4HP8A

Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound nadp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
245
structure length
245
Chain Sequence
NPFSLEGRKALVTGANTGLGQAIAVGLAAAGAEVVCAARRAPDETLDIIAKDGGNASALLIDFADPLAAKDSFTDAGFDILVNNAGIIRRADSVEFSELDWDEVMDVNLKALFFTTQAFAKELLAKGRSGKVVNIASLLSFQGGIRVPSYTAAKHGVAGLTKLLANEWAAKGINVNAIAPGYIETNNTEALRADAARNKAILERIPAGRWGHSEDIAGAAVFLSSAAADYVHGAILNVDGGWLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from Agrobacterium Tumefaciens (target EFI-506435) with bound NADP
rcsb
source organism Agrobacterium tumefaciens
molecule tags Oxidoreductase
total genus 95
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hp8A00
3FNGA 4IGEA 3QVOA 1GQQA 1ZH8A 3JTMA 2E82A 5G0WA 3PVZA 4WCDA 3QVXA 1YDEA 4E32A 5ICSA 1NQAO 1P74A 1DDOA 5KTKA 4FOOA 4YAIA 5TF4A 4IPTA 1Y8RA 2DKNA 3EZYA 3N7UA 4KP7A 4AJHA 4NHEA 5JW6A 5ITVA 2FR8A 4XGNA 2B5VA 5T8KC 1P1FA 1UDCA 2WD7A 1RYDA 1OI7A 3PGJA 4KDEA 1JW9B 3DHYA 3H5RA 5TC4A 3G79A 4XIJA 5CHEA 3VTZA 1E1KA 3WIEA 3VPXA 2O7QA 2IEBA 3UVEA 5A04A 3GVXA 4JN6B 4ZRNA 3F4BA 3E9MA 4RF3A 4EJ6A 4BO5A 1N7GA 4YQYA 4A5OA 1E6WA 3NT4A 5BSHA 3AOGA 4E31A 3M2TA 4YDRA 3OA2A 1LEHA 2VN8A 2EEZA 5BNFA 4Q39A 3RUDA 1BGVA 2UUOA 5K6AC 4P8RA 3WNVA 3GN1A 5DBGA 3MZ0A 1NXQA 3TPCA 1LLDA 5JFOA 2EGHA 4WLVA 5U9CA 3WGIA 4RPLA 2AE2A 5L4SA 4NNJA 5L51A 2HMWA 2CY0A 3V1UA 1A27A 1PX0A 2O7SA 1UDBA 4N18A 4LRTB 4RORA 3FPLA 4YEDA 3RWBA 1P0FA 4AJNA 4W6ZA 4EEZA 3BMNA 4PRLA 4CQLA 5I8ZA 1KEWA 3ICCA 1QYDA 2D8AA 5ICMA 3O38A 1B16A 1Q0HA 2VWPA 2GPTA 1JWBB 4JBHA 4GX5A 2DLDA 1E3WB 1UZLA 1J49A 2ZYGA 1M6WA 2B69A 1CF2O 1DC6A 1OBFO 3IOYA 1MC4A 2AMFA 2XXJA 3K73O 2JCVA 3PQFA 1I01A 2JKVA 1YVEI 1QYXA 4BNUA 4XJSA 1YBAA 1EVIA 2C29D 3K92A 1MG0A 2VWGA 3EK2A 5JC1A 1NAHA 3EMKA 5J23A 3RC2A 1IB6A 4FDAA 3A28A 2QRKA 4DRYA 3DZHA 5ER9A 2C82A 3NUGA 3OJEA 4FOSA 5FF9A 5A4DA 4RLSA 2O48X 2PH3A 1ZEJA 4HV4A 5IXSA 5G2OA 2Y1EA 4RZIA 1NFFA 2C07A 2O3UA 1H2HA 2NU6A 4Y98A 2W8ZA 1HLPA 4FCCA 4IDGA 1CIVA 3FTNA 3NV9A 4A7PA 3JCZA 1LDEA 1XQ6A 1ZVMA 2QX7A 4GBJA 1XQ1A 4A26A 3OBBA 3PQEA 4J0FA 2JHGA 1M76A 3E03A 3ZWOA 4B4UA 4BKQA 5EJ2A 1PIWA 3ZV3A 3DBHA 4HADA 1T24A 4E0BA 1B14A 8LDHA 3GOHA 3TQHA 5JCJD 1H9BA 3FNEA 3DBLB 3ABIA 3GZNB 4R41A 1Y81A 2NU9A 1KS9A 2R00C 4JCOA 3V2UA 4RV9A 1NBOA 3Q0EA 1PTJA 4BMVA 1WXDA 5DDIP 4E2WA 4OM8A 4Y8VA 3ZCXA 5CDUA 2BF7A 5FFFA 2YUTA 1PZHA 4DIBA 2Q2WA 2J3KA 3OIDA 3L4BC 1DOHA 2XOXA 3EVTA 3LU1A 1M6HA 3RROA 2I9PA 4BNIA 4XQEA 4TQGA 5MGBA 3UAGA 2CD9A 3FF4A 1KC1A 3I83A 3PYMA 1E3EA 1ADFA 3RBVA 2YW9A 2AHRA 3EVNA 3RVDA 3EUWA 3NTOA 2QQ5A 1GFSA 1XA0A 4CLDA 1ZW1A 3JSAA 3VPSA 3U0BA 2CZCA 5IDYA 3VH1A 2VZ9A 2NSDA 1H94A 1HSZA 3WFJA 3LC7O 3ETGA 3L0DA 5KJ1A 1SNYA 4OQYA 1S7CA 4LCEA 1XHLA 2QIOA 4J0EA 1EUCA 4O63O 4E5NA 4EGFA 4J43A 1VJ1A 2HMTA 3RJ9A 4N5LA 3P7MA 1I32A 4I8XA 4WCFA 1P9LA 4N5NA 1X0XA 4QEDA 1NVTA 5CG1A 4RVDA 3FI9A 1DEHA 4DGSA 5IZ4A 4M49A 4XCVA 2D3TA 1KEUA 2X6TA 3S2IA 3ZHXA 2V6GA 2BFAA 5F21A 3I9NA 3PHGA 3WGYA 1E3LA 1BXGB 1HEUA 2ZKLA 1NM5A 4RLHA 1JKIA 2IZZA 2Y67A 3NDIA 5F5LA 1TXGA 2FZEA 4FPXA 1F8GA 2C5EA 5THQA 1L7EA 3G1UA 1CRWG 4RDHA 2J5KA 4G2NA 4TRMA 5ILGA 3GDOA 4A27A 3UGKA 2Q45A 3Q2IA 1I24A 2HK9A 2VRCD 4GMFA 1DLJA 4XB1A 2W2LD 3W4IA 3OETA 4NI5A 4PRKA 4CPDA 3U49A 3IDSA 4FN4A 2EXXA 2VUTA 3RUIA 3V2GA 2ZYDA 3GG9A 1NQTA 1EDOA 1IUKA 3PXXA 1QXSA 4Z3DA 4Q3BA 3JQFA 1ONOA 2OOSA 1N9GA 1PWZA 1VKOA 2SCUA 3E18A 1LC0A 4RL6A 2Q49A 2RCYA 2O3QA 4FFNA 4QSMA 3NDRA 1HE2A 3NJ4A 4W82A 4E30A 4C7JA 5L53A 1EMDA 3VPFA 5A03A 1HDRA 1XGKA 4MP3A 4QX6A 4CMBA 1YQGA 1GZ6A 3K31A 4ZRMA 1CYDA 4BO6A 5IAAA 4FB5A 2JD0A 3AK4A 1RKXA 1GZ4A 2AXQA 4WUVA 3TJRA 4LN1A 2TMDA 5H83A 4BS9A 4E13A 4XQ9A 4J16A 2GYYA 1PJSA 1PJ3A 2FY8A 5AXDA 1OAAA 4XDZA 1T26A 3HDQA 1NNUA 4I5EA 1O9BA 4CLOA 4NBRA 2QRLA 3AUTA 3TN7A 4NJMB 5IDWA 4K6CA 3F3SA 1V3UA 1WW8A 4J9UE 2NQ8A 2O4CA 3EW7A 5I9NA 4CLRA 1EBFA 1CETA 1X7DA 3QP9A 4HP8A 5L7WA 1WWKA 1Y8QA 2V6MA 5ES3A 2BFOA 3JQ7B 2RH4A 4IXWA 5IN4A 1G0OA 3WXBA 3GHYA 4U6QA 4NFSA 4YR9A 3FR7A 2P5UA 4AICA 4YPOA 2GLXA 5JDIC 4W9NA 2Y0CA 2G82A 3SX2A 3ZV5A 1HRDA 3BMOA 1V8BA 2FPGA 4PLWA 3TOXA 3L9XA 5H81A 2Y66A 3OFSA 3L9WA 2Z1MA 5JCJA 1EE2A 2I99A 1VL8A 4BV9A 3B1FA 4XJTA 3TFOA 2O3TA 3RBZA 2FPPA 3L77A 4RVSA 4BGIA 4BGUA 1GDHA 2GN8A 2X5JO 1Q7GA 3F1KA 3HSKA 2DPHA 3IMFA 2Y68A 1CQJA 2HRBA 2HMVA 3GHHA 1DIBA 3G3EA 4IGFA 3AI2A 2Q4EA 4R3NA 1DIRA 3E48A 3W6ZA 1KEPA 5LDGA 3F5QA 2ZJ0A 1YOVA 2POQX 4BO4A 3PZBA 2HMUA 1ZIDA 4HFRA 3LLSA 2FZWA 5LCXA 1GV1A 2WD7B 1K6JA 2A94A 3DTTA 4YAEA 3IKTA 3ONEA 4AVYA 4RF4A 2NVBA 2CVZA 2EF1A 1D8AA 4L8VA 2C20A 2Q2VA 5EPOA 3O8QA 3Q9NA 4JGBA 4LSWA 1E3WA 4OSOA 1JVBA 2O2YA 3MJSA 2EHDA 1GQYA 1GEEA 3JD2A 3LLVA 5ILOA 2A9FA 1PZEA 2FSVA 2AQKA 3OHSX 1SO8A 3PRJA 1A71A 3WBFA 1SB8A 1LXCA 4BO0A 5KVVA 4N54A 3S2GA 1H6AA 3HNPA 3IL2A 2O4UX 5EERA 4IJWA 4Q3DA 2GDZA 4BQRA 5A3JA 2O2SA 5DNAA 5K9ZA 3NYWA 4XWYA 4DVJA 1X15A 1GEGA 3LYLA 3TNLA 2R6JA 3RJ5A 3IP1A 4E5KA 3H9QA 1LLCA 1PJTA 4CV0A 1ENYA 3G1TA 3L4SO 3K8ZA 4EUHA 4NQZA 2GN6A 3HZZA 2EKLA 5JMWA 3RQSA 2UAGA 2VRCA 1B3BA 3RUEA 3VH3A 4BKRA 1HLDA 2EJVA 1V6AA 1NX6A 3BMNB 1JWAB 