4HP8A

Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound nadp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
245
structure length
245
Chain Sequence
b'NPFSLEGRKALVTGANTGLGQAIAVGLAAAGAEVVCAARRAPDETLDIIAKDGGNASALLIDFADPLAAKDSFTDAGFDILVNNAGIIRRADSVEFSELDWDEVMDVNLKALFFTTQAFAKELLAKGRSGKVVNIASLLSFQGGIRVPSYTAAKHGVAGLTKLLANEWAAKGINVNAIAPGYIETNNTEALRADAARNKAILERIPAGRWGHSEDIAGAAVFLSSAAADYVHGAILNVDGGWLAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
molecule tags Oxidoreductase
source organism Agrobacterium tumefaciens
publication title Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from Agrobacterium Tumefaciens (target EFI-506435) with bound NADP
rcsb
total genus 95
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hp8A00
1DLIA 1GEEA 2ZTLA 1NHGA 4QO8A 2JCVA 1J6UA 1GL3A 1CF2O 1KY4A 4Z0HO 1XWFA 5JYDA 1R0SA 2AQKA 1Z45A 3JV7A 1AXGA 3H5NA 1NR7A 3W4IA 3IJRA 1N9GB 2GPTA 1G0OA 1LRKA 1V9LA 3FRJA 4PLWA 1Y5RA 1KERA 1X13A 3DAGA 2QIOA 3GR6A 3U5TA 2QG4A 1TT7A 1N7GA 4JN6B 2VUSA 5IXYA 3JYLA 4I9HA 5G0SA 1VL6A 3E1KA 4OL9A 2W98A 3GFGA 3O8QA 1PR3A 2NVWA 3OIFA 1VM6A 2FSSA 1MC5A 4GX1A 4QSMA 9LDBA 3L4BA 4PLYA 3NAQA 2YQ5A 1HT0A 3DHEA 4XWYA 2IEDA 3INTA 3W8EA 4GSLA 3B20A 1DO8A 1YB4A 2GRAA 3LZ6A 1PL7A 2EKQA 3H4VA 1F14A 1DC6A 3QQPA 4OJNA 2AQIA 4BL5A 2X8LA 3OSUA 4JNKA 3GEMA 4AJLA 4YQZA 4E31A 1B8PA 4K6FA 2DUWA 5JDCC 2IODA 4FGSA 4GLOA 3WMXA 1WNTA 1ADCA 4ILKA 1NQTA 1HDXA 1EUZA 2YFHA 4GKBA 3KV3O 4AJHA 4M8SA 4LMRA 3WSVA 1N9GA 3BMQB 1PJQA 4IIUA 3SBOA 1EMDA 4IY1A 5C7IO 1Z82A 4P4GA 1BGVA 1I0ZA 3WMWA 2HO5A 1PZEA 2DBRA 1ML3A 3L4BC 5DCWA 1O6ZA 3PJDA 2FPIA 3RKRA 2GN8A 3HHPA 3S1LA 4BS9A 2Z95A 4WLEA 1ISFA 4WOKA 2QZZA 4XQ9A 2X9GA 4W7IA 1OI7A 2JHFA 2G82A 2VWGA 1NFQA 2Q2WA 3RJ5A 5IXSA 4N7RA 2O3UA 1TB4A 4DIFA 1IY8A 4OH1A 3OA0A 5KOIA 1H2HA 3D0OA 4WE3A 4RVSA 2HJRA 3IKTA 3LU1A 3OQ6A 1F06A 1ZK4A 2P4HX 4IDBA 4JJIA 4MO2A 4YAIA 5C3MA 2NU6A 4ZGWA 4UEKA 3ZGYA 3TZKA 2BGKA 3KM0A 5AXBA 2Y1CA 1B3RA 2R6JA 1GUFA 1UR5A 1VSUA 2B4RO 2D5CA 3DONA 1PZGA 1C3VA 3L6DA 3GVCA 3FPCA 1QLHA 1PZHA 2BFMA 1NBOA 1PQPA 1ONNA 2ZB3A 3N7UA 4H7PA 4UVHA 3RUHA 1JA9A 1BTOA 3ZCXA 4XIJA 3PGJA 3PZRA 5L95A 4XGKA 3FF4A 1DLJA 4Z9YA 3FNGA 1GY8A 4HFJA 1S7CA 3CZRA 3OJLA 3R6DA 2LDBA 4RVUA 3WWYA 1E7RA 4HV4A 3HB5X 3KYCA 4GPD1 3RFVA 4J0EA 1NHWA 2FP4A 2DKNA 2D5AA 1IULA 1MFPA 2YUTA 2GD1O 4JP2A 4CMBA 4DLBA 5A9SB 2NSDA 5KWEA 1M66A 3LQFA 3DQPA 4XQEA 3VDQA 1MP0A 3K2BA 3AFMA 3KSZO 5G0UA 3QWHA 2JHGA 1B7GO 4FJ2A 4FJ0A 3ETGA 3R3JA 3UICA 5JXWA 1RJWA 1WDLA 1TA4A 3O8QB 3ZWAA 4ZJUA 4KMSA 2EKPA 3B70A 2HRZA 3DBRA 2CUKA 3TL3A 4BMSA 5AOVA 2Q1UA 4E2XA 3E9NA 1TVEA 4K1LA 1N2SA 2B4TO 3M6IA 1RM3A 2O50A 2C5AA 3KEOA 3QWAA 4RPKA 1HXHA 1KETA 3Q9UA 1VJ0A 5DCYA 1QYWA 2X0JA 2VRCA 1K5HA 3PQFA 3K9QO 1ZZEA 2DFVA 2VCYA 4BO1A 5JAMA 4BMVA 1PSDA 5T64A 3ASVA 3RIHA 4CM8B 1UZMA 1UP4A 1ZXBA 4EITA 3HQ4O 2NTVA 2RAFA 2AE1A 4CL3A 2ZIZA 5L53A 2GERA 4R3NA 3NTQA 1PIWA 3JYOA 1PJ2A 2HMUA 3ANNA 3NT5A 1NP3A 4B3JA 4GGPA 4C7KA 4E5KA 2P4QA 1UXGA 5KJ1A 4TZKA 5IF3A 4IUYA 5TT1A 1D1TA 4BKQA 1ZXLA 4Y6SA 5L51A 5BSEA 1WVGA 1HDYA 3CZMA 1T2AA 3LF1A 4JX8A 3WNVA 1Q7CA 5IDQA 4BO5A 2YJZA 1LXCA 2R00C 2EJVA 1R12A 1A4UA 1HYEA 2VOEA 4MP3A 4ESOA 4XJSA 1ZK1A 4B4VA 5H82A 4U5QA 4YVFA 1ZSNA 5GMOA 3RQSA 1HDZA 2F1KA 4OYRA 4YT2A 3KUXA 1DFGA 3ZZNA 3FHLA 3GT0A 4Y67A 2GZ3A 1O89A 3VPXA 2WYWA 5BNFA 3GZ4A 4WLOA 4H16A 3CTMA 3MJ4A 4XYLA 4G5HA 4NFSA 4W7HA 1R0LA 2Z5LA 3QHAA 3JYQA 4BGVA 1NAIA 3P19A 4A7PA 4IJWA 1NM5A 4B4UA 3L9XA 3TL2A 4PG5A 3DR3A 4GBJA 4XEHA 3BMCB 2C29D 2HU2A 1QR6A 4XR9A 4GX2A 2WD7A 4UEOA 4UVEA 4A0SA 3AUAA 2FOIA 3C3XA 3S2IA 3KYDB 3I9KA 2B69A 4LGVA 5EESA 4R1NA 2X9VA 5IG2A 4IDEA 1CIVA 1Q0QA 3OM9A 3VPGA 4HP8A 2A4KA 4QFDA 1HWYA 2PZJA 5C7OO 2Y0EA 4D79A 4KQWA 2OP1A 1CWUA 2GYYA 1R37A 1LA2A 4HKTA 1IYZA 1MFZA 4FOOA 3QVXA 2D4AA 1PGNA 4AG3A 4PG4A 1SOVA 1O8CA 4BNJA 1I36A 4QXMA 4BUCA 2Y68A 2VRBA 3E9MA 4ZQFA 5KJFA 3B1KA 3W4KA 4J6FA 2C54A 4DRYA 3H8VA 1E7QA 3MJSA 2HMVA 2C07A 1UDCA 2Y99A 3GGGA 5KIAA 5FF9A 3HDYA 3AY7A 1Q1NA 3H6KA 5A3JA 2HQ1A 5TX7A 5BT9A 4LCJA 4GVLA 3HADA 2OHXA 3TNLA 3BMCA 5AQ1A 4CLRB 3BHJA 4IMRA 5EINA 2O23A 5JMWA 3UW3A 4BO0A 4ZU3A 3NT4A 2J6IA 3PI7A 2VUTA 2OORA 1M67A 3GAFA 1E92A 1I8TA 3H5AA 2CY0A 1RYDA 3NTRA 3PPIA 2EF1A 2C7GA 2PH3A 1JLLA 1U5CA 2B36A 4B8ZA 2QRJA 4OIMA 1DC5A 3ZNPA 1DXYA 4W6ZA 2UV8A 4R1UA 4CLRA 1UH5A 2AEJA 4DTIA 3BA1A 1GQQA 3PYLA 5JSFA 3G49A 1U4OA 4YRAA 3SVTA 3JSAA 2BD0A 4N54A 3GAZA 1B16A 4CR6A 2Z1NA 3HB4X 4WCFA 2LDXA 4QEDA 1NR1A 2PTGA 2NADA 1E1NA 2NWQA 4MVJI 4G65A 5B1YA 4BNIA 2VTEA 4QO7A 2G0TA 4J91A 9LDTA 1LU9A 4L4SA 1LNQA 1U3UA 2YV2A 3WLEA 2VWQA 1GZ6A 3ZWXA 3B1FA 3JYPA 1AHIA 4OQZA 4O0LA 5FWNA 5GZ3A 1WMAA 3C7CB 3MWDB 3O4RA 2FMUA 2RIRA 4XDYA 2W4QA 1XKQA 1I3LA 1N1EA 3CH6A 2YYYA 1O94A 4RV9A 5F1KA 1D7OA 4HFRA 1PS8A 1W6UA 2VN8A 3PHHA 3VKUA 4DBZA 3GVIA 3LSYA 1R4MA 3GDGA 1UJMA 5THKA 2ZB8A 1NQOA 2OFPA 4YPOA 3D5QA 1Q7BA 5JCXA 1GZ3A 5KJCA 3ETEA 4ALLA 4BV9A 3ENNA 1GYQA 1U7TA 2IEBA 1P0FA 1U3TA 2X5KO 3TQHA 3JD0A 3DZJA 2FRDA 3WGOA 5LCXA 1MLDA 1BSVA 2B5VA 1OFGA 3VPFA 3DL2A 2NV6A 1KOLA 4DYDA 3RASA 1VL8A 4GH5A 