4A 2WUFA 3ODGA 4NK5A 2FLKA 4HAIA 4A03A 2BISA 5CYPA 1RJ9B 2OOKA 4LC1A 1YMQA 3BULA 3FKSA 3MTBA 3H13A 4QVIA 4EHIA 1G4HA 2FCAA 5AM4A 3AL3A 2WTUA 2GQ0A 4KQWA 4P86A 4E12A 5IZ4A 4M0PA 3LY7A 1GKLA 4RJ2A 4S1NA 2A1TR 3EDYA 4P7FA 3AU8A 2FQXA 2WAXA 2YVKA 4HQOA 4L0CA 4PV7A 5GADl 4ZQEA 1PLJA 3ET4A 1Z0SA 2J6IA 4O4IA 4B3XA 3R8FA 1RKXA 3L92A 2DFNA 2R1TA 3OQNA 1OFVA 1H1LB 3KYIB 3S1LA 4EVQA 5E95A 4EHFA 1PS9A 1VFPA 2WYVA 3OE7D 2QZJA 3IGFA 1ZZEA 3B1FA 3VPFA 1I14A 2GOYA 1OHHD 2PD3A 1RT9A 2B4RO 2VKTA 2Y6UA 4D9CA 3M6FA 4I8XA 4W5WA 5AO9A 1F0PA 4L7QA 1VJTA 2O8VA 5EUMA 4DEVA 3OFJA 2ZPAA 4BY9E 3DUFB 2VUIB 4C0LA 4ARZB 3PHBE 1FNNA 3EPRA 1BE0A 2JIBA 2SCUB 5FBZA 4PAGA 1UKEA 1XKXA 1HLPA 3WQSB 1A9ZA 2FEXA 1TGYA 4KPFC 4JD5A 3RC7A 3HXQA 3JPWA 3SZUA 1UOEA 4B4UA 1L5OA 1QF9A 1JFRA 5JXJA 4O02B 2HA2A 1XDWA 1ZA2A 1R8QA 1QVRA 3TSWA 1QPGA 1UJBA 1ZJ5A 2Z57A 4W7SA 3OHSX 2F1OA 3RO7A 1P5FA 1ODTC 1U0SY 3C5VA 4FMBB 5AVJA 2OBXA 5LXTB 1MC5A 1R1DA 4N0PA 1TT7A 1DP4A 2HU2A 3GN1A 2VAWA 3NTXA 2NO6A 1NVBA 4K9KA 5DYWA 5AW3A 1XK6A 1PFUA 5HCUA 2C78A 3V5NA 2CK3D 1EE9A 1YJ5A 3C87A 3H4TA 2E5FA 1O95C 3WB0A 2VSQA 1VP3A 4RZSA 1CNFA 3BFKA 1SBHA 2WIFA 3E3LA 1T2UA 1TMOA 2HXYA 2WAAA 1SKYE 4EUKA 5CITA 1C9YA 3ANNA 3QJYA 2GM4A 5LMUB 4QASA 1ZNYA 5K0ZA 2J7PA 4DG5A 5KWVA 1BHSA 1R6BX 1SVNA 2J0VA 2GEBA 2NWQA 3K3PA 1SG6A 1XQWA 2GM5A 4I5FA 4P4TA 4TUYF 4XVHA 3K8ZA 5IABA 1T9BA 3L1UA 4F4UA 3R0VA 4IJKA 1R8YA 1E89A 2NXJA 2FEOA 1ORRA 1G21A 3E1KA 4I6GA 2H57A 1RSZA 3ZWDA 1DKQA 3BA1A 2FZGA 3DOIA 4B73A 2R6HA 2Q3HA 4JJAA 4OK3A 1SKQA 4YUVA 2MR6A 4H6PA 3LGXA 3DFFA 4AUKA 3B9BA 4UU8A 1P45A 4QU8A 2FQQA 5A7GA 1U7WA 1W4RA 3WDLA 3K31A 1BU8A 4KXFB 1LNSA 4R1QA 4JJZA 4YRMA 3N86A 5JYDA 2ID8A 2VXBA 5LOVF 4BN5A 1XROA 3UOGA 4V3CA 2BOVA 4J7CA 3WGUA 4DJJA 3NYQA 3N1UA 3WG9A 2ZIFA 2JGJA 1I24A 3B6ZA 2ZS8A 1T4GA 4RE6A 2NLOA 5DOZA 1XZHA 3AI7A 1MH1A 3LC7O 1K1EA 3G79A 2ANCA 3TRFA 1HDEA 2OR3A 1JAIA 4URUR 4EVIA 2OCGA 2HFKA 3PC3A 4BYMA 4ZCLA 1N2CE 4TMYA 2E9SA 4BP1A 1MXFA 3BRQA 3OG9A 4LDPA 3TX6A 4FGSA 3OFVA 2E37A 3SXPA 1L7EA 2FX5A 5L3SB 2YS6A 4W9NC 3MGCA 5FFMA 3RVRA 3AYXB 1S1MA 2DUWA 4O4LB 3GP5A 4J4TA 4XRGA 4FHDA 2WJVA 4IINA 2O8BB 2XE7A 1PWXA 3CEAA 1RM5A 1L1QA 1UK9A 2COUA 5F4BA 1NXOA 2FPWA 1FJXA 1SUDA 1VE3A 4RLFA 2VP9A 1JLHA 2WR8A 4RMIA 3M1AA 1IQUA 2Q1XA 3EC1A 4Q3LA 4C4RA 5FLEX 4POOA 1R10A 1R0SA 2D54A 3AB3A 4TTRA 3DLHA 1X6VA 2IW1A 1NTRA 1C14A 1HE2A 3PUKA 2WU8A 3BWVA 3O8DA 4XD7A 4A5SA 2IXTA 5SY4A 1JILA 3DE6X 4WZAA 3V42A 5L40A 2OZKA 1E6MA 3O8OA 2PKEA 1AM4D 1ZD4A 3G9TA 3W06A 3ZIAA 2CLEB 4BCCA 4ZQIA 5HZKA 2VTEA 3R20A 3I6IA 3AUFA 4LAFA 2UZIR 2PGDA 4HX5A 1KJWA 1NF3A 3CCFA 4FYVA 3TRIA 3BTSA 3RIHA 2ACKA 4CKYA 4CKZA 4BFTA 1G8HA 1ENOA 3GAAA 4RLQA 2P0EA 1M73E 3RHFA 3PNYA 4DABA 1WR8A 4OA8A 2KBFA 2JC3A 2VNHA 2X0KA 3MJDA 3R2JA 1LTKA 4KN5A 5CXUA 5IF9A 1AQNA 4CEJA 1US8B 1L3CA 2IODA 2PD4A 3OD1A 3QLJA 4CMHA 1U2DA 3JQCA 3NT2A 1ZNXA 4U0KA 2Q3MA 5K4AA 1J9ZA 1VYHA 5K3FA 1EKXA 1FFXB 1EWKA 2H0AA 3GMTA 4RF3A 5J47A 1YC2A 1XZLA 3BH6A 5H80A 2O2IA 2N75A 4RVGA 2LPMA 4O4HA 4JI5B 2HJGA 3ZGYA 1L0BA 1HM5A 3ZE7A 2E4WA 1RHUA 4JR0A 2IYWA 3R3JA 5JSUA 2FPSA 4LSMA 4XX0A 4YA6A 5C7OO 4FGJA 1DAHA 3B1ZA 4FOSA 1C7EA 1GNVA 3IC5A 2F59A 4R2WA 5CLFA 2XUDA 3VR4A 4XCVA 3C43A 5KNDD 2FMHA 1G3RA 3WAGA 5E4JA 4E94A 3ETHA 2PIAA 3A0UA 3SF8B 2AG5A 2CLFB 3QE0A 2XUZA 1TA9A 5AI6A 4F46A 3FCAA 4KBYA 5ALFA 4QBTA 1ZM2A 3QKIA 1PJAA 2FETA 4HXEB 1M9NA 1QNFA 1KTVA 3T7CA 4PZLA 3GJ0A 4ZAVA 1HFKA 2VBFA 2ZIWB 4X93A 3KVYA 4OTZA 2D2XA 3DMDA 2OP1A 4XUGB 1Y80A 3SR0A 4EJ6A 4OQZA 2PYIA 3KWJA 4JL8A 3HU5A 4DBLE 3O94A 4F5WA 3T4XA 2D5BA 2W6ID 1XK7A 1C5KA 2X15A 4JJ6A 4TLMB 3SBOA 3E3NA 5MF6A 1PJBA 5ALXA 4CKCA 5TQJA 1Y1PA 5I7VA 3NWJA 2Q6LA 2LDBA 4V0RA 3Q9LA 4C7MA 4MWEA 5C8YF 4PZAA 1SOAA 3PXEA 3OUZA 1GXSA 1E1MA 2RK4A 3UYKA 4DW8A 3AP2A 3KKQA 3GWGA 2QX4A 5GP1A 2FPIB 1TCUA 2OWEA 