4HP8A

Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound nadp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
245
structure length
245
Chain Sequence
b'NPFSLEGRKALVTGANTGLGQAIAVGLAAAGAEVVCAARRAPDETLDIIAKDGGNASALLIDFADPLAAKDSFTDAGFDILVNNAGIIRRADSVEFSELDWDEVMDVNLKALFFTTQAFAKELLAKGRSGKVVNIASLLSFQGGIRVPSYTAAKHGVAGLTKLLANEWAAKGINVNAIAPGYIETNNTEALRADAARNKAILERIPAGRWGHSEDIAGAAVFLSSAAADYVHGAILNVDGGWLAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from Agrobacterium Tumefaciens (target EFI-506435) with bound NADP
rcsb
source organism Agrobacterium tumefaciens
molecule tags Oxidoreductase
total genus 95
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hp8A00
4YJGB 1VL6A 2HRZA 3BXXA 3LC1O 1QR6A 3LDHA 4ILKA 4ALNA 5G0UA 3VVBA 2PZKA 3HQ4O 1YO6A 4PLVA 1GPJA 3W6ZA 1U8XX 3W8FA 1GDHA 3WWZA 3CXRA 4BO8A 5L53A 2XOXA 2AW5A 4W9NC 3I4FA 1M75A 2BI8A 4O59O 1PTJA 2HK9A 1KEWA 2YFHA 1EE2A 3OIGA 4WPGA 5A9SB 5G0VA 5KKCA 2XF8A 3ZWAA 1DRWA 3QVWA 1FDSA 2OL4A 3L9XA 2QRLA 1TT5B 4I9UA 3VH1A 2QRKA 2D3TA 3U4HA 1JU9A 4FW8A 1H5QA 4N7RA 2JCXA 3NDJA 4FGWA 4IIUA 5BNTA 1PS9A 1HDGO 3SEFA 4MINA 2CMDA 2E4AA 1O0SA 5EMHA 1EK5A 2UVDA 3CPSA 4NFSA 3UGKA 3WGTA 1YB5A 1P1IA 5KCZA 4AJIA 1PZEA 2C7VA 4RZIA 4FGSA 1I24A 2O3QA 4BNUA 4DLAA 3IIEA 3KVOA 1YH3A 1P1FA 1U5CA 2EKPA 2BKAA 3EVNA 5L45A 3EVTA 4EBFA 3DZFA 4Z9YA 4CMIA 2EP5A 1GPDG 2HJSA 3VPSA 3MCVA 1LQTA 1CJCA 5IDXA 4IDGA 4B7CA 3LT0A 3PEFA 5COAA 1XLTA 3TZQA 2B5WA 2POQX 1VL0A 3DTYA 4KDFA 3E9MA 3B6ZA 5K6AA 3DOCA 5CG1A 1DC6A 1EFKA 3PGJA 4J1SA 4CMIB 2P91A 5HWSA 1E6WA 4MOWA 2AE2A 3SVTA 1PGPA 2NTJA 4PVDA 1ZJZA 3HN7A 4BNIA 5JCJA 3KUXA 1I2CA 4XGIA 4B3HA 3ETGA 1ZK4A 1GUZA 1BXZA 4WLFA 2CNBA 4YCAA 1YE3A 3GMSA 1B0AA 3BTUA 3OECA 1LJ8A 4OXNA 2XPCA 4PLWA 5AYVA 3WQRA 3KB6A 1DFIA 2J3IA 3V5NA 3JYPA 1QLHA 2NUAA 3U4CA 1I33A 3JQAA 1O6ZA 5ES3A 4AJ4A 1HXHA 4FC7A 5KJEA 3GGPA 1TLTA 4J0EA 8LDHA 1EBUA 4IQGA 1Q1NA 1ZK0A 4GVXA 3PHHA 