4M54A 4YAEA 1DC4A 2HK8A 4AL4A 4AJPA 4EJ0A 3WQQA 5H81A 1T2EA 4JROA 4ND4A 4IDAA 1G0NA 3G17A 3B6ZA 3AI2A 3VAZA 3GGOA 4J2HA 5IZCC 3FI9A 4R1SA 2OZPA 4BNLA 2TMDA 3QVWA 2Q49A 3PGXA 3VH4A 3H9QA 1VKOA 2NQTA 4ITUA 1YONA 2XF8A 2HK7A 3C7DB 4JBGA 3V2HA 1LTHR 1WZIA 2PKQO 4GSKA 1XCBA 1DIGA 2B0JA 2EP5A 4PG6A 1CDOA 3JQ7A 1MB4A 2V6GA 2HMWA 1H6DA 3C24A 5JS6A 2W2LD 4O63O 5F21A 3RC7A 4BMNA 4BB6A 4MDHA 1ZH8A 1ZW1A 1Y8RB 1ZEMA 4KZPA 2XAAA 2Q1WA 4DPLA 3Q1LA 1YE3A 3MOGA 3M2PA 4XB2A 5HBRA 2C2XA 1NPDA 4TRRA 4WKGA 1KYQA 3WS7A 4WNIA 1DBVO 4WPGA 2OOSA 4QT0A 4A27A 3ZDFA 1M6HA 3PHIA 4QFCA 2HAEA 4OGWA 4E5YA 1LDNA 1V35A 2X0IA 3I9NA 3GMDA 3JQ9A 4GL4A 4OSOA 4IGEA 5U4QA 4EUHA 4YBZA 2VHXA 4UVGA 4R4JA 5TT0A 3O38A 2HJSA 1Z7BA 3ZU3A 3NDJA 4HXYA 4DQUA 2DM6A 3TWOA 2A35A 2IYPA 4J3FA 3DZKA 2GZ2A 3E82A 1M6WA 1CYDA 1MXHA 1W4ZA 3DZGA 3LVFO 3JQ8A 3EK2A 5HS6A 3VZPA 4EW6A 2PH5A 2Y1OA 3IAHA 1BVUA 5TLSA 3GUYA 3GN2A 2YHUA 1UXJA 2GLXA 3U49A 1PGQA 3TZ6A 5CDGA 1QV6A 1VC2A 3CXRA 4DPKA 2FR1A 5I8WA 4GWKA 1VKNA 5H83A 1UP6A 4J16A 4Q3AA 5DNAA 4GX0A 4X54A 3WB9A 3IUPA 1QMGA 2EV9A 1H94A 4NNJA 4CLOB 4UUOA 1E7MA 2CF5A 1EK6A 2GF2A 3GG9A 4NH4A 4ALMA 1WXDA 4OXKA 4ALKA 3SC6A 2EJWA 5ILGA 2OMEA 2O7QA 3K92A 4J4HA 3NJ4A 4FR5A 5DT9A 2FPGA 4L9RA 4Y9DA 2X23A 1PQWA 2X9NA 1DFIA 4QUKA 1NWHA 5L40A 4FPXA 3EDMA 2ZYGA 4P4LA 4RVHA 5L3ZA 1EDZA 1E3WA 3B1JA 2NVBA 4IDDA 4HNHA 3GUCA 1SC6A 1RYEA 2BHLA 3ONDA 1UDAA 2AE2A 4AJ4A 2D2IA 4LSWA 4YJFB 2YZ7A 4DREA 4BNVA 1OOEA 1KVRA 4RPHA 4CL8A 3UVEA 4GMFA 1NFFA 3NT2A 5C5IA 3JQGA 1BVRA 1SEPA 1T4DA 4OXYA 5DP2A 3ROPA 4NMHA 2P5UA 1KC1A 3I23A 4JQCA 1GUZA 3RBVA 5HWSA 2HSDA 4YJGA 3GZNB 1I2BA 1ENYA 3TZCA 5EERA 2VHZA 4UUNA 2J3IA 3GPIA 3WIDA 3MEQA 3GF4A 1E77A 1Y8RA 2W90A 3GVHA 3JQ9C 4BNYA 1ONOA 3AOEA 1NVGA 2P5YA 2Y0CA 3G3EA 3MJVA 4TKLA 1Z7EA 1QV7A 3EC7A 2AEFA 3G0OA 4YQYA 1PWXA 2I9PA 4AFNA 2NLOA 5JAZA 3BMQA 4NK5A 4MVJG 1A7AA 1ZSYA 2Y67A 2J5QA 5GZ1A 3O9ZA 3OJFA 3GVPA 2I67A 4ND2A 3ZH2A 3S2EA 1D8AA 2OUIA 3PIIA 5A02A 1CEQA 1FK8A 2WEKA 3DBHA 1WZEA 1YKFA 1LQTA 3JQCA 1XU9A 2YHIA 5G0WA 1GUYA 4Z9FA 1U9JA 3OJEA 4PRLA 1QYDA 4BNNA 5IN4A 2VYVA 4EI2A 3FNFA 3L9WA 3I6IA 3ZWNA 3GHYA 3LK7A 1JVBA 3PDJA 3X2FA 8LDHA 3LT4A 2O3TA 4RQUA 3V2GA 4EEZA 4JLWA 4Q3DA 5JAQA 2Q2QA 3GRPA 5F1PA 1ID1A 1TT5B 2FR0A 5EJ2A 1HETA 1WAMA 4MJLA 4IS3A 3WG9A 2QW8A 2DTDA 3Q11A 1GV1A 3RU7A 1BHSA 4IJUA 2SCUA 2YDYA 4F46A 1FDWA 3WICA 4XRGA 5MDHA 4B8WA 2VOJA 4YXFA 2EIHA 2IYOA 4PN3A 2J3JA 1IHYA 3SJUA 3ROKA 2G5CA 4TKMA 1KEPA 2AHRA 2P91A 3DOCA 4YEDA 5DBGA 3S8MA 1PEDA 1XELA 3N74A 3DTYA 4URFA 1GFSA 1NVMB 4CM3A 4Z3KA 3LT2A 3K8ZA 3OBBA 3DHNA 4RZHA 3VZQA 4WASA 2VHVA 3IP3A 1Y8QB 3PHJA 4RVFA 1IHXA 4CUZA 1A72A 1A4IA 2BI7A 3QV1A 4AVYA 3RKUA 4PGFA 4XB1A 1OAAA 4I5GA 3WWZA 4NU5A 3V8BA 3NV9A 1IZ9A 4EUFA 2W2KB 1OC4A 2IE0A 3ZV4A 3AI3A 3RUEA 4IDCA 3U62A 1ARZA 2NU9A 1V3UA 3PZBA 1LSOA 4JCOA 1R6DA 3C1TA 3VH3A 5L4SA 2O4UX 4XCVA 1O9BA 3T7CA 4DPMA 1KC3A 4FIZA 1NPYA 3U4IA 1LSSA 5JYEA 5DCUA 5TS3A 4J4BA 4WECA 4R51A 1DHRA 2ZQZA 3RC1A 4E5NA 2VT2A 5CEJA 4BNHA 5A04A 5G0TA 2X7HA 1I10A 3ZW9A 2CSUA 3WX0A 5CFZA 2W8ZA 4EJ6A 1LC0A 1I24A 2FZWA 4PZCA 3AK4A 3KZVA 4O59O 3E03A 1JU9A 1P9LA 2B4QA 3D7LA 1CRWG 1ENPA 1HE3A 2EHDA 5EIOA 3D5TA 3JQEA 5JE8A 1DIRA 2ZB4A 1LDGA 4I9NA 3KOUA 5A5EA 2ZB7A 3C85A 2NNLD 2HLPA 2VZ8A 3D3WB 4PVDA 5DOVA 1PJ4A 2XOXA 3ULKA 4KTVE 4CMJA 1IPFA 4J1NA 2EXXA 5T5QA 3EYWA 3VVCA 3UF0A 3QY9A 1RM5A 1UXIA 1Z75A 1V8BA 4OM8A 1GV0A 1PL8A 4AJEA 3Q9NA 4MP8A 1E7YA 3F5QA 1SCUA 4GI2A 5KVQA 3WQSB 2NUAA 1I30A 4AJ1A 3VDRA 4E5PA 3W6ZA 4J9VA 3RUIA 1K0UA 4NJMA 3RVDA 3BTVA 3WGIA 4LRSB 4DGSA 2D8AA 1X0VA 4ZD6A 4PCVA 3GVXA 4NJOA 3KEQA 5TQVA 4RF5A 4KUHA 1P1RA 3GRKA 4MKRA 2X58A 3GN1A 4GGOA 4R5HA 2PKRA 4HNGA 3S2GA 4R9SA 4XX0A 3DBLB 1E7SA 1E5QA 1BXGB 1P3DA 5T8KC 2I76A 4IPTA 4L4RA 3VZSA 4CLDA 3U09A 4HUJA 1YH3A 3WFIA 4RDHA 4CM7A 3DTTA 4I5EA 5DF1A 3CMMA 5G4KB 4YRBA 4FOSA 4XD2A 3JQAB 5B12A 2PZLA 2CVZA 4E32A 1YRLA 3I1JA 3IIEA 3UFXA 3BHMA 5G4LA 4IJKA 2VHYA 4IXTA 4YJHA 2OGUA 1I2CA 2DC1A 4CM4B 4CM9A 1C1XA 1F8FA 1IL0A 4PLTA 5ICMA 2O4CA 2R2GA 2VWHA 4GLLA 4ZQHA 3SJ7A 2BH9A 4FFNA 4W82A 1ISMA 1E3IA 1ISHA 4FSHA 2C2YA 2E49A 1B26A 2X4GA 3FCOA 3WYBA 1F0YA 3PYXA 4UVIA 1XLTA 3HDHA 1E6UA 3FD8A 2NVUA 4N5LA 3FTPA 4Y6RA 3VTZA 1AE1A 1LRLA 4D3SA 4PG8A 4KUGA 5I9NA 2NTNA 2X86A 2WWRA 3KYBA 1U2DA 1XG5A 4BHTA 3RC9A 3EMKA 2PGJA 3DHYA 4P38A 2Q2VA 1Z6ZA 4D0SA 1NYTA 3UCXA 5TIIA 1P1FA 3M1LA 4UULA 4DQVA 1ZO8A 2DU8A 3R0IA 4J9UE 1EVZA 2X1HA 1OMOA 3LC2O 1FDVA 5IAAA 6ADHA 3BTOA 2NM0A 5FYDA 3RFTA 3IL2A 4FCCA 5I9MA 3ZNQA 1UAYA 3ONEA 3DMTA 1C14A 2NTJA 1QYCA 4K26A 4CR7A 5K6AC 1YOVA 2BF7A 4CM6A 4CODB 1ISJA 3QIVA 4L76A 1DRUA 2JJYA 4AICA 3C8MA 4J49A 2ZYAA 3ADPA 4AJNA 4MKXA 2D0IA 4M55A 2UAGA 3OETA 3FNHA 4BO8A 3H2ZA 1S6YA 3H9GA 4FFLA 5C37A 1R15A 3NDIA 2ZYDA 5A05A 2VNAA 4NIMA 3UXYA 4JP3A 4EJMA 5GZ6A 3F1KA 1HLPA 4XYEA 3VZRA 1J49A 3RUFA 2BGMA 3D64A 4Z3DA 4I5FA 4WUVA 3W4JA 1UAGA 1ZUD1 3ITDA 4W9NA 1BRMA 1QXSA 2PR2A 3FR8A 4WLUA 1T1SA 2CZCA 3VHRA 2WSBA 4CLEA 2Q4BA 3S55A 1X15A 3DZFA 3H5RA 3W8FA 1BG6A 5JPIA 1JKIA 2PZKA 4YA6A 1MG5A 3WIEA 1O0SA 1HEUA 3I52A 4AJJA 5HS4A 2RHCA 5C7LO 