2HZBA 2ZJYA 3AEKA 3AFHA 3KSDO 1E7SA 3CUYA 4IHKA 4UNIA 3FUUA 4DNQA 3E7FA 3GHYA 3EQ8A 3M4NA 2EIXA 2P6PA 3BYZA 4WQMA 2IEZA 1PF7E 1QTQA 3KX2A 1JG2A 1NHGA 2FRXA 2WWGA 3B82A 4Y7CA 5KTRA 2F90A 2CNWD 3AG6A 2AV6A 4RAQA 3BAFA 3AVPA 4X7BA 4Z8YA 2FN4A 1Z15A 3LL7A 1W5SA 1JSCA 4QHTA 2HC9A 9ATCA 1P39A 2X23A 3PUVA 4EKNB 5LA6B 4KV7A 1XI2A 5CT6A 4EX7A 4F71A 1QTRA 2O2JA 3IFSA 3KVNA 5DNWA 1G59A 2IH4A 4TMVA 4BKQA 4MMYB 3ZCPA 5I7OA 4EQ6B 5IDQA 3I12A 5IUKC 3U3XA 3N2KA 2MSLA 1Q0SA 1QGAA 3MS7A 3D0RA 4UAJA 4JGBA 5ESWA 3RYFA 2ZT6A 1B8UA 3F1KA 4F3CA 2FPRA 1E1RD 3V7UA 3CH4B 1KNQA 4JODA 3S2YA 2QN6A 4PQEA 3SIXA 4Q4JA 1UR5A 4NXMB 2WG1A 1IPFA 3GCDA 4RTNA 4H3HB 1UBNA 3Q9SA 4RGVA 4O8CA 2CVQA 1J2RA 4JJGA 2VHZA 3W5AA 4KXQA 1E96A 3AQIA 2XBMA 4W5JA 1YB7A 4WFIA 5ALMA 3ETCA 3MRXA 4PNPA 4QECA 3FYUB 5MN6A 3DM5A 1VL5A 4WLEA 1GAJA 1JSZA 1B8OA 3WQBA 1JPVA 1M6YA 1NJGA 2VBGA 3DVQX 1VTKA 3BM5A 3WLNA 2VTBB 2YCBA 1UMBA 3ZBQA 3OM8A 1KHHA 2B99A 2PY6A 2HB6A 3ENKA 1P1RA 4W4TA 4XZ3A 1LDEA 1PLLA 3BBPA 2H29A 1E2LA 3LJKA 3MF4A 4MW0A 2IY8A 4R2KA 3L0ZA 3HNOA 1XSEA 2ZE8A 3FJYA 1JIUA 3KS9A 5CAEB 4KGDA 5CXXA 4N3GA 1JRLA 2XT6A 3IQDB 5JS2A 1JEAA 1X1AA 2I6SA 4G0XA 2IE8A 4TVBA 1O95D 2IITA 3G2QA 3RIGA 5JAOA 1OXTA 2VAXA 1YBFA 2BR3A 2MHCA 1ICEA 1QDLB 4RK5A 3SLRA 4CT5A 1Z7BA 1KFBB 1YTLA 5JVDA 4U39A 2C57A 4OQDA 2ID4A 3PVSA 3VR3D 2ATVA 2AYYA 2V9ZA 4YMUA 4QPDA 1RC1A 2QKYA 5K3AA 3SQXA 4YS6A 4ZEMA 1ISFA 2CN1A 3ORQA 4CL0A 3T06B 2MJLA 5ARDA 3QVSA 4LHWA 4MWCA 3S81A 1VPVA 4KAAA 4EG6A 1HGXA 4PQYA 4EB0A 1ECLA 3FLEA 3IQFA 4AW9A 4URVR 5HRCA 4FYKA 3WGOA 4ND5A 3L8CA 1WM1A 4HNSA 4HNVA 3GN2A 2OCLA 2RAPA 5K3EA 1VL2A 2M6LA 5IYZF 3VR4D 5A1JA 4YQZA 5BQXA 2EWMA 4YMIA 5JTTA 4KDCA 1G6Q1 4J0FA 3IKVA 4ED9A 2GN1A 2NO1A 4NBKA 4JI1B 5LZ4A 2XUFA 4HN2A 4TTPA 3AP1A 2FFAA 5JLJA 2VA8A 4MUKA 3B6EA 1SXIA 1RWPA 2A9KA 3FTQA 2QJOA 5KNDH 3BMQB 2GGSA 4D81A 1KMNA 1NP3A 1RJFA 3AFNA 1EVIA 7GPBA 5I9NA 3CE6A 5KC9A 3IB3A 3EXEB 2RJNA 3HKDB 3CH6A 2X3YA 3IMGA 4HVLA 5TMPA 2IHZA 1JYEA 2CNBA 2I7CA 1Q92A 1YXMA 3OJCA 2RH4A 4JENA 4WK0B 1SU8A 2FZ4A 2D74A 3AV0B 1DXHA 2DWOA 2V6BA 3DOUA 3VMMA 2RARA 2WIGA 4DHWA 3G23A 1D3AA 1TEZA 3MUEA 4C07A 5B1IA 4IY1A 4OHUA 1SOVA 3SS7X 4F8EA 3U6KA 4H7DA 1LPNA 2EBFX 3OJOA 221PA 1OU4A 2VUUA 4PYQA 3GFBA 1C3EA 5EIBC 3FIUA 5DCUA 4B71A 3ABSB 3I83A 2GD6A 4JLOA 2DZDA 4ZVUA 1QYIA 3R7WB 3W6UA 2IU4A 2Q7XA 1LVGA 3VDNB 2ARKA 3I8SA 2I4MA 2OWDA 1C29B 3ROKA 1P9WA 2O06A 5YASA 1XU7A 4FD3A 3N7AA 5JWRA 3IMCA 2W0SA 3CMMA 1U9ZA 4MRMA 4Q3OA 4QYWA 1XAHA 4RWZA 1USIA 3L05A 1Y3BE 3LO8A 4QAJA 4B3DA 1IPHA 4TVOA 2C98A 4HLUA 5JAPA 1Y98A 1ZC3A 5IT0A 2IOFK 3I39X 5AIBA 1NYRA 4EQ6A 2LRHA 4CT4B 1GTMA 3BL6A 3N28A 4ZEVA 5JSQA 4X3OA 1TMGE 2GD1O 4LVUA 4JLBA 3KUKA 4OQPA 4C7KA 1JTVA 1JT9A 1DMRA 3FFAA 3OOHA 8LDHA 4B6GA 4QTZA 4CHGA 2HO4A 3HY3A 1GAWA 1H1LA 4MYTA 1GTVA 3JQ7A 4Z6KA 3NEYA 4LRYA 1IVNA 4B7XA 5IW8A 4RGQA 3AETA 4OXKA 1W0JD 3DNPA 1FFYA 4MYUA 3JWEA 5DYIA 4HNGA 4BJ5A 4IBOA 4CEHA 2GZHA 1Y6ZA 2AEMA 2BWJA 1U2TA 3VZBA 4Q9DA 3RVOA 4L9AA 4NXNB 3NJRA 4QWWA 5IEBA 1ODKA 1KAQA 2W8ZA 3I1JA 3TAUA 3PGXA 2WUVA 2WVJA 3LA8A 4DWVA 3SZLA 3I6YA 3ZK9A 5AHXA 2ZPUA 3K6JA 4EZEA 2QD3A 1D1TA 1SBQA 2K5UA 4J16A 3ZX5A 1YJCA 4DA8A 3IUPA 1KFCB 1WJGA 1SIWA 3N7UA 1WY5A 5HA5A 1OA1A 2UYYA 4F2GA 1SKAA 1YZKA 4FP9A 3VR5A 4LYJA 4OM7A 4IRMA 5KWIA 3CUWA 4XCXA 2QOEA 2O0LA 2VI5A 4LC0A 4C7BA 1HI9A 3H2SA 3PHLA 4D82A 2C96A 2VJOA 3F7MA 2B1JA 1N4AA 3V46A 3ESAA 3INRA 2UYQA 3ENVA 4KUHA 1MX3A 1JKMA 4EG0A 3H75A 1DS6A 4EEKA 1GPNA 2KMLA 4WFKA 2ERYA 3ECCA 3OZAA 4IHJB 1QIFA 3GQVA 3I04M 4N01A 3H1EA 2Z6VA 4KUEA 1CV2A 3U80A 4BB0A 2YV3A 4Z2YA 3DULA 2VHVA 3MJCA 2DTDA 3IUNA 4FFNA 4QFBA 2I4LA 2RGYA 4BWVA 4EY5A 1JR2A 3GZTB 3H05A 3BJEA 4RS4A 5H0IA 4LQLA 1P0MA 4ZT3A 1IEXA 1NVDA 4CR6A 1RTKA 1XCJA 4H4EA 2DUNA 4BMNA 1GG8A 3OZ7A 4XQGA 4ZVNA 5GVSA 2GK3A 1SUSA 2HA4A 1IXRC 