4HP8A

Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound nadp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
245
structure length
245
Chain Sequence
NPFSLEGRKALVTGANTGLGQAIAVGLAAAGAEVVCAARRAPDETLDIIAKDGGNASALLIDFADPLAAKDSFTDAGFDILVNNAGIIRRADSVEFSELDWDEVMDVNLKALFFTTQAFAKELLAKGRSGKVVNIASLLSFQGGIRVPSYTAAKHGVAGLTKLLANEWAAKGINVNAIAPGYIETNNTEALRADAARNKAILERIPAGRWGHSEDIAGAAVFLSSAAADYVHGAILNVDGGWLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from Agrobacterium Tumefaciens (target EFI-506435) with bound NADP
rcsb
source organism Agrobacterium tumefaciens
molecule tags Oxidoreductase
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
total genus 95
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hp8A00
5C7OO 4Y8VA 2ZYAA 3VC7A 4R68A 1GYRA 5G4KA 4MINA 5L7TA 1UXHA 1Y9AA 3ZWXA 4CMBA 1BXGB 1H6BA 3GDFA 2VHXA 3C1TA 3TRIA 4IJVA 3U9LA 1IHYA 3HG7A 3R1IA 5DOZA 3K30A 5F3RA 2O4CA 3GUCA 4RORA 1ID1A 8ADHA 1YB5A 2AG5A 1NXQA 3HQ4O 3ETEA 3A06A 1T26A 2YFQA 3ZW9A 1YRLA 2QX7A 3AM5A 3I4CA 1Z7BA 5JXWA 1PGNA 3D64A 5I9NA 5B12A 3DBHA 5AVOA 2OFPA 3DZIA 1PQWA 1WMAA 1HKUA 4CL8A 4YAKA 1U7HA 1I0ZA 1Z6ZA 3UVEA 1Y8RB 9LDBA 2OO5A 4WECA 3AUTA 5CEJA 2NLOA 2D5AA 1HYEA 3TSCA 4FC7A 5G0WA 3NDJA 3ROKA 4P4LA 2HSDA 4JROA 2Y93A 4J49A 4EW6A 3RKUA 2X86A 4DC0A 3ZV5A 1X0VA 3DZKA 1IULA 1S7CA 2EF1A 4ND4A 3OP4A 4KWHA 3O4RA 4GH5A 2ZQZA 5CHEA 1KIFA 1HE3A 4QO8A 3FSRA 4NMHA 4XEHA 4NK5A 3EDMA 1PS9A 3E9NA 1QMGA 4AJ1A 3OEWA 4I5GA 4N5LA 5L4NA 1TXGA 4YJGB 3IKVA 1P0FA 4IXTA 2GASA 2PK3A 3BHIA 4U6SA 4DL9A 4JQCA 4XYMA 2NVUA 1J6UA 5IZCC 2JKVA 4M54A 3GRPA 1TT5B 3LQFA 2X5KO 2I65A 3RC2A 3AOEA 4M8SA 2PKRA 1CRWG 4G81A 2VRCD 4YXFA 1EBFA 1YJ8A 1SMKA 4R69A 3BHJA 4XJTA 3QWAA 5HBRA 2XPCA 2ZB7A 5A9TA 3ABIA 3U4DA 3ULKA 3JYLA 1O8CA 4FOSA 5T6BA 4J7XA 4RF2A 4CMEC 3N74A 1CQIA 3UW3A 4LRTB 2AQ8A 2FY8A 3FBTA 2CY0A 5A3VA 3ROQA 4ZVVA 3EVNA 5GZ3A 1T2AA 4G65A 1HE5A 4ZQHA 4ND5A 3OH8A 1T24A 2P5YA 2V65A 5AXAA 1WW8A 4D44A 3JYQA 4R9SA 4DGSA 1GEEA 2WM3A 3VHRA 1MA0A 1KEPA 4LN1A 4S1VA 4OO3A 5JC8A 3IIEA 1C1XA 2WE7A 3I83A 3NYWA 4OXNA 2O3SA 4LSWA 1MV8A 4HP8A 3RASA 5ER9A 3FF4A 5G0TA 4CMGA 1DBVO 3INRA 4G2NA 5CDSA 4IS3A 1GEGA 2R00A 2C5AA 1I2ZA 3VH4A 1GY8A 4TRJA 1XCBA 3AFNA 2VRBA 4Q3EA 5HS6A 4EJ6A 2Y1FA 1JVBA 3DHNA 4YRDA 5JMWA 4D46A 2XOXA 2O4UX 5TS3A 4YAGA 4JP3A 4B4VA 2OP0A 2VTEA 2QZ9A 4OXYA 3WGQA 3ZHYA 1J49A 4L76A 5COBA 2UUOA 4MVJI 4IBOA 3ZWBA 5KJCA 3EYWA 3TN7A 2Q1SA 4GX5A 1KOLA 4TRRA 3HWRA 2X4GA 4HWKA 1LU9A 3O8QB 3OA2A 3OMLA 1ADBA 1FK8A 5ILOA 2NUAA 4FGSA 4BO4A 4BKUA 1OBFO 1EK5A 2QYTA 2QIOA 1MP0A 4DYDA 3R0IA 3ANNA 1R4MB 4RVDA 2I66A 4ND2A 3I9JA 3GH3A 1WLYA 3ZZNA 4Z9YA 2RHCA 1Z82A 4J7CA 3VPHA 4M87A 3FNFA 1IB6A 3GEMA 1BW9A 2OUIA 4WE3A 4J90A 2XXBA 4ILKA 1F8GA 3AU9A 5ADHA 1V3UA 5CDTA 1K5HA 3QHAA 4I1IA 2PTGA 4WCFB 5BSEA 7MDHA 2HMWA 1LSOA 3A14A 4FJ1A 4JIGA 1V9LA 4RVHA 5TF4A 2GD1O 2FZWA 3GK3A 3NDRA 4R1UA 2GR9A 3W4JA 5L4SA 1TT5A 3F4LA 1GPDG 3PI7A 2W2KB 3GOHA 3E8XA 4OM8A 2NTNA 2H63A 1DB3A 3VZPA 3E82A 1EQUA 2ZJ1A 2ZK7A 4WCDA 5AQ1A 3GMSA 1U3UA 1ZK2A 4CQMB 4CV2A 5JDIA 4NJMA 3U3XA 1XU9A 2Z1NA 1CDOA 3LVFO 1YDEA 2ZJ0A 3FNEA 1GUYA 4J9UE 5TJHA 1HL3A 1NBOA 1QLJA 1GDHA 1KY5A 5LDHA 3LT0A 2LDBA 2HCTA 1U3TA 3SEFA 4CLOA 3I9KA 1H2BA 2SCUA 3KEQA 4DIFA 1EQ2A 4EUEA 1K3TA 1U3VA 1HEUA 5KIAA 5JFOA 4OXKA 3IL2A 3ASUA 2C59A 3WX0A 3A4VA 2R2GA 4JGBA 3DAFA 1KVUA 1ONOA 2P91A 1XQ1A 2Q3EA 3JD0A 4DIBA 1WDLA 5H82A 4FFMA 4Y9DA 2OMEA 1EMDA 3K92A 3OJOA 3CZRA 4J1SA 4XRGA 2P5UA 1C1XB 1NWHA 1NPTO 1O9BA 1QYVA 1Y8QA 2B35A 3DB2A 1IZ9A 4DRYA 4Q3NA 3OETA 2NU7A 4BV9A 3G0OA 4NIMA 4CQLA 5JDCA 5JAMA 3H7AA 4IDDA 3U49A 4J0EA 3HDJA 4BHTA 4XIJA 3OJLA 3DFUA 4NBTA 1OZAA 1PZEA 3V1UA 2DQ4A 2YYYA 4P38A 1DLJA 1JW9B 2VN8A 3Q1LA 4NU6A 4ZN6A 1NFRA 3RJ9A 1Q1NA 5I8WA 3ETDA 1AN9A 1O6ZA 1YO6A 2HQ1A 1EFLA 1ZXLA 1GQYA 4RGBA 1E1KA 3KTDA 5KJ6A 4XJSA 4HFNA 4WPGA 2FWMX 3UAGA 2JFGA 4PLHA 4XDYA 1SPXA 2DUUA 4DQVA 1B7GO 3JQGB 5GMOA 4PVCA 4ALLA 2Y0EA 1YJQA 1WZIA 4BNZA 1SBYA 1HLDA 1J0XO 5JO9A 1RM0A 3QWHA 3CXRA 3TNLA 1PEDA 3GG9A 3KSUA 4FIZA 3QVTA 4JBIA 4MOWA 1PS8A 1KETA 3RU9A 1L7DA 1R4MA 3GPIA 4LSMA 3WDSA 1JU9A 4R54A 4RVGA 2FSSA 3I3OA 2H1SA 2WEKA 4BO0A 1N92A 3F4BA 2WDZA 2CVZA 3GDOA 5F1OA 3KYDB 4XIYA 2DT5A 2GUGA 1DJQA 4IIUA 3ZWMA 4TQGA 4DA9A 1XSEA 2VQ3A 4FN4A 4DREA 4CM5A 4LGVA 5GY7A 1NQAO 2OHXA 3WGZA 1E6WA 1V3TA 1I8TA 3NJ4A 1BDMA 3GA0A 4BKRA 3M6IA 4BNVA 1JKIA 4L0QA 3F3SA 2OOSA 3E5MA 4N5NA 3L0DA 5JNLA 4CV3A 3D4NA 2O23A 1KBZA 4J2OA 4YAIA 1B3RA 4LMRA 4D0SA 4MP3A 4Y6RA 3P2OA 5BNIA 3R6DA 1U2GA 2PKQP 3LF1A 1DO8A 4W99A 5DBFA 1GUZA 1R0SA 2Q46A 1A72A 3I23A 5DULA 1VE9A 5B1YA 3VPGA 2EKLA 5L7YA 2CFCA 3AU8A 3QWFA 3P7MA 1UZMA 4GVXA 4DLLA 1KVRA 2PV7A 4FSHA 4HUJA 4WOKA 1WMBA 5T57A 1NVGA 4ZGWA 3DOCA 4ITUA 2P9EA 2VUUA 1ZSYA 2HDHA 3ST7A 2IYPA 1BDBA 1IY8A 2QYSA 1VJ1A 3B6ZA 3PK0A 2I3AA 2PR2A 4BKPA 1GV1A 4OHUA 5K0ZA 1UJMA 4KQWA 3PYXA 1CF2O 3D3WB 3WMXA 1V6AA 4U5QA 3HJAA 4NJOA 3ETGA 4BO7A 5KVCA 2E49A 1A27A 4IM7A 3TJRA 3GVCA 3W8DA 4Z0TA 4F3YA 4G5HA 3TOXA 1FDUA 1ZFNA 1UDAA 1YBAA 2A35A 2VHZA 3B1FA 8LDHA 3O26A 3VKUA 1PJQA 4HFRA 6LDHA 3RFTA 2W2KA 