1MV8A 4XYBA 1A5ZA 1HDGO 1KEUA 2Q45A 4A10A 1NTOA 5TNXA 4C7JA 1RPNA 3DXFA 1I2ZA 2JCXA 4IQ0A 4R54A 1QLJA 1EVJA 1EK5A 3DBVO 4U8GA 2IZZA 2B83A 3H3FA 4R5MA 2GASA 2DAPA 1Y7TA 4BB5A 1VJ1A 3C1OA 2GGSA 3FSRA 3RSHA 2O3RA 1X1EA 1BXZA 4F6CA 1SBYA 4JGBA 5K0ZA 4CQLA 2WE8A 1U3VA 2WJPA 4UEJA 3ICPA 3EGOA 3FPLA 3I9OA 1OZAA 1YGYA 2GDZA 3G1TA 1GTMA 3I9JA 4FS3A 3R1IA 3KETA 3GG2A 1LBEA 3ZV5A 2PY6A 4WK6A 2FY8A 3PJEA 3UAGA 4BVAA 1GCUA 4RPJA 2I99A 3VPSA 4YYZA 1BW9A 4LVCA 3JQDA 2E82A 3GNTA 3QWFA 5T8KA 4E3ZA 2PA3A 1GADO 4PVCA 3ON5A 3UN1A 2PFGA 5FEUA 1O95A 3FR7A 4MIYA 3HE3A 1ULSA 3Q2IA 4Q3EA 4ROSA 5ITVA 1F12A 2DPHA 4GAEA 4YCAA 5THQA 4RVGA 1DJQA 1B0AA 4DYVA 1CQJA 2PD4A 1B8UA 5AXCA 3E6AA 1Z74A 1QYXA 1QKIA 1SB9A 3GHHA 4XKJA 4PLFA 4J4TA 3GLQA 3GEGA 4ZQEA 3T4XA 3JQBA 2Q1TA 1TI7A 4CQMA 3ICCA 3H9UA 1H5QA 2O7SA 1VE9A 3DAFA 1FF9A 1GCOA 2CVOA 2ET6A 2ZK7A 3ITKA 3CIFA 1SMKA 2HMTA 1QRRA 2PZMA 5FI3A 4Z0PA 4EZBA 5KKCA 1AXEA 3BMOA 3RUCA 3L0DA 2C59A 4Q3CA 1U3WA 3GDFA 1HSZA 4R41A 3OP4A 1SOWA 4ZN6A 2VYND 4MVJP 3PJGA 2Y1GA 2JAHA 4E2WA 4D46A 1G6KA 3ST7A 1P45A 3FBGA 4RZIA 3ZHYA 4Q9NA 4EUEA 3PFFA 3I83A 1ZK0A 2FZEA 2I65A 2VNSA 4HFNA 4DIBA 2I3GA 2I6TA 1U8FO 2VQ3A 2NQ8A 1HE4A 2UVDA 3IQDB 4WEOA 3LT1A 3KHUA 3AY6A 4E13A 3AM4A 2YHIB 1ZJYA 1ZK3A 1ZCJA 2DVMA 2GN9A 3BHIA 4NQZA 4CM1A 3U0BA 4WGGA 3D4PA 4YTEA 3GA0A 4P8RA 4MVJM 4CMCA 2BFPA 1Q7GA 1C0LA 2EERA 4DC1A 1VPDA 2G1UA 3BZUA 1DIHA 1WDKA 4FC7A 4DBVO 4E2YA 1RM4A 3KLPX 3WGZA 4FFOA 3E18A 1WW8A 2HUNA 3KO8A 3U4CA 4E2ZA 3MJEA 2J5RA 1FDTA 2CNBA 4DMLA 3RI3A 5TJ9A 3BMNA 3GNQA 4CMIB 2X22A 3HJAA 3IJPA 4D41A 2DT5A 4FB5A 3TN7A 5FI5A 1UUFA 4ZICA 1Q0LA 4YR9A 1V6AA 1E0DA 3U4HA 3WBFA 2V6BA 3HFGA 4GVXA 3OA2A 4TROA 4BKUA 3OEWA 4YDRA 3WJ7A 4R68A 3RBZA 1WPQA 1E1LA 3ZNOA 3GEDA 4B7UA 4DMMA 1JQBA 2X6TA 3M1AA 4BGEA 5B4TA 1SNYA 3JQGB 3CEAA 3AWDA 1BWSA 1PJCA 3LDHA 4W9NC 1JDJA 1P77A 2UYYA 1K2WA 2H5LA 3WTCA 2G17A 5HA5A 5JFOA 5A9TA 3AM3A 2A94A 4BO9A 4TZTA 2I66A 3IC5A 5ICSA 3V2UA 2JKVA 2P68A 4W4TA 1ZSVA 2CD9A 1RWBA 2PKQP 5EQDA 3DFZA 4CQMB 1YBMA 4FN4A 1EFLA 4H3VA 1UP7A 1ZVMA 1NXQA 3GOHA 3ZWCA 1YO6A 4NFYA 4CV1A 4ZVVA 3DOOA 5HM8A 2BGLA 3EAGA 3KSDO 3TF5A 1X0XA 1PS9A 4INAA 5EPOA 4CLOA 2IXAA 5EQFA 3UCEA 3GY0A 3ZWOA 2JD0A 4MIEA 1KVQA 3MTJA 4J7CA 1YJ8A 3DAPA 1H6BA 1DRVA 1PQUA 5ADHA 1YXMA 4WEQA 4AJKA 4BKOA 1PJTA 3WGYA 2O2SA 3RFXA 2JFHA 3PLNA 5EMHA 3COSA 1SO8A 4D3DA 2O48X 3JQ8B 4C4OA 8ADHA 3A28A 1X14A 1CJCA 5CPFA 2QX7A 2F00A 4RO0A 1E3LA 5DN9A 2Q46A 2ZJ1A 1A71A 1JW9B 5I8ZA 4KDFA 1FXSA 5F5NA 3JD2A 1IE3A 3A1NA 2IRWA 4DL9A 4XA8A 1DEHA 4KTTE 1H6CA 1Y81A 3QSGA 2QYSA 3GDOA 3QVSA 4K9DA 4CLHA 5ILOA 4CMIA 4MVJH 1AUPA 1HZJA 5I7EA 1NAHA 2VWPA 4J1TA 3S2FA 5CDTA 2AQ8A 1FJHA 4NK4A 3H9JA 2WM3A 1SEVA 3MCVA 3ZU4A 2BRUA 4B7CA 2DPGA 3QVOA 2AG8A 3IMFA 1Y5MA 2Q1SA 2X5JO 4ND1A 4NFHA 5IDWA 4D0RA 2P2SA 1X7GA 2DUUA 1Y1PA 4BO2A 3ZWYA 2D1YA 4RPLA 1T2FA 1YJQA 1MC4A 4Z0TA 1E1MA 2JD1A 3QVTA 4DIOA 1I01A 1U7HA 4NBVA 4UUMA 4CR8A 4JJGA 1HF3A 4ND5A 4NBUA 3TDKA 1LEHA 4XR4A 3LT0A 2FHSA 1YWGO 1HZZA 1U28A 3EVTA 5B4VA 4BO6A 2ZATA 1MXFA 1ENOA 1XHLA 3KTDA 4WCDA 5JY1A 1L7EA 4D44A 1SZJG 3BAZA 1IB6A 1NX6A 4YJHB 1GYPA 1EE2A 3FWZA 3JQFA 4TMFA 4B3HA 5I9LA 2GO1A 3I5MA 3JTMA 3TFOA 2CVQA 4LCEA 1XA0A 3PRJA 2Z1MA 5L9AA 1LDYA 4TRNA 1KIFA 3IKVA 3TOXA 5A06A 4D42A 1XSEA 2B5WA 2BLLA 3ZHXA 2QRKA 5JDIC 3ABIA 5JMPA 4F6LA 3UKOA 3FWNA 2GCGA 3EVNA 4JK3A 3CINA 4GKVA 3EHEA 4HFMA 1K3TA 1YOVB 1B2LA 1E3SA 1C1DA 3VVBA 4WCFC 1YS4A 4IJVA 3AU8A 1ADFA 2QZ9A 3H65A 4YT5A 4PFJA 5F3RA 1VJTA 3F6YA 4G81A 4RORA 4AJIA 3WGTA 2A9FA 4YACA 1BW9B 3ANMA 1UDBA 4ZQGA 4NJMB 3Q6IA 4CQMD 4O5OA 5MGBA 5ENVA 4BNZA 1GDHA 3UOGA 2FR8A 1JTVA 3PLRA 2PK3A 3EZLA 3HDJA 3O26A 1ZIDA 5U1PA 3I4FA 1X7HA 4QX6A 2FWMX 3KXDA 4R9RA 2BELA 5JLAA 2BI8A 3GC6A 2JAPA 3DZHA 1EFKA 1PJBA 3F4BA 1R4NB 3F9IA 4R69A 2DTXA 3SX2A 3OHSX 5KVVA 1UXKA 1ZK2A 2OL4A 3F47A 2AMFA 4II3A 5JBIA 5L7WA 4B4WA 3I6QA 4WCFB 5ER9A 5G2OA 2RCYA 3WYEA 4N18A 1EUCA 3UGKA 4BKRA 4ZHSA 3H7AA 3NGLA 4B4OA 1DC3A 3DMTC 4LW8A 3RROA 1ZBQA 4GMGA 2O3QA 1J0XO 3OIGA 4LMPA 5DZSA 1VLLA 2GN4A 4OHUA 4L8VA 1PWZA 5DOZA 2ZTVA 1DRWA 3VKVA 4L4XA 3NKLA 1JKFA 1N1GA 2C20A 2Y1DA 5AXAA 4IZIA 5L7TA 1Y9AA 5G4KA 3I9MA 1B15A 5CHEA 1PS0A 1DPGA 1VSVA 4Y98A 1YBVA 3RD5A 5TSDA 1A9YA 2WYVA 3QW2A 4ALNA 2RHRA 3AOGA 2Q3EA 4A73A 4HADA 3PYMA 1BXKA 1R0KA 2BFOA 3F5SA 4YAKA 1P1KA 2VUUA 5JW6A 5FFFA 1YL6A 2Y0DA 3DOJA 5CAEA 3TSCA 1GZ4A 1TXGA 2DLDA 4WLNA 4RLSA 3RUAA 3ADOA 2JFGA 3JQFC 5COQA 4NI5A 5I7SA 4AJ2A 2P9EA 2GUGA 3D3EA 2EP7A 5G0VA 1BDMA 3EW7A 4U0JA 3IP1A 2UUPA 4BGUA 4E5MA 3L77A 2ZJ0A 2WDZA 3JCZA 3ZWPA 5BR7A 3EY4A 1JKJA 3WGGA 4YT4A 3MJTA 5CEFA 1LJ8A 1WDMA 5COAA 2H63A 3L6OO 2PWZA 1ENZA 3M2TA 3DEYX 2IZ1A 4XDZA 3EZYA 3CMCO 2WD7B 4PIVA 1P1HA 3HWRA 2ZTUA 3DO5A 3MTGA 1H6AA 1LSJA 3AM5A 4FGWA 3ZHZA 1P0CA 3QE3A 1PGOA 1HYHA 3W1VA 4BOYA 5CDUA 3CKYA 5DULA 2ZKLA 2J5KA 1TT5A 3AI1A 5A4DA 4J90A 2HCTA 1JAYA 4NG5A 2VT3A 5DDIP 3WQRA 4OAQA 5ES3A 4CMGA 2VTDA 4MVJF 1B8VA 3NUGA 3QWBA 4ALIA 1A27A 1QP8A 3ZHBA 5KVSA 1Z73A 5IZCA 2NVUB 3RU9A 3AUTA 2C7VA 2WYUA 4E4YA 2UDPA 3AJRA 5AXDA 2CF6A 1LDBA 1QG6A 2X5OA 1KVTA 4BNMA 1VL0A 