3ZDFA 4PG7A 4RVGA 4ND2A 4CQLB 4H3VA 3PPIA 5C37A 1I2ZA 1LRKA 2B83A 4ZD6A 2WSBA 4MO2A 3P19A 1NVMB 1X14A 2NTNA 4L9RA 4IZIA 4LVUA 3CZMA 4DPLA 5L7TA 3G49A 2GRAA 5TJHA 1GUFA 3JQDA 4ROSA 4CQMD 3QE3A 4E5YA 4D41A 3GZNA 4CM5A 2OXIA 1T2DA 3RUFA 4ALNA 3W4JA 5IFLA 2VT3A 3RI3A 3JD4A 2PV7A 3D5TA 3DTYA 5A1TA 4XQCA 3GGPA 2X7HA 1UZNA 3TDKA 1KERA 2B4TO 4R5HA 3BMQA 5BSGA 1H2BA 2DT5A 3DFZA 3GR6A 1U28A 2C59A 2PGJA 4JLWA 2ZTLA 4Y67A 3R6DA 1I5RA 3WGZA 4IQGA 3ZW8A 1HE3A 4WECA 1MFZA 5T8KA 3OQ6A 2WWRA 4BMSA 3EHEA 3ENKA 2JJYA 3PI7A 1B8UA 1LU9A 1P1IA 2A35A 2NACA 1PJCA 2IZ1A 1PQPA 4WE3A 2CFCA 3LSYA 4BNXA 3L6OO 4BGEA 1SZJG 5DT9A 2EIHA 4QFDA 5FEUA 1ULUA 4JX8A 4XX0A 3H5AA 1R12A 5EL0A 4CM4B 1GL3A 3K96A 1LTHR 3LVFO 4W99A 4WJZA 1ADGA 1EQUA 2VNSA 1WZEA 1VE9A 5TSDA 3X2EA 4PVCA 3KBOA 2B36A 1NWHA 2J5QA 3D0OA 5A9RA 1L1FA 5EQDA 4O6VA 3RUCA 5G4KB 4URFA 3S2FA 5I7EA 1IHXA 5K6AA 1Y5MA 1QP8A 4MVJP 4MVJE 1NPDA 3D64A 4Y6SA 3ZU5A 2JHFA 3KB6A 1BXGA 5HTOA 1KVQA 3QWFA 4P38A 1YXMA 4YAGA 3GRKA 4P4GA 4BB6A 3CZRA 3PJFA 1G1AA 2WYUA 1GYQA 4B7XA 3NGLA 3DOJA 4QXMA 1J6UA 1F0YA 1EVZA 4OL9A 4B8ZA 3AU9A 4ALJA 1MV8A 3EAGA 5JAMA 4DC1A 4A73A 3AOEC 4NIMA 4WLUA 1JVSA 4HBGA 1QMGA 3DAPA 1D3AA 5CG2A 3GC6A 4M54A 4OH1A 1PS9A 7ADHA 4CUZA 1MB4A 1M75A 1ZMOA 2HCTA 3ICPA 3QA9A 3PJGA 3K6JA 1ISGA 3UH1A 2X23A 4A10A 4B8WA 1EE9A 3CEAA 3ETDA 5GMOA 4NBVA 4FGWA 4H16A 3V2HA 4E2XA 5DN9A 5JY6A 3OSUA 3OJOA 4PZDA 3RKUA 1PJ2A 1U4OA 4WCFB 4XGIA 4CLHA 1FDVA 1Q7BA 4W4TA 3R1IA 3S8MA 4IIVA 4D42A 1ZKMA 4GSKA 3EGOA 3QRWA 1I10A 1UH5A 2VRBA 3DOOA 3NTRA 3AM3A 1E7RA 3E9NA 3M1AA 2QYTA 2JCYA 4BQPA 4LW8A 1OC2A 5JDCC 1QRRA 3DEYX 1T1SA 5TIIA 3RC9A 3G17A 3EC7A 2PTGA 4CMEC 4ZICA 1HXHA 4YT4A 2IXAA 5IN5A 2NU7A 5FI5A 2ZB3A 4L4SA 5C7OO 4F6CA 3SC4A 4LK3A 1RM0A 4IMPA 1TT7A 4NFYA 4Q9NA 4NJMA 1XU7A 3CPSA 1PGNA 2D5CA 4OGWA 3FHLA 2H5LA 4L4XA 3FNFA 1TVEA 2EW2A 3PEFA 1YB1A 2HU2A 3JQ7A 4CM1A 1PWXA 3HN2A 1DLIA 4KQXA 1EUDA 1HDCA 1BVUA 3OMLA 1E7MA 2FRDA 3ZU3A 2VUUA 1C1XB 1LX6A 3HFSA 1X1TA 4MVJM 3VKVA 3AJRA 4TROA 2BGKA 1YJ8A 2Y0DA 4J7CA 3DQPA 2ZK7A 1KOLA 2R00A 2QYSA 1P1HA 2RAFA 4GX1A 5KVSA 2NLOA 4YRDA 4JIGA 4Z0HO 4GLLA 4E5PA 3H2ZA 3SLGA 5KKCA 1KC3A 3U62A 1EVYA 3L4BA 4RDIA 1DIAA 5IXYA 4BNNA 1I8TA 1YL6A 3HJAA 4MIYA 5BQFA 1KY5A 3D3EA 5CFZA 4R9RA 5ENDA 1NAIA 3MOIA 1J4AA 3RC7A 4OAQA 1ZK2A 3GDFA 2CDBA 1YQDA 1ENPA 2O3JA 3KEOA 4O1MA 5COBA 2C2YA 4F46A 2ZB8A 3VOSA 4BNYA 4CLOB 4BO3A 4GWKA 4I08A 3GRPA 1E0DA 1ZMTA 1E7SA 3MTJA 3WYCA 3JYNA 3Q9UA 4CLRB 4YT2A 1E1MA 1FK8A 3WYBA 4M86A 1Y8QB 2BHLA 2GZ2A 5TNXA 3D5QA 3WGHA 4OIMA 2AEFA 5TS3A 4KMSA 2OFPA 5KJFA 3PWSA 4GX2A 2J3JA 4EJ0A 4BKUA 3KYDA 1W0CA 3MJTA 3BMOB 3OEYA 1KVSA 4AJKA 2C7GA 2VT2A 4RVUA 1UXIA 4JQCA 4XRRA 1ISJA 1LDGA 4DIOA 3TZCA 1Z6ZA 3ZWBA 3K30A 5BR7A 3L6DA 4C4OA 4PG8A 2W90A 3KRTA 5KVQA 2DBVO 1IPEA 1A7AA 3DMTC 3NGXA 1BHSA 4BNWA 4CMJA 3F4LA 3OIFA 2NTVA 4K6FA 4XYMA 4PLVA 3FBTA 2OORA 3HDYA 3WLEA 1JDJA 1DO8A 3ZV4A 2E48A 3C24A 3K2BA 1IOLA 1QR6A 1W4ZA 1NR1A 3I9JA 1E77A 1WDLA 4M55A 1PL7A 4B4VA 9LDTA 3C85A 2J8ZA 1YOVB 4F45A 2X5OA 5F5NA 1HYGA 5A5FA 3MEQA 2B37A 1DC3A 3NT5A 4DQUA 3KYBA 4YXFA 1B15A 2PZLA 3AUAA 2PLAA 4QO8A 4E21A 2VYVD 5B12A 4MKZA 2AA3A 2BI8A 4QQRA 1N92A 5C7IO 4LGVA 2HJRA 5I7FA 5I9LA 2IODA 1WVGA 2D2IA 3I4FA 2NADA 3HFGA 3V8BA 5DP2A 3AM4A 5EMHA 3ZI0A 4GGPA 3U5TA 3O8QB 3KHUA 4RPJA 1LSOA 2ZTMA 3GLQA 3DDNA 4IDCA 3ZNQA 3AY6A 1HYHA 5EESA 4BO2A 4CV1A 1H6CA 1ZFNA 4ZHSA 4AJ1A 1N1GA 1PJ4A 1SAYA 2FWMX 3JYOA 2VYND 4J90A 3WQQA 5B4UA 4E5MA 3IP3A 5THKA 2HLPA 1X13A 2G17A 3QQPA 3QVWA 4CM6A 4UEKA 1ZCJA 2RHRA 4BGVA 4N5MA 1U7TA 4MVJF 2P4QA 5TLSA 4D3FA 3JQ9C 1ZUD1 4I1IA 4PN3A 1YB4A 4R5MA 4DL9A 1C0IA 2VUSA 2EERA 2PD6A 4M8SA 3RD5A 3TZQA 5DULA 2PD4A 3DAFA 5BNTA 1PGQA 1LSSA 2HQ1A 5I9MA 2BRUA 4GMGA 2Q4BA 2JCXA 3AWDA 1GYPA 4GWGA 4L0QA 4ZU3A 3ZW9A 3JD3A 4M87A 1PJBA 2DM6A 2CUKA 3BXXA 1QYCA 3IQDB 4MVJD 5T6BA 1SBYA 3P2YA 3H9UA 5L4NA 4TVBA 1XSEA 2VHVA 1LRJA 3W4KA 1QLHA 4IINA 1BWSA 5G0UA 5HS6A 3T4EA 2VTDA 5G0SA 5JDIA 4G65A 4CM4A 1ZSYA 4RGBA 1C3VA 3RU7A 2EP7A 4R68A 2NWQA 4CV2A 4J91A 5CPBA 1BDMA 4NFHA 5JAQA 4EYEA 4EEXA 3CXRA 1W73A 5G4KA 4IDFA 1GUYA 2H9IA 3U4DA 1Z73A 2V7PA 1YL5A 4BNHA 2GN9A 3NKLA 3WMXA 3HE3A 3GAZA 2I6TA 4FFPA 3GH3A 2EWMA 1U3VA 3RC1A 4B3JA 1LSJA 2WE7A 2AQHA 3BMQB 5DOVA 1LI4A 4DWVA 1GPDG 2O23A 4RJTA 3KSZO 2BH9A 1U3UA 4FJ0A 3DZFA 1DIGA 1WP4A 5IG2A 3U09A 4NZ9A 5COAA 3ZV6A 3LT4A 1GYRA 5KWEA 1O5IA 1I30A 1JKFA 5JXWA 1UXKA 2A92A 4Y6RA 3IUSA 3R3SA 4RCVA 3RSHA 2EGGA 2W4QA 3BMCA 4PLGA 4PLFA 2VWQA 3AI1A 3LZ6A 4BVAA 3MJVA 4U6SA 2V6FA 5JAIA 1SEPA 2YV1A 2Y1DA 2BGLA 4IBOA 3JQGB 4D0RA 5TQVA 2DVMA 3CH6A 3KLMX 4PLZA 5KOIA 4IY1A 1TEHA 3H6KA 1A5ZA 2WTBA 3SJ7A 4DQXA 5DCUA 3C7AA 2AW5A 1B8PA 3BTUA 5CAEA 3ZN2A 1DHTA 2EKPA 1QORA 3IC5A 3F46A 1ZSNA 4R9SA 5TT0A 2BKAA 4BUCA 3JQ8B 3UOGA 1NHWA 4DBZA 3AM5A 1XEAA 1DJQA 2BD0A 2JFGA 3INGA 3QW2A 3DMYA 3PHJA 1VL6A 4FFMA 4GX0A 4CM9D 1NYTA 4WNIA 1JAXA 1R15A 4LMRA 5EIOA 5LDHA 3FTPA 1SCUA 4FFLA 5A3VA 2B35A 2Y99A 2YDXA 4BO1A 1XLTA 2O50A 2VWHA 3Q3CA 3ZHYA 1M66A 1SPXA 2P2SA 2YHIB 1B26A 2Y0EA 4B4OA 4B7UA 5CEEA 4O0LA 4OSPA 4R16A 2PGDA 2RH8A 3WS7A 