1F8FA 2Y1CA 3MCVA 4RDIA 3VTZA 1E6UA 1V0JA 1E7WA 1U5CA 1ZJYA 2VWPA 4DIOA 3NAQA 3IOYA 4RF4A 5TIIA 4PLFA 1V35A 4W9NA 1QRRA 2ZTUA 1ISFA 3NKLA 1KS9A 4MO2A 1UP6A 3TL2A 4BB6A 5KCZA 3WNQA 3X2EA 3H9QA 5EMHA 2YHIB 4ALMA 4BNTA 4MVJA 1DRVA 1XLTA 1VC2A 4OYRA 3PHLA 4XB1A 2PKQO 3WBFA 4YT4A 1PJLA 1Y9EA 1YBMA 4CMJA 4D3DA 1PQPA 4I8XA 1A9ZA 5DF1A 5ITVA 1DHTA 3OM9A 4ALKA 4XDZA 2EERA 1QLHA 4IJWA 1HRDA 3ONDA 3T4XA 1LQTA 4O6VA 5JAIA 4XGKA 5I9MA 4JLWA 2CDBA 3I9LA 2VZ8A 4Z6KA 3VPSA 3WYEA 1IPEA 4BO1A 2W98A 4I08A 3F47A 1IYZA 1U2DA 5FEUA 1HE2A 1ULUA 2DBZA 2NQ8A 1E5LA 3BTSA 4U6QA 5A05A 1D1TA 2D3TA 2Q99A 1E5QA 3ZN2A 5LCXA 2IZZA 3VVBA 4AJKA 5G4LA 1UXJA 3JSAA 2DM6A 4L4SA 2YQ4A 3H5NA 1ZNQO 4TVBA 2NU8A 4NU5A 3G3EA 3LC1O 4GMFA 4NBVA 1ZIDA 3WS7A 2NNLD 3HN7A 3SC6A 3JQBC 3CTMA 3SC4A 3RUFA 1HTBA 1U1IA 5DZSA 3NGLA 4PRKA 1P74A 5A5FA 2PWZA 3ON5A 2CF6A 4GL4A 1FMCA 1EK6A 3TZKA 4CLRA 1YOVA 2B36A 1HDOA 2IXAA 2JAHA 1KVSA 1A4UA 2FP4A 1LDMA 1NQTA 4M86A 2O3RA 1WDKA 2JL1A 2NV6A 4RF3A 2D59A 2X9NA 2GLXA 1U9JA 2Y0CA 2X5OA 4CM7A 4HKTA 2X8LA 3D3EA 3RIHA 3LDHA 4BMVA 1H6AA 2H5LA 5CG1A 4IIVA 3DZFA 1MG5A 3WTCA 1SEPA 3SLKA 4BGVA 1PJ2A 1Q0HA 4B4UA 2FR8A 2X0NA 2P9CA 3C7CB 2NADA 1PS0A 3RUCA 5KTKA 1N5DA 6ADHA 3BYZA 4YT2A 4Z9XA 4A0SA 1NQOA 1V8BA 2EG9A 1NX6A 2O3QA 4E13A 2VNAA 3GHYA 3WYBA 4F45A 1MB4A 1RYDA 1Y8RA 2DC1A 5DNAA 1EVIA 1ULSA 1UXGA 3PVZA 4XA8A 5JDIC 1NVMB 1UR5A 3KSDO 4K9DA 4PLWA 5DOVA 4TZKA 1P1FA 3V1YA 3MJCA 3L6OO 2E48A 2O7QA 4B3HA 2E4AA 2BMAA 4UUNA 4UVGA 4DTIA 2EJVA 1P1HA 2QRLA 3FCOA 4GX1A 1HWYA 1UAGA 1GTMA 1K6XA 4MVJH 5I8ZA 2PGJA 2JCVA 1I10A 1B26A 4WEQA 5BQFA 2ZQYA 3DHEA 4BKQA 3PWSA 1LEHA 3QRWA 1DIAA 4YT8A 4YJGA 3NTRA 2ZCVA 4H15A 1HZJA 4PLPA 4ALNA 4E2ZA 4CMEA 4YAEA 5KKCA 2P4HX 3IJPA 5T67A 1G1AA 2D0IA 3NEPX 4U0JA 5EQDA 2RH4A 3C7AA 3PQDA 5JDCC 4DQXA 3PGXA 1R6DA 3I6QA 3V8BA 3WOHA 3PTZA 5HWSA 1Y6JA 1QSGA 3FPCA 4O5OA 1XWFA 4AJLA 2AXQA 3PHGA 1GZ6A 4CODB 4AJ2A 5COQA 4OOEA 4NPCA 3TZ6A 1DFHA 5KJ1A 1GD1O 4KOAA 2P2SA 3CEAA 4AL4A 3Q2KA 3ZU3A 4AJIA 4DC1A 5BNFA 4WEOA 4NDNE 3OFSA 1QXSA 3JYPA 5TJ9A 1BWSA 1ISGA 4EJMA 3HN2A 1UDCA 3AUUA 4BGUA 2C2XA 5ENDA 2UDPA 4XQEA 4NHEA 4LRSB 3GNTA 3I1JA 4B7CA 4MVJM 4EZBA 2NTJA 4ZQGA 4P8RA 3RQSA 5CDUA 2Z5LA 1OMOA 2C0CA 2FPIA 5FFFA 1C0PA 3NX4A 2JD0A 4BV8A 3VKVA 3OIGA 1BVUA 1GU7A 2J3IA 3GN2A 3WNVA 3ZCXA 4L75A 4BB5A 3EGOA 3PIIA 3NT2A 5A9SA 3COSA 4EUFA 4CQLB 1NHWA 3JQCA 3PJFA 1OC2A 3D4PA 5B4VA 1I3MA 1M6WA 3FBGA 4EI2A 3D4OA 3T7CA 1LLDA 5BSGA 2GRAA 4NBRA 3VZSA 3BMOB 5T8KA 3ZH2A 1JWBB 1TVEA 4ONEA 5IFLA 2VUSA 4OIMA 3WG9A 3NV9A 4I5EA 3F5SA 2EIHA 2CUKA 4RO0A 1E77A 2Q2WA 4OKNA 5CG2A 5THKA 3JQGA 3HSKA 1HLPA 1VL6A 4WLFA 4BGIA 3PYMA 4YTEA 3RSHA 5IDXA 2I3GA 3KLPX 4A10A 1ISJA 1WZEA 3DBHB 3FD8A 4Y67A 4YDRA 3DOOA 4IMPA 3UF0A 4RPKA 1RM3A 3UICA 3NT5A 1U5AA 3ZWYA 3JD1A 1UXKA 1T1RA 3KYBA 3S55A 1PL7A 4ESOA 5ITWA 1DHRA 3IQDB 4P4NA 4R41A 5TGDA 3I6IA 5DCYA 1HF3A 1LLUA 2FSVA 3AI3A 3CE6A 1GQ2A 2V6GA 4TWRA 3G79A 4XGIA 3ZNQA 2IEBA 3GVPA 4K1LA 3ZW8A 5CEEA 2D2IA 1H9BA 1R12A 2J5QA 1F17A 3PEFA 2G5CA 4YRBA 3VAZA 2XAAA 4QO7A 3VTFA 1NAHA 1DIRA 4PG6A 3Q0EA 3RUHA 3H5RA 4S3MA 4F46A 4ZICA 2HMTA 4ZU3A 3HFGA 1WDMA 4CM8A 1PZGA 1T1SA 2A94A 4FOOA 1SB9A 3BMQB 2B69A 1J5PA 1XG5A 5IJZA 1PR9A 1Z45A 4Y98A 3LT2A 4GPD1 2LDXA 4LMPA 3WBBA 1HE4A 4RV9A 2D4AA 2WD7B 3G49A 4YACA 3HHPA 4CLHA 1XU7A 2Y1EA 1JKFA 2OORA 1M75A 1GL3A 1IOLA 1WXDA 1BHSA 3QV1A 3N58A 4XB2A 3UCXA 5B4TA 3EY4A 3OSUA 3WIDA 4YB8A 4GAEA 1Q2XA 2IRWA 3TDKA 2YUTA 1O94A 3NT4A 4J0FA 4MVJP 4TRMA 2OL4A 3GHHA 2EV9A 4KTTE 3WLEA 2JD2A 1DFGA 3GT0A 2EJWA 3PHJA 4E5NA 1UZNA 4O63O 5EIOA 1TI7A 1GV0A 1KEUA 2D5CA 4I5DA 1PL6A 2H6EA 3WJAA 4U0KA 4OJNA 1ZW1A 3RUAA 4DBVO 3FTNA 4FJ0A 1PR3A 2CNBA 2HMUA 5IG2A 1MG0A 1YWGO 2F00A 3PXXA 4U7WA 4MVJD 2VNSA 1I33A 3GVIA 3L77A 2P68A 1DJNA 2B37A 2FR1A 2HJSA 2RCYA 4YJHA 3QVSA 3FR8A 1A4IA 5ENVA 5H81A 5L45A 4RQTA 1LDBA 1ZJZA 1YL5A 3ZV3A 4DPKA 2WYUA 1ENOA 3C1OA 3EK2A 3GNSA 3WSWA 1N8KA 3G1TA 5FWNA 3JQDA 3FHLA 3VH1A 3TFOA 1NTOA 1X7GA 4XKJA 3BAZA 4I5FA 2GERA 2Q1WA 1QYXA 1N9GB 2Y66A 2EP5A 4IQGA 3S2IA 4IQ0A 1JAXA 4BNUA 4GLLA 1T4DA 2TMGA 4PN3A 3WIEA 4EJ0A 4E2XA 2I9PA 4ID9A 3ZU5A 4DVJA 4Z3DA 1N9GA 4HY3A 5IDWA 3ZWNA 4AG3A 3JQAB 4DQUA 2C82A 1TLTA 5MGBA 3QW2A 5A9SB 1EFKA 1FF9A 2VUTA 2BI7A 1EVZA 1Y5RA 3GR6A 2FHSA 3SX2A 1C0IA 4WCFC 2FOIA 1A71A 3R3JA 1E3SA 4FFPA 1X1TA 3GZNA 3PIDA 3PPIA 2GN8A 4II2A 1DPGA 2B5WA 4YEDA 4PLVA 4FS3A 4X54A 5KJFA 3Q9UA 4GWKA 1MLDA 3TOZA 1E7RA 4QECA 4XQ9A 3WR5A 3WGGA 4YAJA 3BZUA 3IJRA 5FF9A 2QG4A 2RIRA 3WSVA 2W8ZA 2CDAA 2EW2A 4E30A 1DXYA 5EESA 2VT2A 4U8GA 1DIGA 1GAEO 4GWGA 5ILGA 4D3FA 1J4AA 4IINA 1D1SA 3PQFA 2DLDA 3A28A 3Q9NA 4GVLA 3I5MA 3QA9A 4Q3DA 3WQRA 4DPMA 3OQ1A 3OQ6A 4CM6A 3KHUA 3R3SA 5I7EA 5U1PA 3HB4X 1K6JA 4RQUA 4C4OA 4FCCA 3STHA 2W2LD 5L95A 4ZRNA 1QR6A 3CZMA 5JCJA 3U5TA 3DOJA 1D4FA 1KVQA 1LBEA 3FPLA 1W73A 2CZCA 5FYDA 4TMFA 4CUZA 2VWQA 4WJZA 4YPOA 5B4UA 3QLJA 2CDCA 3H6KA 4RVFA 4FFNA 4YQYA 4YYZA 3BTUA 2O7SA 1NM5A 2IODA 2UYYA 1BRMA 3K9QO 4WUVA 2W90A 2Q2QA 3WFIA 4BNHA 5H83A 3ADPA 3FWNA 4HXYA 4PLCA 1MUUA 1G0NA 3IS3A 4MP8A 3TZHA 2ZATA 3RC7A 5IZCA 2BKAA 4DLAA 