3JD3A 5JO9A 2YV3A 1GPDG 7MDHA 5KJ6A 4MKZA 1SAYA 2AW5A 1WMBA 3DBHB 4J0FA 1UXHA 1J5PA 1Y9EA 1AN9A 2E48A 1DAPA 1PGPA 1TEHA 4P4NA 2WE7A 5A9RA 4W99A 3RAJA 1E3JA 2VYNA 2V6FA 1C0KA 1HE5A 1NQ5A 4IQ8A 1PU2A 5BSGA 4XGNA 3JQAA 1C1DB 3H9EO 3WSWA 1V0JA 1Y8QA 3V1TC 1M2WA 1P74A 2A92A 4YAGA 1HL3A 4CM8A 1ZMTA 4K28A 4BNFA 2H6EA 3I9LA 2E37A 5JDIA 4IM7A 4CM9D 4NBWA 4OOFA 3KSUA 3LLSA 4II2A 4DWVA 3FTNA 1K6IA 4D45A 5BSFA 4GX5A 2VHWA 2NU7A 5KCZA 4IS2A 3H3JA 3FBTA 4PLGA 4UVDA 5J23A 3PWZA 5ENDA 4J43A 3U9LA 1KS9A 1RKXA 4FW8A 3PXXA 1LLCA 4KUEA 3ASUA 4JXKA 4XRRA 4A03A 5TGDA 1KVSA 4YT8A 1HLDA 2VZ9A 2FN7A 3OF2A 4FJ1A 5TRTA 3D4NA 2W2LA 3U3XA 2VRCD 4PLVA 5AYVA 1YDWA 4E21A 3QLJA 4QECA 4UREA 3OJ0A 1EEHA 2PLAA 2PNFA 4CM5A 4DLLA 1FDUA 4CUJA 1J4AA 1NASA 1JAXA 3KYCB 3LYLA 1U8XX 3CSDA 3D3WA 4M86A 4XQGA 3IUSA 3ZWBA 4PZDA 5B37A 5TJHA 3OICA 1ADBA 5DP1A 2DQ4A 3VTFA 1M75A 4YRDA 2O2YA 1WLYA 1KVUA 3KLMX 3JD1A 1PTJA 2Y93A 1YQGA 4BNKA 4FBGA 5IN5A 3DC2A 4BNWA 3ONFA 3RJ9A 3GMSA 2AQHA 4MVJD 2HDHA 5KVCA 1ZMOA 3SC4A 2H9IA 2VYVD 3TZHA 2PD3A 4RF3A 4CV0A 2RH4A 4J1SA 3JD4A 3WYCA 4BQRA 1PJSA 2J8ZA 1QYVA 1D4FA 2NACA 4TSKA 3KVOA 4O1MA 3IOYA 3W6UA 2AEMA 3DFUA 1H9AA 4DA9A 1T1RA 1KEVA 5KTKA 4O6VA 1XQ6A 3V5NA 3V1YA 1DAOA 4FC6A 4R3WA 1XDWA 2G76A 2UUOA 3ORFA 3DZIA 5IZ4A 1N7HA 4OKIA 5IDYA 5TC4A 3OJOA 3PIDA 4XYMA 4YJFA 1EVIA 3GGPA 1X1TA 4RF4A 1U2GA 3NRCA 3JYNA 5F1OA 3GQVA 1I5RA 2D3TA 1E3WB 4E30A 1DOHA 1YDEA 2FSVA 3ETDA 1GPJA 1A9ZA 1PJLA 3K6JA 3TPCA 4NBRA 1YL7A 1MUUA 3D1LA 1YQXA 1NFRA 2GR9A 5JY6A 3OFSA 1IPEA 4N5MA 1GEGA 2ZQYA 4A5OA 1NQAO 1ULUA 2B37A 3ZWMA 2IZ0A 2GSDA 3TJRA 2DBZA 1H2BA 4WLVA 5JNLA 1E6EA 1L7DA 1YB1A 1IZ0A 1DIAA 3ZV3A 3AU9A 5F5LA 2VZ0A 5A5FA 3STHA 1AGNA 2X0NA 5KNLA 5CEEA 1T2CA 1XR3A 1GR0A 2HRBA 3PWKA 5CDYA 5AVOA 3QP9A 4CV2A 1HDOA 5BNTA 3BMOB 4RJTA 3NTOA 2CFCA 3A06A 1D1SA 4LSMA 1NVTA 4B7XA 1ORRA 2J3HA 3KRTA 3PHGA 5L4LA 2Y05A 3E48A 5COBA 2Y66A 1DIBA 3ANLA 4OO3A 5T67A 2GNAA 3LLVA 4I1IA 4RDIA 5KKAA 3LC1O 5JC8A 1RM0A 2QHXA 4Q39A 4FQ8A 4XZ3A 1T24A 2IXBA 4EDFA 4Z6KA 2WMDA 4I08A 4M87A 2PV7A 1CETA 3WGQA 3TRIA 1LX6A 3PWSA 5IJZA 4JBHA 3BMNB 4BO4A 4E0BA 4NU6A 3SLKA 2O3SA 5IDXA 2RH8A 1P33A 4FD3A 4M49A 3QRWA 3PK0A 1SB8A 4EEXA 1R4MB 4KOAA 2CDAA 3OIDA 4U6QA 1T2DA 1K6XA 4PG7A 1FMCA 3D4OA 3SEFA 3PJFA 4ALJA 2POQX 1PJ3A 3OECA 1PL6A 5CG2A 1NWCA 3MJCA 3SXPA 4EGFA 6LDHA 2CMDA 2H1SA 1E6WA 1ONPA 3I4CA 3L6EA 4WLFA 1LLUA 1HDRA 1QSGA 3UCFA 3WFJA 4WJZA 1JN0A 1H93A 2CDBA 3QJ5A 1LDMA 2QQ5A 3GZNA 4TVOA 4YJGB 4S1VA 4CQLB 3K2EA 3TFQA 5A1TA 2OBYA 3BTSA 4UUPA 3TOZA 1ZJZA 1DHTA 1EBUA 1U4SA 4RL6A 4Y6PA 4NHEA 2XXJA 1I3KA 3V1UA 5JO0A 1YQDA 3MOIA 4TQGA 3PHLA 2BMAA 4U7WA 2AA3A 5HRUA 3ZV6A 2JFFA 3RWBA 2EKLA 1UZLA 4JBIA 4M89A 3P7MA 2V7PA 1K89A 4E12A 1GAEO 3ZW8A 4IINA 1DB3A 1KY5A 1LDEA 1OC2A 2CDCA 4I8XA 4DXHA 1LLDA 5DBFA 3C7AA 2YV1A 1N5DA 4MINA 4WOJA 4BGIA 2OO5A 4ND3A 3TZQA 1R66A 1VRWA 5A03A 3DZBA 1UZNA 3F46A 4KWIA 1I33A 3ROQA 3UHAA 1G1AA 3K73O 3A14A 2EEZA 1HSOA 3GNSA 4BIIA 1P1IA 2WTBA 3Q0EA 4CMKA 4YWJA 2C5EA 2EWMA 1XQ1A 1ZEJA 4D7AA 1OBFO 4CMEC 1GQYA 4GWGA 3IS3A 1IUKA 1X7DA 4MOWA 2Q99A 2YY7A 3VOSA 3A4VA 1M76A 1TLTA 4RCVA 4OOEA 2ZTMA 2JD2A 1PGJA 3AUSA 3HN2A 4L75A 5L7YA 3WR5A 1GU7A 5A3VA 1DFHA 4NR0A 5I7VA 3DB2A 1HYGA 4G2NA 4LVUA 4N5NA 1HE2A 4FDAA 3AW9A 3F1LA 2ZCUA 2ILTA 4MPDA 2FPPA 2XPCA 5K6AA 1IOLA 1B3BA 1O5IA 5U9CA 3WJAA 5T6BA 1P1JA 2YW9A 4RVDA 1DSSG 4IBOA 2TMGA 3HG7A 3ZU2A 4AJOA 3C1AA 2EW8A 3HNPA 1EQUA 1Y6JA 2YDXA 4GQAA 3WTBA 4F45A 4PRKA 2Q50A 2Q4EA 4YJDA 2ZCVA 1E1KA 1F17A 4ZRNA 5JAIA 1N8KA 4PZEA 1ZNQO 4YB8A 3JQ7B 2BFAA 4IGFA 4FFRA 4IXWA 3OQ1A 4JIGA 1U5AA 1KBZA 3RBXA 5JC1A 4I5DA 1EQ2A 3PFWO 1R16A 3NDRA 1R4NA 3E9QA 1ISIA 3QWIA 1I32A 4IIVA 4JJFA 3AFNA 3Q3CA 1C0PA 3HDQA 4PLCA 1ISGA 4CUKA 5L45A 3KB6A 1XEAA 4L73A 5GY7A 1HKUA 5LC1A 4CJXA 1LRJA 5BQFA 4J2OA 4FFMA 4CMHA 3A9WA 3JQ6A 5DBIA 4MIOA 1E3EA 4CM4A 1HDCA 1QORA 4HY3A 2W2KA 1PX0A 3NEPX 4KP7A 4DC0A 3NYWA 2R00A 2GZ1A 4IQGA 3T7EA 3K30A 1U1IA 3HZZA 1HTBA 1GD1O 3BIOA 3ENKA 4DQXA 1W0CA 1YBAA 2DFDA 4CMEA 1LSUA 3KBOA 2AXQA 2I5PO 4PLZA 3RCBA 1CERA 5JCJD 4NBTA 4NPCA 1JVSA 4LN1A 3DMYA 3VPHA 3FNEA 3FN4A 3P5SA 4U6SA 3ROMA 2GN6A 2Y1FA 4IZHA 4L0QA 3G1UA 2P9CA 1HRDA 1LLQA 3DBLA 1EE9A 4TWRA 3MWEB 4H15A 2PGLA 4MVJE 3NX4A 1H9BA 3WLFA 1XU7A 3INGA 1BMDA 4BNTA 1PZFA 3E5MA 1W8DA 2C82A 2D59A 4XIYA 3U4DA 4RQTA 3WBBA 2I3AA 3WDSA 1EVYA 3DBRB 4ZA2A 4BNXA 1DJNA 4OKNA 1LUAA 2PD6A 4Z9XA 4K6CA 4LISA 3K96A 3I3OA 1I3MA 2RBEA 2P9GA 3DDNA 4R16A 3ZN2A 1EUDA 1MA0A 4DLAA 3P2OA 4BO7A 2IDZA 3ZU5A 5T57A 3AY3A 3VH1A 4RF2A 3WXBA 4A2CA 2EG9A 3VC7A 3LC7O 4S3MA 5L4NA 4UAGA 2XXBA 1W73A 2E6UX 4B79A 3CPSA 3UUWA 5BNIA 1DDOA 4MVJA 1EBFA 1MG0A 1V3TA 3NGXA 2QRLA 4R01A 3K31A 3OMLA 5ER6A 7ADHA 3EUWA 3MZ0A 4CV3A 4D43A 1T25A 4OSPA 4DVJA 4A26A 2DBVO 4OXNA 1C1XB 5HTOA 1A7KA 4J7XA 4PLHA 4XGIA 4F3YA 2X0RA 4TRMA 5KJEA 2C0CA 3WOHA 4IDGA 4CLXA 1LQUA 3JQBC 2OBNA 3F4LA 4NDNE 4OQYA 1XGKA 1ADGA 4ZRMA 3VH2A 3F3SA 4HWKA 5TF4A 1XYGA 2EW2A 3ZWWA 2J3KA 3R3SA 1BDBA 4FFPA 5CDSA 1V3VA 2PGDA 4PLPA 3W8DA 4XQCA 3ZNNA 3HSKA 1E7WA 1B14A 5EL0A 1JWBB 4DUPA 4ID9A 3E8XA 2V65A 5CG1A 1WP4A 2DBQA 