1UXJA 5E1OA 1Y6GA 1URPA 1EJBA 5GMOA 2L17A 3EQ7A 5FOWA 4Q0MA 2NU6B 2OMKA 3COPA 4F3NA 3FWYA 1WQ3A 3QLUA 4TKVB 4BKMA 3MEQA 2YWCA 5GONA 1OWOA 4WESA 3VNVA 1QS0A 2TSYB 4WY8A 1U8YA 1HZZC 5E8JA 3LRPA 3UK7A 4AUMA 4G23A 2V7GA 5AQEA 4D9KA 2CXOA 2DAPA 3ZK8A 2Y92A 1SM4A 1H5QA 3DZCA 1UAYA 4Y98A 3AUUA 5TMEA 4F4IA 2A9RA 5FTNA 1QFZA 1Q1NA 4RY9A 2JIRA 4LDZA 5G2OA 4C3OB 2PUBA 1MP0A 3TQFA 1FVXA 1CIPA 3DOFA 2CLHB 3TXXA 4I50F 1USKA 5K20A 4CXMA 4KVFA 5CLJA 5I9IA 4A2PA 2XB8A 3I53A 1FP6A 4MQEA 2ZI6A 3K9LA 4QNMA 5CJ2A 4TWZA 3HI6A 2WIAA 2XBUA 4AJIA 4EY6A 4YFYA 4BV2A 1KI1A 1QC5B 1AB6A 1E7WA 4WKBA 5KYWB 2G4LA 5IPFA 2AD1A 3TTVA 1KPGA 4EO7A 2VSOA 4A92A 3QVLA 4J0JA 1G4UR 5EXPA 1ZRHA 3VSAA 2MT9A 1RLJA 2A1TS 4F5YA 1IN5A 2RG7A 1CJKC 3IVGA 1P81A 3PF9A 5DWVA 5FOXA 5IVHA 2DXIA 2Q6IA 2H0QA 2ZETA 1DT3A 3EXAA 1JFLA 1ZMTA 2IP4A 1NX9A 1YIAA 2BYTA 5AICA 3CLKA 4K8OA 1UOQA 3I64A 3OOJA 3CLUC 4ND8A 2QMZA 2NAPA 4NONA 1CS0A 3KLNA 1GAEO 2GXUA 3BEDA 2YKGA 4HH4A 1TC1A 2I1QA 3SHTA 4J75A 4G84A 4Q7JB 5B2EA 2XT0A 1X7WA 3E15A 3OQPA 3R09A 4R5HA 1H2FA 1XCMA 2KSQA 3DYBA 4R1NA 3VR6D 4EF6A 5K0GA 3EMKA 2P5YA 1BDJA 4GP7A 3UB3A 3TECE 1M2OA 4MR7A 4FN5A 1KJ9A 2G9ZA 1I2ZA 2GF2A 2WHXA 3PGJA 3IXQA 3LQ2A 4PYMA 4ZO9A 3TAHA 4P0QB 1TAUA 1DQPA 1OXUA 3BXZA 3MWJA 2Y05A 1IHOA 1XVTA 4MEBA 2JFGA 1COWA 4N7JA 3VU9B 3R0ZA 4EGCB 3RJ9A 1T0IA 1Y6FA 4HXGA 3WWOA 3C8MA 3O93A 1HORA 3BB4A 3JWJA 3UMRA 3L40A 5CT9A 4HPWA 4N1AA 2BONA 2I8AA 4V0OA 2B3TA 1QCDA 2EP7A 3YASA 3SD7A 3ND7A 3ZV6A 1JH9A 2OL4A 1P1CA 3VO9A 1GZ5A 2GFHA 1PL8A 2BGJA 2BMAA 3VDXA 4NZ9A 4HTFA 4EPXA 2VYCA 2HTEA 4ZC1A 4B2IA 4KQ6A 4MIYA 3FNIA 2XNJA 3LX6A 4PR0A 4CM9A 5KYXA 1WXGA 1QIJA 4EO4A 1AN0A 2A0XA 2F1JA 2CD9A 4YJHB 3TL6A 4DXDA 3CF2A 4KSCA 2AHRA 5GV8A 3CEMA 2L19A 1YC5A 5JNWA 3QFHA 1N75A 3G1UA 3KCQA 3CUEF 5DT2A 3UJ7A 3C3JA 1QQBA 1FJHA 1Y3CE 3VU1A 1NLUA 2PS9A 2IBTA 3C3CA 5EMHA 1ODFA 2C0PA 4YP7A 3KTAB 3PQ8A 5JJKA 5KTSA 3GD7A 3H87A 5KVCA 3QLVA 4IEIA 3PKZA 4I2NA 2H00A 4FSDA 1R15A 1YRYE 1Z68A 2E1PA 3RYIA 2Z5VA 2ZB4A 1WZNA 3HNRA 2WJPA 3V4VB 1JA9A 1HQYE 1W2HA 1I6WA 2VPQA 1IOWA 1X7YA 2Z0MA 1F2DA 3E05A 4IDBA 5G0SA 3ABZA 3TM4A 5H1YA 4PSKA 3L0OA 4G5QA 2ZRJA 2C7RA 3DKKA 3W9SA 2XITA 1XBTA 4LV6A 2BFOA 1E6CA 5GJVC 3FKSD 3NHLA 1HBJA 4LJ9A 5FP0A 4CI9A 3LNCA 2ZBUA 3CINA 1YJBA 3AOEC 1PFVA 2RH9B 2X5KO 2QRLA 4WTOA 2HMAA 2RB4A 4RF4A 2OK8A 2DQSA 4RPKA 3OLCX 2WJWA 1X8LA 1XRQA 3HA5A 1XF1A 5LYJA 5IZCA 3K5IA 1FFHA 4XJTA 4HUQB 4Y18A 2AC7A 4WDRA 4PGAA 2CFTA 2AXNA 3DZIA 3I92A 5ESRA 4UBIA 3ESXA 5JDCC 4OJQA 1M0EA 4BFUA 4RA9A 4RKYA 3TPCA 5H3CA 4CLOA 3ED1A 1UXHA 4GPTA 4DMFA 5JIBA 1K3TA 5ETJA 1FUUA 2CLDX 4PAWA 5E7IA 3D31A 5BYAA 3CPSA 3NDBB 4H6WA 3KQNA 1W9HA 5IANA 2F8TA 1PS0A 1PT8A 4V24A 4PLFA 3ORHA 1FTSA 4E09A 4EB6A 2G9VA 2DJ5A 2M98A 1A72A 1IK6A 1TEXA 4PAMA 2PKRA 3WYDA 4J2TA 1PJTA 1G19A 1MLDA 1P6UA 3MILA 2BHNA 4DDKA 5IMBA 4JITA 4BLTA 4ROSA 4DIMA 4D9NA 4PF1A 4G09A 1GPJA 3B1XA 4XWAA 1ND5A 1TRHA 2R8OA 3QPUA 1Z7YA 3QVOA 4TTTS 2WIBA 3LIPA 2YW2A 3DPSA 2CCGA 1U8AA 4R69A 3P20A 4LJAA 1J9GA 4M22A 3CH7A 1G7CA 3OLWA 2J3LA 5LQJA 1M1XB 4W1PA 1ZQ1A 3OPQA 3U5ZB 5IG2A 1GL3A 1ZD2P 2FNAA 4LYYA 3VPBA 1IWOA 4XKJA 4IDAA 1IXYA 1BOOA 1H6DA 5KWSA 3LTEA 1CHDA 5IKPA 3DL0A 5H8WA 5BMVB 2NN3C 1SXGA 4XLZA 2Q5OA 4OOEA 1QGUA 4ZYLA 2ZUDA 5E0KB 2Q4RA 3B38A 5G02A 2PA3A 3T95A 2AN3A 2IYAA 1E1CA 4CLXA 3WICA 2C03A 2QT9A 2ZREA 4WEQA 1ZPDA 2KE5A 3RS3A 3C3PA 3L01A 3BIWA 3GZNA 1IXZA 2OSVA 2Q2QA 1SC6A 4NG4A 5CDYA 1DDIA 4R5MA 4E33A 3NBQA 2CV2A 2WWTA 3A6DA 4J76A 2EGUA 5AESA 1OIVA 1V4NA 4PSDA 4L74A 3N59A 1YTUA 5CBPA 4U00A 2ZBPA 2PQMA 1CKEA 2I78A 2PKQP 3JAKA 4N6OA 7ADHA 3RAEC 1M33A 2O1XA 2HK9A 2F1IA 1RXEA 2ZYGA 1AHNA 1C0IA 1E61A 2JKVA 2FSVA 2Z2YA 1QFMA 3QHPA 5ITZA 1WZUA 1EXNA 2QVGA 1L7AA 4PHHA 4Y6SA 4P3XA 3DWGA 4ENTA 4B75A 4HMOA 5I7HA 3ROXA 3ZVNA 1KZ1A 1ZU4A 2R6R1 3JQRA 3GGPA 3D3EA 4FNGA 