3BTVA 3RROA 5T5QA 2DFDA 3Q6IA 3WGOA 4A2CA 3ZWAA 3GG2A 4LVCA 3M2PA 5BSFA 3ZGYA 2PH5A 5HA5A 1Q7GA 1F14A 4ND3A 4YJFB 3U4HA 2JFHA 3H3JA 3U09A 4CV1A 1YGYA 1GZ3A 3C24A 1YONA 5A3JA 2AW5A 2J8ZA 4IZIA 4AJHA 1P44A 2V6MA 5KJEA 3GQVA 1PJ4A 3L4BC 1XHLA 3MZ0A 3I9OA 5GZ6A 4CV0A 3AUSA 4DPLA 1DC3A 5C7LO 3D1LA 4W6ZA 7ADHA 1DIBA 3LSYA 1C0LA 1GCUA 4OGWA 2FPGA 3S1LA 3H3FA 4E0BA 3PZBA 1N2SA 3PP8A 1SZJG 1XYGA 1E3IA 1RKXA 2C07A 4XQGA 4PZDA 2A4KA 4NFSA 1FDSA 3LLSA 4BO6A 5K6AC 3SBOA 4MJLA 1VLLA 1UH5A 4UVIA 2PA3A 4KWIA 5F1KA 3WWZA 3WGIA 3A9WA 4M1QA 4OL9A 4W7IA 4CM4B 1U8FO 3ZHXA 1P33A 4NNJA 4EEXA 4L4XA 2OXIA 1FDVA 2BGLA 1ZK0A 3LZ6A 3ENKA 4WLEA 3JV7A 1F0YA 1DDOA 1ZK3A 4PFJA 4PG8A 3JCZA 3CH6A 4CM4A 5JBIA 4JXKA 3E18A 4P22A 2C7VA 3JTMA 2Y67A 1B15A 1DIHA 4PGFA 2EKQA 1DAPA 3WQSB 3L9XA 4D79A 4BNYA 1EUCA 3VH3A 1GADO 4K26A 5LC1A 1IL0A 4YRAA 2VYNA 2GYYA 1VRWA 1YVEI 3NUGA 4TRNA 3SLGA 3KETA 2WWRA 3VH2A 1SO8A 3SVTA 3AOGA 2DVMA 3LU1A 5IAAA 4OSPA 5F1PA 1VKNA 3H9UA 2E37A 3E6AA 3BTOA 5A4DA 1MXFA 1HDXA 1MFZA 4E32A 5IN5A 1R66A 3WGHA 2WJPA 1T2CA 4IDAA 3LK7A 1ML3A 2O2SA 4QTZA 4A7PA 3FR7A 2QRKA 2X5JO 3H9JA 3O03A 4DLBA 3EMKA 4PCVA 3VDRA 3GMDA 2RH8A 2XF8A 3V1TC 1GQQA 4JP2A 2B4QA 2PGDA 3KZVA 3GZNB 3DXFA 4ZQFA 5JLAA 2Q1TA 4RLSA 1IE3A 2HLPA 2V6BA 3QWIA 4HBGA 5IZ4A 4J6FA 2EW8A 4QUKA 4HNGA 4E5PA 5A1TA 5JY1A 1NFFA 3DZGA 2NVUB 3DBVO 2E6UX 3EZLA 2DAPA 3RVDA 3BMCA 1PGOA 2AEMA 3E9MA 1P9LA 4BMNA 3GN1A 4PVDA 4URFA 4QT0A 3W4KA 4CMHA 5C3MA 4WOJA 1UUFA 1ZSNA 3E1KA 2FZEA 1JTVA 4RF5A 4J1NA 4PG7A 4H3VA 4NH4A 3LYLA 1F06A 1I2CA 1B14A 1ZMTA 3PDJA 4D42A 3IKTA 1YL7A 3MJ4A 1RM4A 4BOYA 3GFBA 3ROPA 4UAGA 4QEDA 1YH3A 4LCJA 3U4CA 3RBXA 2X1HA 4JK3A 1XIVA 4UREA 1PTJA 1JWAB 2HKIA 2VT3A 1FXSA 1GZ4A 1W4ZA 4MIYA 2AEJA 4FW8A 2UVDA 2VYND 3PFWO 5AOVA 3V2GA 4BKOA 4XYLA 5L4LA 2BFOA 4EDFA 3Q3CA 4IDGA 4GI2A 1E7YA 5A5EA 4JJIA 1R37A 4WLVA 3PQEA 5AYVA 4D0RA 4L9RA 3OA0A 9LDTA 4YJFA 4D43A 2G76A 4GX0A 3V2UA 4DWVA 5ICMA 3SJUA 1I5RA 3JQ7A 2YQ5A 4KUEA 1ENZA 1PZFA 4K28A 5KVQA 1HSOA 3DAPA 1Q0QA 3U0BA 2DTDA 4OOFA 5JO0A 2DBQA 1EUDA 5L7WA 1D7OA 3T7EA 1QYWA 1PU2A 3AI2A 4CR6A 4XCVA 1XGKA 5CEFA 1NAIA 4IUYA 3PZRA 1T2DA 4I9NA 3EC7A 5DBGA 3CUKA 2JD1A 4YBZA 4ALJA 3H8VA 3DEYX 4CL3A 4GLOA 4MP6A 3C8MA 4H16A 4ND1A 1KC1A 1PJBA 1UXIA 2VHYA 1OOEA 3T4EA 2Y99A 2Q49A 4AJEA 4JNKA 1PIWA 4YVFA 4XYGA 4IDEA 3EHEA 1KY4A 1B16A 2NVBA 3KXDA 3W1VA 1LSSA 1E7QA 4J1QA 5DBIA 5K9ZA 3I9NA 5AXCA 1YS4A 3MJSA 4ROSA 4IDCA 1PJTA 3AI1A 3PHHA 5KOIA 3K31A 1B2LA 4QXMA 4D3SA 3NTOA 4AVYA 3DBLA 3H4VA 3AW9A 1GYPA 5DT9A 3QY9A 4B8ZA 2I99A 3EW7A 4M89A 1X7DA 3CMMA 1HYGA 1SOVA 3DR3A 2ZIZA 1MGOA 5IDQA 1RM5A 5DCUA 3UH1A 2JCXA 2JJYA 3ZV4A 3JQ8B 2JAPA 1ZMOA 3DMTA 2QZZA 4YQZA 3H65A 1PJCA 3KOUA 3OHSX 2IDZA 1H93A 1E3WB 4BVAA 4LISA 1H94A 3DTTA 1P31A 1DOHA 2AA3A 4FC6A 4PIVA 4OAQA 4UUMA 4YA6A 3F46A 4FB5A 3CMCO 3S2FA 4BIIA 2YJZA 3WGYA 2J3KA 2EGHA 3JYNA 1DFIA 3P2YA 1X15A 1CYDA 3GVXA 3HUDA 4EEZA 1U7TA 2G0TA 2AQIA 2VWGA 4IJUA 3M1AA 4GMGA 4WGGA 2I76A 3C85A 1SAYA 1BXGA 4RCVA 2HU2A 3RCBA 2EEZA 5CPBA 2NACA 2BHLA 1GPJA 1LLQA 4RZIA 4ZA2A 2IYOA 1V3VA 4KUGA 4KUHA 1LQUA 3GEGA 4R9RA 5DN9A 3GNQA 3MOGA 2Y05A 4CQMA 3DWFA 2D8AA 3H9GA 3FWZA 4Q39A 5THQA 3BMQA 1NPYA 2AHRA 3W8FA 5K6AA 1EDZA 1EEHA 3INTA 5CDGA 1GCOA 3W6ZA 4EBFA 1E3EA 1NR1A 1XQ6A 3AM3A 1ZVMA 4XD2A 3QVWA 3JQ9A 4QX6A 1OFGA 1Q0LA 1ZEJA 3GVHA 3O8QA 1QG6A 1B0AA 2AE2A 2GN4A 3KBOA 1I3LA 4JCOA 1O89A 3C3XA 4NJMB 3PLNA 2Z95A 2GDZA 4CJXA 2OGUA 3K5PA 2OZPA 5F5NA 1LI4A 4A73A 5A03A 4BUCA 4E5MA 2A9FA 1JQBA 3MWEB 3RUEA 3MTJA 1XKQA 1LX6A 1BGVA 2X58A 1DSSG 3Q11A 4FR5A 3PFFA 2RHRA 3D3WA 4CM3A 5BSHA 3QIVA 2IXBA 3AUAA 3OBBA 1P45A 3PYLA 4K6FA 4UEOA 3GLQA 1PJSA 2NU6A 3AY7A 3WFJA 3EVTA 2HMVA 2I67A 4LCEA 4NBWA 5EERA 2YDYA 3QVOA 4CM8B 3JQ9C 3V5NA 3NTQA 1CETA 4YR9A 1U3WA 1Z73A 2NM0A 4EUHA 2C54A 3HB5X 4XR4A 4JX8A 4FFOA 3AOEC 4UVEA 3ANLA 3VZRA 1K2WA 5DDIP 4AJPA 4XX0A 3GC6A 2YFHA 1DC6A 4L8VA 2EXXA 4RZHA 4RPLA 1AUPA 2FMUA 4W7HA 4IDFA 3RFXA 1O5IA 3FNHA 3ZNPA 4YJHB 1E0DA 3RBVA 4Z0HO 1I32A 4UEKA 4XWYA 2PFGA 3CINA 3HZZA 4L74A 2X0JA 3S8MA 5J23A 5CFZA 2J5RA 5CP8A 1ENPA 2O2YA 4CLOB 1ZUD1 1B8VA 5C7IO 2C2YA 2I5PO 4BQPA 2YV1A 4R16A 4RVUA 3ICCA 3PJDA 2UV8A 4R1TA 1EVJA 4UEJA 3L9WA 5HM8A 3D5TA 3SXPA 4BNNA 1KEVA 1T25A 3G1UA 1VL0A 2F1KA 2C5EA 4BNIA 2HRBA 2JFFA 3RFVA 4A03A 5JS6A 5KKAA 4MDHA 2R00C 1EBUA 2J3HA 2Q4EA 3ZWCA 3PJGA 3ONEA 2Y1DA 2VZ9A 1OI7A 5ICSA 5KVVA 1WWKA 5TRTA 4QQRA 5G0SA 3UCEA 3QP9A 2FN7A 4RJTA 5CDYA 2GF2A 1DLIA 1UP4A 3RU7A 1TA4A 5IXSA 1NNUA 4PLTA 2HMSA 3PDUA 4E2WA 3RUIA 3JD3A 2A92A 2X9GA 3GDGA 3GRKA 3HFSA 4PZCA 5JAZA 3ZWPA 4W9NC 5TNXA 1U4SA 3OJFA 3GAFA 3KSZO 4BNXA 5U9CA 1DC4A 2HAEA 1ADFA 1XA0A 3ICPA 4XGNA 4HV4A 2GN9A 4XR9A 4CQMD 4E12A 5HS4A 4OKIA 2IE0A 2VHVA 1LC0A 1P1RA 5DCWA 1H5QA 1ORRA 4N18A 4JN6B 1RYEA 1LXCA 4W4TA 4C7JA 3ANMA 2B4RO 5I7FA 2B4TO 4R01A 2JHFA 4IGFA 3WWYA 1PX0A 3ZWWA 1VL8A 3IUPA 2FR0A 1WAMA 1NR7A 4E33A 2AE1A 4BNKA 3EZYA 2YDXA 1NPDA 3KB6A 3M2TA 2X9VA 5JCXA 1JAYA 1T4BA 5L3ZA 3KO8A 1K6IA 1AXGA 1C14A 4WNIA 4DBZA 4XYBA 2GNAA 1CERA 4GSLA 4IPTA 2WD7A 3GUYA 2WYWA 3RUDA 2RAFA 4FFLA 3E48A 4IGEA 1N1GA 4CMAA 