5I7FA 2YFQA 1BXGA 3GH3A 5B4UA 3PDUA 3E5RA 3IDSA 3HFSA 1H0KA 3BYZA 1K6JA 3PQEA 4R1TA 5BSHA 3L07A 3H2SA 3JQAD 3QA9A 3AUUA 3P2YA 3DWFA 3Q2KA 4HBGA 3RC2A 1SPXA 4BQPA 4IMPA 3PTZA 2QYTA 1D3AA 1P31A 2EGHA 4B3IA 3T4EA 1T26A 1F8GA 3PVZA 3NJ8A 4RLHA 1LC3A 3UH1A 1PR9A 2JCYA 3WNQA 1ZKMA 1LI4A 4D3FA 4HX5A 1NNUA 3SLGA 3O03A 4XJTA 4XYGA 4E6PA 1C0IA 3GPDG 3AOEC 1EZ4A 1MX3A 3HN7A 4ZQBA 5LDGA 5A9SA 3PQDA 1YVEI 3PEFA 5JDCA 1VI2A 3K5PA 4ONEA 2EGGA 4BNGA 1Q0HA 5CP8A 1KEWA 4P22A 5LDHA 3BXXA 3LF2A 1Q2XA 2OXIA 3INRA 2AG5A 4Q3BA 3KYDA 4LK3A 3G79A 3WGHA 5K9ZA 1YL5A 2WD8A 2YQ4A 5JCJA 2OP0A 2HMSA 4CPDA 2DTEA 4KQXA 1JWAB 4Q3NA 4J7UA 2NU8A 1EDOA 2B35A 2E4AA 4L74A 4RPGA 1NPTO 1AHHA 1I3NA 2HKIA 4NZ9A 4EYEA 5ITWA 2JL1A 1XIVA 4BO3A 3CUKA 1L1FA 1P44A 4KDEA 4YAJA 1WWKA 4KWHA 3N58A 4QQRA 4EBFA 2V6MA 4BV8A 1FDSA 4MP6A 1ZFNA 4U0KA 4LRTB 2HK9A 4QTZA 4TVBA 4BKPA 2BKAA 4Y8VA 4I9UA 1MGOA 1T4BA 4E33A 4M1QA 3L4SO 1N92A 4TRJA 3RUDA 1E5LA 3HUDA 4J1QA 5CPBA 4BNUA 4IDFA 2Y1EA 3GFBA 1GQ2A 4CMAA 2O3JA 1YB5A 3BTUA 3CE6A 5IFLA 4WNCA 4OMUA 4RGBA 3X2EA 3ZI0A 1GYRA 3PP8A 3ZWVA 5EN4A 3GK3A 3OH8A 1CQIA 3OQBA 3OEYA
chains in the Genus database with same CATH superfamily
5IWAB 2ZTLA 5A3RA 1GL3A 1C8BA 1CF2O 1KI2A 2BFBB 2HF2A 1KAEA 5IM4F 5JYDA 1NDUA 3IALA 3HCWA 2HPAA 3KFVA 1T2VA 4ZV7A 3ZLTA 4K9QA 1TFUA 1SBHA 3QFRA 2NIPA 1N9GB 2GPTA 3EGXB 4UAUA 4YMIA 3W4IA 4PLWA 2IS2A 4ND8A 4U7DA 1ZVVA 3X1DA 1Q19A 1Y5RA 2GAJA 3GR6A 2QIOA 5EJGA 3FYSA 3LUCA 2VQFB 3CLRC 4KPFC 4OXXA 3G1WA 3DNMA 3OQHA 1N7GA 4JN6B 5IEJA 3RYTC 4I9HA 4N9QA 2P2YA 5IRCD 2D1FA 5SZIA 4TMYA 1A88A 5HFAA 2JBWA 2PKCA 5I48A 3N8GA 3GFGA 4MV7A 1K92A 2BZ0A 4KRYA 4PHHA 1WR8A 4HYTA 1AGRA 1Y1QA 1O97C 1MRNA 4PIMA 1MC5A 2PGAA 3CX7A 3BRWA 3G9QA 4GX1A 3IAM6 2XWSA 1XAIA 9LDBA 2C9ZA 4KAAA 1U63A 3LKZA 2FPSA 2H2AA 2BM9A 2YQ5A 3D02A 5EXDA 3DHEA 4XWYA 3C15C 2IEDA 2C7RA 1W4BA 1UMBB 3B20A 1A76A 4IQFA 2FDXA 5K3BA 1XHFA 3QKSB 4TSFA 2RAPA 4WH0A 4ZMBA 1F14A 3QQPA 5AVRA 4KXFB 4JNKA 2X3YA 3R6GA 4AJLA 5I4IA 1MORA 2AWNA 3G0BA 1SXIA 3OOWA 3K2IA 5LWQA 2IODA 4FGSA 3WMXA 1YS2X 4K9SA 3PQ2A 1QHFA 3DC7A 1FSGA 1EFCA 4KDCA 1GZ7A 3UOAB 4CCWA 1FRNA 2RSLA 2FA9A 4OHFA 2GXQA 2R8OA 3GLSA 4Q4HB 4DDHA 4GGMX 5NULA 5PGMA 3X1KA 2CJPA 4DSZA 4FD2A 1GO2A 2K2QB 5B3JC 4AB1A 4RE6A 2OZVA 1EMDA 5CB8A 2FFHA 4MW9A 4IY1A 3GLRA 5C7IO 4BDSA 1Z82A 4P4GA 2JFZA 1OASA 1VLJA 1U02A 4U4AA 1RBMA 3BICA 2F3QA 5DWDA 1DJOA 2VBIA 3VM6A 1P4JA 2DBRA 1IDN1 3UBTA 5IC4A 3IVAA 3S1LA 3JAWB 1WL8A 4G4JA 1ISFA 4WOKA 4YLGA 2VXOA 3F7OA 2QZZA 5J4YA 3K6SA 1BN6A 1PP4A 1QHEA 2JFNA 4C78A 2IOYA 1KWKA 2GPNA 1OI7A 2JHFA 3CRQA 4WD3A 2WWTA 4Q00A 5JFGA 3U7QB 2Q2WA 1P7YA 1EP2B 5L3SA 1DEKA 3HO6A 5DHRA 4FZ3A 4GRDA 2MR5A 1U2GC 1CS0B 2O3UA 4F8YA 2JKYA 4CCYB 1SCKA 3A1VA 3WL5A 3H5LA 1IY8A 1YS7A 3OUTA 1KZ1A 3EZ6A 1ZD2P 1YU6A 1AHNA 1O58A 2K5UA 1KI7A 2R8XA 5EPUA 5HNKA 3RHZA 5ANRB 1TVKA 5K3FB 3CSSA 5EOVA 4WE3A 4PO3X 4NMWA 2IDMA 1RXYA 3OQ6A 3ZJTA 3HYCA 3NS7A 5EYPA 1PNRA 2RGNA 4B6JA 3CZ5A 1F06A 1P0QA 4IDBA 2G9QA 5AO9A 3LQYA 1QZUA 1VBMA 2NU6A 1VJDA 1W29A 2RHDA 1Z2PX 4KYTA 5DISB 2PS1A 5EWLA 3WAJA 3VX4A 4LF9B 2JCGA 3COPA 1PFQA 2CWDA 3SKXA 3HVKA 1UR5A 5KX5B 4TMVA 3DONA 3AKCA 2JBAA 3IB6A 1RI4A 1QJ4A 1QLHA 1HYQA 1PZHA 3ZDZB 4XVUA 2ZE8A 3D5EA 4GP6A 2REBA 1THGA 4H7PA 4GPBA 4TLMB 4UVHA 3QU9A 3OIWA 3ILHA 2NU8B 3T9DA 4D98A 1X42A 3PZRA 4UHHA 1R0WA 1TC2A 2IVFA 1II8B 3LGAA 4P6VF 2G8NA 3N2ZB 2AMLA 2NUPB 4HFJA 1VB3A 2DEUA 3ZE6A 3UC9A 5L3QB 3OJLA 1VYVA 4RD6A 3EDYA 4ZWNA 4FHGA 4RVUA 4FZJA 3W6PA 3WWYA 4CDRA 5J4HA 5LU8A 1QRAA 1Z07A 4G07A 1GVHA 2COEA 7MHTA 1XLTC 4HI0E 4PWYA 5D7NA 1OB5A 2XNDD 1CB7A 1MFPA 3BF7A 3PE3A 3ZY4A 2EX4A 3GIWA 4J94A 2YY5A 4MLPA 3HHEA 2VBFA 1GPMA 1ODLA 3A05A 4GICA 4TL7A 1P7PA 2JHGA 1FW6A 4QNMA 4D4IA 2YNMD 2MU1A 1U9IC 1Z6YA 2NZ2A 3GUUA 3S28A 3C6MA 4LRUA 1RJWA 1WDLA 4EB0A 3AR7A 3ZWAA 5CYOA 4MQUA 1SKAA 2CUKA 1YNOA 3KCQA 4DV3B 2W2MA 4JL8A 3WQHA 1ZICA 4WDRA 3QI2A 1R5OA 1FP4A 2ZPAA 3NV7A 1UINA 2H9AA 3HUUA 3LSTA 5FLYA 2VHUA 4RPKA 2YZGA 2GKOA 2ZP1A 3Q9UA 1MJNA 4C4TA 3I05A 4IFTA 2IV2X 1EFPB 2V3WA 1NYLA 1AK2A 1OFUA 2R5FA 3HCOA 3QHPA 3L7LA 1Z4OA 1PSZA 3DW1X 4LX8A 5ALQA 3MQ2A 4BTEA 1KI9A 1YMUA 5T64A 1OGJA 3RIHA 4V02A 3STTA 1JB1A 4KE6A 3HQ4O 2RAFA 3EQ6A 3HH8A 3PQ5A 3UT6A 2NO9A 2ZIZA 5L53A 2GERA 1GNSA 2HU5A 4CEHA 1T4GA 1J2YA 1LNSA 2C4WA 2FMXA 3A2KA 4PBTA 2BEKA 5EZ5A 1DKNA 2CLKB 2HMUA 1W85A 2WVAA 1NP3A 3ANNA 3IO5A 1GRCA 3PNMA 3PXCX 5EJMA 4IRXA 4MI1A 5HHTA 2JGFA 1SVSA 4MV9A 5M5BA 5FAKA 2QMUA 1WVGA 1ZGCA 5IC6A 5ED4A 1NM5C 3IAXA 2WINI 2C96A 1Q17A 3GGDA 3LF1A 3LX5A 2IYYA 2VJMB 4W6QA 4AZTA 5E6RB 5DTJA 1R12A 2J09A 2CT8A 3HKCA 1Q11A 2R7MA 4KSBA 3IAS6 1GPBA 2M1XA 1XEXB 2H7XA 1YQ9A 4B4VA 2ZJ6A 1JEEA 2HRQA 4ZI3A 3TLCA 4DA4A 2XCRB 1O08A 2F1KA 3K0FB 1DFGA 1KZ7B 3KUXA 4PGGA 5KQLA 1TZ2A 1M1NA 1P81A 2IY7A 4Y67A 1T0PA 2IHZA 1O89A 4I1YA 2OWEA 3ZDRA 1NJSA 4RIIA 4D9IA 5AFSA 1UEJA 4HBZA 4Q9JA 1ZDMA 3PPVA 4NFSA 3QHAA 3JYQA 4K6MA 1GZDA 1NAIA 2AXEA 2Q3HA 2YWGA 3K0HA 4M8LA 1QAOA 1LBSA 1RPAA 1G4AE 1NM5A 1QVAA 1RABA 1TK9A 3AKEA 4NMLA 4B4UA 2EBUA 1ZHOA 2XWQA 3DR3A 2PRKA 4QBIA 3BMCB 4OK6A 4XEHA 1FVXA 2C29D 4B1FA 