4IVPA 4LNHA 1JTFA 3UF0A 4EFDA 5K0TA 1AHIA 3RANA 4TS1A 1UMCA 2ST1A 4QREA 5BV0A 2VDRB 5KINB 1DINA 3F1LA 4J4HA 2LCQA 2RDMA 4NYIR 3I3SR 2FFJA 2BFBA 3ZWWA 4CFSA 4RA6B 1UK6A 2B8JA 4R0NA 4MLPA 1ONNA 4QE3A 2BLNA 1YB1A 4BU0A 1NT4A 1Y82A 3PR3A 4K3VA 2F00A 2KLHA 4WAUA 3H9UA 2O3RA 1TMKA 2DT5A 3EXFB 1DLJA 2JKYA 2C5FA 2Z95A 3SEFA 3J7AC 2FSUA 3EGEA 2HF9A 4OYYA 4YJHA 1KZ4A 1M66A 1Z2PX 2PHZA 3BJRA 1ZOOA 1DBVO 2ZSEA 3CLRD 3FKQA 4G6ZA 3WHKA 1V1MB 5ERXA 1ZBQA 2C2HA 4YRSA 4K0KB 4FKZA 4KHPB 2V8OA 1Z6ZA 4QUHA 3FF4A 4BZZA 4MV4A 2AE1A 3WSWA 5LQUA 1YQUA 1XHFA 3D8TA 1XNGA 4DLKA 1ZVQA 1K9VF 1DSSG 3ZEAA 3D4OA 3AL2A 5B4TA 3LPDA 3RSFA 8MHTA 2C3OA 1T1EA 1E8DA 3CTPA 4XLTA 3B5IA 4FFWA 1WX1A 5UKDA 1NQXA 1DHTA 2JJ1A 3P5SA 2JS7A 1CQXA 2DQYA 1JF8A 4F97A 3B20A 4FW9A 4XJSA 2GBCA 2JVJA 5B3KA 1VJ5A 4KI7A 3TGWA 5K45A 2PRIA 5CVDA 3MM4A 2BFWA 2ENWA 4O6VA 1YU6A 4ARZA 1ATIA 3KUXA 1JAZA 4N9WA 2LXNA 2AJDA 3ISTA 3QVGB 3VPXA 4BATA 4HDSA 4C4SA 3T6KA 2OYSA 2AEJA 3EVCA 4RD1A 2O5CA 1O7JA 4KAFA 4OXXA 1T3TA 2J9YB 4S35A 4ZVVA 1LWNA 1Q91A 5HE8A 2RFLA 3C1AA 3MAAC 1PG5A 1J5XA 2GN9A 1F3LA 2HNBA 3PDWA 4MDYA 4G1MB 5F4ZA 4CCYB 3DBLB 2IPLA 1G16A 2OCIA 5K8IA 3AVTA 1GTSA 1FNMA 4LZNA 1FE8A 1VCMA 1G64A 1TU4A 2MSDB 3AFMA 4LXYA 3WBKA 4ALKA 2OGSA 4IXDA 3FNHA 4BO5A 4ZDKA 2O48X 5CFOA 3AC0A 4H3KB 3C1UA 2X42A 1M83A 1O9HA 2ZM6B 1KYXA 3QI2A 4K87A 3TZLA 4EY3A 5CB4A 5DNUA 1NOIA 2JANA 2WBLC 4U2DA 1TQ2A 2AJBA 1C1YA 5TE9A 2H31A 1K2VN 2HQOA 4GM0A 5EUQB 3CR7A 2H59A 3PYMA 1P80A 3PLRA 4C6HA 5I7SA 1DRVA 1IN1A 1XEXA 3AUTA 3PJRA 4GGMX 2ZI9A 1TKCA 4XTCS 1U8EA 2DHDA 1UEJA 2CLCX 2E5WA 2QAIA 3KE9A 2P8JA 2IU6A 3KZ1E 4P3KA 3A9SA 1ZVVA 4XB6B 1TO2E 5I51A 3EE6A 3K1YA 3LDGA 1W0JA 3ZV3A 1BVHA 2QP3A 1TRKA 2R8EA 3RROA 1WS6A 1CTQA 4TRNA 4ITUA 2PMCA 1BXRB 4AY4A 3AEYA 2BGWA 2ZAGA 3L04A 2NYRA 1RJWA 4WOPA 3MNFA 3NBXX 3IP7A 4EGJA 4LMRA 1NUQA 4OK5A 5BWOA 4GW3A 5LBTA 1P75A 5IAOA 3CWZA 4KNWA 3KJFA 4G65A 2ZRGA 1RJEA 2HA6A 3R3HA 4KXNA 1WE2A 1ZD3A 3LRTA 1YAJA 1T8SA 1I1NA 2FWJA 1NAIA 3B3AA 5AVRA 2WNSA 1W73A 4S04A 1E6KA 1K5HA 2AFVA 4NOMA 4X6UA 3UMSA 1BYUA 2YV1A 2NQ8A 4A23A 3HACA 1NATA 1A2OA 3ANLA 3R6TA 3BQ9A 3LO5A 4MQMA 3GWZA 4KAXA 1FDRA 4BRSA 4L9WA 3AIOA 4M76B 2I7TA 3ILYA 3TTTA 2WHQA 3A1NA 3UHOA 3X1YA 2A3RA 3D0OA 2CDRA 5CPFA 3IULA 5JBIA 3HB7A 1E9RA 1CY7A 2PWZA 4MULA 4EW6A 4UBNA 4FM9A 1GCOA 1RJ9A 2GHRA 3BHIA 3F8TA 1C1XB 4QD3A 1JEYB 1LPBB 4I0WB 4FFOA 4OQFA 4P5EA 3IS3A 4Q4HB 4LTMA 1Z45A 3HWRA 5EFOA 4DPMA 3NIDB 5K4HA 1GAQA 1KDPA 1SVUA 5IVIA 1FP7A 4KQ1A 4PC1A 3RGWS 1XRRA 1WLYA 2X86A 1CJCA 3Q6MA 3AINA 1JEEA 4YEDA 1H94A 4LXIA 4M1EA 2GEVA 3E3MA 3GLTA 4D5EA 2WHPB 4C89A 4GOJA 3D6TB 3RK1A 2IYLD 2IYVA 5K8UA 3KFXA 4ANFA 2A58A 4RWEA 2FAXA 2CXTA 4G97A 1OHHA 1YR3A 3SJUA 1KS2A 1B3RA 1GFSA 4ILKA 5IH3A 1JXQA 3UGKA 4MQEB 3PNVA 3WL3A 4CT0A 4DDTA 4QARA 2H2DA 4ZV4A 5JWOA 1XMOB 2K2WA 1EX7A 5AW6A 3EGWA 2OMEA 2PQ6A 2QRVB 2B92A 3BKWA 1Z28A 1WEKA 2AG8A 4GWGA 4Y9DA 4DSTA 2LZ0A 3ZDDA 1U90A 4QTTB 4HGPA 5JDIA 1KFEB 1GT91 3Q2OA 5JSZA 4N39A 2V65A 1MAHA 2WF8A 4NV0A 4E5UA 5KS2A 3OCXA 3HVIA 1P2SA 3DMFA 1J8MF 3GJXC 3E27A 3LYUA 3RYIB 2GCGA 3EH1A 3P96A 3QW4B 1KSJA 4IIJF 4U2GA 4B87A 3ZHUA 5LWQA 3N39C 2ISSD 3DOCA 2FW9A 2QM0A 3DE2X 2ACWA 4WL0A 2WAMA 1A69A 4HSGA 3H5NA 1E2NA 3TIGA 2P4QA 3L1HA 5AKEA 1Y4AE 4J1SA 4HAUA 4YLEA 5LQRA 1ILWA 3OETA 3ZCSA 3EG9A 3T9DA 2FPXA 1PHPA 4OXYA 3WE7A 3KNZA 3QX7A 4D8WA 2HLHA 5AVWA 4OQNA 4LYDA 2FN8A 1L5SA 5IJAA 1D2CA 3DP9A 4EUNA 5BSHA 4GKKB 3TMKA 5FPHA 1JVSA 1AF4A 2JFXA 5E7QA 2F2TA 1P73A 1QVWA 3PX2A 3SYRA 1BA3A 4IDQA 3E9CA 2VAVA 5D5HA 3N87A 4L0DA 5MDHA 4N8EA 3QA3E 3STYA 4ND1A 1JIIA 4ZU1X 4HWOA 3DCYA 4OOFA 5JXWA 4FYIA 3GEEA 2P9YA 3K1AB 3MN1A 2DPXA 4W5TA 2BD0A 2IDKA 3CT6A 2V5AA 4MW2A 3TFQA 1XR3A 5TX7A 1N78A 1UT5A 1LBQA 2RHGB 3A7DA 2GF9A 2H1RA 3ZI7A 4B6JA 2XHEA 4BGVA 5HK9A 3LWZA 5D5PA 2ONYA 1GR1A 2I87A 