1LTHR 3WGTA 1VKOA 1PWZA 4BS9A 4M55A 1BMDA 2E82A 3OIDA 2WTBA 3LLVA 1AHHA 2C7GA 1N1EA 2ZTVA 4CR7A 4TSKA 4ZRMA 3LC7O 1I30A 4AJ4A 3TL3A 4DUPA 2BF7A 5HTOA 2WMDA 4R5MA 5BT9A 2BGMA 1P1KA 2Y68A 3ASVA 1BSVA 3OICA 4PG4A 2EHDA 2YV2A 3N7UA 2GSDA 3WB9A 4NR0A 2HK7A 3JQFA 3U62A 2EGGA 2J3JA 5L9AA 4F6LA 3OJEA 2PD6A 4BO2A 3MJTA 3RD5A 4KP7A 1I36A 4J91A 4PZEA 4CUJA 1HXHA 4MKZA 2PGLA 3P5SA 4RPHA 3C1AA 1PZHA 2GZ2A 3NJ8A 4N54A 3D7LA 1LA2A 4HX5A 1PSDA 3RC1A 1R16A 3RI3A 3DMTC 1C1DA 3DAGA 2GO1A 1X14A 1HYHA 4IMRA 1N7HA 4C7KA 4GX2A 1B3BA 4D45A 1LNQA 3W4IA 1C1DB 4WLNA 5L40A 1E1LA 3I52A 3ONFA 1VPDA 4Q3CA 4EITA 5KVSA 3DZHA 3WJ7A 2HUNA 1CEQA 1VSVA 2VHWA 1RWBA 5EN4A 4R51A 4B4WA 2D1YA 3HDQA 1NP3A 5U4QA 3OQBA 1LRLA 3E03A 2ZKLA 2CVOA 3DHYA 4B3JA 1TT7A 1U28A 5JPIA 4B7UA 5T64A 3GEDA 4F6CA 1LDEA 3GF4A 1LJ8A 3QQPA 2O3TA 1CWUA 1JA9A 2FRDA 4OQZA 4BNGA 3ZHBA 1T2EA 2VWHA 3OECA 1ARZA 1ZEMA 2HJRA 3JQAA 2B83A 4B4OA 1HZZA 4CLXA 4RLHA 5DP2A 3AM4A 1SCUA 1GYQA 3UUWA 1JDJA 4BNWA 5I7SA 1YBVA 2XXJA 3LC2O 4NG5A 3MOIA 1XEAA 4Y6PA 3VPFA 1BTOA 2DKNA 1ENYA 2GN6A 2Z1MA 3HE3A 4HFMA 1LUAA 1TB4A 4GGPA 3F6YA 3ENNA 1CQJA 2DTXA 5IN4A 2NTVA 4CMIB 3OEYA 2VCYA 3BMOA 5TC4A 2DTEA 3BMCB 4XZ3A 2YY7A 3DZBA 1SC6A 3KV3O 3M1LA 4NK4A 2Y0DA 3TQHA 1ZZEA 3PGJA 3IUSA 2YV3A 1LSUA 3JQ7B 3JQBA 2PLAA 3MJVA 1PWXA 4OQYA 4FPXA 2PD4A 3W8EA 1YXMA 2B5VA 3DDNA 5EQFA 4IDBA 4A5OA 5HRUA 1ISIA 1R4NB 5G2OA 5COAA 4A27A 3RKRA 3VDQA 1P0CA 3MWDB 3JQEA 3OF2A 3AFMA 5AXBA 3KYCB 3QSGA 1R15A 3KEOA 2ILTA 2X7HA 1I24A 1Y81A 1P77A 4BO8A 1ZKMA 2CD9A 2GPTA 1JN0A 2UUPA 3JD4A 3JYOA 1JKJA 3KUXA 1PL8A 4P4GA 5JCJD 3AJRA 1ADGA 4R4JA 3D5QA 3DTYA 4KZPA 1YKFA 2JCYA 1YQGA 4BL5A 1XR3A 3MTGA 4J1TA 1YB4A 3HNPA 1ZO8A 4RL6A 3NDIA 2ZYGA 1R0KA 3QJ5A 1A7KA 2CMDA 1H6CA 4ZQBA 4R5HA 2BLLA 4AJNA 4CR8A 2DPGA 4UUOA 4Q3BA 4YJDA 1E6EA 2X22A 2WYVA 3ORFA 1A7AA 3PHIA 5ER6A 2JHGA 1JVSA 2PZJA 4J43A 1YB1A 2ZB4A 4BO3A 2Q1UA 2Q50A 4Q3AA 4AFNA 2EWMA 4J4TA 1LRKA 2FPPA 4FFRA 2CVQA 4E2YA 5I7VA 5L51A 1X0XA 3L4SO 5GZ1A 4QFDA 5JW6A 1HDGO 3PWZA 5JYEA 1KEWA 3F5QA 3FTPA 4Z3KA 3JQ6A 2WE8A 3D0OA 2PZKA 4CLRB 1FJHA 1T2FA 4R1SA 4FDAA 1ISHA 4I9HA 4GSKA 1YQDA 2G82A 4IZHA 2NQTA 3FN4A 1I3KA 1UZLA 4QFCA 1GUFA 3OJ0A 3ZWOA 4KTVE 3WYCA 5G0UA 2RBEA 1E92A 3C7DB 4BQRA 2NVWA 3DBRA 1B8PA 2ZB3A 3UKOA 4JJGA 2HK8A 1BW9B 3JQAD 2ZTMA 4R1NA 1ZK1A 5F21A 1E3JA 3RBZA 1EUZA 4BNMA 2VRCA 3H9EO 4GGOA 4YWJA 1Q7BA 4B7XA 1JLLA 4GQAA 3DMYA 4J2HA 3GGOA 5LDGA 1H0KA 1Z7EA 2CSUA 3GGPA 1LDYA 2BGKA 3K73O 1QV6A 4Q9NA 2VYVD 2DBVO 4D7AA 3RJ5A 1XELA 2POQX 4NFHA 1H9AA 3WICA 3VPXA 4D41A 3IMFA 3ROMA 3TWOA 4ZJUA 3PWKA 5TQVA 3TPCA 3AWDA 1NASA 3F1KA 4LVUA 1EE2A 3BA1A 4N7RA 3H2SA 3H2ZA 1EVYA 1BVRA 4ZD6A 1HETA 1SB8A 2YW9A 2GCGA 4EYEA 2V6FA 4TROA 4BMSA 4CLDA 4UVHA 1I3NA 2QHXA 1R4NA 2ZCUA 5A06A 4CLEA 4TVOA 1E1MA 4DMMA 2O50A 4ZHSA 2O3JA 4A26A 4B8WA 5IF3A 5JE8A 3K96A 4KDEA 1O0SA 3ZNNA 4BNLA 1C3VA 1S6YA 2EKPA 1R0LA 1KYQA 1I01A 3IAHA 3PLRA 1DRWA 2VTDA 1Y1PA 2PD3A 4JBHA 4NZ9A 4B3IA 1HDRA 4XRRA 3QVXA 2G1UA 2Q2VA 1TEHA 1YDWA 4E5KA 1E7SA 5DP1A 1Y8QB 2J5KA 1YL6A 3B20A 4JBGA 3ZU4A 5FI5A 4CUKA 5A02A 4CPDA 3KM0A 2EP7A 2BH9A 5T8KC 1NFQA 4TKMA 1RPNA 3KRTA 4CM9A 2UAGA 3O9ZA 1CIVA 1VSUA 5JSFA 3GFGA 3VZQA 1GR0A 4HNHA 2Q45A 3UGKA 3AY6A 3VOSA 1ADCA 1EZ4A 2QQ5A 3QWBA 1DAOA 2IZ1A 1X1EA 1XDWA 5CPFA 3K8ZA 4PLZA 3EUWA 4ZQEA 2WSBA 1A5ZA 3KYCA 1B8UA 5EPOA 4XQCA 5EL0A 4E5YA 1EE9A 1LRJA 4N5MA 2YHIA 1KVTA 3GAZA 3JQFC 3G17A 4CMKA 4YCAA 1SEVA 4Y6SA 2BRUA 4CMCA 1L1FA 5FI3A 5TT0A 2YZ7A 5A04A 2BFMA 4CM1A 1DC5A 1Y5MA 4W82A 2W2LA 1PGQA 3AK4A 5C37A 4LW8A 1M2WA 4GBJA 1LLCA 1PQUA 4TZTA 2WD8A 4WCFA 4KQXA 3DC2A 3NGXA 4RPGA 5IXYA 4QSMA 4RPJA 5TSDA 1P1JA 2P9GA 1G6KA 1DRUA 3INGA 3B1JA 1W0CA 2GZ3A 2BELA 4RVSA 4WLUA 3UN1A 1BXKA 4L73A 4UULA 3TF5A 1ZXBA 1K0UA 4Z0PA 2AG8A 1YE3A 2ET6A 1ONPA 4K6CA 3BIOA 4PG5A 4AJJA 4FJ2A 3E9QA 4I9UA 1M76A 1F12A 1ZBQA 3FNGA 3GZ4A 4J4HA 4E4YA 2AQHA 3HDHA 1HDCA 3IC5A 2X6TA 3NRCA 4OH1A 4PLGA 3U4IA 3WXBA 3ZWVA 1E7MA 1EDOA 2BI8A 4HADA 4L4RA 5C5IA 2PZLA 3BXXA 1HT0A 5KWEA 4LK3A 4GKBA 2QRJA 3VVCA 1FDTA 2Q4BA 3UCFA 5BR7A 1SOWA 3JQ8A 4MVJE 1MXHA 3S2EA 3ZNOA 4BO5A 4IY1A 1UP7A 1X13A 2AQKA 4M49A 4H7PA 3F1LA 2VOJA 5KNLA 1I2BA 1M67A 3EAGA 4BNJA 3FRJA 4NI5A 4BNFA 3BMNB 1ZCJA 2VOEA 3WMWA 3DBRB 1ISMA 3IDSA 2OBYA 3IP3A 3B70A 4OMUA 5JAQA 4E3ZA 1O95A 1LDNA 4J3FA 2OP1A 3DO5A 4FQ8A 1X7HA 3LT4A 3QE3A 2R6JA 4WK6A 4WASA 3I4FA 1AXEA 1QV7A 1WP4A 1NWCA 3WQQA 4BO9A 1H2HA 4DMLA 1KERA 2PY6A 2PH3A 5G0VA 4JJFA 5TX7A 1OC4A 3GY0A 4NFYA 5F5LA 5A9RA 1YQXA 4KDFA 1E3LA 3TZCA 4PLYA 5TLSA 3ZI0A 3MJEA 5B37A 3B1KA 3X2FA 4NBUA 3K6JA 1NHGA 3K2EA 2J6IA 3TZQA 3L4BA 2NSDA 3E5RA 1WPQA 4B79A 3DZJA 2GGSA 3TFQA 2OBNA 1QKIA 4INAA 5AXDA 2P4QA 4UUPA 5JMPA 4CM9D 3HADA 4WKGA 1PGJA 3O38A 1QYDA 3LT1A 3S2GA 2BFPA 3V2HA 1NYTA 3DQPA 2VZ0A 3UFXA 1ONNA 2W4QA 4MKRA 5BNTA 1M66A 2C20A 4IJKA 2H9IA 1L7EA 1HDYA 2BD0A 3SJ7A 5JYDA 4J7UA 1KC3A 4ALIA 1M6HA 2O48X 1VJTA 2ZTLA 1K89A 3KYDA 1VI2A 3LF2A 3Q2IA 4MVJG 2HO5A 1ZK4A 4HFJA 3UOGA 2G17A 1N7GA 2DPHA 1U4OA 1W8DA 4II3A 1G0OA 1UDBA 4RDHA 1U8XX 2CF5A 4O0LA 3RAJA 2IEDA 5CAEA 1NQ5A 4FGWA 4KMSA 4E31A 1QYCA 