1D7OA 3DBVO 2Q1WA 3QVSA 1P1JA 4U5QA 4D79A 5ADHA 4XA8A 3IAHA 2PGLA 3L07A 1O94A 4H15A 2ZTUA 1TA4A 3IJRA 1RYEA 3SBOA 1UDAA 1UXHA 3N58A 4PLTA 2PR2A 3BTSA 3H4VA 5AXCA 1PR9A 2H6EA 1UJMA 1HDXA 1XKQA 3OIGA 1V3VA 2CNBA 2QHXA 3GVIA 2OBYA 5A06A 1C1XA 1X7HA 5KIAA 1UP7A 1DRVA 1HDZA 1Z45A 5IDQA 1GCOA 5HRUA 1EFLA 4R69A 1LBEA 2YJZA 5TX7A 3I3OA 3TSCA 3ZNOA 2DBQA 1EK6A 3NEPX 1PJQA 3INRA 4PZCA 4I5DA 3KTDA 1ZK3A 4D0SA 1P31A 3CE6A 4HNHA 4ALIA 3PLNA 4TSKA 1DFHA 1C1DA 3D1LA 4LSMA 3AY3A 4NBUA 3KETA 4ND3A 1QSGA 2ZATA 3RU9A 2Q46A 3ZWVA 1R37A 2X0JA 3DBRA 2E4AA 4N7RA 3PLRA 3LQFA 2O3SA 2X58A 3WICA 3KYCA 5CEJA 1BRMA 3STHA 3AW9A 1Q1NA 2P5YA 4P4NA 3NRCA 4FS3A 1N7HA 3Q6IA 4CV3A 5G0TA 1R0SA 4XR9A 1Q2XA 2CDCA 3HB5X 2UV8A 2JAHA 2Q1UA 3VPGA 3WSWA 4L4RA 1TI7A 4YBZA 3TL3A 3ZHZA 4EBFA 2E37A 4RF5A 1VI2A 6ADHA 4MIEA 5JSFA 4CQMB 3R0IA 2C2XA 2HJSA 1FF9A 4IS3A 3OM9A 2NU8A 1EEHA 1HE5A 5T57A 4D46A 4YACA 5DCYA 3T7EA 3K9QO 4DREA 1ZK4A 4I5GA 5JY1A 4EUFA 3I9OA 2DC1A 2R2GA 2DTDA 4FIZA 3FRJA 4Z9YA 2OO5A 4OYRA 5KKAA 1K6IA 3PYLA 3PK0A 5KJEA 4YAKA 1UUFA 2IYPA 4U7WA 2NTJA 2AE1A 2JFHA 4TRRA 3ONDA 3PDUA 1E92A 4DC0A 3U3XA 1A72A 3AOEA 3QWBA 2Y1GA 2FSSA 4I9HA 4IJVA 4DPKA 4BIIA 3C1OA 1UXGA 2FN7A 2X0RA 3OF2A 2P9GA 3S2EA 4BNVA 2X9GA 4CJXA 2GZ3A 1XU9A 2PZMA 3H9EO 2YFHA 3VPHA 5I7VA 3PFWO 4JP3A 4L74A 3D4NA 3KUXA 3PDJA 4GAEA 3VDRA 1LDMA 3UCFA 2WE8A 3ITKA 5L4LA 1K3TA 2YQ4A 3KYDB 1LQUA 3ADOA 4J1QA 2I66A 5EQFA 5FWNA 1AHIA 2CMDA 3O03A 1BSVA 2HAEA 4F3YA 4HFNA 3ZU2A 3MJCA 2JFFA 4B4WA 4CMGA 4BNFA 4IDBA 3DZGA 1T2AA 4R1TA 1IYZA 2C5AA 5JDCA 4CM9A 2PNFA 4GPD1 1TLTA 2OMEA 3D3WB 3HWRA 4CMEA 2LDXA 3I5MA 2ZB4A 4ALKA 2Q3EA 1RM3A 2PZKA 3S55A 1AN9A 1HT0A 1HDOA 1GCUA 5CDGA 4WKGA 1XELA 3PHLA 4UUPA 1HDYA 1GADO 3BZUA 4L76A 4PLYA 5DP1A 3RASA 5C7LO 4IM7A 1CWUA 4CUKA 4X54A 4XKJA 3WIDA 1DFGA 2BGMA 3F6YA 3O26A 2W2LA 4NBWA 3AY7A 3AU8A 2Y1FA 1JKJA 3ZWPA 4XB2A 5B1YA 1PGPA 3D7LA 3V5NA 2BELA 1WPQA 1PS8A 1BXZA 1Z75A 2OUIA 3Q2KA 4FC6A 3OH8A 5JPIA 4KUEA 1Y9EA 1MGOA 2P91A 1ZNQO 1B3RA 2GERA 5EN4A 3EZLA 5BT9A 1E5LA 2UYYA 4OOEA 1SOVA 4HXYA 1JLLA 4RQUA 3DL2A 3DB2A 4J4TA 1SB9A 3PQDA 4XQGA 1QLJA 3UFXA 4BO8A 4PLHA 2LDBA 3OICA 3AFNA 3BTVA 1X7GA 5CP8A 1KETA 4BNJA 2GF2A 4DPMA 2NM0A 1L7DA 4FJ1A 4UVDA 4PG5A 1DPGA 4KWIA 2YV3A 1ISHA 4R1UA 2VQ3A 1RM4A 5DF1A 1B2LA 4YTEA 1WZIA 2ZQYA 4PFJA 4WK6A 4B3HA 1MG5A 5HA5A 1UP6A 1E6UA 5C5IA 1NVGA 5MDHA 4JJGA 2PFGA 1NFRA 1ONPA 5T64A 3JQGA 3WGQA 2PKQP 1SEVA 3ZWMA 2QW8A 4TZKA 4HFJA 4KDFA 5CDSA 3V1YA 1GUZA 4IS2A 3LF1A 4JBGA 4DA9A 2FR1A 4DLBA 1W6UA 3WTCA 5U4QA 2HUNA 3HDJA 3KOUA 1LC3A 1WDMA 4DLAA 1EBUA 1OC4A 3JQ8A 3WJ7A 3UHAA 4D44A 4RF2A 1N2SA 4CM8B 3ZWWA 2WDZA 4OXKA 1S6YA 2Y1OA 2V65A 3DZKA 2Z1NA 3NDJA 1BXKA 3DMTA 3TL2A 4EUEA 4OQZA 2B5WA 4YJGA 4S3MA 4PLPA 3CIFA 4Q3NA 2OHXA 4FBGA 2ZJ1A 2YFQA 4PCVA 5A9SB 1XDWA 4M1QA 1PZGA 2YHIA 3H7AA 3JQ6A 2PWZA 3MWDB 2AG5A 2D0IA 4GVLA 3GFGA 2P9CA 5L7YA 4UUNA 3H8VA 3BMCB 5GZ6A 4S1VA 4GL4A 2J5RA 1DJNA 3WGTA 2NNLD 3QWAA 3QY9A 4E3ZA 4LMPA 1H93A 1ZJZA 2P4HX 1DBVO 3M1LA 2W2KB 1KBZA 3DAGA 1LDNA 4HX5A 4ID9A 3QSGA 1F06A 2FPIA 4LRSB 4U0KA 3ROPA 4OMUA 1MA0A 1H6DA 3I52A 1D1SA 4BNLA 1YDWA 4NK5A 5U1PA 2I5PO 5KCZA 4AFNA 1KYQA 1RPNA 5L40A 2CF6A 2AQ8A 3KZVA 3I9KA 4AJ4A 5TJ9A 5L9AA 2J3IA 2X8LA 5T67A 4WLOA 1I36A 3H2SA 1PL8A 4TRJA 4MKXA 4TVOA 4LVCA 4DMMA 4ESOA 2VZ0A 3RIHA 1PL6A 2NV6A 4IQ8A 4CMAA 3JQ9A 3BHJA 1YQXA 1HSOA 1KVUA 2BFPA 3A1NA 3LF2A 5JAZA 1OFGA 3C7DB 3OP4A 4HNGA 5B37A 4OJNA 4NMHA 5DZSA 2RHCA 5JO0A 3HADA 1ZEMA 3HG7A 5A05A 2B4RO 2GASA 4GSLA 2DTXA 3PP8A 3GNSA 5DCWA 2AEJA 4E33A 1FDTA 1T2EA 4FW8A 4E2ZA 1YBVA 3GQVA 3C7CB 1NFQA 3GDGA 5IDXA 3E1KA 4ITUA 1EZ4A 4UEJA 4I5FA 4DLLA 2JL1A 2GNAA 1MXFA 1U8FO 2ET6A 3PWKA 5IF3A 1IY8A 2OGUA 2Z95A 4ZA2A 4QECA 2GD1O 1WMAA 2Q50A 4NU6A 3G0OA 3DHNA 2DTEA 5KJCA 1T1RA 3R3JA 4OKNA 2G0TA 3HB4X 4CL8A 4CM3A 1JTVA 3GA0A 1ZSVA 1GR0A 3O9ZA 4WEQA 4XYLA 3JQBC 4CQMA 3RFVA 1LUAA 3RFTA 4A0SA 3EYWA 3UW3A 1NTOA 3TZ6A 2H63A 4J1TA 4B3IA 3A9WA 3PZRA 3VTFA 2OZPA 3JQAD 5A02A 3C8MA 1JQBA 1C1DB 2ZCUA 4J3FA 1LRLA 3VH2A 4BO9A 1HF3A 2WMDA 3OA0A 1R4MA 4XRGA 3DBRB 3SJUA 2CDAA 3PWZA 4DBVO 1ISIA 1I2BA 3KYCB 4XZ3A 4GKVA 2XPCA 4AJOA 3H3JA 2QZ9A 3QWHA 4PIVA 2HSDA 4J49A 4BOYA 3GPDG 4J4HA 5LC1A 3H65A 1C0PA 1U1IA 1HWYA 4BB5A 1F14A 3U4CA 4Z9FA 2GN4A 2OL4A 4DYDA 5IZCC 1AHHA 1EUZA 4MP8A 4I9UA 1XCBA 1IULA 2D1YA 2DUUA 1HZZA 1AE1A 3VVCA 1U5AA 2PKQO 3B1KA 4CR8A 2XXBA 3ROKA 1P45A 2PZJA 3PIDA 2Y93A 4ND1A 3DWFA 3ZWXA 2NVUB 4PLCA 1E1LA 3FWZA 3GEGA 1Z82A 1O8CA 3W1VA 1E7QA 4ZQFA 4YWJA 1Z7BA 2IXBA 4NH4A 4HUJA 4IDEA 3TZKA 3ANNA 2ZQZA 3KEQA 3D3WA 4ZGWA 1VKNA 1DIHA 5A9TA 3L6EA 5FI3A 4IJKA 4LCJA 4RVHA 4XYEA 5AVOA 2IE0A 3WYEA 4RZHA 4NG5A 3TWOA 1U8XX 4BNTA 3K5PA 4UEOA 3ON5A 1R66A 1ADCA 4PVDA 1T25A 5DBIA 2NQTA 1VRWA 3ONFA 1R0LA 5H82A 4EW6A 5JBIA 3EY4A 2I3AA 4GI2A 1H9AA 4WPGA 3GF4A 4QTZA 3AI3A 4XEHA 4L73A 4QUKA 1EVJA 1TT5B 4YQZA 3GUYA 1NQOA 1FJHA 2TMGA 2GO1A 1FDUA 1A4UA 3MWEB 1E3JA 3A06A 4GLOA 3JYPA 1U7HA 3PHIA 3CMCO 5JO9A 1LJ8A 3MOGA 4IZHA 4CODB 5COQA 3WG9A 3ST7A 2DQ4A 4QT0A 2GSDA 2CVOA 4GGOA 1H0KA 4KZPA 3WBBA 1E3SA 4UVGA 2GUGA 3X2FA 1R16A 