4R01A 3RJ5A 4P38A 3K6JA 3ICCA 4D79A 5B1YA 4P4LA 1QMGA 5JLAA 1LTHR 4D41A 1W73A 4YWJA 3LK7A 1Z45A 4CM8A 3KV3O 3ANNA 3KOUA 1HDRA 3PHJA 1IZ9A 3ANLA 3I9OA 3OIDA 3RFTA 4MIYA 2G5CA 3L6OO 3GOHA 3K5PA 5TSDA 3VZSA 1J0XO 2Y05A 1FDUA 5EIOA 3TFQA 2G17A 2HMSA 3NJ4A 1RKXA 3UOGA 1LEHA 2YY7A 2X23A 1KVQA 1OZAA 4DLLA 2X8LA 3D4OA 2V6BA 4WKGA 3EDMA 4U8GA 2Q2QA 3FTNA 2DUUA 4BV9A 5CHEA 1EBFA 2OBNA 3QWFA 4CM8B 3ZW9A 3W6UA 4CL8A 1LLDA 1HZJA 3WJ7A 3GRPA 4BIIA 3RFXA 1E7QA 1U1IA 2OOSA 2X58A 3KYBA 3OFSA 1I36A 5ER9A 3JYQA 4PFJA 1EDZA 2WMDA 3NTRA 3V1TC 3K8ZA 1YOVA 2Q1SA 2HK8A 4BGUA 3GHYA 3JQCA 5L7WA 3VVCA 5C37A 5L4NA 1YJQA 3OETA 1VJ0A 4BO2A 5IDQA 1ZEJA 4Z3DA 2NVBA 4WLNA 3WDSA 4UEKA 3P2YA 4BNLA 3WICA 3PK0A 4FJ1A 1D8AA 4L8VA 1PGOA 5T8KC 4TMFA 3RBVA 1ULSA 1YWGO 5CDGA 3LT1A 2PV7A 5A9TA 3GNQA 4AL4A 1H6BA 2VWGA 2VYVA 4OQYA 2NVWA 3DWFA 4PZDA 3WNQA 5DCWA 4CV1A 4BMNA 3JQGB 1HRDA 4J7UA 1FDTA 3VZPA 1PJQA 4BNKA 1UXHA 1RJWA 4E21A 1YBAA 3ZWYA 3I3OA 2EV9A 3MJCA 4DQVA 4RCVA 1NP3A 3ZI0A 4HNHA 2YQ4A 3BTVA 4J90A 1I3LA 4KMSA 4F6LA 3ANMA 1QYCA 2W2KB 2ZCVA 3KEOA 4Z3KA 1LDEA 4WNIA 2X6TA 5I7EA 4JJFA 3DC2A 1CETA 5JAZA 1J49A 1P74A 3I52A 4JJIA 4RVDA 5LDHA 5ILOA 1YQGA 2HMWA 3AW9A 4GLLA 3TSCA 2VWPA 2OBYA 3ZWCA 5DZSA 3I6QA 2PH3A 1LUAA 2A9FA 1DC3A 3VH3A 3A14A 1NPYA 1NFRA 3PTZA 4AJ2A 3U49A 2PY6A 4GKVA 3W4IA 2WE7A 5B12A 3P5SA 5GZ3A 4NFHA 4I5DA 4B4WA 4OQZA 4YVFA 4Y9DA 3JQ7A 4PLFA 2C07A 1F17A 2YDXA 3CMMA 3WSVA 1O8CA 4AICA 4XKJA 1BVRA 4BQPA 1YXMA 2GASA 3C1AA 3GK3A 2ZB8A 2FR0A 3JD0A 1M66A 2PD6A 3GUCA 3WGYA 2NWQA 3GAFA 1JKJA 3EZYA 1ZK1A 3WIDA 3JQ7B 2OXIA 1R4MA 4RVFA 2HLPA 5U4QA 1TT7A 1DHTA 1F14A 3GN2A 4R4JA 4AVYA 2QW8A 3FD8A 3HB5X 4AJOA 2VZ0A 4RDIA 1XU7A 1GYPA 5L4LA 3GZNB 1F8FA 1X1EA 1R4NB 3RI3A 3N7UA 1CYDA 3A4VA 4ZQGA 1GTMA 3V1YA 1EDOA 3GQVA 3OEYA 1UUFA 4CMEA 1I5RA 4DL9A 1IPEA 4A0SA 2JFHA 3JV7A 1KETA 4BGIA 1NYTA 1HKUA 2GDZA 2O3SA 2PGJA 2DTXA 4Z6KA 1RM3A 3QY9A 2CY0A 5G4LA 1ZJYA 4DPKA 2YUTA 