5FJJA 3R5KA 4MQ6A 1ECPA 2J5RA 2VO1A 1TVKA 1PAUA 3BE8A 3FPLA 4XB1A 4ZA2A 3MXOA 1XV5A 3WI7A 1JU9A 2CXRA 2DWUA 1PQYA 3IUEA 1OAAA 4C0SA 4L3VA 1D07A 1NBIA 1NZJA 1TTHA 4NFLA 1A4UA 1NBHA 1KZ6A 3QXCA 1UKBA 3G49A 4XOIA 2W58A 2O2YA 2HHJA 3FZYA 5EHQA 5M2QA 4ZT7A 1DBRA 1JHPA 1V2HE 2KWIA 2VLIA 4Z9FA 2D6FA 1H42A 3IIMA 2JCYA 2FYTA 4FC6A 4B80A 2HUPA 1KZYC 3TD9A 4EITA 4BQNA 3QMWA 2O8CA 3ZIDA 2PIDA 4RFVA 5AM3A 2YWBA 2C2KA 2JAQA 2OKCA 4DRXA 4R1MA 2PR7A 2R7NA 4GOOD 4P2GA 5JCOA 2H11A 4ZHQB 1CG6A 3CTMA 5EP3A 4TT8A 4NJOA 5K2OA 2CKDA 4CLEA 2ZWAA 2ZRAA 1D2NA 2BDUA 4R1OA 3VX3A 2HM7A 2X9QA 4PINA 1L8XA 2HRZA 1PL6A 1I4DD 1I51A 2BEWA 1D2RA 1KAOA 3TQHA 5GOTA 3EIQA 3EDRA 2ZYDA 2AW3A 4Y2TA 3CF4A 4GF5A 1TJ3A 4XARA 3NT4A 4HUQA 2XEXA 1ESCA 1P9NA 2P8SA 4HCJA 4BL5A 1DQYA 4C3ZA 4EZBA 2XJ9A 1F60A 3FFTA 4RDIA 3JQFA 3PC4A 2DBVO 4KMMA 4EB3A 1Z25A 1WVMA 2PXXA 3PF8A 4NARA 2D7JA 1LPMA 4DV0B 1NVWQ 2I2BA 1KYIA 2ECPA 2ZT8A 4L5IA 2AQKA 2O0MA 1WXWA 3VC2A 4EWLA 4LHVA 5HFAA 5EP2A 4EHKA 3P9YA 2R97A 4Q3AA 1T4MA 2FSVC 2PLRA 1YZHA 2GN0A 4BO6A 4DUZB 3EZGA 1SCKA 3I9KA 5C51B 2IWHA 4OI1A 4RY0A 1YVRA 2FF5A 3ZDQA 1T3SA 1P1BA 3CLRC 4R9RA 4OHKA 4E3ZA 5GIOE 1KDZA 1NDUA 2INGX 4QEKA 4KO3S 3CM0A 1PDWA 1ZM3A 4UXIA 1RTTA 3MCUA 1VRCA 3EAGA 1R9GA 4OLHA 5EXXA 3SC2B 4B1FA 1P4GA 4DARA 3AY3A 5L45A 1PG0A 5DMHA 2PBFA 3Q7PA 1O96B 5JQGA 4O4IB 1AS0A 4UFNA 1AMOA 3K30A 1Q0HA 3AVQA 1X1QA 3JARB 3OWHA 4IJ5A 1YS1X 1ZGAA 3KKLA 5IS2A 4FCVA 3DHEA 4DLNA 3T3NA 4QGFA 3L7KA 1HLFA 5J5VA 1KOLA 1G5TA 1XLUA 3G13A 4OKIA 3A28A 4UCXA 4BQFA 1YUNA 2ZJZA 4JL6A 4C1NA 5CNIA 3GDOA 1JQBA 2F8SA 3MUFA 1OPXA 1WRBA 1DWUA 1X70A 1U80A 3CW2A 4V0LA 4EM6A 2CVZA 2Q3DA 2WTAA 3DBRB 1BMTA 3PFKA 1XD2A 1GZ7A 1PD0A 4AKEA 1RJGA 2ZAIA 1Z0KA 1FLAA 3ZQUA 2IYNA 4YPOA 5JXHA 3DE1X 5DN6A 3PFIA 3G1WA 1II8B 2KBEA 2JAUA 4HYTA 2BMWA 3HCNA 3L5KA 1ST3A 2RI0A 2CDBA 3F6BX 1UIMA 4PRLA 4Q5IA 4RU1A 1TT5A 1NAHA 2UZ4A 4CG3A 2AOUB 3G85A 5EE1A 5L7WA 2JEOA 3I72A 2PG3A 2CJWB 2RGWA 5JO0A 4K05A 3EBLA 1RIFA 1ZXLA 1Y48E 3AY0A 1JYFA 4FFMA 5E6UA 3RGGA 1SXJC 3QVGA 3UJ6A 3U7RA 4NBTA 5T6BA 3A32A 1FMFA 4QUBA 2CF6A 1KJNA 3D9QX 1Z4MA 4X1IB 4YRAA 3H4VA 2YNMA 2P62A 4U5QA 4ZGGA 1SEPA 1NW8A 1QF6A 2AJLI 4C22A 3W9YA 3TW8B 2EX4A 2EQ5A 3CLHA 1PR0A 3LHDA 2RHDA 4G5GA 4MCAA 3ROEA 2JVIA 3WKDA 5IF3A 2O8FB 2VYQA 1U11A 4QJ5A 3I58A 4PZPA 3O1JC 3QYPA 3IP3A 4ZP1A 4AO7A 4MMZB 2FSFA 3GPLA 5GM2A 1JDTA 4RLSA 4K6CA 3DZDA 1AQLA 4GDMA 1O94D 2EF0A 4MA4A 3TLJA 3MMSA 4M60A 3EW9A 4A16A 4X8HA 2DSTA 4MW1A 5D87A 2A0WA 1E3TA 1LEHA 1A7AA 1FSZA 1V3TA 1P7ZA 5I3CA 3HVKA 4OIMA 2QGNA 2QMQA 3LHIA 4UD6A 4YQEA 4WZBB 4ACBA 4BASA 1DXYA 2UDPA 1QONA 3BJIC 3VYWA 1X1RA 3IYLW 1ACLA 2OV1A 4GICA 1HNXB 2DQKA 1BXRA 1CUIA 1JWLA 4LA4A 1ULHA 4X5OA 3FMGA 4A2WA 3K9NA 5FWYA 1FSFA 1ORDA 3GBVA 4S1PA 1SPBS 5G41A 3UJDA 3I0ZA 5AKGA 5FPQA 5DBEX 4D3YA 1VKOA 4QATA 2ZTMA 3INNA 4RK6A 1L1FA 3TLKA 3PDIA 3KU4A 5ALKA 2YZKA 2ZS7A 2P5SA 2HTFA 1H1TA 3KUUA 4YJFB 3UENA 4BVBA 1MUUA 3GP3A 3R5FA 3CUUA 1KGDA 1F06A 2PRYA 2WNIA 1W8IA 2X8WA 3A4YA 2H8GA 3BD9A 4QWMA 5BW4A 5J4YA 1A1VA 1M7HA 1I36A 3KJZA 3JVEA 1E99A 1Z5VA 4WESB 1TQDA 5HJ7A 4N76A 3KETA 1Z82A 4L4RA 4M6WA 2GCIA 1X1CA 2J1LA 4HQNA 1LV8A 5AR1A 3BRCA 3VAYA 1C1XA 5KDOA 3C97A 2X1MA 3K6KA 2QG6A 3PUWA 1W25A 4LSGA 3V1LA 3K9WA 1WABA 1SEVA 1AOXA 2J6BA 3NS7A 2G76A 1YDFA 2EWWA 2EZ8A 2VHEA 2WVAA 1UBSB 5IASA 3Q6NA 3C7DB 2Q3BA 4LDNA 2FSIA 2R751 4NFYA 1KRXA 4PRZA 1YMVA 2XF8A 2OZLA 3LW8A 3LT0A 5HWSA 1X1EA 1EE1A 5FBKA 4TV9A 1GM5A 3GMDA 4C6SA 4AUEA 4HDMB 3PFCA 4QDXA 4O5AA 4D6PA 2XCSB 3ORRA 2NVWA 4FWTA 1JJ7A 2W5UA 3PCXA 3ET5A 4CFZA 2Q62A 4WKGA 4F04A 1GN9A 3NETA 1M72A 4DCVA 5EJ5A 4RGYA 2IUUA 1S01A 4BTLA 3H8JA 3G59A 4U3JB 4QJ3A 4LSWA 4ZU6X 4E88A 4ER5A 3WAJA 1XCGB 3MVEA 5AJWA 1T36A 3MOIA 4G0PA 1OBOA 1O96A 3S29A 3DEAA 1Y8RA 2E89A 1WSAA 3E22A 2P4HX 2XMCA 3IIEA 2HA0A 2ZR9A 4DSOA 4GI7A 