4P4LA 1WDKA 3SEFA 4ONEA 4CM7A 1BDBA 1U9JA 1M67A 3ANLA 4IJUA 1Y7TA 4AJ2A 2J6IA 4TWRA 2X5KO 4FD3A 2YZ7A 1K5HA 4J1NA 4XYGA 2EP5A 4WNCA 2VNAA 4CUJA 1I3LA 1MUUA 2NVWA 2X9VA 3B6ZA 4ZQEA 5F3RA 4E12A 4L75A 3U9LA 4EZBA 1YBMA 3W8EA 3MCVA 1D1TA 1A9YA 1YJQA 2Q1TA 2V6BA 1VJ0A 4ILKA 1E7WA 1E3IA 1EFKA 1ZO8A 2HK8A 1UZMA 2QZZA 3AUSA 4WLNA 3UXYA 3VAZA 1B8VA 1Q0QA 2IRWA 3PIIA 3WFIA 1Q7CA 3ROMA 4F6LA 3JYQA 1VC2A 1GTMA 3BHIA 2WYWA 4H7PA 3ZNPA 1ENZA 4UUMA 4YRBA 2RBEA 1ZJYA 4EITA 5KJ6A 3WLFA 4ZVVA 2EKQA 1OMOA 3PJDA 1RJWA 4G81A 1V35A 4KQWA 5AOVA 4PG4A 4WEOA 1X1EA 4XD2A 3UCEA 3ZWAA 3E82A 4NPCA 1DAOA 4Z0TA 4O5OA 4YVFA 3D4PA 2D59A 3JD0A 3VZQA 4CM8A 4HWKA 1UAGA 1Y1PA 2JD2A 3VC7A 4YYZA 3ORFA 3JQEA 5AQ1A 4YT5A 3OQBA 3PFFA 4D43A 1QV7A 3MJ4A 2YYYA 3JQAA 5A9SA 1PS0A 3LT1A 4Y6PA 4YJHB 2X9NA 1O89A 2GGSA 3CTMA 3GGGA 1FMCA 1A9ZA 3VZPA 3E6AA 1NHGA 4RPHA 4ZN6A 2I65A 2F1KA 3MTGA 1MX3A 3VZSA 1QV6A 4EDFA 1MP0A 4R3WA 1R6DA 4MOWA 1NR7A 3TZHA 4AJLA 1CERA 3KM0A 3HUDA 3ZNNA 1QYWA 3GPIA 2FP4A 5L45A 1B0AA 5C3MA 4E6PA 1W8DA 3QVTA 1DRUA 2W2KA 3WWZA 4BHTA 2G1UA 2HK7A 7MDHA 1HL3A 1F12A 4IDDA 4UVEA 4WOKA 1SOWA 1MC5A 4KUGA 4A03A 2HRZA 2WYVA 4QFCA 3WQRA 2EJWA 3HDHA 4CMIB 2RIRA 1P33A 1HKUA 2Y05A 3F9IA 3OJLA 4IIUA 4MIOA 4CR7A 2YHUA 3F47A 1YB5A 1O6ZA 3F1LA 3HN7A 3UUWA 1C14A 1IE3A 4KWHA 1GY8A 2C0CA 1BMDA 3SLKA 4R1NA 2XF8A 3RBXA 3AFMA 1AUPA 3GY0A 1YGYA 3HHPA 3WB9A 3GMDA 4R54A 4YJGB 3P5SA 4K1LA 1PQWA 5T5QA 2Z5LA 5BSFA 3TFQA 3OJ0A 2AEMA 2YQ5A 4Y9DA 4K26A 4ND4A 3LC2O 4YA6A 4MPDA 3ULKA 1C0KA 2IEDA 5JYEA 1YE3A 4JP2A 2F00A 1EDZA 1I3KA 3BIOA 3A4VA 1XR3A 1IZ9A 4U8GA 1XIVA 4OHUA 4U0JA 4YJFB 3JV7A 2ZTVA 3KXDA 4TKLA 2Q2QA 4BV8A 3GZ4A 4FFRA 4IQ0A 1ZXLA 2NUAA 4XGKA 2ZCVA 2HDHA 4J2OA 2VHZA 3C3XA 3RUHA 2VYVA 1LDBA 2DFDA 2P68A 3N74A 1ZK0A 3K2EA 3E5MA 5G4LA 3WQSB 3VKUA 1HDGO 1I33A 1Z7EA 1FDSA 4MJLA 5KVCA 4R01A 3SC6A 4CR6A 1DXYA 5BNIA 2DBRA 3RAJA 3S1LA 4AJIA 5HM8A 4W7HA 4GQAA 4BNKA 4WLFA 1E1NA 4WOJA 1G0NA 1MXHA 1NPTO 2PD3A 5GY7A 5DOZA 4XDYA 3ZH2A 2VYNA 2E6UX 5ITWA 3PJEA 4ALMA 1P3DA 2B0JA 4FR5A 1N8KA 1P1RA 2FHSA 3B70A 3V1TC 1UAYA 3WDSA 1LSUA 4JK3A 3GG2A 4FQ8A 5TRTA 4FFOA 3ZHBA 5L95A 4ZQHA 4CMKA 2H1SA 3JQCA 4LISA 3O4RA 3PGXA 5GZ3A 5A5EA 4UVHA 3I4CA 1K0UA 4JROA 3BTOA 5AXAA 4CMHA 2VHXA 4RPGA 4MVJA 3NT2A 2EV9A 3T7CA 3WGGA 3H9GA 5TGDA 1YH3A 1ONNA 3RFXA 4II3A 5EINA 4TMFA 1JAYA 3CMMA 2DUWA 2I3GA 2IDZA 4YCAA 1NASA 2DBZA 4I9NA 3I23A 2X4GA 4J7UA 1ZBQA 3JYLA 3FCOA 1AXGA 1SC6A 1N1EA 1YWGO 3U4HA 1WMBA 3DOCA 2NVUA 1NWCA 4FC7A 2ZIZA 2GCGA 5K0ZA 4DQVA 1DC4A 4RQTA 1JU9A 1U2GA 4RO0A 4RVFA 4GVXA 1CQIA 4XYBA 2B4QA 4IMRA 1WNTA 4D3SA 3QV1A 3W8FA 4B7CA 4KTVE 3Q11A 3OQ1A 1UP4A 1P0CA 1XYGA 1IL0A 1BW9B 3GGOA 3ETEA 1R4MB 3ZWNA 1VLLA 3TRIA 4P22A 3E9QA 3GAFA 4TRNA 5AXBA 3W6UA 1E6EA 1PQUA 1R4NB 4YJDA 1GV0A 1Y5RA 3WTBA 4JNKA 4XR4A 2GZ1A 3ADPA 3KVOA 5CPFA 4D7AA 3NAQA 2XAAA 1I3MA 2EG9A 1BG6A 3ENNA 5F1OA 1GZ3A 1CJCA 3LK7A 5GZ1A 1HTBA 3ASUA 4HKTA 4DIFA 1TT5A 3GN2A 1KIFA 3DZIA 4Z3KA 1YO6A 3GNTA 1Y8RB 2FR0A 2VOJA 2ILTA 1J5PA 3DFUA 3I1JA 4JJFA 1PR3A 3H3FA 2YDYA 3OEWA 3ASVA 1I2CA 1NQ5A 4R51A 1H6BA 5B4VA 5I7SA 1BTOA 5L3ZA 1HE4A 2X86A 4PG6A 4GKBA 3FPCA 3TOZA 2BI7A 3TF5A 2PKRA 4OOFA 1Y6JA 2DAPA 3VHRA 2IZ0A 1UXJA 1IHYA 3UCXA 1P1KA 1O0SA 2HKIA 2ZB7A 2O3RA 3A14A 5G0VA 4OXNA 1R0KA 1M2WA 4FGSA 1NPYA 3DR3A 6LDHA 1IZ0A 4MINA 2PH5A 4BL5A 4WCFC 8ADHA 4NK4A 2VOEA 3C1TA 2J3HA 4WLEA 3ROQA 2FOIA 1Q0LA 4BNGA 4KTTE 1H5QA 3PTZA 1LLQA 4HFMA 3I6IA 5F1PA 4DMLA 2PA3A 1TB4A 4OXYA 4AJJA 5AYVA 4MDHA 4PGFA 3UN1A 3IS3A 3CUKA 1DSSG 1WLYA 1KVRA 3E8XA 3KLPX 1N5DA 3WMWA 1DB3A 2OP0A 3GVCA 2CVQA 2QRJA 3FNHA 1FDWA 3P2OA 3QHAA 2IYOA 5JYDA 2WJPA 3T4XA 1DRWA 4BNMA 1K2WA 4C7KA 4EJMA 3LC1O 4MKRA 5JE8A 3JQBA 1F17A 2OP1A 1QG6A 2AG8A 2I67A 1PGJA 1KVTA 2VZ8A 3HQ4O 2DFVA 2QG4A 1AGNA 1KEVA 4NBTA 2JD1A 2G76A 3GEDA 1PGOA 1A4IA 3GVHA 1T4DA 4Z6KA 1FXSA 2D4AA 3QIVA 1ISFA 3DHEA 3BHMA 4OKIA 3ZWYA 1V0JA 2VHYA 4Q3CA 1E7YA 4MVJG 4AG3A 3IIEA 2CF5A 4YJHA 1SMKA 3INTA 3JQFC 3NJ8A 1YL7A 3GFBA 4J2HA 4B79A 2DU8A 1GAEO 3OJFA 2D5AA 1MFPA 4KUHA 3DBLA 4EI2A 1J0XO 4Z0PA 4GH5A 2GR9A 1U5CA 3ZGYA 3QLJA 3VZRA 4E4YA 9LDBA 3QJ5A 3RUAA 1P44A 4BKPA 4Q3AA 3GT0A 3WGOA 1ORRA 3H9JA 1KY4A 1U2DA 3D4OA 1G6KA 1A7KA 4J4BA 4MP6A 5IZCA 4AL4A 3EDMA 1AXEA 2X0IA 3ZWCA 1XG5A 4IXTA 2YY7A 4BKOA 5HBRA 4CMIA 3DZJA 4ND5A 3VDQA 2OBNA 1T4BA 3GVPA 1HYEA 3VH4A 3I6QA 3SXPA 1QYVA 1PEDA 5DBFA 4IDAA 1ENOA 3U4IA 4JBIA 3FBGA 4NR0A 2UVDA 2VHWA 3LT2A 3IKVA 4CMCA 2HMSA 2VTEA 1PJLA 5HWSA 1OZAA 4JXKA 1WAMA 3BYZA 2P9EA 1GQ2A 1VJTA 1LLUA 3DZBA 3JQAB 3Q1LA 3H5NA 2C54A 3GNQA 2UDPA 3RKRA 1I0ZA 2PK3A 2WEKA 4ZJUA 1BVRA 3WOHA 3DBHB 3ZZNA 5JNLA 3ITDA 4W7IA 4NU5A 4W9NC 3RCBA 4DUPA 1V9LA 3CINA 4G5HA 3ZU4A 4D45A 2E49A 3VVBA 1VL0A 2EW8A 2FMUA 4YJFA 2X0NA 4HY3A 2AQIA 3FSRA 4KOAA 1ID1A 3FN4A 4UREA 3PYXA 2ZYAA 1F8FA 4NJOA 4UUOA 1Z74A 4M89A 4WGGA 4MVJH 4CLEA 3IJPA 5JCXA 1LA2A 1GPJA 4IUYA 1U3TA 4UVIA 1HETA 1T2FA 1GU7A 1YKFA 3COSA 2WM3A 4MVJI 4J1SA 2BMAA 2DPGA 3FWNA 4Z9XA 5IJZA 1U3WA 1K89A 3M2PA 4FJ2A 3CSDA 3F5SA 1LQTA 3GUCA 3BA1A 2G5CA 1B7GO 3MJEA 5JMPA 5HS4A 3UICA 1ML3A 1YONA 1ZK1A 4WASA 