4Q9NA 4PZCA 4CMEC 5KKAA 1W4ZA 2J6IA 5JE8A 3QA9A 3SLKA 4PN3A 1T24A 1U8FO 3WQQA 3TL3A 2GR9A 4E32A 3H8VA 3GVHA 1KIFA 4CLOB 2NSDA 1HZZA 4I08A 4RF4A 4UVEA 3WGZA 4E5PA 1HSZA 1PR3A 1QXSA 3NGXA 4PZEA 4EYEA 1OC4A 1UXJA 3IJPA 4AJPA 2ZKLA 1QP8A 3AY6A 2WSBA 2QZZA 4AJHA 3TWOA 4FOOA 3NV9A 3QWAA 1ZXLA 1LSOA 3G79A 3ZWVA 1EQ2A 3CMCO 4B79A 5I7VA 2V7PA 4XR9A 3NT2A 3GLQA 1WZEA 3GNTA 4J4TA 3LZ6A 2X7HA 5ITVA 1NPDA 4F45A 2OGUA 5ENDA 4TZKA 4BB6A 4DYVA 3VHRA 4NPCA 1U2GA 4XEHA 4CJXA 1VJ1A 3VAZA 1YL6A 1UDCA 7ADHA 1PQWA 5TX7A 3ZV4A 3PWKA 1W8DA 2BH9A 5EQFA 3CUKA 3QJ5A 2UV8A 5I8ZA 4MIOA 4OMUA 1F06A 2NLOA 2AG8A 4GLOA 2J3KA 5K9ZA 4RF5A 3KHUA 2EW8A 3H2ZA 1HYEA 4UULA 4E30A 2GF2A 3R1IA 3DBVO 1IPFA 2IXBA 5IXSA 4ZGWA 3TQHA 4E33A 2VTEA 3AUSA 4K9DA 2CDCA 1HWYA 1JVSA 1VKNA 1W0CA 4XWYA 3QW2A 3S2GA 2R00A 4A5OA 4KZPA 1P31A 3R3JA 1T2CA 3VPHA 4U6SA 2SCUA 3GVCA 3DTTA 4ZQFA 1NAHA 1V0JA 1ZUD1 4TVBA 3T7CA 4UVHA 5JXWA 4N5NA 1OAAA 5HTOA 4L0QA 1AXEA 5A02A 2YV3A 4JLWA 4NBRA 5IZ4A 1NX6A 1Q2XA 1NHWA 2R00C 3OA0A 4XX0A 2X0NA 3DZBA 1J5PA 1C1DB 1ADBA 3RIHA 4YJFB 3RAJA 3H9QA 3BMOA 1YJ8A 3D0OA 3I1JA 1NFFA 1KYQA 3F6YA 4R69A 2GCGA 1GV1A 4OSOA 2TMDA 4QTZA 5CP8A 3BHIA 2RAFA 1B15A 4FIZA 4RPLA 2X0IA 3R3SA 5GZ6A 2Q50A 3HB4X 4KUGA 1H6AA 3E03A 4RGBA 3ZZNA 3JQ8A 5GZ1A 3GDGA 1MA0A 5IAAA 3NRCA 4I5EA 2NQTA 3GVPA 2EKQA 1UXIA 2Q4EA 1X7GA 3E9QA 4U6QA 4A2CA 2YJZA 1ZSNA 3MWEB 3K92A 1BXGA 3WS7A 3DXFA 1X13A 1V3TA 4AJLA 4BKRA 4CV2A 1WDLA 4IDDA 4J1TA 1N7HA 3PHLA 1MFZA 5DULA 1D1TA 3A28A 2ZJ1A 1NWCA 4XJTA 3OICA 4AJ1A 1YKFA 3ROPA 3JQ9A 3OJLA 1YONA 1Y5MA 1T2AA 2PD4A 1U3UA 5COBA 1NR7A 2CFCA 4RL6A 3KSDO 3ZWWA 3NEPX 4BKUA 4R16A 1BTOA 1GCOA 3DZHA 3E18A 1BHSA 3MEQA 3NUGA 1BXGB 1LC0A 3D5QA 4NIMA 4ZU3A 1XYGA 3PYLA 4GWKA 5COQA 2EP7A 4IPTA 3DBHB 4GWGA 5KVQA 2YYYA 3IUSA 3HDQA 2ZYAA 1WLYA 3OJ0A 3Q9UA 5ILGA 1H94A 5BSGA 1I3NA 2QX7A 4WE3A 3DOJA 1PJLA 1VE9A 4ZQBA 1R16A 3LC7O 4IY1A 4FDAA 4PGFA 3HSKA 4XYLA 4PLHA 2Q2WA 