4WBNA 1TUIA 4UM7A 4KKVA 2BLLA 1R6UA 3IQIX 1MO4A 1S4QA 5A5DA 1I5EA 1L5HB 3QRWA 4ZOCA 1ZOSA 4D74A 1L8OA 2PX6A 2DBQA 1M5RA 3KV3O 1XP8A 3ITDA 4G0OA 3G5LA 1R0LA 1G8FA 3DOEA 4AMBA 1C7FA 5KBYA 2AJ8A 1JWBB 4FEYA 4DZZA 1EHYA 1IE3A 5KJFA 1LTHR 3SYKA 1LLUA 3LBAA 4A5OA 1KQNA 4DDVA 1N2JA 2A0UA 3HXLA 4JYMA 1ZINA 4MJ3A 1EIWA 1S3FA 3IXMA 1JB1A 3QG1A 4XDZA 2ZTVA 1ZBDA 1E62A 1G6HA 2O0HA 3TJMA 1TCVA 3WYAA 5CB4F 3LT5A 1YE5A 2C7VA 2OBMA 1BQEA 1E0SA 1Z29A 7REQA 1ESZA 3IAXA 4I50B 5BSVA 2PUWA 1GPBA 5EJ9A 2FDCA 1OR8A 2AS0A 3B51X 1E5LA 2QORA 2F43A 2I8CA 3DNFA 2A0KA 2Q2VA 1CPYA 1ZW6A 4J0HA 4G36A 4Y6GB 1JQEA 1S0UA 1I8TA 2W2LA 2R68A 3CZAA 2OPBA 2VSFA 2PUHA 2Q50A 3EEYA 3L18A 3OTGA 2GI4A 2OAGA 5K99A 2XCTB 5JU6A 2OBNA 5AJZA 3HZZA 4JMPA 4FYPA 4HDQB 1L5RA 4AN4A 3MB8A 1VL6A 5G3YA 3UTCA 1SJ9A 2FRDC 1RPJA 1G6OA 1ZN7A 4A8TA 1ECCA 3BMCB 3H6KA 5TQ2B 3CISA 2NADA 3CF6R 4IMPA 4V0KA 2RGXA 2YX1A 5COAA 2ZDHA 5H9VA 4ESOA 3G8YA 2Z4RA 3ORSA 3OLQA 1IHXA 1U4OA 2WABA 3KKZA 2PXCA 3K6RA 4JOBA 5BQPA 2ZROA 2R7AA 4BIIA 5BSRA 2XNCA 4O33A 2YFYA 3JYQA 3D43A 1V4VA 1L7DA 4JH0A 4RIEA 1XNHA 4PZUA 4Q9LA 2H2GA 2R9VA 2ZRBA 1G98A 3EA4A 4UFPA 3WSTA 1XRPA 4M89A 1KC1A 1ULBA 4RCZA 1SO8A 4ZT6A 5LQAA 1AQJA 3KQWA 4KWHA 3ICWA 2OENG 3VNQA 3CVXA 2XRZA 2D5AA 1R4MB 1FZTA 2W6NA 2JHGA 5F3RA 2WM8A 1CLEA 2O7VA 1U1EA 1EWQA 1IB0A 2Y4OA 1FQKA 5CW2A 3I1FA 1R0CA 4ASUA 4MAFA 1F51E 4JI6B 3EW7A 3IDZA 2PH5A 3E35A 4KKXB 4MUGA 3QUBA 2V6GA 5HQ3B 2XADA 4O3FA 1PN3A 3UANA 3FBGA 3CLTC 2ICAA 2Y1XA 3PGKA 1SCUB 4Y1FA 1HETA 4CM1A 1P77A 4BNYA 3I6ZA 1UJ6A 5KQGA 5KVAA 1FVOA 5JAQA 2NACA 1XRLA 2ISCA 1REQB 3CZ9A 1SZJG 3G2MA 1ZIXA 3ND8A 4H16A 4JA2A 1TM5E 5FL7D 1W34A 1NLMA 5BN5B 1I2DA 1NBMD 5T4BA 3QX8A 2C4NA 1B15A 5KJEA 2H9AA 1XJCA 3IKLA 2V3CC 2XXJA 4M8LA 1E0KA 2B5WA 2BR5A 2DHRA 2HY7A 1K7SN 4URYR 3UH0A 4BUZA 4EUFA 5JCOC 3NH6A 3WK4A 1I3OA 2IYRA 1Q0LA 3IOBA 3FOCA 5IFKA 3ADPA 2SKCA 4KDEA 2II6A 5MHTA 1RQGA 2SECE 5HKOA 1UQTA 5EJAA 4RV5A 3UT5A 4Z49A 2BRUA 4US2R 1TA0A 5J4KA 3ADBA 4TOIA 2Z04A 3GNQA 3KOMA 4N0DA 5JS8A 2BGGA 3HO1A 3EXHB 3KT0A 5EE0A 4E5YA 4WD3A 1BA2A 2RI1A 4YALA 3QU7A 1F4PA 3OT1A 1T4DA 1SQSA 2AYZA 1SQ0A 3VVBA 5BVGB 1PGNA 1CUJA 3V4SA 2MTBA 3F97A 3ZCRA 4BU1A 1AHHA 2R47A 2R3SA 821PA 1LVUA 1N0WA 5ALPA 1YBVA 2NQTA 3JX9A 3KEGA 2R2AA 4ZCQA 5CFRA 1ADFA 3A05A 5BR8B 4MEAA 2HCRA 2OHVA 3BCSA 5C81A 5TS2A 3BXEA 5DGXA 3EZ9A 3SX2A 3U1VA 3RYHA 4GSYA 2CVOA 2NT3A 3VPSA 4B48A 1SVSA 1UF9A 1EUYA 2ZJ6A 2GM3A 5EMMA 1C9NA 4CCSA 4W8HA 1P6QA 3TBKA 1NJ1A 1K3FA 2WICA 3TRKA 4FDTA 1C3VA 3QLEA 3RTBA 2EKBA 4RZXA 1EVEA 1A77A 3FYHA 3WJ1A 1E2DA 1FX1A 1VM6A 4RHFA 3DS8A 2YDYA 1USVA 2GMWA 4DMHA 5DYGA 1NR5A 2JL1A 5SY9A 3ZV7A 2IXBA 1GU0A 2YXNA 2H5EA 4UOQA 1QU2A 3HN7A 1E58A 2M1XA 3GQBB 3I45A 3HO8A 1NUHA 4Q4CA 3WKBA 2QJWA 3K70C 2JZCA 2R85A 5H68A 3GFPA 1Y7LA 2R8RA 4ZDWA 3T3DA 5ER6A 3K53A 3AF5A 2I80A 5JFOA 3TMAA 3E6AA 3QE4A 3CSUA 1AD2A 5C7LO 5FBWB 3FVVA 3OZSA 5IMSA 2DFLA 1EK5A 2XAAA 3A6HA 3PP8A 1AQUA 1A7JA 3IEPA 2OCAA 2CEAA 3OX3A 3HGTA 4H0NA 4HB2A 4DCNA 4Z0TA 4X71A 3LI2A 1OI7A 1G2PA 3REQA 1JSRA 1NKTA 1X1BA 2G88A 4P83A 2YV5A 3NDPA 4YB8A 3VR1A 3HSYA 1YQDA 4ZT4A 2VNIA 1CUWA 3KOWA 1KWKA 1L7OA 1Z5WA 3ND9A 3L02A 1UKYA 1HE4A 3P32A 1KIAA 3WMGA 1EZZA 4BCBA 1VBFA 5AOVA 5IXSA 1WG8A 3CVUA 1P0CA 2J45A 2EGGA 3S2IA 1APBA 4L8YA 3AF4A 4NJEB 2XI4A 3F9CA 3FWKA 4WZZA 3IEVA 3S8MA 5JTUA 3FZNA 1IAVA 2YXBA 4LKOA 4B31A 1OGJA 3EIEA 2JASA 3VYSB 2YBDA 3KOYA 3K94A 3QEBZ 4AFNA 2R96A 2FA9A 2H85A 3O4RA 3C3KA 3UOWA 2FHSA 1YKGA 4O2BB 3PRYA 4Q9NA 1ULTA 2VDNB 1IM8A 2XMGA 2EW2A 3GJZA 4QLOA 3PWTA 5HKKD 3FTCA 2FPKA 2Z3WA 3PTLA 4B4VA 4MVJM 1TIBA 1M67A 1W46A 2V98A 1XKLA 3OH8A 3ZLBA 3AVOA 4AU1A 1WHTB 3ZQJA 1U0GA 1VCIA 5KSPA 3C15C 5TXGA 2P3OA 3I32A 1VLQA 4HMPA 2B4AA 3R9XB 5AXBA 4QDZA 3GGJA 4ZOAA 1ZIOA 1LDNA 2H16A 2HHAA 3SZRA 2PRSA 2FN9A 3X1KA 2VQEB 1TCCA 1U9IA 