2WD8A 4DTIA 1T2CA 5JS6A 1XWFA 5KNLA 5TT1A 3E5RA 3OECA 1PZFA 2X1HA 4Q3EA 1ARZA 3DXFA 3M6IA 2CSUA 1P77A 1YS4A 1RWBA 4PZEA 3WNQA 4QO7A 4XIYA 1VSUA 5B4TA 2Q1SA 4TKMA 1DC5A 1LNQA 2PY6A 4J6FA 4NDNE 3PHHA 3GK3A 5CEFA 5JC8A 4BO7A 1E5QA 4J7XA 1K6XA 4K28A 3DONA 1RM5A 1IPFA 5ER6A 1ISMA 1ZZEA 3W8DA 3WJAA 4YRAA 4BNZA 4J9VA 1U4SA 4INAA 1EQ2A 4AJPA 1JA9A 4A2CA 3KO8A 2Q99A 2HO5A 4R1SA 2VCYA 1DAPA 1JN0A 3FR8A 3NTQA 1O95A 1V3TA 1CEQA 1UR5A 5JLAA 5I8WA 2BFMA 1CDOA 4BMNA 1VM6A 4OO3A 5CDYA 4UAGA 1I3NA 4JJIA 4E2YA 2X22A 1LDYA 4CLXA 3QWIA 1D4FA 1ULSA 1DHRA 1MLDA 3KSDO 3WWYA 1PSDA 4II2A 3I9LA 3IUPA 3DC2A 3KSUA 3C1AA 4YB8A 1QKIA 3WX0A 1C0LA 1EK5A 5ENVA 4YAJA 1OOEA 3B1JA 3LDHA 3WR5A 5CDTA 1NP3A 3JD1A 3SVTA 3UKOA 2C7VA 1VPDA 4D3DA 4CL3A 5FYDA 3LT0A 3GMSA 1Y9AA 4DXHA 1HZJA 1YRLA 2JAPA 3B20A 5F1KA 2Y1CA 4ALLA 3CKYA 1ADBA 4ZQBA 1N9GB 4RPKA 4UULA 3AUUA 4AJEA 4YT8A 3GEMA 1BW9A 3BAZA 3WSVA 2UUPA 3DO5A 4ZQGA 1ZXBA 1PU2A 4DYVA 3NX4A 2YV2A 1DFIA 1GD1O 2W98A 3UF0A 3I9MA 4TZTA 5BSEA 1VSVA 2A4KA 4K9DA 1X0VA 1R4NA 2I76A 4FSHA 3KV3O 3FD8A 4R4JA 4O59O 3ANMA 2BLLA
chains in the Genus database with same CATH superfamily
3FNGA 4UAUA 4UHKA 4ACBA 3I30X 4G5GA 5G0WA 2QYHA 4A82A 3THWB 1FTGA 3A04A 3KJGA 4BY9E 3C45A 1BA3A 4XJXA 3VR4A 3EMDA 4JL8A 1NQAO 2VHEA 3DVLA 1EHYA 1U28C 2VYQA 4RCZA 4FOOA 3ZDAA 1QX3A 1Z0UA 2VJQA 4IPTA 2CDNA 3N7UA 4A8PA 5ALLA 1PR0A 1CNEA 4ZK6A 4NHEA 3DKIA 3OZGA 4HRVA 5JW6A 3QFFA 5ITVA 3OQNA 1XTUA 2BGIA 1CRZA 5T8KC 4JLKA 3UUFA 4C01A 5IYZB 1FLAA 1RYDA 2JFQA 2JJ8A 2WJIA 2A5LA 2JJ1D 2XSZA 2QUAA 3H5RA 3PGJA 5TC4A 5J2TB 2Q9CA 1U90A 2L82A 1OXXK 1WD7A 5TPZD 5LU9A 2CV0A 4A6DA 4CEIB 4UBMA 3TNFA 2IEBA 4NEHB 3FNQA 1NUHA 2V7WA 4KLRA 4YO7A 5IAKA 2IF2A 4L5CA 1Y48E 2VAMA 4L7QA 1W87A 4B6PA 3GJZA 2VJBA 4BRSA 4E4TA 5IRCD 1NVAA 3LWZA 1TRHA 1PF7E 2H0QA 1K66A 1E6WA 2YVUA 3BHNA 4X1KB 3PX3A 3KTFA 2J9RA 3B7WA 3CURA 1LK0A 1CUGA 2DF8A 2E4ZA 3EVCA 3VQTA 3ZUGA 1Q11A 3KEFA 4RJKA 3BKXA 4EKEA 2BY4A 1LEHA 2VN8A 1EXMA 2QE7D 1DG3A 4Q39A 1M1UA 4D99A 1BGVA 2UUOA 4YJKA 5KNBD 2HA5A 3OF3A 2Z8ZA 3MZ0A 4MR8A 1MT3A 10MHA 1TIPA 4MJXA 5JFOA 1OB2A 3KSRA 1ODFA 1OCEA 4MYUA 4RPLA 4DANA 5F7ZA 4ETMA 4RY2A 2CK3A 4MQLA 1N6RA 5I9IA 2ZWMA 1E2QA 4U7GA 5CITA 5JNSA 4US0R 2G67A 5JR3A 1RHKA 1BVYF 1TJNA 3FM9A 1Z3IX 3FROA 3R20A 1J90A 1FNMA 1PKEA 1G6OA 2PT9A 2E1PA 3NHZA 3IQHX 4JENA 1A27A 1DAEA 2O7SA 4RFLA 3IP9A 1UADA 1IEWA 5FHRA 4WXRA 4F4CA 4KE6A 4IVPA 2W8BB 4RORA 2Q3MA 3IEKA 4AJNA 2VJKA 4EEZA 5DGHA 4B1FA 4PRLA 1C1YA 3WC4A 5I8ZA 4CQLA 2B30A 3ICCA 1R6UA 2I34A 1KAHA 4JVMA 3O38A 4LYGA 5JYBA 1Q0HA 3FVQA 1OT3A 4ZAYA 5J47A 3PVSA 3ND9A 4GX5A 5AI4A 1DXQA 1XZKA 3JWIA 2OM2A 3OCJA 3PFCA 2CLEB 2IYLD 3B89A 4I36A 2DLDA 2PXAA 3AEZA 3B9BA 4ZVKA 2ZYGA 3CNBA 4A2PA 2PEYA 4UNSA 1CF2O 4RPCA 3W8RA 5AW8A 2VHTA 3M3DA 3S2UA 3VSEA 5K0GA 1OBFO 1MC4A 1ZM4A 5C1OA 4D3XA 2EQAA 1WUJS 4INJA 2JCVA 5KSWB 3CEJA 1D4OA 4GP9A 3OOJA 4E08A 3BH0A 4RK7A 2GVDC 4ZAGA 1O95C 1TZCA 1KYTA 1NV9A 2G36A 2A1UA 2BFFA 2YVQA 4ZV4A 1UKAA 4V1CA 4MPTA 5CDHA 4P83A 3EK2A 1ISRA 1NAHA 4IH4A 1VQ1A 3DUFA 2Z09A 4LYHA 5JC1A 2BFBB 4OX9Y 3U6KA 5J23A 5FJIA 1JJVA 2GM4A 1IB6A 2DULA 3Q1KA 2A33A 3CF4G 1RHQA 3DZHA 3OPVA 2AZTA 3OTWA 4IO1A 4L7VA 4M1YA 5EP2A 3OJEA 5ER9A 9GPBA 2C9BA 5FF9A 4RLSA 1YRAA 3PDHA 2PE5A 2Y6UA 5BR8B 4DCPA 3DMGA 2O3UA 2FOLA 5E1OA 5IBRA 2Z9CA 4OBXA 3VDXA 1T5TA 1QHHA 3LM8A 2NU6A 4Y98A 3FBWA 1AKVA 3CW8X 2X3FA 4FCCA 4A7PA 3L1IA 3LC0A 3JCZA 4HNVA 3B1VA 3ETCA 4AMBA 4F38A 4NBNA 521PA 1VFPA 1UCFA 1WY7A 3UV3A 2FFJA 1H8HD 3HYRA 1PVOA 5AQEA 3W2TA 3HBNA 4R0MA 2QU7A 3AUXA 3DBHA 1GSHA 1T4GA 4NE7A 2N1BA 1FXWA 5JCJD 2IZOA 4X66B 1UZUA 4R41A 2TYSB 3HPRA 3FHCB 1KS9A 2QZJA 1JF8A 3LLCA 4FHFA 4H3HB 4HN4B 1PTJA 4S2UA 4Q1BA 2H8GA 3UMJA 1EGHA 4E2WA 3VX4A 3ZCXA 4EA9A 2BF7A 3BB3A 3LYHA 2YUTA 5FFFA 3EH1A 3Q87B 4DIBA 2Q2WA 1SD5A 2NXWA 3IOBA 4HH1A 4FKZA 1U2ZA 4TYWA 1II8B 1T3GA 3QNWA 1G4HA 4GYJA 1MB0A 2I9PA 5AXDA 4EG3A 4DV1B 3U17A 2QM3A 3V7NA 1PVDA 1G7CA 3BT7A 4PHHA 2XQIA 5DTRA 1CKEA 3UHFA 4ESHA 1FQKA 1NXPA 1TUEA 5AI6A 5T4HA 2YW9A 2Z43A 4MVXA 3RSSA 5A5GA 4KIUA 3M3PA 4KXLA 3H5LA 3KAJA 3EVNA 1GZHB 3S1AB 3IDQA 4LHSA 1YZ3A 2WA2A 1GFSA 5LP6C 5KS2A 4EITA 4YXWD 4DR7B 4KJXA 4RW0A 2QTNA 3GRUA 4KITB 3VH1A 4GZ6A 1ZUNB 4UMVA 4DDWA 1DKRA 2OB1A 3IAS6 4Q1VA 2FQ1A 5IJXA 4KE9A 3CR3C 4YP6A 3ETGA 2FW6A 3ROZA 3SHOA 5DM70 2GZSA 2G1JA 2QIOA 3BE6A 4PCUA 3T3OA 3SX0A 5JJKA 1TA0A 3AVXA 1HYQA 1XLVA 2E18A 2RIPA 4X8LA 3UTDA 3CH4B 4RHXA 2DY1A 1JSZA 2XIQA 3BJZA 4LV8B 4N5LA 1I32A 4IHAA 4A36A 1HC7A 3WLPA 2ZZKA 1UBHS 4EJSC 4H4CA 4RVDA 2G1PA 4RWZA 1RJGA 1DEHA 1UBCA 4NMWA 3ZKWB 2FN9A 1UT5A 3JAWA 4XCVA 1G41A 1BH6A 5IZ4A 3X3HA 3URMA 3QMMA 1XJ5A 3L8GA 1PJRA 2A67A 1XAHA 2QLJA 5A7HA 4MQBA 1SRQA 4W5OA 3WYDA 1YACA 1R8JA 4QBKA 5IVHA 4XIGS 2A14A 5FOVA 3OSZA 4HWOA 1JKIA 2IZZA 2QRVA 3NDIA 4NY1A 2QLMA 3HACA 3L43A 3UIEA 1U7UA 2HXSA 4FPXA 5BSKA 2OORC 4DARA 2C5EA 5THQA 2GAIA 3VNUA 4OATA 2B4YA 3FWPA 3UO8B 5D3MB 4CTNA 5JIBA 4RDHA 4B74A 2G09A 1YFKA 4JLMA 4A27A 3UGKA 3V55A 4K5QA 1OPRA 4KXYA 5IMSA 2MSDB 4GMFA 4ZAVA 1K9SA 2W2LD 2WU3A 1QDEA 3W4IA 5CCBA 3DOIA 1LTQA 4LEIA 3JZAA 2JJQA 