5IT9A 1C3JA 1SCJA 2HU2A 4XR9A 1XDSA 3GEPA 2WD7A 3NIBA 1A77A 1W52X 4OV6B 4KRFA 2ZUFA 1BDIA 3AUAA 3S2IA 3O31A 4V0OA 3KYDB 2LRHA 4RL4A 2B69A 4Z8XA 1AUQA 2WZCA 2UUBB 3L7IA 2PS0A 1NC1A 5IG2A 4N0QA 4IDEA 3K0CA 3EXIA 4RK6A 1Q0QA 2VDVE 4XD7A 2FX5A 3H75A 2DPYA 5FTNA 5H7XA 4LXUA 3L7KA 5FXMA 3TW6A 2PZJA 4C0LA 4UBOA 3EFOA 1NI5A 2Y0EA 3KTAA 3T5DA 1FIUA 2R1VA 2OP1A 3DV9A 4B3RB 1TVMA 3PPYA 1R37A 5I9LA 1LA2A 4IP0A 4HKTA 1DCKA 1MFZA 3QKIA 3WAKA 1JSXA 2D4AA 1VI5A 1PGNA 3NANA 4Y2SA 4AG3A 1IN1A 4PG4A 1SOVA 1DTSA 4GLFA 4Q48A 3B1YA 4GM0A 1CJSA 4BUCA 4JC4A 1DAKA 2Y68A 1GGEA 3RM3A 4KXVA 1OQAA 1HT3A 2C54A 3FGOA 1CY0A 1ESEA 2CHGA 2N46A 1Z29A 4KRXA 3NOVA 4OSEA 1KEKA 3O2QB 1UDCA 3GGGA 5TGTA 1OWPA 2HXSA 4QG7A 3HDYA 1OXBB 4NAVA 3AY7A 4RDXA 1Q1NA 3H6KA 1XZGA 1O95C 2HQ1A 3EPPA 1U2PA 5EHIA 4UOEA 1ZCAA 4G0YA 4LCJA 4GVLA 4UE2A 3HADA 3HK2A 1P60A 1XFDA 5FJIA 3TNLA 3BMCA 3LP6A 1KXZA 5AQ1A 1XJ5A 2JFWA 4O4JA 1FMFA 1YZUA 3UW3A 4ZU3A 4EHFA 5HKOA 2M6SA 2QU7A 3GAFA 1LBHA 4G0QA 4DDUA 2ATCA 3NTRA 4GOLD 3DLPX 2H4JA 2FEOA 2PZFA 1PLJA 4IX9A 3DCYA 2B36A 1EFUA 4L27A 2QRJA 4EI7A 5ERXA 2NGRA 4W6ZA 4MQEB 3O4FA 3UBMA 2PJUA 3LUJA 2DULA 4IVNA 2OLKA 2R1TB 5HF8A 4CLRA 4BC1A 4C9BA 1K7XB 2PVSA 2FUG6 1UMKA 4Q9LA 2QTNA 1GQQA 1RWXA 3QGMA 5BV2P 4I6JA 2WSYB 4E07A 1U80A 2OZKA 2A67A 3V1MA 1UPUA 4D8UA 3SOPA 1WTAA 4EW3A 3SVTA 4F9EA 1N2ZA 4IKPA 1R00A 2XMPA 3H2IA 3HB4X 3NM4A 3EQ8A 2LDXA 5BSTA 1A1VA 2N3ZA 4QEDA 2OCAA 3LTNC 4OATA 2QBYB 4MRPA 4LFCB 3QNUA 4PX5A 1O94D 1AKUA 2Q5HA 4QUDA 4G65A 2O5EA 5CNKA 1OJ7A 2WU3A 4BNIA 3IV9A 3C4VA 2VTEA 4QO7A 4FHCA 4JKOA 4ZVSA 1KKLA 4L4SA 3ZWXA 1D5WA 1GZ6A 5LNK6 1OCEA 2QMOA 3O1HB 3JY6A 1UT6A 5GZ3A 5LP6F 1H1LB 3TI9A 3RRYA 2LUOA 4F7WA 4H6PA 3UPTA 1I3LA 4EYGA 2YYYA 1GITA 3H99A 4FUTA 4FT2A 2QNBA 4RV9A 5SZKB 1O8BA 1CQZA 3CF0A 4EPRA 2JJ1A 4INZA 3VKUA 4DBZA 2J0SA 4HEQA 4BVJA 2IH2A 2HA5A 5C1IA 1R4MA 5AW5A 1NG9A 3LA8A 3KZCA 4LNAA 1JHVA 4HOYA 3H5OA 1WUIS 3DD1A 1UJMA 2ZB8A 1NQOA 2G1PA 2GBFA 2YVQA 4MV4A 5BR8B 7REQB 4KVFA 5KJCA 3ETEA 4ALLA 3PR1A 2VJCA 3HA2A 1U7TA 3WHLA 2QM7A 3SWWA 3PQ6A 1LPMA 3JZFA 3JD0A 5AJTA 3TQHA 4IHAA 1ZNXA 3E3LA 3VV2A 4ENQA 1RP1A 3U3ZA 4MVCA 4BMCA 1OFGA 5LQJA 2C8JA 1U28C 4PEVA 2IHJA 3D7SA 1V1RB 2VI5A 3ME5A 1KOLA 2PX0A 1NMQA 5DHQA 4QJ3A 3OY2A 4IEIA 4GH5A 4M54A 2GEFA 1ZRMA 2B20A 3KX2A 4JA0A 1DC4A 5LOVA 3T7RA 3NBYC 3REQB 2W5UA 4UEWA 3ZY3A 3WQQA 2VTVA 3B13B 3LQ2A 2NXNA 1EVEA 3E0QA 2VKQA 3G88A 3K0BA 4JJEA 4P5EA 4KVZA 2O7NA 1RBYA 3DL7A 1O4WA 3VR5A 1SBIA 2QIPA 4W7SA 4R1SA 2Q49A 1CUXA 1EXMA 1WXHA 4DCOA 3HBFA 1YTUA 3VMFA 4HNVA 1VKOA 5ALKA 5KTTA 3H2JA 1YONA 3FDZB 3I53A 3ZE2B 1OF1A 3C7DB 3BD9A 4JBGA 5JSZA 1PWYE 2ESRA 3R20A 1WZIA 5GVRA 1KFKB 3VBEA 4TLBA 1H42A 1CDOA 2V6GA 4B34A 1JTEA 1U9CA 1H6DA 1WOMA 3C24A 5LUAA 3D81A 1TYCA 2JBAB 1SVMA 5JS6A 1NW4A 5F21A 4REMA 4RV5A 5TQ2A 3GJ8A 4Q4JA 4N47A 3UJAA 4DMKA 3W5CA 4MDHA 4TXLA 1M6EX 1G8SA 1NXXA 2PT6A 1NOIA 1ZW1A 1Y8RB 2XYPA 4IG9A 4Y2PA 4KZPA 2XAAA 5HIJA 3HN6A 5CVTA 4LJ5A 2B4AA 1YE3A 4TMWA 2IBMA 2CL7X 3MOGA 4MB0A 3M2PA 2C2XA 2XAUA 2D8MA 4TRRA 4XPIA 3VR3A 4EIWA 4QFMA 2BGGA 3SIRA 2HYIC 4FIDA 3UWDA 3HVUA 1JALA 2QDKA 4WNIA 1DBVO 2OOSA 2XYHA 3L1KA 2JZNA 4L7QA 4PPQA 2E4VA 4QT0A 5E0KB 1CY2A 1TQHA 2ERCA 1V35A 3JQ9A 2Q2OA 1GRVA 3GMDA 3AFGA 1XXHA 2H0QA 3KUKA 3L7CA 4IMIB 4CCYA 1K8XB 3C8ZA 1TLLA 3ECAA 2YBDA 5GONA 3MRTA 4NLLA 4R4JA 2CE7A 4A0RA 3GV0A 2XUGA 1II9A 1Z7BA 3F6RA 4BWVA 4J3FA 1QTQA 4KN5A 1KI1A 2GZ2A 4XLLA 1KQ3A 3E82A 2QX6A 1CYDA 3VZPA 1ZOOA 3R3HA 4LPKA 3RK1A 2W6QA 4A2QA 3COYA 3IAHA 1DQSA 5TLSA 5K7SA 3MMSA 1Y7HA 4I0WB 3E4DA 4JIMA 2I8AA 1NC3A 3NH9A 2QLNA 2VPXA 1QOZA 2IZOA 3FLAA 5GOTA 4G2TA 1QV9A 1VC2A 4LV5B 3WYNA 4DDKA 4LKOA 4DPKA 1JHDA 4EA8A 1O94C 2O8EB 4EDHA 4BGDA 2PUJA 1GPLA 1VKNA 1D0SA 1TJ3A 1UP6A 3BSYA 2PU7A 5DNAA 5H83A 5HUQA 1ICEA 2OILA 3IUPA 5TF0A 3MJRA 2EV9A 3CR7A 3U4MA 4CW7A 2CF5A 1EK6A 3GG9A 4U00A 4ZCRA 4MVWA 4F85A 3KEMA 2W71A 5ILGA 2OMEA 1YSCA 3ZZ0A 2EL7A 4HWRA 5JAOA 1E2GA 1FX0B 1M0TA 2BHTA 3HV2A 5DT9A 1RACA 1AKQA 4PPGA 3UENA 4LY3A 5HZMA 3QKSA 4FBMA 1XYYA 4CKBA 2Z2YA 5ALNA 1BMQA 1G3UA 2OOKA 4L9RA 5LWHA 4QOIA 1PQWA 1NWHA 1RC0A 4IUBS 1X2EA 3ZUPA 2EZ8A 3O21A 3B3QA 3E2IA 1E3WA 2AOXA 4YJ2B 2NVBA 3L1VA 4LXXA 4PTZA 4HNHA 3GUCA 1SC6A 2QT1A 2BHLA 3ONDA 1QQAA 4E7PA 4AJ4A 4LSWA 4DREA 4M0DA 1W4CA 4BNVA 1X1QA 4KHZA 4NH0A 5KTOA 3EXG1 3JXEA 4JZYA 3GAMA 2I22A 4WMLA 2QN2A 3JQGA 4QDOA 2QTGA 4OXYA 4NMHA 3DKIA 2P5UA 1XF1A 3C3AA 1GUAA 3E9YA 3I23A 4RYDA 2Y2UA 3TI7A 1JYSA 2FU5C 2J07A 2WSSD 1RPZA 3DSRA 3LUPA 1NBME 5DYYA 3GZNB 4G4SO 1FQJA 4WBNB 4ND8B 2VJNA 5EE0A 2R6CA 3TZCA 2VHZA 2P2ZA 3EQ7A 1XCPA 2DKFA 5T3YA 1N6KA 3B36A 3KAKA 3SEAA 4QRIA 4TM8A 3SR4A 3TJMA 5CT6A 3WIDA 2P78A 1XB2A 3MEQA 2VP9A 1E77A 3N0WA 4TXMA 5EKTA 1ELOA 3HVIA 3GVHA 3K4HA 4BNYA 4HPWA 1ONOA 3AOEA 4GECA 4PZYA 3TRKA 2B25A 4V3CA 2BBWA 2G72A 5DB4A 3PXGA 1C4WA 3BRQA 3ELWA 3EW9A 5EE9A 4TS9A 3EVGA 1FPMA 1G8JA 1ORDA 3KYIB 4DIMA 1EWQA 3G0OA 2LXNA 4G41A 1PWXA 2I9PA 3EGWA 2ZWVA 3ZS8A 5JAZA 3CXUA 4ZO9A 4RD2A 4RZ2A 5AI6A 2ZS7A 3QYJA 4X41A 2H8KA 3VR1A 4EYSA 3E53A 3GVPA 2I67A 2PH1A 2J7PD 1D8AA 2OUIA 3PIIA 4MQFA 3ZZTA 4ZYTA 2IU4A 