4MVJF 3OIFA 4MIEA 1GFSA 3DFZA 1AHIA 3WLFA 2PZMA 3GGGA 3P19A 3KVOA 1AGNA 3ITKA 4Z9FA 4AJOA 1DEHA 5JY6A 4FBGA 1E1NA 1Y7TA 1MX3A 3DL2A 3IP1A 1WNTA 3K2BA 3L07A 2TMDA 1VM6A 4O1MA 1IHXA 2X0IA 2DBRA 3ZHZA 4IQ8A 4NQZA 4MIOA 2HRZA 4IS2A 3ADOA 1YOVB 5ES3A 3CSDA 2AMFA 3HDYA 2QW8A 2B0JA 3BHMA 1H6DA 1A9YA 3JD2A 1NVTA 3CPSA 2YHUA 3KLMX 3ITDA 3I9MA 3RC9A 5MDHA 1P3DA 4DXHA 1PGPA 4R3NA 4YT5A 2DU8A 1MFPA 1Q7CA 1LC3A 1ZSVA 3F9IA 4PRLA 4WLOA 1BXZA 3CIFA 1PJ3A 2DUWA 1IUKA 5L53A 1W6UA 2NWQA 4IXWA 1C0KA 2C29D 4R3WA 1IPFA 5G4KB 3PRJA 4CMIA 1HSZA 1Z74A 3ZDFA 2VYVA 4MPDA 3FI9A 1FDWA 3L6DA 4MKXA 4DYVA 1D3AA 3A1NA 3DONA 3UHAA 3ZV6A 2Y1GA 5JC1A 1Z75A 2I6TA 2X23A 3DBLB 2Y1OA 4TKLA 2HK9A 1HDZA 5EJ2A 5I9LA 1MC5A 1VJ0A 1AE1A 3RWBA 4J9VA 4E6PA 2O3UA 2BFAA 2ZB8A 4J16A 1ZH8A 4GKVA 3W6UA 4XYEA 3GPDG 1WVGA 3L6EA 3WTBA 4BGEA 4EGFA 4O59O 4OSOA 2GZ1A 5IDYA 3H5AA 1MC4A 3CKYA 1LDGA 1E3WA 3UXYA 4AICA 5TT1A 2DFVA 3AY3A 2V7PA 2X0RA 3MEQA 4FD3A 4WNCA 5EINA 2IZ0A 1QORA 1D8AA 2PNFA 3BMNA 1CJCA 1QP8A 1UAYA 2AEFA 1IZ0A 1BG6A 1LSJA 2NU9A 3PJEA 1P1IA 4J4BA 1SNYA 1RJWA 2ZYDA 4UVDA 1OAAA 3ZU2A 4E21A
chains in the Genus database with same CATH superfamily
2Q5LA 2I1WA 2Z2ZA 2H9YA 1GG8A 4R68A 1PFQA 3BRQA 5BV8A 3F2VA 3RAPR 1GYRA 5G4KA 2H18A 3HJRA 1UXHA 4GOMD 1TNDA 5CFOA 3O2NA 2EX0A 1H6BA 1OR8A 2AG6A 1PYGA 2WM9B 3B8HA 3DUFA 4KPUB 4X97A 1J25A 4D4IA 1OWNA 3BD7A 3HG7A 2KW5A 3R1IA 3K30A 5DOZA 5F3RA 2IH5A 3ZDCA 4LHSA 6GPBA 1TYEB 1ID1A 1ITZA 4K9QA 5JTUA 2AFRA 4DCOA 1YR9A 4DS3A 2XGJA 3IP6A 1TLFA 3A06A 2YFQA 1ZOOA 4PRYA 2BRUC 1M2VA 2JB9A 2JVJA 1Y3IA 1BYUA 2QX7A 1SXJB 3I4CA 3KTOA 2YV4A 3FDFA 3RVMA 1Z7BA 3ND6A 1PEAA 1PGNA 5TVKA 1E2FA 2QKYA 1SVIA 3OFKA 3DBHA 1WHSA 1BJKA 1SVNA 4EHLA 3EIHA 3VNQA 3AV3A 1PQWA 2PUEA 1HKUA 2ZT8A 5DE3A 3A9UA 4D8VA 1JFSA 2P11A 4BO0A 4I9FA 2OQVA 4NZNA 1SM4A 1CDEA 5E4YA 5E9JA 3WGJA 4XARA 3TTYA 3CVXA 4WZBA 4WY2A 3VJMA 1PUXA 2DLCX 4FC7A 3ROKA 2PHZA 1P2FA 3U37A 4I50F 4FW9A 3OEHD 1RQPA 3BICA 4HNQA 3ND8A 2J87A 3EGDA 3H2JA 3GFQA 2P78A 1QH1B 3KHSA 3ND9A 4JLAA 4DC0A 3PXUA 3ZV5A 1NMZA 2EF1A 4ND4A 4YI3A 5HKOA 1ZICA 1D2EA 5ALKA 2HBRA 2ZQZA 2CB0A 1KIFA 2XT6A 4QO8A 5AK5A 4XEHA 2C5HA 2CL6X 4KO1S 1QK4A 3KTAA 4NK5A 1PS9A 1R64A 3KKKA 5I3CA 1W35A 4OHXA 3OEWA 3M70A 4BMZA 5FPKA 2JFBA 1CQWA 5BSMA 2NW6A 3R5KA 4C0LA 2CLMB 3CH4B 4A5SA 1NRWA 3O92A 4IXTA 4W5JA 5AK4A 1HC7A 3C3EA 2GASA 2PKEA 3BHIA 5F2OA 1URPA 1SY7A 1TEXA 1Z5GA 2PRSA 4N39A 2HGSA 5B58C 1HURA 5IZCC 2CXTA 2I78A 1VL1A 4AMZA 3RC2A 2ZT5A 3AOEA 4WL0A 5EXPA 2FDXA 5LXTB 1AF7A 2VPYA 1B6RA 2AD1A 4IGAA 2DULA 3E0XA 4TT3D 1U90A 2QUJA 1EBFA 4AUEA 3UJDA 2MYUA 5CM9C 4XJTA 1IRIA 2V54A 3ID6C 5HBRA 3RIXA 4OLAA 4ZU1X 3WLJA 1J21A 2VF2A 2UUBB 1V25A 2XLCA 3BKWA 1G1MA 4LBYA 3RSSA 4F97A 5T6BA 1RYHA 4J7XA 4CMEC 2EHJA 1IM2A 5A4KA 3WSTA 1CP3A 2P9FA 4N03A 3THWA 3DOFA 4WMLA 2IY9A 4LRTB 1IWPB 4UHFA 3FBTA 3NBXX 2WU8A 1CUHA 3GGJA 5A3VA 3ROQA 3UMYA 1QVVA 4DCGA 2PO7A 1KDVA 3DUWA 4ZQHA 4ND5A 3OH8A 1T24A 3T4PA 5DHQA 4A2PA 4Q4HA 4KKVA 1P75A 2IXTA 1W36C 4R9SA 3VISA 3VHRA 4BVEA 5F7XA 2A1TR 3OZDA 5DCLA 3ZDDA 4NZPA 2ZDHA 1X7WB 1JEDA 1VBFA 4OO3A 1PBNA 3DHVA 4MW2A 3QPVA 3IIEA 4WINA 4GP6A 5CH5A 1GQSA 3B1WA 3HXPA 1RQRA 2MYTA 1NTRA 4JB0A 3R5SA 1BQ4A 1L7NA 4IJ5A 2W00A 4EPXA 2PAAA 3PGA1 4AG6A 4ENRA 2C4MA 1B8OA 2P9QA 1EM8B 3M83A 1TYDE 3MG9A 5CDSA 3LHSA 2R00A 3SHTA 2B1JA 1EEXB 2IPNA 2PSFA 1BCSA 2IYAA 2ZYTX 4ZVPA 5T7BA 1I2ZA 3VH4A 1PUJA 1CUAA 4C89A 4TRJA 2QD5A 1U04A 3EXHB 4EI9A 3GP8A 2YCBA 1JZTA 4F8JA 2O1XA 4Q3EA 4EFDA 1NJ8A 4FDUA 3QPAA 4U7DA 4TS3A 1G5IA 1E32A 1XKXA 5JMWA 2H1HA 4XIFA 4GBMA 1YASA 1ZCFA 3QUCA 4FYWA 3QXSA 1HEIA 3TRDA 3LUGA 4KLNA 3LV8A 1U1FA 4R3UC 1MJGM 2VTEA 3M34A 1KRXA 2WUWE 1VPLA 3D4BA 1W0JD 1J49A 2XKJE 5DM70 3PDCA 1DZIA 2HUPA 4MVJI 5FOVA 3TBHA 4FWTA 3QLUC 2V7TA 1AURA 4AZWA 1JHYA 5CCDA 4TRRA 1NF9A 4HWKA 2YR0A 4DUGA 1ADBA 1KI6A 2AWNA 4LZPA 2EFEB 3ZCUA 3UM9A 2Z0MA 5LBTA 4FGSA 3TIGA 3CWCA 1T9DA 4BO4A 2X77A 1JLMA 1H0RA 3SI7A 3FG9A 4BKUA 4UJ5A 3PRYA 1DOAA 1MP0A 1TZMA 1VI6A 2QIOA 3H84A 1N2XA 3HP4A 4DYDA 3QXJA 4CTMA 3IV9A 1SOMA 2GESA 2Q4DA 4MB0A 5AVTA 4ZK2A 3RHTA 4MWGA 3NHZA 1E9RA 2RHCA 1ZCZA 2PX0A 2NUTB 3RS8A 2FN9A 1IB6A 3GEMA 5HQ3B 4D6PA 1IQPA 1E1RD 1NI3A 3PQ4A 2ASEA 4UU7A 1P5ZB 2BTQA 4S1PA 4XE5A 5A62A 5JZOA 4GRAA 4UASA 3AU9A 4DCSA 2FFRA 2VTBB 1TUGA 5BSVA 3KOOA 7MDHA 4WCFB 5BSEA 3AP2A 5ICEA 2ETXA 2HMWA 3A14A 3GYBA 4FHCA 4WH0A 1CNFA 4JIGA 3KJHA 2ARKA 4RVHA 2NYUA 2A5LA 3VPAA 1G42A 2JIQA 3CUVA 2GD1O 4NVRA 2D1TA 1O77A 4UAJA 1JJIA 3O4JA 5EKDA 5AQEA 2R5NA 1HYQA 1SVMA 2MOKA 3G9XA 3UK2A 2PEZA 3DDOA 2CV1A 2Z4SA 2VHCA 3E8XA 4CEIB 2IF0A 5EWMB 3WL5A 2H63A 1DTSA 1Z16A 1EQUA 2ZK7A 1UPUA 4XFKA 1E1CA 1NLYA 1ZK2A 4CQMB 4EG5A 4GYYA 1TM4E 3A8TA 3MBOA 4OFBA 1FY2A 2Z1NA 1RAEA 5BR1A 4Z8YA 3STWA 4J9UE 3DOUA 1LFAA 1KPIA 1HL3A 5LDHA 1BA2A 1JAHA 1P9NA 1K5PA 3ES9A 3Q7QA 4CT0A 4E70A 1J2YA 2AI2A 2R1ZA 3ET4A 4NS1A 5BVGA 3VZDA 5FWXB 3DCYA 3SEFA 3SMVA 1MB9A 5C5EA 1PLJA 3AVUA 4CKBB 5AIBA 4ENPA 4O25A 1G5QA 4KXWA 5KIAA 4OXKA 3R74A 3TIVA 3ASUA 2C59A 3C48A 1XQWA 3ZY2A 1ACJA 4DDVA 5K3FA 2O8FA 4XDGA 2P91A 2H2DA 2WW8A 3JD0A 1M8GA 1IU9A 