4HLNA 4OD0A 5DASA 5E3JA 4M83A 1F60A 4AECA 1L9XA 4JC0A 3RUIA 1NQTA 1ZYUA 4LUCA 3DE6X 5IXJA 5KDDA 4FZ3A 1IUKA 1KGDA 3KLBA 1QXSA 3RM3A 2BFEA 2F62A 1KP3A 3DL7A 1ONOA 1XD9A 2QD1A 3H7IA 3HGQA 4GM0A 5A3SA 4EL5A 5KWEA 3T9EA 1PWZA 2O07A 3NW9A 3T1TA 3QI7A 4TKUA 1KZHA 1VKHA 1Y5LA 3U1VA 1HE2A 2VBIA 4BX2A 2NXNA 3JWJA 5FA6A 4C0BA 5HK9A 5L53A 1CUEA 3T52A 1X3LA 3L7MA 2OEPA 1ACMA 1BZYA 2Q6IA 3OPNA 4MP3A 4TMXA 5JH7B 4CMBA 5JXJA 1YQGA 3MHPA 4FKBA 2QN7A 5IKXA 3K31A 4W5QA 4LDAA 2CHGA 2ZSKA 4BO6A 2YBEA 1KL7A 3KQSA 3I4LA 3AK4A 4WUVA 4NJEB 1GL7A 3TJRA 3TLMA 2DRIA 1Z6TA 2ZT8A 3THWA 2IPOA 3B36A 4KRGA 1RI5A 4XQ9A 2OXFA 3AV0B 4Q05A 1QU3A 2X40A 5AHKA 1CW2B 2XA9A 3LCMA 1KY3A 3BUSA 4LC0A 4JAVC 4DDKA 1NNUA 3OZSA 3TTXA 1O9BA 1PK7A 1SULA 3QQ5A 1JG2A 5BSWA 2A9JA 5H3HA 1N2OA 4K9KA 4NJMB 3KWLA 3TMYA 2OLEA 4ZT7A 4K6CA 5F73A 1Z4MA 4U7HA 3JPYA 2IYWA 3COZA 3EW7A 2HIHA 1EBFA 1PYOA 3E3MA 1CETA 5EVCA 1BE1A 1WWKA 5IYZA 2V6MA 4NONA 5GINE 5LQMA 1PQYA 2QTTA 4EELA 5I4BA 1SXQA 1Z2DA 1MA3A 4GM4A 3GHYA 4CEIA 1Q1ZA 4PGAA 2W6PA 2VK4A 3FDXA 1SOAA 4JUFA 3CYFA 5G1PA 1QKJA 4JD5A 5IARA 4W9NA 2Y0CA 4V2UA 2OG1A 3SX2A 1HRDA 5D01A 4HQ6A 4Z86A 2FPGA 4BWYA 3OOHA 2J4FA 4MW4A 3TOXA 3LE8A 2Y66A 2M9MA 1RQPA 1EE2A 2BDUA 4EPYA 1H69A 1JTEA 1VL8A 3VV3A 2CT8A 3T6KA 1HFWA 2JIPA 4P3KA 4UTOA 2FPPA 3I0MA 1G7TA 2SKDA 5F4BA 1GDHA 1TCBA 1Q7GA 5CVVA 1T9GS 3D8TA 4TLLB 4ZV7A 2PTHA 4UJ5A 2HMVA 3MCAA 5EJGA 3G3EA 4IGFA 4ODIA 3AI2A 2XQKA 1QOQB 4R3NA 3WADA 1H05A 4QVIA 4BU1A 3MFYA 4X84A 5H9VA 2KSQA 4U7DA 1J0BA 3BSYA 4NZOA 3SZLA 1Q21A 1ESNA 3E58A 3U26A 2DB3A 3PZBA 3T54A 2PGAA 3D8HA 2H92A 4D9EA 3TMAA 3LLSA 3UAZA 1O8BA 2W8BA 2GFHA 3NJRA 2WHYA 3OU2A 2A94A 3DTTA 1XF9A 1U04A 4YAEA 3RO7A 4PS0A 1OU0A 3I72A 5CFNA 3ONEA 3IKTA 3SFTA 4AVYA 4RMIA 4LY3A 2ODNA 4AF6A 2CVZA 2F1RA 4H60A 1PUJA 2EF1A 4QLAA 4HNSA 1DELA 1VRVA 2IQIA 1HY3A 3A9RA 3SQWA 3O1JC 3U3JA 1PW7A 4M8IA 2O8EB 1O97D 2XVMA 4LSWA 3UJPA 5CD1A 3TW6A 3LDGA 1KI1A 2GQ0A 2O2YA 3MJSA 3QKRB 2AXEA 1N32B 1GQYA 1Q1QA 2GYVA 3AB7A 1K8RA 3SHVA 5CK4A 2FSVA 2AQKA 2ZJYA 3AJEA 3D31A 3KUKA 4FFDA 4O29A 1SB8A 3RTBA 5KVVA 1U8CB 1MC8A 1XKLA 1XQYA 3GUZA 1XB2A 4N54A 3ADBA 5AK4A 3IL2A 3PEVA 4M9QA 4QUJA 1AKEA 2K7FA 2FSHA 3QPDA 4C3ZA 1UQRA 4BQRA 2GCNA 2O2SA 4MGZR 5DNAA 5K9ZA 4DHEA 2IVZA 4QVKA 5J4LA 2WTUA 2PRSA 1TMGE 2DJIA 3WK5A 1VE5A 1G3UA 3ZI7A 1J5EB 1P2VA 1NYLA 2OFOA 3D7MA 1GARA 3IP1A 1OTYA 4ND8B 3VC1A 2X9LA 4YGYA 2ETXA 1I6KA 1PJTA 2HO4A 5EP3A 4HL6A 3L4SO 1PEYA 4JI7B 1F7VA 2YY6A 5IVIA 2GN6A 3HZZA 3FAZA 3IDOA 2WF6A 3MUEA 2AJLI 3G0DA 3RQSA 5JMWA 1BYIA 4DDHA 3NBKA 4YP9A 3RUEA 1XP5A 3PKZA 4ICIA 2XADA 4KL8S 4XJVA 3SP1A 4BX0A 2JCBA 2CJWB 1IZZA 4ZDIA 4DUGA 1VDZA 2HJVA 4RVGA 5AJYA 1QAQA 1WU7A 4H3VA 3QKWA 4RTQA 3TE6A 3F7OA 4JA2A 4ARSA 1PLLA 1I2ZA 4HX2A 4ZCLA 5CB4B 3V8QA 3M9LA 3M4YA 4PC3A 3GRRA 2D62A 3ESDA 4MO2A 4MYDA 1OILA 4DPLA 4LVUA 4MQEA 1TDJA 2CMHA 2BGTA 4FQ5A 4ROSA 2CXHA 4MVYA 2ESRA 3EWAA 5JMOA 4UMDA 5EGSA 4CQMD 3C74A 2C4MA 3A3YA 5K0JA 2DETA 1A0OA 4LZNA 5B36A 2WM8A 4D41A 3PUIA 5ARBA 3VNRA 1KI6A 3QI2A 1J8QA 1Z34A 1BJTA 3QBJA 4ZC1A 4EFDA 5IJ9A 2XT9A 3RI3A 2BJVA 4A2QA 4RY9A 5FBRB 2X7HA 2VUIB 3HV0A 4EGAA 1UZNA 3TDKA 1KERA 1II8A 4UEQA 2FRXA 3OUZA 3RLIA 1A50B 1AK9A 3ZCUA 2FPXA 1CUFA 1Z5NA 1U2PA 3GR6A 1I7PA 3MT9A 2QM8A 2PGJA 4KPYA 4G0YA 4X3OA 4JLWA 4WFKA 5H3CA 5A2QA 4GPZA 1TLLA 4U5XA 4NAHA 1TM4E 2EBHX 1HE3A 3A32A 4EM6A 4DA4A 1GCAA 1MDFA 1WVMA 1WW3A 1LF5A 2XOKD 1DL5A 1L7PA 3S1AA 1OYWA 3OQ6A 2X41A 3FVTA 4AN1A 3FCYA 2JJYA 1A98A 1LU9A 1WXXA 3F5DA 1NLFA 2JRLA 4UTXA 4BVEA 3COWA 1BN7A 1GUBA 3EXG2 4D6YA 1L4HA 3PGA1 1M5TA 2IUTA 5K8CA 4WE3A 3E8MA 1SVKA 4BNXA 1FMJA 1GGEA 2VDWB 4CKWB 1SZJG 3LPDA 4O4IF 1ULUA 4JX8A 1GG2A 2C9ZA 3H5AA 3HB1A 5EL0A 1WCIA 1QG2A 2IGTA 4CM4B 5AVJA 4Q9LA 5C7YA 5C8XA 2PMKA 1F6BA 1XRSB 2ZPTX 4JU8A 1QO7A 3O2SB 3PDIB 4U9HS 5AW9A 1VYHA 4WJZA 1EQUA 2OHJA 2QM7A 2VNSA 1DOAA 1VE9A 1ADJA 3OLVA 3KR1A 4G0NA 4G5YA 3KBOA 3TQOA 2B36A 1SHTX 2MMCA 3RVRA 1GAWA 1ZWLA 5A9RA 1L1FA 1J56A 2JIQA 3BFJA 1OBOA 2YR0A 5EQDA 3ZKWA 5AVWA 1TKAA 2YIMA 4ND6A 4DXAA 5G02A 5K6AA 3PQ7A 1EFAA 4MVJE 5B6JA 2DQSA 3LGXA 2Q6TA 2OYSA 3LHKA 4F5ZA 3ZU5A 4D57A 1UM9A 3LX5A 2MTBA 1O2DA 5HTOA 1B8NA 1RJDA 3DJYA 4YAGA 2OESA 4YMSA 3IFSA 3CUTA 4LRUA 3AR6A 1QHIA 3CJQA 4I4LA 3ABSB 1L5HA 3PJFA 2O52A 3NAZA 2WYUA 2X6QA 5AT1A 3NGLA 3E27A 4KQMA 1S8FA 5D3MA 5J2UB 2A7QA 2C3YA 2PYZA 2EFEB 2RMKA 2B25A 4L6CA 4B8ZA 3ACDA 1KKMA 3H4TA 2MU1A 3GZTB 4DC1A 4WLUA 3OX3A 4YMLA 4GRDA 2C83A 3EMVA 4HBGA 1QMGA 2FFHA 3R9XB 4UXJA 3D6VA 4NCHA 2WTNA 3VM6A 4F1KA 5IBCA 4WDRA 2IDKA 2LR0A 1N0VC 3TTSA 4CUZA 1TVKB 1NC3A 1VI5A 2PO5A 3QYFA 3UH1A 1ISGA 2SKCA 2WTXA 3CEAA 2WFZA 4TZ0A 2DY0A 1UMKA 5KQGA 5CAEB 4H16A 1EUCB 2GS9A 1RPZA 1UODA 2AYXA 2OILA 3CCBA 2XGSA 4MCAA 1EH5A 3B5EA 1RCFA 3KYJB 5DNEA 1U4OA 4RADA 3BOSA 3VYVA 2O54A 2FZCA 3GCXA 3N53A 1MORA 5FBLB 1MH9A 1S1MA 5AM1A 3S8MA 2AD5A 2QN2A 4D42A 3MGBA 1SGWA 2QL6A 3AP3A 4AJEA 4F1JA 4P3YA 1SUFA 2PVPA 3Q8KA 1EFRD 1UH5A 2P4UA 3NTRA 5HF9A 4AKGA 1W9MA 2Q5CA 2BKVA 3IKJA 1U6JA 3M1AA 4H7HA 5EKUA 2JCYA 2O19A 4LYAA 2YXEA 1SCUB 5JDCC 4NJEA 1E9VA 1ZJ6A 2HA7A 3QXHA 4BFLA 