3VR0A 1BA3A 1YKFA 4C5AA 2OD7A 3VHXB 3DLCA 3TOSA 1CFZA 1KMHA 3EIEA 1E4OA 4KXXA 5G0WA 4GD3Q 4ICIA 4F4UA 5JYCA 4DMCA 2E2WA 1MGPA 2V7EA 3EIHA 2FSFA 2PX3A 4XIGS 5JLJA 1U9JA 4PRLA 2JLZA 3FVWA 3WRXC 3SFZA 1F60A 4MDEA 4ZI7A 4N3CA 1V9SA 3HP7A 4P7BA 2VYVA 2G40A 2IBSA 3VC2A 3KQKA 4W9MC 1F7UA 3PLAE 3I6IA 3ICWA 5TMDA 4TLEA 1W1WA 2B61A 4FNOA 3ZWNA 2PUFA 4C2AA 4NBKA 2BCEA 2VK2A 4MS4B 4C0SA 1ISPA 1CHDA 3GRPA 3LUBA 1MOSA 1ID1A 1TT5B 2HB6A 4QTYA 3FFAA 4R8SA 3ORQA 2QGNA 1NMEA 1I5EA 3E2MA 3L1UA 4IS3A 2D2EA 4MJLA 1PNOA 1V5WA 3HSYA 5JS2A 2Q5CA 4I50B 2DTDA 3WLQA 2ZUDA 1DJLA 2AKYA 1W44A 4KQCA 5BOSA 2O8CB 3HCPA 4M0CA 3W0LB 4IJUA 1D2RA 3X1XA 1R7RA 1H2ZA 1U2SA 1KMMA 3EZNA 5EXPA 4F2HA 3VISA 3VSDA 4OFWA 1CUHA 8GPBA 1XRLA 2VZLA 1A3CA 3DEFA 3D3KA 3SJUA 2MR6A 2B1GA 3VU0A 4OVKA 4YMVA 3S8MA 4P7KA 4V1CB 1KQFA 1CQJB 2Y3IA 2O8NA 4GP7A 3LT2A 2FUNB 3OBBA 2EYUA 3DHNA 3LTEA 4EPTA 5KHLB 1CJKC 3ONNA 2DUJA 2QDXA 3K9FC 1Y8QB 1JP7A 1Y0BA 4NZPA 4BIMA 1OB2A 2PVCA 1YZ3A 4IILA 4ZAYA 4GPTA 1QGZA 3ZTTA 3MWLA 3VU3A 1AG9A 1AS0A 1XZMA 2DHEA 1XVTA 2OM6A 3PKIA 1WUYA 1V2HE 3RKUA 3ZQ6A 2WJHA 1XMJA 3GT7A 3IULA 4W1QA 2YQZA 3AONB 3CZ4A 2QUZA 1GUDA 1P80A 3IUEA 2EZ4A 4EUFA 2IE0A 1NXVA 3UK0A 4CQJA 2XT0A 4N3BA 3ZV4A 3TKAA 3AI3A 1QFSA 3KL2A 5LYJB 2GZDA 4RFVA 3CX8A 4K87A 3PZBA 3C1TA 2R11A 3VH3A 3WIVA 4J75A 3N8IA 1TUIA 5E2AA 1EJBA 4XCVA 5H9VA 4DPMA 4FIZA 1NPYA 3NETA 3U4IA 4ROTA 3I64A 3N2KB 5TS3A 4WECA 4UMDA 2VT2A 1H4SA 2X4LA 4YYEA 4LK2A 5G0TA 1GL9B 2F3TA 1PDVA 2PPVA 2AC2A 2WYHA 2XZOA 1DDGA 4OTZA 3G2JA 4TGLA 1OXVA 3C4JA 3V00A 1H4VB 3IA2A 2AFHE 1LC0A 1ND6A 3EEYA 4ZEOA 3WGJA 1T5LA 1SG6A 4XOUA 4OQPA 1A9PA 1X7XB 2JI6A 1LNZA 4HZUB 4Q5IA 2B4QA 3DQQA 5ELLA 1YJAA 1IXZA 2PRSA 3LHKA 4JKYA 1RLMA 1JG2A 2R4UA 1Z0JA 2JRLA 3A6JA 4DLTA 3MVEA 4YRNA 3D5TA 4P7GA 5I5EA 5KYTA 4A6XA 1U90A 4TT3A 1LDGA 2VP0A 2W83A 3OO1A 4GXTA 3VYTB 1H9CA 3GMIA 1L5HA 1YNSA 3CZAA 3DE3X 2NO6A 3HWWA 3OFNA 3TQSA 2VP6A 1XLWA 3D3WB 2HDOA 1T5DX 4G5GA 1ZP6A 1KSFX 3SQWA 4CMJA 4F86A 1XTPA 2PRYA 4B71A 1FRFS 3B6JA 2A58A 1AQ6A 1C4OA 3RC3A 2QKYA 2DH6A 3QY9A 1RM5A 1Z75A 1L5WA 3JALB 4JLVA 2ZRQA 3TAUA 2I4LA 4Q12A 1PL8A 4AJEA 5A6SA 3F5QA 1UBGA 3TW4A 5ITZB 4RTJA 2HHJA 2H3EA 2SNIE 2I78A 3DOFA 4O2BB 4AJ1A 2J6HA 4M1MA 3L4KA 4DKJA 3G9XA 3FPKA 1RADA 1UF9A 1YFKA 3RVDA 1X7WA 5HQ3A 3WGIA 1Z08A 1PV4A 1NMSA 1RFGE 4PHGA 1I6KA 2D8AA 1X0VA 3R3WA 2W2QA 1E1CB 1QS0A 2HYDA 2Q41A 4P3OA 4UM5A 5DHSA 4ZD6A 4NJOA 3R3YA 3D0RA 4P0TA 4Y9UA 1P1RA 1G64A 4AU1A 3BH7A 4LJSA 5CVDA 3U1TA 3S2GA 3PX7A 1YGPA 2Q4OA 4XX0A 3QPBA 1UMCB 2VSNA 3AJ9A 2GYWA 3DZ8A 5DGXA 1RPJA 3D8BA 4WKPA 2E5LB 1L8OA 4AFNA 1DKQA 2H5JA 2XE8A 3LCVB 2ECQA 3FJOA 4C4AA 5HJEA 3T3PB 3TIFA 2I62A 4RDHA 1OBVA 2VJLA 5DRYA 3EC2A 4IFEA 3R9WA 4DV0B 3R3ZA 3DJFA 4Y2VA 2B1IA 3AV0B 4YRBA 1ECBA 1KYIA 3DL0A 5IBPA 4C0AC 1AK9A 1K6MA 3RNLA 3OCZA 2CXSA 4GXRA 2AI3A 4CT4B 2ZE6A 4K9LA 3ACBA 3BWXA 3T9AA 1XVVA 1POXA 4IRUB 4IJKA 4YJHA 4A0FA 2CNNA 1BE8A 1OAKA 2NZJA 5D5HA 3ZCQA 5CEJA 3P2IA 4N5IX 3WLNA 4CM9A 4JT8A 1XD2B 3LY7A 1IL0A 4IFBA 3UXHA 1JPVA 4PYQA 3VKHA 2O4CA 4MRMB 1E8NA 1GARA 3RKSA 4UUAA 4FFNA 5T3UA 3SJ7A 1ISMA 1E3IA 4BVBA 2WLSA 1B26A 421PA 3FCOA 3ZHOA 1Z16A 3N2YA 3O3MB 4OU4A 4OHWA 2C2GA 1ZA2A 3A6ZA 1A5SB 3LDFA 3ZLVA 2PJRA 1E6UA 3K1ZA 3FI0A 4N5LA 2QL5A 4Q7QA 5EJAA 3COZA 4Z0NA 3O6VA 1TTTA 2XGSA 1C30A 4O0MA 2QRMA 4KUGA 1SD1A 1U11A 1I4TD 2WWRA 3QPUA 5CX1A 1XMIA 4Y2QA 1FQWA 3DOEA 4JJ6A 4P93A 5JECA 4D0SA 2X76A 2XUKA 3M1LA 4UULA 1MQ8B 4IL5A 4YRJA 4J0KA 5EP3A 3UCXA 2OECA 2PGXA 1EAMA 2E4ZA 2GPWA 4HQ0A 4QBFA 4XE5A 4AUNA 3CCCA 3EQ2A 2HM7A 1USGA 5BN1A 5KWIA 1SC4A 3OQIA 5G40A 3F6PA 4Q7JB 1DTWB 2NM0A 3BTOA 2BKXA 4MR7B 5FYDA 3RFTA 3S44A 5K8CA 3VR4A 1UAYA 1ZVQA 2XQGA 3ONEA 3KHSA 3UK1A 4X5OA 4EPWA 1OD6A 1S2DA 2PSDA 2QXUA 1WABA 1GFZA 2B2NA 3MWJA 4KK3A 3WYGA 4K26A 1MEJA 1Z26A 4KLNA 4CR7A 1E1YA 1HLFA 1JIXA 2OHVA 4CM6A 1ECJA 4ARSA 3PA8A 2ZT8A 3EYAA 5P21A 4RM3A 2OG2A 1R74A 3HDVA 3SVZA 1VIDA 5IT4A 4JP1A 1Z0UA 3ADPA 1Y3HA 3QOYA 1RLIA 2YJ3A 3QXJA 4Q02A 5DSXA 3TVYA 4AJNA 2XXAB 2O20A 3R3UA 3KQYA 4G63A 4MWOA 4B83A 4CF3A 1UWVA 4C87A 3QUAA 2RHHA 3BPSA 5C37A 3UQYS 3ZWQA 3NDIA 3CT4A 3AEKB 4HAIA 1NSTA 5EI5A 1PYGA 1ZH2A 2NAFA 4NIMA 2IELA 1HH4A 5DI3B 4IVQA 4R1PA 1LFDB 4EJMA 2ATXA 3FCUB 4BFVA 3MB5A 4AY6A 4MA5A 4ZYWA 1G18A 4NCKA 1S8FA 3ORHA 4BLWA 3ZCPA 2Y1XA 1G20A 2BGMA 3D64A 4M37A 1VXRA 4HDKA 5I8PA 4R40A 4U9UA 3V8VA 5BURA 3IKJA 1ZUD1 1VOTA 3IMKA 4W9NA 5FPTA 3TRJA 5ES4B 5M29A 1BXRA 3ABQB 4BN4A 1HEYA 4E94A 1KH1A 1VJRA 3M5PA 2NO0A 4IV5A 4TL6A 4IIGA 3VHRA 4Q7EA 1W5AA 3MT9A 4Q1FA 4W5OA 3CTPA 4HR7A 2OCPA 1YCGA 1CUAA 4HS9A 4DUGA 1YT5A 4IDHA 5D00A 3PX3A 1X15A 3H5RA 3W8FA 3KJFA 1J2TA 3AZOA 2J31A 2VDMB 5GINE 1EK1A 1L3BA 3I3SR 3UK2A 1MG5A 3KTOA 4I14A 4KU4A 1EFVA 5BW8A 1D6SA 4OQFA 3T9BA 1Q0TA 5JHGB 2W48A 4YJ3F 1JHXA 4BBAA 2EJCA 1A82A 1RCFA 4TXNA 1MV8A 3H11B 3NNNA 3SS7X 1FRQA 2QTFA 1Z37A 2EF0A 3JATB 2GS9A 1RPNA 2JEYA 1I7SB 2AVNA 5EMKA 4H0CA 1R0YA 2GOYA 4IQ0A 1QLJA 2EQBA 1EK5A 4R84A 1D4OA 3TSYA 3IKMB 4X62B 4YMTA 4KR7A 2G08A 1G3MA 2CCGA 3I5XA 4BB5A 4QLBA 4TZ0A 5C8XA 1NDQA 1QDEA 3C1OA 5T6MA 1N5JA 3Q40A 4QUIA 3RSHA 