3EUWA 5JDCA 5A5FA 3GDFA 1GYQA 1LDBA 1E3SA 1DC5A 1EVYA 3OJEA 4OXKA 4GX5A 4BO5A 5L51A 5BSEA 2A94A 3L6EA 9LDTA 4RPJA 4PIVA 5BNIA 2Q2VA 3OBBA 4BUCA 5EPOA 2J8ZA 2GN9A 4CL3A 1E3WB 3FNHA 1S7CA 1ENPA 2DBVO 5JDCC 2X9VA 3JSAA 4HFJA 4B8ZA 4BGEA 5JSFA 4IS3A 3FCOA 2HKIA 1KC3A 1HEUA 2GNAA 3M2PA 1K6IA 5JY1A 3ZWXA 4BNYA 1CDOA 1JVBA 3AM5A 1IHYA 3QWIA 4ALIA 3ADPA 1UDAA 2DFDA 1GZ4A 4M8SA 4RQUA 1T2DA 1V3UA 4DVJA 5IXYA 1I01A 3LT4A 5KWEA 5JYEA 3F1LA 3DAPA 1ONOA 4L4RA 3VDRA 2H1SA 4IJWA 4UVGA 2WDZA 3WFJA 5I9LA 2BGMA 2C5AA 1IY8A 2D0IA 3ABIA 4KUEA 5JC1A 4BO3A 2JAPA 4J4BA 1N1GA 3AUUA 3HHPA 3HN2A 1JLLA 3FWZA 4WK6A 1SPXA 4HBGA 1E1LA 4F46A 1L7EA 4RLHA 3ITKA 4IZIA 3RUAA 2NU9A 4KWIA 1CRWG 5CFZA 4OXYA 2CF6A 1C0PA 4BNNA 1J6UA 1VC2A 3PQDA 5L3ZA 1C0KA 5H82A 5JNLA 4J91A 1E0DA 1UP6A 3C1OA 3G49A 3Q0EA 1DB3A 1V35A 3VZRA 4JQCA 3T7EA 4ZD6A 4OYRA 4GVLA 1DIGA 1VSUA 4JBGA 5DBIA 1ZSVA 2AE1A 4Z9XA 3T4XA 4D44A 4BNWA 5DBGA 1O89A 4DPMA 2C2YA 4U0KA 1LSJA 4CM9A 1E77A 4Y6SA 4CQMD 4EJMA 4MP6A 4CLXA 5ADHA 1ZK3A 3H9UA 3ONFA 1NVGA 3G1UA 1E3IA 4GPD1 2PD3A 2CDBA 3NJ8A 3AU8A 4R3WA 4QT0A 4ZA2A 3AUTA 5EINA 1N1EA 2EJWA 1E7WA 3FI9A 3PVZA 4K26A 3U09A 4TKMA 4XYEA 4FFNA 5JDIC 2YZ7A 4CR8A 3DZGA 1E3JA 3ENKA 3GPDG 3GFGA 4MVJH 3Q9NA 3HNPA 3QVSA 2OZPA 3GRKA 4G5HA 5EJ2A 3RU7A 4CLEA 4HP8A 3BHJA 1XR3A 1E1NA 1FMCA 1UDBA 1K5HA 3W1VA 4FPXA 2NVUB 3BAZA 2OP1A 1NQ5A 2FSVA 1E7MA 4M55A 5JAMA 1MXFA 1G0OA 5AOVA 5C7OO 1NXQA 3RWBA 2DPGA 3PGXA 3BMCA 3CKYA 3RSHA 1SB8A 4K28A 2VHYA 4ND4A 4W4TA 3IDSA 4DA9A 3K73O 1XWFA 3VDQA 4W9NA 3FRJA 2PGDA 4EJ6A 4WEOA 5KTKA 2NM0A 3QHAA 3GY0A 3AM4A 3S8MA 3MTJA 3OHSX 1NNUA 4QXMA 1ISGA 3MZ0A 3M1AA 4DMMA 2GD1O 4B3IA 3B20A 3BMCB 3KETA 4IM7A 4JGBA 3H6KA 3TZ6A 3ZU3A 2VHVA 2R2GA 3V2UA 1M6HA 2X5OA 5A3JA 1IULA 1EVIA 3DOOA 5HS4A 4P22A 1HLDA 4EW6A 4IMPA 4RPGA 3ST7A 4WGGA 1Z7BA 3ITDA 2I9PA 3OIFA 3V2GA 4FBGA 1ISFA 4J16A 4E5MA 3SX2A 4YACA 4S1VA 1ZCJA 1H6CA 1Y8RA 3DQPA 3I9JA 4WUVA 2OORA 2V6MA 