3KUCA 1BIFA 2PTGA 2QLLA 4H4EA 2V54A 4G56A 2IY9A 2IXAA 3DA8A 2VO1A 1IZYA 1KAQA 3LUCA 1JZTA 2ZRBA 4L4SA 3T7JA 4PXSA 4ES6A 5C7OO 5GTDA 4F6CA 3JZDA 1VLQA 4LYFA 1H2ZA 1KPGA 2PX0A 4JMLA 1NRIA 4IMPA 4MTCA 4PXYA 4Q34A 4Q9NA 4IMIB 3LUAA 1I51A 4NJMA 4CIDA 2AYZA 2ZJ2A 4TM7A 1CF9A 1TZ2A 5LMNB 2PKCA 2FFAA 2Q5IA 2YIVX 3FNIA 3TL2A 4OGWA 5ALEA 3PA8A 2ZBRA 4E1BA 3SZMA 2EW2A 3ZIAA 3MYYA 3VTAA 1WHSA 3QBVA 3V8EA 3ZGXA 1XZLA 1QFMA 2RHGB 3L6UA 3MWLA 1KJ9A 2YN0A 3H97A 1Z56C 3N5CA 3H8WA 1HDCA 2C8KA 2HU7A 3UFBA 1JIQA 2R66A 4XASA 5CURA 1ZJWA 2VUUA 4MVJM 3TSOA 3N2GA 1OT5A 2SCUB 4H2DA 3VKVA 4QGSA 3H75A 1M6VA 2NPFA 3IAS1 2WZDA 4ENQA 2ASVA 3D8RA 4LFBB 2ZRDA 4KGDA 3L49A 2CKMA 4WVLA 2YRXA 2CKDA 3K1YA 1AKQA 4ARZA 4DDMA 5KVSA 3O8OB 5DN6D 2PVSA 3N07A 3HDVA 1XZAA 3BBPA 1Z12A 1A3CA 5FLYA 5FH9A 3L4BA 1FJGB 2P7HA 2W43A 3R5XA 3HJUA 1ZD9A 4BNNA 1I8TA 4YJ2A 2XGMA 5I7WA 3KEGA 4N0EA 1NG1A 3A4LA 3Q9SA 2FJUA 3PUWA 5CHYA 4YONB 2JZNA 1FP4A 4ITVA 4R9RA 3GLFB 5PNTA 5KNDD 2FA9A 3RC7A 4ZVOA 3EZ9A 1NXXA 5AKLA 2CDBA 3KEOA 4O1MA 4CKCB 2ZIXB 2F55A 1DJOA 3IEMA 1ZA2A 2EZ9A 1ZUWA 4EGSA 1QANA 2E21A 3VOSA 4N41A 2JH3A 4GWKA 3W06A 1E0DA 2CYCA 4D80A 2R7MA 3CLUC 1XZJA 4XCXA 4EYGA 4NZNA 1Y4AE 1XKTA 3A6GA 3RIEA 1HK7A 3VTKA 3JZMA 3WYCA 3JYNA 5IM4A 2I2CA 3Q9UA 4CLRB 1EGVB 1N2HA 4WD3A 5JRZA 2G5TA 3FPHA 2GZ2A 3QYPA 4LXXA 4QOSA 1P39A 2K2QB 1N3IA 3HR7A 2I7XA 4HGQA 5TS3A 3ELBA 4HEHA 5C8DA 4D0GA 4YUAA 2B6NA 1UQTA 2AG6A 4GX2A 1QO9A 1Y6FA 2J3JA 4WBXC 2R1ZA 3C3DA 1C2YA 2N42A 4IJ5A 4EBBA 5HVNA 4BKUA 1G38A 2I3BA 2VUHB 3BMOB 3ONNA 3NXKA 4RVOA 4X1IA 2VT2A 4RVUA 1UXIA 4JQCA 1M83A 1ISJA 1E2HA 4WAUA 3PNPA 4TWIA 4P7BA 2VJYA 2W42A 3PFHA 1WE2A 4B43A 2IGBA 2FWAA 3ZVKA 4DMRA 1KMQA 2QPOA 3KWJA 2FFBA 3W5SA 4RTKA 1UOPA 3DMTC 5I5EA 4CMJA 2XH8A 3LOQA 3AHDA 2NTVA 4K6FA 2A6PA 4RM3A 3SBDA 3JU3A 3O4GA 5EEGA 3PSAA 1FUKA 3FBTA 5J3JA 2I4RA 5KX5F 1NGSA 3W5HA 3FVWA 3HDYA 5DNYB 4EFMA 1CUBA 2W37A 1DO8A 3E84A 2E48A 4YFVA 2G88A 3VPBA 3K35A 1QR6A 1WX1A 2ZAGA 3I9JA 4TMYA 3AEYA 5K8IA 5DTJA 3ZWQA 9LDTA 3HXMA 1W76A 1UPUA 4DMCA 8GPBA 1DX4A 1JIJA 1QO0D 2J32A 2W48A 5D6NA 4F45A 5JVDF 3MEQA 2QT0A 4HMQA 4RTPA 1PR5A 1VLZA 4FGLA 4HRXA 3E23A 2C3PA 2VS1A 3NT5A 4YXFA 4MRMB 3AUAA 5SYAA 2CJWA 2JHPA 3HJBA 3IPXA 5ALNA 4EABA 1VLJA 4R05A 2AA3A 4QQRA 1MIOA 3T1VA 1RMYA 3LTNC 5CB4A 3T15A 4EG6A 5CB8A 2IODA 3PC6A 3RABA 5I9LA 3NHFA 1KRWA 1WVGA 4P2BA 2V58A 1SCBA 2GD0A 3HH8A 4BGDA 3KLOA 2IDJA 4MW7A 5DP2A 5EMHA 1KE1A 4G0WA 3ZJ4A 4P54A 3GP8A 2YWGA 4RFSA 3AIIA 4GF5A 4LZPA 5FWDA 2IYVA 2G7ZA 3J81A 5KSOA 2XYGA 1UEJA 5J1SB 1EE1A 1FU4A 1L7VC 4BO2A 5C53B 4KQKA 3IUNA 4ZCRA 3H5WA 3K9GA 2NYRA 3SZGA 1GVNB 3JPWA 5HGXA 1JFTA 3QOWA 4EG8A 1L5FA 3K70B 1SAYA 4J90A 2C5GA 1G20B 1V8PA 1CQPA 2V7GA 4YP7A 3WQQA 4FFWA 3IP3A 4R2MA 4F1WA 5THKA 3D0RA 4JITA 3QVWA 4CM6A 2RHRA 4JP1A 4N8EA 4N5MA 2CFRA 4MVJF 5TLSA 4G84A 1IXRC 1DKNA 1GP2A 2E4UA 3JQ9C 4L08A 4PN3A 1C0IA 2EERA 2PD6A 3RD5A 4JT8A 3SE7A 4B17A 5DULA 2PD4A 3AL2A 3DAFA 1D0SA 2XLCA 4LFCB 5BNTA 1YQTA 1LSSA 3BFPA 2H00A 3A6KA 1RRFA 1OFTA 3AWDA 2FZVA 2H52A 3CF2A 4TTQA 4ZU3A 3L8FA 4M87A 2Q2OA 3D6HA 2EDCA 2JBWA 4YROA 2P90A 3H9UA 5L4NA 2FZGA 1XSEA 2CFSA 3W04A 1K98A 1V4NA 4TSRA 1ZMBA 1QLHA 4JJKA 4PTLA 5HS6A 2VDWA 2JBAA 2VTDA 3H1FA 4KO8A 1K1EA 1XXHE 1P5HA 4LRYA 3VDMA 1U8YA 1TD1A 5DGXA 3ET4A 4CM4A 2B78A 1E8MA 4FSXA 4CTJA 5K0BA 3GROA 2VKQA 1C3VA 2EP7A 1ZRNA 3PDIA 5E4FA 4RKWA 3BH6A 4J91A 4MVCA 5CPBA 2YZMA 2YWDA 1BDMA 1N6LA 2A9QA 4N03A 4L22A 3DJFA 3C5VA 5D3ZA 1VOTA 4EGJA 1U9IA 2Q5OA 4MQ5A 2V7PA 1YL5A 2GN9A 3P71T 3PUVA 3RWOA 2WHRA 5LPNA 3KOMA 5ALPA 3AVOA 1FQOA 2EWMA 3CNOA 2I4OA 3RC1A 3CLHA 1LSJA 5DOVA 4BFUA 4B3JA 5JPDA 4C2TA 4QUAA 5EVJA 1GPDG 1MRSA 2GBPA 4BTVA 4BVKA 5JAHA 1LBTA 3DZFA 5CLGA 5COAA 3ZV6A 3OZDA 2C97A 1I0LA 2R8XA 4G1FA 4QOJA 1GG5A 1E63A 1ORWA 2ZJOA 3C6QA 4ZOLF 5ECGC 4NWIA 3PLAE 4KLCA 4WN9B 3A1WA 3SDBA 3IUSA 3MNFA 4R83A 3RSHA 3BGWA 5BN5A 3HXTA 2IDMA 1JXOA 1Z5WA 2BBTA 2VWQA 3SNHA 4BVAA 3R9XA 2NOAA 1SEPA 2J6BA 2V3VA 4EHKA 4NCAA 3JQGB 5HXAA 3AH8A 2ZRHA 1BWPA 1V1JA 5TQVA 2DVMA 4D0RA 1CNMA 4PLZA 1LKZA 3V4SA 1TVKA 1X1AA 2QN3A 4TV8F 1YB6A 1TEHA 2DH5A 2D2XA 2Z3ZA 2VTBA 1ES9A 2WUEA 3C7AA 2AW5A 2R68A 3BTUA 5CAEA 3ZN2A 5GOTA 3RGWS 1Y89A 1Z83A 3OZIA 3UK6A 4A6PA 3IC5A 4WWHA 1BEEA 4IQFA 1T5SA 5CIQA 2CV1A 1QYRA 5JS7A 4AS3A 2ZROA 3JQ8B 2QB5A 1E89A 4QTYA 3AM5A 2OLJA 1OXTA 1K7YA 2GK6A 1X86B 3B7GA 3T99A 2BD0A 2JFGA 2QSYA 3BCUA 3P2IA 3RQIA 1CQWA 3ADCA 4NPHA 1TVCA 4IIGA 1JAXA 1R15A 1TYDE 2I8AA 1EAYA 2FEAA 3EXEB 3HFRA 3LFUA 3EISA 1USVA 1SCUA 4MWGA 4Q9AA 5K2MA 5A3VA 4BO1A 1RXUA 2I4IA 3E22B 2ATCA 1NJFA 4OSPA 4JI6B 3WY9A 4L5BA 2PGDA 2RH8A 2GPBA 3DBVO 5I7RA 1MMFB 1VIDA 2CFOA 3FTFA 3QVMA 1EP3B 1ZP6A 1L6RA 2Q1WA 3KHTA 4MI1A 1IWBB 4O2RA 1G1MA 1P61B 2BTQB 3EQ7A 4U5QA 4ZCQA 2JGJA 2X0DA 5ADHA 1AC5A 3KFXA 2ZSAA 1PEAA 1FXUA 1DBRA 2G5PA 1O94A 3L07A 1URPA 3N3BC 1TA4A 5HCIA 2IE8A 4G4SP 3IUQA 3G0IA 4QARA 4N0MA 1GN8A 3N58A 1W48A 3C3YA 3BTSA 1SM4A 4HDQB 2PUHA 3E9YA 5DTQA 1NBEA 3T7AA 3KAQA 1XKQA 3FMFA 2DHDA 2DFPA 5CM2Z 1JPVA 1ZW6A 2CB9A 1TGYA 2QJWA 5AKEA 4DHWA 1AKRA 1BHJA 1L7BA 2GBCA 3PUHA 3W5DA 3L1VA 