3TVDA 4LZPA 1JG6A 2HMYB 3W9SA 1KOJA 2J3MA 1SBYA 1WKBA 4K1XA 1SKYB 4CQLA 1RKVA 2ZSIA 2WE8A 1TTHA 4TMXA 1V3QE 2X8JA 2IDKA 1VZ2A 1UBTS 3MB8A 4OLFA 1KDPA 4XWWA 3C6YA 4YRTA 1SG0A 1TYZA 3EGOA 1HMYA 2HHCA 3I9OA 5BUCA 2PKWA 4JI5B 4FMPA 3NBQA 5AKZA 3R1IA 5C1PA 4HWSA 3CX4A 3EXG2 3FA2A 4KKVA 4WKCA 2PPLA 3TE7A 4JXJA 5AOBA 4YUXA 1T9BA 4WK6A 3AHEA 3NNSA 3JAMA 4BZXA 1L7BA 1UFOA 3PJEA 1TYBE 3U81A 1Y82A 3BL6A 3CGWA 4RS4A 3P5BA 2YWRA 3R4CA 4ZCLA 4BVAA 4D9KA 4FB4A 4YQFA 1QCZA 3QKUA 2XMSA 5FPPA 2E82A 5IMBA 3IPXA 4GR4A 3CNEA 3E0XA 2BUAA 1WUJS 4MYCA 5JXHA 3TW8B 4E03A 2H65A 3ON5A 2PFGA 5BNZA 1BAPA 4XM1A 2PGNA 2VRWA 2H7CA 1Z5GA 5SZJA 3HE3A 3ROFA 2JANA 3HKBA 3Q2IA 3QUSA 4PSCA 5ITVA 4LF6B 1E20A 1F12A 1TUGA 4NV1A 4GAEA 4YCAA 5DLQC 1GTSA 4YCJA 2I3ZA 1DI0A 5CFOA 2IU6A 3R6WA 4F3CA 1ZNZA 3AVVA 3D3JA 5AXCA 3NALA 2XVXA 1QYXA 1ZISA 4EFMA 4BFLA 1VYTA 2WQZA 4BQEA 5LA6F 3GEGA 3T4XA 1UWLA 3ICCA 4I6EA 4F92B 4DBLC 4YCLA 4D1YA 2FDCA 4DMUB 4EG0A 2XTZA 5KQMA 2HEIA 1IZ8A 2CVOA 2ET6A 2H1LA 1R9MA 3CIFA 3N7TA 4TS1A 1XRPA 1P4SA 3TR6A 2FX2A 4XJXA 4Z0PA 5JNSA 2AHOA 2JEOA 3NUQA 3OLZA 3TQFA 2ODBA 2WU8A 3NVKI 3V7FA 2F3UA 2AH5A 1VECA 4RHUA 4E14A 1Z9BA 1DX6A 1U3WA 3G6KA 3MS7A 4G5XA 4TN1A 1SOWA 1PHPA 2VYND 3NTXA 1OXTA 3BJEA 2P9TA 3PJGA 4D3YA 2VAVA 4ZIRB 3UW1A 2BMWA 3WLAA 1W34A 4HUQB 2DFLA 1J70A 4WZAB 2J9YB 1GWNA 2JDID 2VNSA 1J2EA 2YHSA 4DIBA 2A9KA 2VQ3A 2NQ8A 2XT6A 2H07A 5JOQA 4XARA 3AY6A 1YZGA 3GRAA 3JQQA 3NBFA 2G1JA 1ZCJA 2XW6A 2L42A 5LLDA 2QYOA 4NQZA 5A0TA 3PA6A 3U0BA 1J8MF 3K9BA 5JWHA 2IVZA 2PXXA 3VNSA 2OO7A 2PS3A 1F2TA 2E89A 3DDOA 4N7MA 3L18A 2ZYIA 1R0RE 3NJRA 4MVJM 1G38A 4CIDA 4INPA 4ZEMA 3BZUA 1DPFA 2G1UA 3CEMA 3UKDA 4NATA 1B6GA 4X1IA 5CLIA 1DBPA 1RXUA 1CHNA 3KLPX 4BFUA 5LXTA 3E18A 1CEEA 3FCEA 2I6FA 1CZUA 1LV8A 3ENZA 5J5AA 4E2ZA 1JA0A 1EVKA 4EFLA 3TBHA 1Q21A 4P3XA 2PSEA 1RZUA 1JR2A 1YUNA 3BMNA 3URMA 2X22A 2WJ4A 4YMUA 2DT5A 3DDCA 3Q10A 4ZICA 5FH9A 1E0DA 2GRUA 1JQDA 3N2GB 1ADJA 3U4HA 1BVHA 3KZKA 3UJHA 3K0CC 1WQ1R 2ZIWB 4J8PA 1X9HA 4COKA 4DA7A 1EG7A 3F5DA 1WPQA 2A0KA 3JWIA 3ZNOA 4DMMA 5A3QA 3AYXB 5ALTA 5B2EA 1JLRA 3AWDA 5BR4A 1TF7A 4MMYB 5ARDA 3LVBA 5L95A 2OBBA 4ENTA 3GLHA 3WTCA 1KKMA 2G17A 3NTVA 3VA7A 2JAOA 4UHEA 2IHUA 3IDOA 3ZDQA 2AOVA 1U3FA 3AM3A 1F1JA 1WHTB 3UYLA 3IC5A 4MWEA 4MUNA 1B0UA 2CYBA 3NHPA 3EXHC 4JEHA 1XEFA 2QP4A 1JI0A 1V8DA 3DP7A 4DWOA 2Z3WA 3H5VA 4FN4A 1SU4A 2OG1A 1NXQA 4CETA 3F96A 3GCZA 1YO6A 3ND9A 1Z6GA 4ZVVA 1YULA 3DOOA 3P9IA 2BGLA 5JAUA 3WISA 4A6PA 2XODA 3EAGA 2E1PA 1NBHA 3G13A 4IHJF 3USCS 1U7WA 2VDLB 1MQ9A 2XCLA 3Q85A 1BOOA 1YJCA 4CLOA 3N9IA 1BCSB 2WBLC 5AJWA 2XNJA 4QUGA 4IDOA 3UV3A 3SQLA 4JGIA 1LW7A 3GY0A 3B78A 1FYWA 1TMYA 2JD0A 1NJ8A 3A1SA 3PQ4A 3FDJA 4J7CA 2Z83A 1YJ8A 1GTZA 1J97A 1QQ5A 3Q88A 4KR0A 4WEQA 3ZY2A 2M6LA 5C8DA 1Z2EA 3WGYA 1U2QA 2FPOA 3RFXA 4F3TA 4N8EA 2BP7B 3COSA 3E9RA 2YWFA 4HGYA 3OX1A 3LPCA 3C5VA 4D3DA 2XCQA 4D4HA 1JR4A 4D4KA 4DN6A 4RMHA 8ADHA 4EQZA 2HCBA 2VQEB 1UKVY 2YIVX 5CPFA 2GILA 2D2VA 2IW1A 4KMMA 3VDMA 1TJ4A 2QW0X 2Q46A 3TG2A 1RNLA 1MC1A 1JW9B 2CLLB 3KSRA 4GR5A 5I8ZA 3TCKA 1FXSA 5F5NA 5E95A 9MHTA 4V38A 3DV0A 1IE3A 1VLHA 2A1UB 2KBFA 3PC8A 3BEDA 2IRWA 4DV4B 3IMCA 2WAXA 3A8TA 4D99A 5JSUA 1Z2NX 4ZI2A 3QVSA 4K9DA 4EUSA 1LQ2A 1T9ZA 3I62A 4MVJH 3HB9A 3GT4A 4JXXA 1P9RA 3CZPA 4H7DA 2OHJA 4PINA 4WERA 5I7EA 1P6UA 1FVOA 2CWWA 2Y71A 3IA7A 4O1IA 2MWMA 4HVLA 3W5BA 2UYCA 3S2FA 3P9YA 4ADSG 5CDTA 1KR2A 5AKLA 1MN6A 2UYHA 2O8DB 1O87A 1OX4B 3KKMA 4OHBA 1T9DA 1MTZA 4BU1A 1SEVA 1Z5VA 4EB6A 2YIDA 1M74A 1Y4SA 1S01A 3ZU4A 2BRUA 4FR0A 1TM1E 1ZH0A 4ABTA 3AILA 2V58A 3EA0A 2AG8A 1JZQA 1AURA 2Q1SA 2R6AA 4NFHA 1CVLA 1WBBA 1U0OC 4OK3A 1AMOA 1G7RA 1X7GA 1Y1PA 2B3TA 4FCVA 5IJXA 2D1YA 3PCTA 1P3JA 3BXEA 4RPLA 3Q6NA 3V42A 1U3CA 1NUAA 2YJNA 2RB4A 3KQWA 3PFNA 2FMTA 1UM9B 1OI4A 3QVTA 3SXUB 1LPBB 1U7HA 3P2MA 4DIOA 4LJRA 2PZAA 2WILA 3HO8A 2XNDA 4NBUA 3ZVRA 3L05A 2WHYA 3EXEB 5CK5A 1W9HA 2IEYA 5CXXA 1U8CB 1VG9B 2MMCA 4I3GA 3TK1A 2ZE5A 1OILA 1U28A 1OPXA 2R1UA 1G8HA 1TQ6A 1Z62A 3KTDA 3PUXA 4DE5A 1R6VA 2FAXA 2YWEA 4WCDA 4Y2GA 2O54A 3ESDA 3ELBA 4F4CA 4K7JA 1A96A 1SZJG 4AO6A 1IB6A 1NX6A 1SU8A 4LZAA 1LX7A 5CIWA 5C8YB 3IE1A 5JRDS 4LF4B 1QF6A 1IY0A 3MWGA 2CVQA 4JJKA 2H8GA 2PGIA 1HFKA 4K9OA 2Z1MA 3PL1A 5DW0A 4DC9A 3OU6A 1Q0SA 5DXFA 4NYIR 3N2NA 3VC3A 2C7QA 2HPHA 5C0OE 3UXMA 2Z9CA 1IWOA 2BMDA 3ABIA 4ZYVA 4MWSA 1E3DA 1EK0A 2FF5A 1LPNA 2ZR7A 2B8WA 3EFBA 3VAAA 1XQXA 3GRUA 3AXSA 3ROMA 1XTZA 5CB4B 1C3XA 3G0GA 1K3TA 4ZK2A 1B2LA 2ON6A 4B3MB 3ZDXB 3GT3A 1MNAA 4WCFC 4AXXA 1H8HA 3QPWA 1KPIA 5LBIA 3E7FA 5H9WA 3S27A 2IOFA 1ADFA 2QZ9A 1P18A 1MDFA 3LG2A 4PFJA 1M3SA 4A16A 3FWHA 2P0AA 1SUPA 1IJKA 3PDIA 3FGPA 4KQ9A 4UJ5A 4ZDWA 4RORA 3RRJA 1U65A 5KYYA 3BZWA 2G06A 3DF9A 3WGTA 3T3IA 2AN5A 5C32A 2XUOA 3HEBA 1UDBA 3VUFA 5DHTA 2FMIA 1ZL0A 4ZQGA 1WCXA 2K4MA 3KOYA 4CQMD 4WXYB 1KJQA 3IIMA 2YINC 1FU8A 4NV3A 4BNZA 1YVPA 2FR8A 3HYLA 4CXMA 3E5HA 2VXBA 3K16A 1DS6A 4JQYA 1N57A 4OP2A 4BWGA 2ODQA 3CVWA 4Q82A 3KXDA 1P75A 2BELA 3O8DA 3VC1A 3CU5A 1VL1A 3ABOB 3WKBA 4OQEA 3D7KA 1N6HA 2CNLA 3EXEA 2PZ8A 2Q5IA 1FS6A 1EFKA 2X6QA 1A7UA 1LVHA 2QVXX 3F4BA 3QEOA 3KS9