3BSSA 2OXCA 4W5HA 3Q0IA 1U63A 3LT2A 2HCTA 5FA5A 4EELA 1WBDA 1EG2A 2YMLA 1CQJB 2I99A 5DI3A 1JR3A 3NC4A 5C35A 1YZUA 4LOJA 2ODTX 2CD7A 1PVOA 3CUVA 4MAMA 5FA8A 2LWIA 4NQRA 4DIOA 1QPZA 4BEVA 4TYQA 1XAJA 4IJUA 2FQWA 5JD3A 2QN3A 3UH1A 1I4WA 2PSHA 4KB5A 4AMYA 2QM7A 5CTAA 2PGNA 3Q11A 5B5SA 4YJ2A 4GRAA 5EZ6B 1PL7A 2Q0SA 1C1DB 2Q99A 5ALRA 2ZE6A 1T0JB 1UDCA 3KZVA 2ZKIA 3KEMA 2CZCA 1JR3E 5C8YB 3JD3A 4QYIB 4S3MA 1BZYA 3TGLA 4JZKA 2C9MA 3FOBA 3VTFA 2WYWA 3G5UA 4B4WA 2XECA 2RC6A 3JD0A 4H15A 1JLRA 1EFTA 2XYVA 3P19A 1Q7BA 4DJEC 3HKBA 2DT8A 2R4QA 3IPCA 3N70A 2F8MA 1J0EA 2IIPA 3M2PA 1I9CA 4U7GA 4KX3A 3V2HA 3DZHA 1TPYA 2QV0A 1Z7GA 1TU0A 4F7WA 5I7AA 2VRCD 1ISRA 4QUGA 3FZEA 3ZVRA 1JPNA 2B4TO 1GCGA 2D1SA 1WDTA 3CX3A 3FLAA 5DDIP 3QVKA 4NMMA 1WBBA 3FYUC 1KEEA 2DG2A 2PS3A 4IEEA 2AFIA 2B2XA 4FK8A 3SBXA 3I6MA 4C2AA 1P72A 3OIWA 4TUYB 3DR3A 1DXQA 4LK3A 1AKRA 2JGAA 3NBUA 4G86A 4NZPA 4WN9A 5CEEA 3L0YA 1RMQA 2NOAA 1AKVA 4ISBA 4PN3A 1U0JA 1RI5A 4IRXA 2QX6A 3GT0A 4G1EB 4RD6A 5JRDS 1K0FA 1HNWB 5I4IA 1T9GS 2HJSA 4QGBA 4UULA 2V6FA 1K4MA 2G7MC 2DHEA 3PJDA 3U39A 4D9MA 1O5IA 1A7UA 1JJFA 1IJBA 4P93A 1FFCA 2TRSB 3V1YA 3WLPA 2V7EA 4GO1A 4L6CA 3V2GA 4DUGD 4NZMA 4ZO8A 5KB3A 1OU0A 4J0IA 1VE5A 2XWSA 4RH1A 4KG7A 2FFQA 3I2JA 2P27A 3GQBA 3KFVA 2XKAA 4A8PA 3QP9A 4IZ6A 4BMSA 1PZGA 2VDLB 1GKIA 1NRJB 1H23A 2OXEA 2E6UX 4KI0A 4XWYA 3OJ0A 4F8YA 5KZMB 5ITVA 4CQNA 2QXUA 3PEYA 3WRXA 4IKOA 2L42A 2Y1WA 4O0MA 5JCZA 1WO8A 4UOZA 5BN4B 3LBNA 5IT4A 2BUBA 3UHJA 5JAZA 4L4XA 5TLSA 3NM5A 2UVPA 3GDFA 3LOUA 5JYBA 3CRZA 5U1PA 4J94A 3ZH2A 2UV8A 2FWPA 2ACEA 3FHCB 4TWAA 4YI3A 5KSWB 1L4GA 3PD1A 4QYSA 1AF7A 1WQ1R 4BXOA 3I2YX 1GARA 3R5JA 4IX9A 3WGTA 2QW0X 2P6UA 3QY9A 2LP4Y 3TTYA 4MJLA 2XIQA 2DJIA 3F5DA 4P0TA 2R6GA 4C0QC 4C2BA 4KO2S 2CL0X 1TVEA 2FV8A 2V1XA 1ZZGA 2BH2A 2EFYA 4RFSB 2WRZA 2Z3VA 1OZAA 4GMXA 1SN7A 4RD4A 4ZI3A 3K0EA 3EXG1 4FCTA 1D6NA 2GA9A 4RFLA 5B1DA 4CTKA 4ERXA 4UDXX 3VJKA 4KJXA 1OVMA 2BFBB 1THZA 1H2EA 1EK0A 2VRBA 4RVDA 1Q3TA 3FVTA 1G7TA 3U09A 3JQ8A 4HAOA 4KWEA 2C9OA 3RIEA 2P7IA 1CY8A 3KE8A 4OJKA 5LBIA 2PUCA 2OLJA 1QZUA 1L4UA 1SBZA 1Y6RA 5ITWA 4AWBA 1H65A 4DC1A 2GK6A 4QUIA 2B8WA 3DE0X 4WLUA 2VJQA 3RTDA 3T3IA 2PMWB 4CJXA 4UTRA 4JC4A 5FWXA 1W36B 3JS5A 3MJTA 2NUTA 5LOVB 2VWQA 3GVHA 2CFCA 3X1JA 2V7QA 1TC2A 3EF3A 1PWYE 1ZDMA 2ZITA 3FYDA 5HG0A 4BE4A 4HTFB 1QRAA 2ZUUA 5HCIA 1MJ5A 4QLAA 3JYHA 5KYXB 3K5PA 4B7ZA 1THGA 5H81A 1C3OB 2RBGA 5BRJA 3MIIA 2QT0A 1EX1A 1J2JA 1L5WA 2RIRA 5FNVF 3P2YA 1G8SA 6LDHA 5JCPA 2XWBF 1JQ5A 4OP3A 1AJEA 4KYIB 1WLSA 3ROQA 5FL7A 1YONA 4P34A 4DE5A 4EVSA 2C4WA 3IJPA 2FVXA 1PEAA 4J7UA 2FPUA 3RC2A 3ZHOA 2FG5A 4C21A 6GPBA 2RHOA 3FNFA 3I6BA 3U7GA 3FWPA 4JT4A 3RLFA 3ABIA 3EEBA 1E4OA 3I1IA 2FJPA 4OV6B 4YQYA 1XCLA 1XZFA 1V2GA 1YRHA 1Z4LA 1ZGCA 3JQGA 3K8QA 1M5UA 3QUAA 2FX3A 4RZ2A 2NSHA 4C6RA 2L2QA 2HWWA 2RH8A 2C2YA 3QNWA 5CDGA 4DQ0A 3R40A 3AVWA 2QMEA 4HXYA 1AXGA 1N6OA 1WOYA 4MV1A 4OBBA 3A9WA 4P33A 4Y6PA 1W1UA 4GX0A 5BYBA 4Y9TA 1HXHA 1E2FA 1XTBA 4KQXA 2FB9A 1R8JA 5JOQA 3IAHA 1P5RA 3NHFA 1GGFA 1XQ6A 3B1KA 3OTIA 1Z06A 2IL1A 5LP6B 3OT1B 2UYCA 2C4UA 4W1QA 5FPTA 2WMOB 2VDWB 4FFVA 4X1OA 1T5OA 4ZTBA 4RM2A 1N9GA 3QSYA 2GN6A 1R4NB 3BWXA 3JQAD 3KQTA 4QZVA 1V35A 3ZW8A 4CDNA 3RUIA 5KSOA 1NT2A 1N1EA 1RAFA 2IELA 4G9EA 4RVFA 4PQFA 4WY5A 3U40A 1WUJS 4CU2A 1RYEA 4N5HX 2PPVA 5KNLA 2A7XA 3TCKA 1CERA 3EQ9A 1IVYA 4PPFA 5B55A 3ABQB 3M6MD 5FUYA 3OEED 3U4IA 3DDUA 5E7JA 1CR4A 4MJ7A 5EP4A 3T52A 3MBOA 2H3HA 2HLPA 2P2DA 1MFPA 1D4ZA 3MINB 1T2FA 2DFVA 4WFQA 5CJPA 3PEUA 2AA3A 2YHAA 2HF2A 4MK4A 3S2EA 1DJOA 1IY8A 1EA5A 1I2CA 2MOKA 5DV9A 2ZBVA 3EGXA 3VOTA 4Q3DA 3ZZMA 3KKMA 4AWAA 5DN6D 1DAKA 2QTMA 4KITB 2RE8A 1E77A 1O57A 2JATA 2PL5A 3B2QA 1HYBA 2I1VB 1DC7A 3EVZA 3AETB 1MTZA 1ZQ9A 2H1HA 2OK7A 4LHEA 3TIVA 2GLUA 4TQAA 3GLGE 1SQ5A 4KR0A 3VO1A 4IOMA 4B79A 5JMTA 1KDYA 4OJMX 