1RE1A 3L7JA 1M0EA 1DRVA 1E60A 1Q0RA 5JECA 2I7CA 1J21A 3Q4GA 3LS2A 5HRUA 2VLIA 1EFLA 3EB9A 2WP8J 3G9ZA 4R69A 3I3OA 4NBSA 3BJIC 2P2DA 3O8OA 1JDBC 3PNQA 1Y6RA 4PZCA 1SIBE 4J0CA 4I5DA 3KTDA 2FMKA 4QODA 3FJ1A 4R9VA 3W2FA 3CE6A 4AMUA 1JQ5A 1YJAA 3NTLA 5IWAB 2ZUBA 5EQTA 3T3HA 1C1DA 2QJTA 1VFNA 2M1ZA 2DERA 2WM9B 3LA8A 3H16A 1GTL1 2FYTA 3AZPA 4ND3A 5FNZA 2H7XA 1DIOB 2WWIA 1BJRE 3GJSA 2NU7B 2ZIXA 3DBRA 3UK2A 4OUDB 2RI6A 2XRYA 1X3SA 1NV8A 2I2FA 2XGGA 4LE0A 4IHKA 4M1OA 3CU5A 4A0HA 3VR6A 4EHJA 4K9SA 2P2CA 3AX6A 4R9UC 3SG0A 2VIIA 4P4NA 1C9YA 5LYJB 4NZPA 1ZMXA 4YRGA 3GJ6A 3LCVB 2GYUA 2RK6A 5ALYA 5TEVA 3F98A 2GNOA 2CDCA 4DNPA 1A2KC 3CN9A 1VHWA 4B5KA 2Q1UA 2QGZA 4WKBA 2C8JA 2J31A 3ACBA 1TI7A 4L4RA 4Y0AA 2O2DA 4U9UA 4YBZA 2GARA 2PHZA 5JS8A 3CPJB 1YS6A 2ZVJA 5JI3E 4ZHQB 2WJ3A 1ODCA 3ROEA 1B00A 1VI2A 1LW7A 4Q9HA 6ADHA 1U5BB 1NW9B 3UJ9A 4QGFA 1FVFA 3VR3D 3B1WA 4BN0A 2ZS9A 1Z47A 2C2XA 2HJSA 4IF6A 4IS3A 4XPIA 1JXQA 4B2IA 4H7DA 7REQB 4TKVB 4D81A 5EGNA 2ZRCA 2J6HA 4C0QC 2D4HA 4PONA 3LP8A 4RMNA 4D46A 1PBTA 3D3JA 4G85A 4CIXA 1OLUB 4DREA 3N70A 3QVLA 3FSGA 3CSUA 5DEIA 2XEXA 3OE4A 3CRVA 2YV4A 2F9FA 3IQGX 3I9OA 1ZC4A 4GS5A 2R2GA 3RYHA 2JB9A 4PICA 2XW6A 4OYRA 4TM8A 5KJEA 1RZ3A 2NTJA 2AE1A 2JFHA 2P4SA 1SC9A 3VAAA 3PDUA 2VAVA 3EFHA 1G55A 2JLCA 3UG6A 1EDEA 1XYVA 3QWBA 5LLDA 2R84A 3QVKA 4K3VA 4LV5B 5J2UA 8MHTA 1M1YE 2Q41A 2V7QD 1T13A 3AXSA 4DPKA 3U5ZB 2WJAA 4LZJA 5AK6A 4QDTA 5E3HA 2X9GA 1K0FA 1UBGA 1XU9A 2GZ3A 4PSCA 5FTLA 5IH7A 2ZGVA 4C14A 3PFWO 5BQ3A 1Z0KA 1K5GA 1H2YA 4TL8A 5F52A 1NQWA 4PX5A 3KBBA 4JLPA 3PDJA 3QU5A 4GAEA 3VDRA 5JISA 3ELDA 1QQBA 3R3VA 2WE8A 1ZQ1A 3IP8A 2XUPA 4RACA 3ZWNA 4XWKA 2XBMA 8AT1A 5L4LA 2YQ4A 5DM4A 3H05A 3BX1A 3CRMA 4PSUA 1G9SA 4J1QA 4J0KA 2W4MA 1X7XB 3OZCA 1A77A 4PCAA 4ZZIA 1CULC 2RONA 2GAJA 1Z5GA 3NNDA 1CJSA 3RVJA 2HAEA 4EKNB 1UWVA 2ZRMA 4F3YA 3VVMA 4B4WA 3WMFA 1QU2A 4B6JA 4CMGA 1SCQA 3DZGA 4O4IB 2IU4A 3AF2A 4Q7LA 4OGKA 2AOTB 1U0TA 5K01A 1JHZA 4UZSA 3ZGOA 1W36C 2JF0A 2UZ4A 1KMIY 3PR2B 3RVKA 3PL5A 1TLTA 1JE1A 5JAOA 5BV1A 4PANA 3EWIA 1FFEA 3G0BA 5FWXB 4WK2B 1AN9A 1Y7HA 1TIBA 2ZT5A 2CBZA 3N39C 4IIJF 1HDOA 3FYUC 4GBGA 1NW6A 4M53A 4WKGA 5CFLA 1SQ5A 5AM2A 4RHYA 1XZPA 2CJXA 4KQCA 5FUBA 5C9ZA 1TIKA 4XVQA 2O8FA 1RLMA 4I3GA 2X0EA 4HEA1 3E8SA 1GG8A 5DP1A 3C97A 1E5DA 3HN6A 3RASA 4CUKA 5K0SA 4HLUC 3VU9B 4CF7A 2PV0A 4DR3B 3WIDA 3AJ9A 3AHEA 1VBMA 1OIXA 2J4CA 2V3WA 2VSXA 3JWHA 3SU8A 4XB2A 1AO0A 3LHDA 1V43A 3RSCA 4JFRA 1PN3A 1TUBB 3D7LA 4MWZA 4UCXA 5B1YA 1IBSA 5K0CA 2Q62A 3CB2A 1WPQA 1V4BA 3BPSA 2OUIA 4O0MA 4B87A 3DXYA 3AEKB 2NSYA 1B3RA 2GERA 3DS8A 4KR3A 1H2AS 1QUFA 1J22A 1I6LA 3EIXA 5EZ6B 5KYUB 3AW8A 5MN5A 3R7LA 4UNNA 1JLLA 4JWKA 1TKCA 1ST3A 1SUWA 4X95A 3K1JA 3T5BA 4US1R 3V7UA 3ELYA 1SB9A 2ZXEA 3CVYA 5CJPA 2HR1A 4NHOA 1EDDA 3CWCA 2QIPA 4MDFA 2A3NA 3OICA 5CP8A 4R81A 2GF2A 3I9V6 1OA1A 1XTZA 1NDQA 1KH3A 4PG5A 1XRPA 1DPGA 4TQ9A 1D9ZA 1JG6A 1P80A 3BJRA 4P7KA 2DQYA 5GONF 1MB9A 1WZ2A 4R1UA 5EHXA 3DT9A 2XECA 1KJJA 3MRVA 4Q1AA 5JFTA 2EJUA 4B3HA 1AX9A 1MG5A 2R6FA 5J5CA 5JG7A 3EN0A 1E6UA 3KOZA 2C42A 1QH0A 2WSLA 3QH4A 1TD9A 2OZVA 4JJGA 3ENZA 1NIJA 2R44A 2OGZA 1ONPA 1Z4LA 2YXPX 3JQGA 4R1QA 4IJ6A 1SEVA 1U0RA 3J7AC 1W88B 3B53X 4PX2A 2P9QA 3VR4D 4TZKA 5CDSA 3SR3A 1M2FA 2KHZA 3V1YA 1GUZA 3K4QA 4Z4QA 4H6WA 4IS2A 5E2IA 1ECBA 3T5MA 4J29A 2H06A 3PXBA 4JBGA 1JDVA 2ODWA 4PEVA 1D07A 4O4HA 1OREA 4LJ8A 3DLPX 1PR6A 3WTCA 4C3VA 4C4XA 1K6MA 2II6A 2JGLA 4C21A 1Q77A 1LC3A 2WG0A 3QX3A 1EBUA 3JQ8A 3IV7A 4LQLA 1K7XB 2RGYA 4Z8YA 5F5XA 4M1TA 3FZNA 3WJ7A 4CM8B 5G1OA 3F90A 4C0LA 4OXKA 2WVAA 1ETHA 1O6GA 2R48A 2XSZD 2Y1OA 3NOQA 3W3AA 2OV4A 4DMUB 4URVR 4EUEA 2NQ2C 2NPIA 2XB4A 1YCFA 3LV8A 4ABYA 3CIFA 3G5MA 1KPHA 1OVMA 2YFQA 1FUYB 2XDWA 3EXEA 3IHLA 5ALXA 2IFTA 4I46A 5BO5A 2IYTA 4YRIA 1JWLA 4IRMA 4Q4HB 3HI6A 2X7JA 3E22A 4M8KA 4L51A 4M1QA 5HJ7A 1BX0A 1U0OC 1YJCA 3Q7RA 2E7ZA 3TPFA 2CLDX 2DLNA 3JQ6A 4J0IA 1SXJA 2JRCA 3GBVA 2YASA 5DLQC 4UZEA 3GFGA 5EHZA 4KXVA 2RGBA 3H8VA 3ZPXA 1LPAB 1XVIA 3ZW7A 4FDTA 1DJNA 4JP5A 4E3WA 1XNGA 3RTCA 3QKIA 3QY9A 2FP4B 2NZJA 3M1LA 3BGSA 3RRXA 2QMOA 4XLZA 3K72B 5AP9A 4NNPA 4C4RA 3OFNA 3KE8A 2CK3D 1TC2A 3AIMA 3CLSC 4K9PA 4E22A 3OX2A 3QSGA 1P91A 2GM9A 5CIWA 1E1QA 3B60A 1A1SA 4B71A 2NO7A 4NX2A 1PDVA 4JOSA 1YDWA 3HZHA 2E85A 4EMUA 1VP9A 4TKMA 2WKRA 1ACLA 4R0VA 4AFNA 1PNRA 1UFVA 2I22A 1ZN8A 2Y77A 4LBZA 5D84A 5JQWA 3ETHA 5TF0A 1LX7A 3UWDA 4BNDB 1E2MA 3G8AA 1FFCA 4LGCA 4FD2A 5TJ9A 5L9AA 1W0KA 1W85B 5B7GA 4WLOA 1I36A 2QW1A 3D2LA 2PCLA 4DR5B 1KI9A 4M7RA 1DEXA 2JIZD 3NIFB 4TVOA 1VYTA 4UBJA 3WRYA 1EI9A 2XE4A 4P4TA 1YOBA 4B09A 2VZ0A 1HMYA 2NV6A 5T4BA 3RIHA 1WBJB 1FRNA 4F4UA 1MW9X 1QWSA 5LQDA 5B2EA 5CH3A 3CGGA 1FRFS 3PD7A 5EI5A 1KI7A 3BHJA 1KARA 3DPUA 4LXTA 3F9RA 1EU1A 4UOQA 4CTOA 4HWSA 3O3CA 1Z2OX 5CUQA 1L5NA 4ECEA 1NT4A 4XGRA 5JAZA 3GU3A 2QTWB 4G1UC 4OJNA 2O14A 3RS2A 4LI3X 3KQHA 3ERCA 4OUDA 2RHCA 2WZCA 2HY7A 5JO0A 2JK0A 1EJ0A 2H3EA 3HADA 1S2IA 1SBZA 1S8NA 2B4RO 1JXAA 2GASA 1CD5A 4TWAA 4Z7OB 1AMUA 2VBFA 5JWOA 5ALDA 1NSYA 4E33A 1FDTA 4FE7A 4LWQA 4PPQA 2NUAB 4PYKA 4E2ZA 4YUYA 4H1VA 5FUQA 1YBVA 3WAJA 4JJAA