4NDZA 4YASA 1E9DA 4OB8A 4Y9DA 1Y3FE 3UQZA 2OMEA 1EMDA 3OJOA 4J1SA 2QM8A 3CZRA 2H92A 1C1XB 1NWHA 1QYVA 1Y8QA 2PPVA 4D0LB 3LQKA 3AB7A 3EG9A 2XTJA 1WVIA 3L8HA 2B35A 1NP6A 1IZ9A 3IQFA 4HPJB 4BV9A 4X85A 4MRMB 1E3MA 4CQLA 1TD9A 1GUBA 3I05A 4ZAZA 5JAMA 1QVZA 3H7AA 1VSTA 4NYJQ 3D2CA 1E2HA 2IPLA 3NU1A 2K7FA 1BMTA 4XWAA 1KARA 2XA1A 1YS1X 1QE0A 1NNI1 2XD4A 3DFUA 1G2PA 1YDGA 4Q1AA 3W2GA 4A3SA 2CFIA 4JI8B 2I6XA 4AT1A 5INTA 1U2SA 5FHQA 3TNYA 1IOVA 2NUBA 2G4CA 3BD6A 4S24A 4R40A 4F1WA 4YMSA 3BJMA 1JFRA 1SUWA 3FVQA 2AF4C 1LK7A 1O6ZA 1YO6A 3DXXA 1E2GA 1QHHA 2R44A 3RK0A 5E95A 3IBFA 2R7LA 5KNDA 1X9HA 3BQNB 3T7RA 4AMGA 3FAKA 4HFNA 2JFGA 2VH1A 1SPXA 1Y5IA 2I34A 5BVGB 1RXEA 1YVDA 3JQGB 3OWXA 2WD9A 5D5QA 1M54A 4PVCA 4ALLA 3Q85A 3K1YA 5BN3A 5CA1A 1LW7A 3T61A 4M1WA 3BFPA 3NWOA 4DCVA 4AMUA 1S3GA 1WZIA 2CZGA 2WAOA 1XD2A 4R71A 3L5KA 1L6IA 4PAGA 5FOUA 1F9AA 1D0IA 2BISA 2ICAA 3M4NA 4LTMA 5L3VA 1G3RA 2AZ4A 2BFDB 2JI4A 3AERA 3KQSA 3VU9B 4B3MB 1KJYA 3NRJA 3K09C 4FIZA 1ZINA 4N41A 1G2QA 1SZPA 3QVTA 4MOWA 3RU9A 1PR6A 1L7DA 3IR5A 1WSDA 1RIIA 3GPIA 1TO2E 3Q15C 4F5DA 4BWGA 4RVGA 2FSSA 3W04A 3HVRA 3CVYA 1DT5A 2D13A 2WEKA 2R1VB 3KDSE 3WNBA 3W8NA 4ZYLA 4CWAA 3GDOA 4TTIA 4AWBA 2H2WA 4XLTA 3ZWMA 2PNJA 2B20A 1QGDA 4TQGA 5IAOA 5JH7A 1D4ZA 1M7BA 1AIPA 3KAJA 4FN4A 4CM5A 2MTBA 1GILA 2ZRLA 2GPAA 1NQAO 3FMFA 2OHXA 3M4XA 3P2IA 5GY7A 5GONF 3VU3A 3W7AA 3HZHA 5MFPA 2CJWA 1BDMA 2XXAB 2ODNA 1HK7A 2VP5A 4AP9A 3FKSA 4XW2A 3TVTA 5CFLA 3F3SA 2B8EA 3MYRA 3E5MA 1E2PA 3IB6A 4N5NA 4J2OA 5B58T 1KBZA 3LDGA 1L5GB 1VMKA 4PR0A 2WYHA 2WWYA 4FFBB 1W0KA 3RWOA 3HXLA 5H7XA 8ATCA 3QELB 4W99A 3WGMA 5DBFA 1L4BA 1WSBA 2FFAA 4HDSA 2OCPA 3NBQA 2O2XA 2P7IA 2YXPX 3VPGA 1Q1EA 1VG1A 5DKFA 5L7YA 3BRWD 2XD9A 5A7FA 4QDKA 2QTFA 2MCFA 3EFBA 3SY8A 5TQ2A 4EKNB 1JXMA 4GVXA 2P1DA 5L3RA 2PV7A 2IDMA 3L46A 4FSHA 4WOKA 4EYSA 2VSOA 4NONA 3DOCA 1INLA 1Z28A 3A2LA 2I33A 2C2GA 3CX8A 2XNDD 1ZSYA 3T0FA 2AW3A 2IYPA 3HCRA 3VKWA 2V7QD 1VJ1A 3D59A 1E2JA 3BE5A 1XAGA 2CK3A 3VC1A 5LZ4A 1U65A 3IHWA 1GV1A 5EA2A 5LJLA 1S7GA 1UJMA 4M6WB 1CF2O 3D3WB 3UJ7A 3Q3HA 4TMYA 1V6AA 4U5QA 5H3CA 4CFYA 1DQPA 3NC0C 3F7OA 3KJQA 5KVCA 2NSYA 4PXAA 4F3YA 2DWQA 3TOXA 1T6XA 3P0HA 4E11A 2VHZA 2PYZA 4TTRA 2FI1A 1E8DA 8LDHA 2OFXA 3GQBA 2VJAA 3W3ZB 1CNEA 6LDHA 3MAJA 3RFTA 4RDIA 2CB9A 2N3ZA 5A5GA 1L7MA 1U5CA 1ZJYA 4XFDA 5CUQA 1FBTA 5C81A 3DFIA 5H3HA 2QE6A 3IKJA 3NAQA 3IOYA 4MPPA 2HIGA 4EPYA 4RF4A 4PYJA 1ISFA 4OHVA 1RJ9B 4X1IA 1CZNA 1KS9A 5GWXA 4M37A 4OJKA 2H29A 4FZ5A 4BX2A 2RGXA 4E5DA 5KCZA 2FMXA 2WILA 5EMHA 2AYXA 5K7SA 4A91A 2ZRJA 2MT9A 4X71A 2PSJA 4ALMA 5BW8A 1DRVA 1VC2A 2OHJA 3A05A 4XB1A 2PKQO 4EG3A 3PSHA 1YBMA 4NXNB 2ACEA 3G7UA 1A9ZA 5K99A 1USKA 4HQOA 4MS1B 2QF7A 3STVA 4GRIA 1XZFA 3AETA 1KRHA 2WJ3A 4KMOA 3QNUA 4XDZA 2WHRA 5CT5A 4F8YA 5JXGA 3GLGB 2C8KA 5F4BA 4CF3A 3ONDA 2A7QA 1LQTA 2EJCA 3OHMA 3ZDAA 2Z08A 5LR6A 1IJEA 2AN1A 1A8HA 5EE0A 2PXCA 4MI9A 3CCCA 3VPSA 4ND8B 1E58A 3WADA 1MQSA 2W98A 3S81A 5KPDA 1Y0BA 3I45A 3OLCX 4LQLA 4LJAA 1IYZA 2GK6A 3BD8A 1ZH0A 2G5PA 4AP5A 2H11A 1MIOB 1VSBA 3UAVA 2X8JA 4DM4A 2IDKA 3S7TA 5JCOC 2IZZA 1DU4A 1E66A 2VK8A 3GJXC 3LOUA 3TAHA 3VVBA 4AX4A 3JSAA 1RWOA 4FR2A 1QG2A 2QZ4A 4IH9A 5JVDA 1QP4A 2WKWA 3LW8A 3OZXA 4F06A 5GINE 4BY9E 3VSDA 3D54D 4HXEB 1UFQA 3EDOA 1ZIDA 2IYYA 2QDXA 3WAKA 3O95A 3JQBC 3CTMA 1Z6YA 3RUFA 1T8YA 1U1IA 4B4DA 1IMJA 3WLMA 1CTQA 1FRVA 2H16A 3DFMA 3H0EA 1C80A 4UAUA 1X7XA 3U7RA 2YJ5A 3ZJYA 4GL4A 5T4EA 3SIXA 1C50A 1FMCA 1VCOA 2QI9C 4LBVA 2WWVD 2ODEA 4JC5A 5J1TB 3RODA 4CLRA 1GA1A 1VHTA 2IEAA 4KITB 2TECE 3KB2A 5AW3A 1LDMA 4M86A 3U7GA 4ARCA 1BFKA 2CXXA 1UIRA 2YXEA 1WDKA 2NV6A 4IHJA 3URKA 4DKXA 2C3MA 3FZEA 5BV7A 1PDWA 2GLXA 1E1QA 4R8RA 1ZBDA 4M0CA 2Y0CA 3NYQA 1Y1LA 3HDTA 4INPA 3BGWA 5CW2A 2FW6A 1MRSA 4CM7A 2X8LA 3OSZA 4BMYA 4L8YA 4ETIA 1WB9A 1N0VC 4TLBA 1SD2A 4M1OA 3KEFA 1R9MA 1K68A 3S2UA 4LJ8A 1RWQA 4MW7A 4KK4A 2NO6A 3SNHA 1DKNA 3VHXB 5BVHA 2BP7A 4NECA 4HLUA 3ICQB 3AZOA 4DA8A 1YHYA 3WTCA 4OGKA 2VSQA 2SICE 4P82A 3A6HA 4BGVA 3VAYA 1OTHA 1ZR2A 4UHEA 1S2LA 1PJ2A 1XZ8A 3ESZA 1OLOA 2OM6A 3KELA 4LXQA 1YI1A 3AEQB 4B6OA 1NBIA 4KBFA 2C83A 3C7CB 3LBIA 3RUCA 4JKYA 4C06A 5AVSA 6ADHA 3AQIA 4M0KA 2ZSJA 4YT2A 4A0SA 1NQOA 1V8BA 2RI0A 4MLZA 2GRUA 1YRBA 4ACBA 4DSNA 1FJXA 1EIWA 4FKMA 1TX4B 1VPEA 2C04A 3PNSA 3LT5A 3CC8A 4LYYA 4QHYA 3U3KA 1V9CA 4KO4S 2CJFA 4HWGA 4XA8A 1L4YA 3CX6A 5CVVA 1NVMB 3KSDO 4QWMA 1GGEA 5IPFA 1L5LA 3EVBA 1P1FA 2QTGA 3CTPA 1A0OA 2O7QA 5ALOA 5IM5A 3I92A 1XRJA 2E4AA 2G9UA 4PIMA 3R8FA 4UUNA 1SC3A 4NABA 4RJIA 1U0RA 3BREA 3PF9A 1PF7E 1BHJA 3A2MA 3DFFA 3PUYA 1HWYA 1HZZC 1G8SA 4NAHA 4G0OA 1SKAA 1MO6A 4MVJH 4OM7A 5I8ZA 4G8JA 2HY7A 1I10A 4V0RA 3T5DA 1ZVKA 3MWDA 4Q4HB 2RHWA 1U0LA 3D7KA 3PWSA 1CG6A 2AGVA 1L7BA 2REXB 3QRWA 4EVIA 3CONA 1NVUQ 1XZLA 3R76A 3NHKA 4H15A 4D8TA 3HACA 4E2ZA 4YAEA 3FMVA 3FZYA 3GD5A 3T12A 5CFPA 2P4HX 2GFIA 2AG0A 4U0JA 5T67A 1S2DA 1RMQA 3GRCA 3C7AA 1S01A 3HMKA 3JQRA 4L72A 3M6XA 1G9TA 4M8NE 1CVRA 5HE8A 2NZXA 1Z38A 2YBEA 3R40A 1KMNA 2GYVA 3MTAA 1QSGA 3FPCA 3P0JA 4Q6WA 2W6OA 3WMRA 3PHGA 1Y8ZA 5JPDA 4RA6A 4CODB 1QTQA 2AVDA 4OOEA 3ORQA 4P31A 3GJ7A 4DXAA 