4Z0PA 1C9EA 2BJVA 2H18A 3M5PA 4M7PA 2P2CA 2UZAA 4B47A 4UBOA 1GFIA 1DMSA 3I8OA 4O4LA 1JU3A 2XMBA 2NV6A 3JR3A 4OLJA 2ZI7A 5SZJA 5A6SA 1VE1A 2YZMA 1HDXA 4RDHA 4FNAA 4I9NA 5D00A 1ZNZA 2CVHA 2QZ9A 3N2NA 3TEFA 3UMYA 3T1QA 2A2ZA 3FTPA 3II6X 3KJQA 1VKZA 4ZKEA 5FWAA 1JAHA 3HU1A 3IO5A 4IILA 2OHXA 3MLBA 1JG6A 1LDBA 1BH6A 1PEDA 2LIVA 4KQ9A 4DG8A 3SM9A 1DPGA 4WINA 5EIWA 1TYZA 3NAGA 4Q3CA 1AK1A 3NPAA 4OQXA 5E38A 4EGAA 5F2KA 1LH0A 2ZRLA 3KSMA 1A9OA 1J0AA 2P7HA 3IALA 5D3MA 3ZTWA 2WHPA 3I5YA 2X8BA 1QE5A 4Z0HO 2C1EA 5HZHA 1GNSA 4KACA 1JEQB 1QKJA 3E5NA 3RSOA 4HQLA 4EAAA 4R2IA 2A9QA 2VT6A 2QLNA 2D1FA 2VFAA 2NUTB 3DMPA 4HEA6 4NMLA 3VXKA 1SVIA 4GXNA 5LOVA 2H92A 3IP5A 3QPBA 1JHXA 2BF4A 2ZT5A 2BHSA 5K6AC 3EVTA 4MVJF 4LX8A 4TT3A 1L8QA 1BXZA 1JA1A 2ZRPA 2C8VA 1Y8AA 3N0TA 5CLHA 1BFDA 4DCPA 2OEPA 4D3XA 3P9PA 1I0LA 2VPXA 3HWWA 1BNCA 1EM6A 2IEIA 4MDHA 4W9MC 1YMUA 3MSCA 5ESXA 2Z43A 3DDOA 5E9AA 2D0DA 4JP5A 3UWDA 4F84A 1M10A 5J2TA 4C7OB 3QFRA 2JK0A 1UC9A 4D2IA 1YF3A 1D4AA 4HWRA 1KXZA 1QE3A 1HPLA 1Y3FE 2W2TA 2ENUA 3FNBA 2IYFA 3GJRA 3QIVA 5GWXA 3RG8A 4EECA 3AZQA 3FPAA 5FKJA 1R0KA 1RQRA 5HBRA 5DTJA 2VSXA 1Q12A 4FX5A 5E0OA 3WL8A 3AHCA 2WIDA 2I67A 4G4JA 2YCLA 1YU9A 1D1QA 1QQ5A 1TIPA 4DLRA 5KC8A 3KIPA 1EK6A 1XWIA 2IYEA 1E9BA 1LPAB 1ZONA 3N6XA 3OWOA 1T1JA 4XQ9A 4R1TA 1IG3A 4AT1A 3EPPA 1LRKA 2BFEA 4MLZA 5A6VA 4OP2A 1VOTA 4AO8A 2IPOA 3MCWA 1FFEA 4HO1X 5E1DA 4Z5XA 3TFWA 1YRWA 2HA3A 3TG2A 2ZB2A 5J5CA 3HXTA 5HOQA 1XX6A 2ZBGA 1RQPA 5C8YA 5HM8A 1JSXA 2C7BA 4Z7OB 1W36C 4PHTA 2VPIA 1DWOA 3IAAA 1Y4ZA 2DRIA 4FFDA 5FWNA 1U28A 3PRKE 3TL3A 4KQIA 4WVFA 3D1VA 3LXMA 4QRHA 3MA0A 1P7WA 4EPVA 4O3MA 4ZYVA 3HWX1 1WW3A 2B20A 5B58C 5DNEA 3VZPA 3WWYA 2GD2A 2K87A 4JDPA 4M0KA 1BJTA 3RHZA 1E5XA 2WD7A 1NXQA 1EXWA 1GO2A 2ORVA 3G6KA 1G17A 3PGVA 1VHWA 3QYAA 2VF4X 2HNAA 4CETA 3ESYA 5DRYA 4UHBA 2VA9A 2WK1A 1QRUA 1XMVA 3EB9A 5FWYB 4QYTA 4E1VA 3RUHA 3G9QA 1XD9A 1YDEA 2HWUA 3BTUA 1UXOA 3GAMA 3P2JA 2Q28A 1J70A 2PJDA 1UL1X 3CX4A 5EKUA 8OHMA 2OY0A 2WMYA 3KPVA 3L8HA 4IHQA 4XEUA 4RTOA 4HLDA 4TMXA 3L0PA 1VB5A 1EAMA 4B45A 4YY3B 1FDVA 1ZAKA 2L82A 3C4VA 4RANA 4UVDA 3KQYA 3LQ1A 1K5GA 5IARA 4B0OA 5AUPB 4DLTA 2CMDA 4NULA 2MYTA 2Y0EA 3TAXA 2QTRA 3V4PB 1CDZA 2OT3B 5KUTA 1MO5A 4R8MA 2YWHA 1EDBA 5H3HA 3JZIA 4MQFA 1VMIA 3MJVA 4ZCRA 4QKQA 2WWIA 3LE8A 3RYFB 4ARVA 4GKBA 4YHHB 1VMDA 4DCMA 3RFFA 4NS1A 1GL9B 4NG5A 2B37A 4B3SB 4D0RA 3I2GA 4RTLA 3T9EA 3N3AC 5FTMA 1SZPA 1P7YA 4FSXA 2X5XA 3O7MA 1NQOA 4KRFA 3B1WA 1T6XA 2Q2WA 5AI4A 2PT6A 1KZ9A 1E9CA 3ZJYA 2OORC 3PFFA 1PDOA 4XWTA 4JXKA 3ZQKA 1L5VA 1T3LA 2C82A 2VDQB 3G0BA 4IKPA 1H1DA 5DTQA 4EYGA 5CG2A 5JECA 5IVKA 1QU3A 4AZTA 2ZRHA 1CU1A 3AEUA 4QU5A 3GJ6A 5EMNA 1QX3A 1JKFA 2EZUA 1Z8HA 2JGEA 2WG0A 2Y99A 3OZIA 4PGHA 5AVKA 4BQSA 5DYTA 1EHCA 2OO5C 3BDAA 5JUWA 2HJRA 3HFJA 2J3IA 1ZGBA 3AZPA 5LFAA 2IOFA 2ZS9A 4NI5A 4Q9JA 2YJ6A 4AUNA 4ALMA 4WKNA 3TDMA 3T4PA 4DYDA 1J2YA 5DEOA 4D41A 3EVAA 4F45A 1X0VA 1HT3A 1Z8FA 2V45A 3HYRA 2FWAA 2P2YA 3R0JA 4N0MA 1CB0A 4HDOB 5IAGA 2JGRA 4ND4A 1EFVB 3DEKA 2YYSA 3A9VA 1UDBA 2ZBFA 3UICA 3NI2A 5K0BA 3THXB 5INTA 1B6SA 5CFPA 5M7EA 1E9SA 4L9SA 1G0OA 4NBVA 1EFAA 1IY0A 5FO0A 2VP4A 3IAUA 3BDIA 4H1TA 4NK4A 3DC2A 1WKCA 4BNVA 4DAEA 1MV5A 3EXEA 4QGSA 2FR8A 1DB3A 1GUYA 1TKBA 4QUJA 3GLSA 4A0SA 1M34E 3PRJA 1Q0TA 4DLVA 3R8CA 1CVLA 3EDCA 4DDWA 4YV0A 1W96A 2PUAA 5FOVA 2P69A 1MEJA 3BK1A 2VNJA 3X3HA 3M4ZA 1JDZA 3OUUA 4TMTA 1N2GA 5JS7A 4R83A 2QLMA 4YTEA 3TIXB 4I1UA 3BDVA 3ECAA 3GJ7A 3OBBA 1LW6E 4CVNA 3P2KA 1CUSA 1K6JA 1W5EA 2MINA 3AI1A 3M6UA 5EHXA 3FR8A 4R0MA 1KJZA 1IBMB 3S5UA 2I2AA 2WJZB 1YI1A 3KHKA 3V32A 1GGJA 4FFRA 2UXCB 4EFLA 1I3CA 1Y3DE 2G1JA 4JT2A 1G7SA 1CZKA 1GGMA 4M9UA 1GPKA 2PGIA 5HKAA 2QVYX 2X8AA 3BORA 4IWXA 1V7ZA 3D6AA 2IEAA 4MOWA 4DLYA 1TJ4A 4MGZR 1PJ3A 4S1VA 1ZISA 1ZGJA 5KOHA 2LR0A 4ARSA 2HSGA 2HJ9A 3IOYA 5JASA 4PWYA