4P7GA 2YWJA 3UATA 2XUPA 5KJ1A 1EFVA 2QTVA 4EB0A 1O0CA 4RX1A 1GD1O 1GT6A 1I7PA 3V55A 2E89A 3CEAA 1M1NB 1WB6A 3E84A 3DDWA 4H0CA 2X4DA 3ACCA 4G09A 2YICA 3AHIA 5AR1A 3SYRA 4WEOA 2NP6A 1AKWA 2QRQA 2XUDA 3VR0A 4BP1A 1NE2A 4HNAA 1FNSA 4RY9A 1LF5A 4PQYA 4OY3A 2QVYX 4S0ZA 3REOA 3STUA 4ZMSA 2YVUA 2OZLA 1X7YA 4PCUA 1WRBA 1QCZA 2QV0A 4M4SA 1A9TA 3ELBA 3JZDA 4IVQA 4NHEA 4DR4B 4LRSB 3GNTA 3I1JA 2JA2A 2VO1A 2Z8YM 2IHYA 4IFTA 4MVJM 1IQ0A 2NTJA 1LD3A 2Q28A 4QBGB 4XLLA 2HJ9A 1TQ4A 3O8BA 5CVDA 2P41A 4EL0A 5CXUA 2C0CA 3BXPA 4NY1A 1SU7A 3KVYA 5FFFA 2PU7A 2XMSA 4GM4A 1C0PA 3NX4A 4FNGA 3GRUA 4RHEA 5FWDA 5GJVC 2UYHA 2PT9A 1TEVA 1IQRA 4M22A 5J5CA 3Q8WA 4ZO4A 3VKVA 5KSYA 3DPIA 3PITA 1PCXA 3IOMA 2ZYRA 3W5VA 4GLJA 2J3IA 1MNAA 4S1TA 4X91A 1ZU4A 2ZJYA 2J0VA 4JC0A 1P9OA 3FNRA 1XK7A 5ANRB 4B3FX 4BCBA 2O05A 4LDNA 3PJFA 1NUPA 1CW2B 3JQCA 4ZK6A 1OC2A 3D4PA 4DV2B 1DJMA 2NMVA 4CT4B 1I3MA 4LHEA 4G1EB 4EI2A 5FP0A 1F8YA 3GAMA 1RRPA 3HSSA 2ZVDA 5FWYB 1JILA 3OFND 4WKOA 1ZMRA 3CT6A 1OY1A 2LVBA 1Z13A 2DKFA 2GRAA 4CG1A 3U4GA 2CLSA 9MHTA 3BMOB 1FS5A 4IYJA 4UATA 1CXZA 3C43A 5T8KA 3ZH2A 5IFLA 4KE7A 4NYMR 2O8BB 3IXMA 2W2TA 4OIMA 2PT6A 3AIOA 1LPMA 2FG5A 2NQ2C 3BXOA 3NV9A 1LPAB 5E1DA 1C9KA 4V03A 2OBFA 2I6UA 4G0UA 1GSHA 1E77A 2Q2WA 3GLRA 4RGYA 5CG2A 5THKA 1I7DA 4AF8A 1LNSA 2HSEA 1VHWA 2IK8A 3R2JA 1T9BA 4HN9A 1VL6A 1JMVA 4JJEA 4WLFA 1U1CA 5CVEA 3RVSA 4PHHA 3L0IB 4KBYA 3LTNC 3DOOA 4FZVA 1B42A 2Q7OE 4BFCA 3SICE 5I3ZA 4ZV9A 3LNCA 4DV4B 2VQEB 4WV3A 4ASUA 2JVKA 3UICA 1U5AA 3SIWA 3H5VA 2FUNB 3AIKA 3X44A 3TQOA 4DMUB 1A82A 1Z2DA 3R7SA 4C4ZA 4HYEA 1JHMA 5FBWB 4RK7A 3S55A 3KPUA 2H8GA 2QN8A 4GC9A 3ILYA 3IQDB 1C7QA 1DMSA 4UU8A 3IOCA 3I6IA 5TGDA 4D0NA 4DARA 2ZR0A 1LLUA 2PMKA 3CF2A 3BXEA 5HKAA 2JBAB 2Z8ZA 4LWZA 5GM1A 1TO6A 2F1RA 2XNSA 5HGXA 3CH5A 2IEBA 3GVPA 4NNPA 2M6SA 3ZW8A 3VYSB 2ZSEA 1TTHA 1JEQB 3K5WA 3L0OA 3TZLA 2HA5A 4YRBA 3KUKA 5D85A 4QO7A 3J81k 2ONCA 1NAHA 3QX7A 1ZI9A 4PG6A 3UT5A 4S3MA 3DWIA 2R0QC 2HMTA 1JLLB 1MAVA 3Q88A 3UK7A 2PXHA 4TLDA 1PZGA 1T1SA 2QAGA 4JV5B 5FWAA 2QOEA 5K0NA 1UOPA 1YIOA 1PR9A 4ZC1A 2H0AA 3T6KA 2QSJA 3QM1A 1ATIA 2KS6A 3LT2A 4Y98A 3DFKA 2LDXA 3K7EA 4JT2A 4Z4GA 2P90A 3ZGZA 1HE4A 5TPWA 3TVDA 4RV9A 3K5IA 2C3UA 1I3OA 3KYIB 4F38A 1MENA 1XU7A 4KQJA 2OCLA 4RH1A 5JISA 1JKFA 1M75A 3H3XA 3WKCA 3ZDRA 4GOLD 1N6OA 1YCGA 1TF5A 1ZJ6A 3SEQA 3TAUA 5JU6A 4A6PA 1CDDA 5AM2A 2ZRGA 7REQB 2Z6QA 3I42A 3GV0A 4ZYUA 1AMNA 4JMPA 2D3WA 4UXJA 2QTNA 1OBCA 3HXTA 5HIIA 3WIDA 3ZJ4A 5FBVB 1WMSA 5FTWA 4E07A 1NNEA 3KT6A 3TDKA 1THTA 4NE2A 2VXYA 3AFGA 1U8TA 2QM0A 3UC5A 1SUDA 3MIZA 4G5GA 4MVJP 4A16A 3E9DA 1I80A 2ENUA 4D82A 3YASA 2QXUA 2ZANA 2JD2A 2BR5A 1DFGA 4B3TB 2NT4A 5EHIA 4OX9B 1JEYA 1GA6A 1E59A 4O63O 5EFOA 3H2GA 4C4XA 4X93A 3HMQA 1B74A 2BMVA 1KEUA 4I5DA 4MW5A 4DQDA 2H5EA 2H6EA 3D0RA 4PZAA 3IAM1 3S40A 4GGMX 2OO3A 4D92A 3Q7EA 2XY4A 5L3QA 4DBVO 2P4SA 4CM3A 3FTNA 4M1SA 1PR3A 2P2CA 3KUCA 1RZRD 3KUUA 4EQZA 5IS2A 3L6UA 2HMUA 4MWOA 4JLPA 2F00A 2V9ZA 4HAIA 3MCZA 3IEUA 3OUZA 3UHPA 4C3OB 1LVGA 4U7WA 5EIFA 4MVJD 1QK5A 4LUCA 3UWDA 2P68A 4BBPA 5JNRA 1FMFA 3AP1A 2VZEA 4X7BA 3ZEAA 3AO0B 4YJHA 4YO7A 1UDRA 5ENVA 4BIMA 5H81A 1RLIA 5L45A 2HDNB 1ZJZA 3SX4A 2WYUA 13PKA 2LGJA 5EEHA 3FW1A 3QTBA 3THWB 3G1TA 4M1MA 1KE1A 3NIWA 3S28A 3UGJA 3FLAA 1C3OB 3GJZA 3QFFA 3DTVD 5KYTA 5CH8A 4KJZA 5I47A 2WMOB 4WKCA 1Y42X 2NYVA 2VCEA 3RHZA 2P9BA 4PN3A 1XK6A 4L9SA 5CT8A 4R8MA 3WIEA 2ILVA 1JKMA 4LG1A 3ZTTA 1HTWA 2QAIA 2ECKA 4LKOA 4R0NA 4DVJA 3VU9A 3OCUA 3WHPA 1N9GA 1QQ7A 3CF0A 3DHWC 4RZSA 4ZANA 2YCLA 3ZWNA 1OFVA 4B4KA 4C14A 3JQAB 5ILQA 5DNYB 1UBCA 2WTXA 4HUQB 1L7QA 5J2TA 3K3PA 1GSAA 3QW2A 3OKFA 2PRKA 1FF9A 5A9SB 4FWIB 3SS7X 2ZIUB 4EFMA 2VUTA 3LUKA 5J59A 4CCSA 1C0IA 3OM0A 4WCFC 5KAPA 1VPTA 4BZQA 4DABA 3OE1A 1A71A 2NPOA 3R3JA 4P2GA 2HTEA 4GR5A 2QUBA 2OSBA 1DPGA 1JDZA 4BVJA 5JMOA 5KTRA 5DNUA 4PO3X 2Y2UA 4XSGA 1W93A 2BHTA 2NUTA 3PE4A 3A6EA 5D5HA 2RB4A 1MLDA 4MR9A 5KQRA 3N2NA 1E7RA 4MV1A 2V7GA 5LYJB 3WGGA 2E1RA 4YAJA 2CXHA 2IOYA 2W8ZA 1KHTA 1BEZA 1AY0A 2IF2A 2O52A 3NVDA 2YV5A 4GI3A 2A5YB 2OEPA 2VT2A 4NV1A 5DYWA 1DIGA 1QWSA 2NPFA 1FE8A 1QP0A 1J4AA 3EFHA 4G4GA 4W1QA 2WY2D 5AW0A 3PQFA 4QRIA 3WRXA 1SHUX 3A28A 2CEKA 4KE9A 4Q3DA 3KOYA 3ZY6A 3NBMA 1Z5NA 1YS9A 4QFMA 1Q0RA 4S0XA 1VB5A 3HGTA 4ZT7A 4Q9IA 3HB4X 1K6JA 3V4FA 4C4OA 3STHA 5JWRA 2W2LD 3JARA 5L95A 3VV2A 3RS2A 4O4LB 3CZMA 1XUOA 2AKEA 2RD2A 4KWEA 2QRZA 1EVKA 1SUCA 2QA5A 5ERXA 2C7RA 4KGZA 3VGPA 4RD1A 1JHAA 4CZ2A 1G8MA 2PYDA 3L92A 4K6OA 2R68A 5B4UA 1IZYA 3H6KA 2J4FA 4DB4A 1E6MA 3K1AB 2GHRA 4FFNA 3VVMA 3I2HA 2H1VA 1IBLB 4LE1A 2PIAA 3KOMA 5EGNA 3AT1A 4A8JC 3N2LA 1O95D 1XX6A 4MDEA 4IJQA 1LW6E 4JA0A 3UWMA 3N8GA 3JALB 1SIOA 4YPFA 5HF9A 1R0BA 3TQCA 3OESA 4CKBA 3IP9A 1ORIA 2K4MA 4HXYA 1IAVA 3DD5A 2HCJB 2C1ZA 4MP8A 1COWD 1SQGA 2IOQA 3MUOA 4FKBA 4Q7LA 1O97D 1SQSA 5C4IA 4LOJA 4DLAA 4ODIA 2AR7A 5T5QA 3Q6IA 3ZWAA 4O29A 2WMYA 1T4CB 3GFSA 4REQB 5IHXA 1DAHA 3W3AA 4DDKA 1DJOA 2XMDA 3IHTA 2IH4A 4LYEA 4RTLA 3JZIA 3LVBA 3NQ41 2QEQA 4ND3A 1MRZA 2XUJA 4YJFB 4AMBA 3U09A 5DSZA 1W8IA 1RMYA 2F3UA 3A6FA 1XP5A 4D9HA 2CBZA 3T7TA 4AY5A 4IZIA 1QIFA 4AJHA 4WN9B 2P77A 2BUBA 3MZ0A 3PKIA 4B6FA 3I9OA 3DE4X 1KYWA 4QQ8A 1C3EA 5GZ6A 3AUSA 3JARB 3MRXA 1Z4KA 3ESCA 2J31A 3C2QA 4GO1A 4YP0A 3X1JA 1TUEA 3LSYA 4Z2YA 1WQ3A 2F9LA 4YRLA 1UWVA 3EUEA 3NVKI 2WVAA 2ZRMA 3LW7A 3OUUA 3VOAA 3KJIA 3NS7A 3R4CA 4IW3B 1E3IA 1UMDB 4HQRA 4XQGA 2H5JA 4CF7A 3T7AA 4PZDA 1PZXA 4FMDF 1OFUX 2C57A 3E53A 2XT9A 4OYYA 3LLSA 1QOZA 2G88A 2AZXA 5IVHA 3KL4A 1H23A 4H7KA 3WGIA 3T1TA 2H4JA 3MWFA 3K4QA 2CFTA 4KYTA 4W7IA 4DZZA 4EEXA 3E7DA 4L4XA 1F6WA 2YWBA 2OXIA 1E64A 2ZE8A 3TG8A 2C5GA 2QTZA 1ZK0A 3NKFA 5CLLA 3OJWA 4N1AA 1F0YA 5CURA 5K51A 4U7HA 1UM8A 4EENA 1KTVA 3JCZA 3CH6A 4I6GA 1J2UA 4JXKA 4QJ3A 1Z4IA 5B7GA 5KTOA 4WA8A 1F3OA 2OT3B 3T9AA 2H7CA 4ZI3A 3PF8A 4K3UA 2EBWA 2HDOA 3PFNA 4B0OA 3W1WA 3MPOA 2J0EA 3NC1C 1RS0A 1SH7A 1CP2A 1K98A 3EY9A 1R9NA 2GAIA 3DLIA 1L5KA 3VDNB 1SXQA 3D3QA 3IBYA 3WV4A 4B80A 2WHPB 1JJBA 3N8NA 4K26A 2VDKB 2WWXA 5HG0A 2VYNA 2HC9A 1VIYA 1P60A 2ZWMA 1YVEI 1XJWA 4OGGA 4RFLA 5AHRA 3OX4A 4WNYA 2WWRA 1NW7A 5AW5A 3PVCA 3AOGA 1NJSA 3VH2A 1WF6A 3ZVRA 4DCTA 3ILSA 2O0MA 3LU1A 4LXHA 2YMQA 4HZIA 3FPHA 4IHJB 3H11A 1LNZA 4DQKA 1AUQA 3MCAA 3AHHA 1JB9A 3H9UA 4DJDC 1FYFA 1UBHS 3BTOA 4M9SA 4E32A 2ZBUA 5IN5A 1R66A 1LFDB 3TOVA 5LU9A 3DBOB 1ETUA 2JIZD 2P2DA 2X40A 1NZDA 2V96A 1J8YF 5FA6A 3EXHC 1J22A 2VQDA 3LK7A 3MA0A 1YE5A 4QTZA 2JGLA 3N2ZB 3EFOB 3H9JA 3TW4A 4C4PA 5F3DA 2JKZA 3QXGA 4RKFA 5EIXA 1O0BA 4MYDA 2HLHA 4TMWA 2AOTA 4E5SA 2D4HA 2HJHA 3GMDA 2RH8A 4JLKA 1GQQA 1JAIA 2D06A 3ODGA 1TU4A 3OAAD 3W34A 2I4OA 3F97A 3RHFA 3KZVA 1ZWLA 5JLAA 3WHLA 4ZQFA 5I7WA 1UKBA 3EGXA 1Y5NA 4NHOA 3U7JA 2Q1TA 3HXQA 2HLPA 2VPXA 2ZBRA 3RSFA 4C5CA 3S2YA 3LBFA 2RC6A 2FWNA 4AZ0A 4UOEA 1RBZA 2BFNA 1ZOIA 1LI7A 5IK2A 3DZGA 3LPNA 2NVUB 1KFEB 3ZVKA 2O07A 4DV0B 4UPVA 2XNKA 4Z2AA 3HCDA 4LDJA 4QJBA 3SM9A 3RSGA 1YU6A 2HBQA 5IJAA 1EJ2A 3WWCA 4BVGA 2A14A 4QELA 2Y76A 3FCYA 4N0DA 1WULS 2HF8A 2LRHA 5HNKA 2D8MA 4MR8A 4R81A 3IYLW 3WO1A 2ZYWX 1UBGA 1UWCA 1X70A 2O8EA 2N42A 4PVDA 3OU6A 4QT0A 3LBNA 5C3MA 3KKMA 1ZSNA 4QQFA 3RARA 3U7FB 2FX5A 1KI4A 4RJKA 1M34A 1Y7IA 5KYNA 3FSEA 3DL7A 3PPXA 2FZEA 4I4TF 5LFAA 1JTVA 4RF5A 3KBBA 3PGKA 2IFTA 4WT7A 4H3VA 1XZPA 2QD3A 2EX4A 3KQVA 3EIOA 4NH4A 4V24A 4B7CA 2BHSA 1L5OA 1VHLA 1ZMTA 3NNSA 2X3FA 2RGRA 4GDFA 3E05A 3HZRA 2YZKA 3GZTB 4C5BA 4B9AA 4BOYA 2B1IA 1VSQA 2P1RA 2C9CA 2P2ZA 2YXNA 3CKMA 3GFBA 1OVGA 4M1KA 3P2JA 1KWKA 3JVIA 4I1OA 4DJFC 2CV0A 1AK1A 3BEOA 2X1HA 3HH8A 1XIVA 3BL8A 1X92A 2J4DA 3ZBUA 1PTJA 3OTIA 1X2EA 2HKIA 2VT3A 1WCXA 1FXSA 1NN3A 3I01A 1YR2A 3B60A 4HXFB 5LIRA 2IH2A 4MIYA 3KWJA 3CRNA 3FFWA 5IH7A 1QE5A 3PNQA 5L4LA 2BFOA 3D8HA 2Q3JA 3MTIA 3E2MA 4QBHA 1JQAA 5FKJA 5J4YA 5JSZA 1YB6A 1E7YA 5A5EA 2F8SA 1Q21A 4X95A 1R37A 3VYTB 1U31A 2YOGA 2Z9BA 3HK2A 3LRXA 4D0RA 1AKNA 3OA0A 9LDTA 1PFYA 2J9FA 1QGUA 2G76A 2RDMA 2EKDA 3KFVA 4I8IA 3EVGA 3SJUA 2I2XB 2Z5FA 4QU8A 3V2UA 2WYOA 1IZZA 1I5RA 3JQ7A 3NWBA 5K3DA 4R0MA 4KUEA 3B13B 3HV2A 1ENZA 1D0VA 1P9WA 5JI2E 1U9ZA 2I4TA 4KFSA 2PGNA 2MWMA 5EXXA 5A0FA 3SVZA 1RP7A 3JXEA 3OO1A 2HPAA 3K70C 1GRVA 3WA6A 4TVSA 4O33A 1EUDA 5L7WA 2FPMA 1D7OA 3A1TA 3T7EA 3AI2A 4XCVA 4UBIA 4ESHA 2FEWB 4BX3A 1YHZA 2UZ1B 3LUFA 5CEFA 2DETA 3R7NA 1V4BA 2F9FA 2C5SA 4MS1A 1T2DA 2G1KA 4JLJA 3VNVA 1CNMA 2Z4RA 3UT6A 3K0AA 1T10A 2BGRA 3RS4A 3PGMA 5I7AA 2JD1A 3LKZA 1QV9A 3X1XA 3ROGA 3KFXA 4KODA 4H16A 4ND1A 1KC1A 4F3CA 3G2NA 2FPRA 1BRTA 1MX1A 2Q49A 1S8FA 1WXHA 3KPYA 4UUQA 5DGXA 5SZKB 4IKEA 1TCAA 1FTWA 2PH1A 2VP2A 1D04A 1VCIA 4GOJA 4QOEA 4BE4A 3EPPA 2WC1A 3VR4D 3RQIA 3VYUB 4FI3F 2Y71A 2GM4A 3I9NA 4N40A 3ZKWA 2QJTA 1N2IA 3C39A 4ROSA 2AN3A 5F7JA 1XDGA 4ARSA 1N6LA 3B1ZA 3MT9A 2IS6A 3KZXA 2C8LA 5ECGC 1T29A 4QXMA 4XASA 4QAQA 3NTOA 4AVYA 2CCKA 3AW9A 2B82A 3QY9A 4RU1A 4B8ZA 4M89A 1U5BA 1YDFA 2I22A 3CEMA 4B31A 3DR3A 4W7SA 4MGEA 4KVGA 3Q4GA 1T36B 5DK6A 3EA0A 2JAPA 3JQ8B 3QFRA 4O4JF 4AYWA 3SZUA 4YQZA 4QDUA 1VA5A 1P7WA 2FETA 3OHSX 1PP4A 3R5XA 2PVPA 3KKZA 2L18A 3OFVA 4UPDA 2Q21A 4L5CA 4WJKB 3OCJA 4MA4A 3X3HA 1TCUA 3OPXA 2ZDQA 1I2MA 4W9MC 4M0MA 5HEKA 5A6SA 2AA3A 3H8SA 1ODLA 4CF4A 1RI2A 5BYBA 4X7PA 2VJYA 4YA6A 4EM6A 5JZMA 3SR4A 2I4RA 4G63A 4PZZA 4JYMA 3WVNA 2I71A 4COKA 3W6NA 1TK9A 3RIGA 4A6XA 3WGYA 2EGHA 1FFDA 3H7IA 1LZLA 1X15A 1MX5A 3HWX1 5JSQA 2QLBA 4CTNA 3CB2A 2FLWA 2IC5A 2OYRA 5KWSA 3FE2A 1WXWA 4C20A 5LQCA 4WCVA 2V3CC 4GMGA 1QQ5A 1SU6A 4U3JA 9ABPA 4IIGA 1BXGA 3S7ZA 3DYVA 3KJEA 3RCBA 2EEZA 1XI2A 2CJXA 4FVTA 1N0UA 1Z34A 3RS7A 1J7JA 5HF5A 2WT8A 3WLLA 4CTOA 1W581 3CPJB 7GPBA 4JI6B 3BIJA 3OCCA 4L3VA 4RMIA 1UK6A 2YYSA 3AEYA 3W7VA 3HVKA 1LQUA 3PA8A 3V6MA 3AQ4A 4R9RA 1VP9A 2YTZA 3KU4A 2X9LA 3GNQA 2PA0A 2Y05A 1BE8A 4G5OA 2BFCA 2D8AA 2I0FA 2F64A 4N0PA 4RNDB 3K72B 1GTL1 2H4YA 1KIMA 3BMQA 1OXMA 2AHRA 3JTEA 5CDGA 3P27A 4QRDA 3UG6A 4EBFA 2AZDA 1E3EA 1O4VA 4Q3LA 4GE3A 1ZIYA 3L8YA 2VKTA 3PQCA 4TWJA 1QGOA 4YRSA 2D5IA 2R8XA 2G5TA 3JQ9A 4KYIB 3QVKA 2CYBA 1GQFA 3GVHA 2I55A 4MJ7A 3AHCA 4BZXA 3G1WA 2ZZNA 3I30X 1ZP6A 1X80A 3C8ZA 4MV9A 4N5DA 4PZPA 4JCOA 3RYIA 3C3XA 4PPYA 2ADOA 1N57A 3RABA 4CKEB 3K5PA 3KZCA 4OUKX 5F5NA 2FOXA 5IJ0A 4KR3A 4RY0A 2IS1A 3RUEA 3MTJA 2A88A 2Y27A 4AO6A 1XKQA 2RHTA 4FBLA 2NU6B