1SO8A 2NACA 2VRCA 1EMDA 2VYND 3OQBA 3Q2KA 5T67A 4EGFA 3F5QA 3F3SA 1LRLA 5LDGA 4A7PA 3I9MA 4OKNA 4PVCA 3M2TA 3Q2IA 3R0IA 1IE3A 3E48A 2PKQP 1A9ZA 4FFRA 3ZWBA 1G0NA 5C7LO 1Y8RB 2X86A 1K0UA 3PJEA 1WMAA 1CF2O 5DOVA 4A10A 2X5KO 3ON5A 1PGJA 4E2WA 4D45A 2VWHA 2H6EA 2F00A 2WJPA 1PWXA 4KDEA 5CPBA 2O3JA 4H7PA 1H0KA 4XDYA 1SC6A 1SOVA 4IJUA 3CE6A 1P77A 4EITA 1C0LA 1C0IA 2I99A 2GN4A 4R1SA 4X54A 4CUKA 1HETA 1I0ZA 4MVJE 1YQXA 3KBOA 1EFLA 1M67A 3FBTA 4B7XA 4P4NA 4DGSA 1E1KA 1X0XA 4DC0A 5F5LA 4XQGA 3ZCXA 4D42A 3M6IA 2AQKA 3U62A 1TXGA 3WYEA 2O4CA 4LCEA 4H15A 1PS8A 3SJUA 3ZNPA 1K89A 2VCYA 5BSHA 2C2XA 3QVXA 2FZEA 2GERA 3HE3A 1Y7TA 4K6FA 1XIVA 4B8WA 2FR1A 1PJ2A 5KJCA 1B8VA 3KO8A 1A27A 3RUCA 4Q3CA 1KVRA 1LSUA 1XDWA 1B8UA 3TFOA 3I9NA 2Y1FA 5A06A 1NR1A 3VTZA 1JDJA 4RF3A 4YT5A 3ROMA 4PG6A 1NFQA 2AHRA 1Z7EA 2RH4A 3JCZA 5JY6A 1YB1A 1DAPA 5I7SA 5F3RA 4IGFA 3ROQA 4J0FA 2RHCA 3BA1A 3LYLA 3M1LA 4OSPA 2GZ3A 4DLBA 5JFOA 4YT8A 2FWMX 3JQAB 4YT4A 5IZCA 4YEDA 1Y6JA 3GT0A 1A4UA 4Z0TA 3RUEA 5F1PA 4CODB 3W4JA 2BI7A 4GL4A 5ENVA 4BNVA 1PJBA 4IJKA 1LLUA 1GZ3A 1ONPA 3G17A 4WNCA 4B4OA 2D5CA 2VUTA 5JC8A 2UDPA 3D3EA 4BV8A 3WGIA 1GAEO 2QYSA 3JQEA 5IZCC 1XU9A 4FR5A 2G1UA 4W7IA 3NYWA 2EXXA 1KBZA 4ND5A 4MVJG 4Y6RA 1DXYA 3BIOA 3VH4A 2EERA 4FSHA 2ZTMA 1MB4A 1TI7A 2B83A 2GUGA 2HO5A 3ETDA 2HDHA 5U1PA 3PYMA 4ALKA 3ZNOA 4D7AA 3ZV6A 1I8TA 4CM6A 5TT1A 5T8KA 2DC1A 2C20A 3C7CB 1YS4A 3V2HA 2OP0A 1HYGA 2Q1WA 1E1MA 4YAKA 3WX0A 1ONNA 3U4IA 4JNKA 1P0FA 2JL1A 2VUSA 1HDYA 3P2OA 3PFFA 1JAXA 1YVEI 5H83A 2Y1DA 3CZMA 3D1LA 3L0DA 2GZ2A 1E3EA 3IKVA 4YQZA 3MJ4A 5MGBA 4BKOA 5F21A 1C3VA 1DEHA 1SB9A 1YOVB 2X9GA 4R1NA 1G6KA 3I6IA 3RASA 3AM3A 2Y0DA 3UN1A 3ZU5A 2UAGA 1ISIA 5C7IO 1XEAA 2EF1A 2P5YA 1RPNA 2E82A 1AGNA 2IZ1A 1B16A 1C14A 3DB2A 3RKUA 4CMGA 1ID1A 2P4QA 4QFCA 3WOHA 1DPGA 4J3FA 4XYMA 1WW8A 1LQUA 1I2ZA 1JWBB 4NZ9A 5U9CA 1IHXA 3AOEA 1BW9A 2W2LD 1Q0LA 1QG6A 2JD1A 3JQ6A 3RFVA 4JBIA 1Q7GA 3U0BA 5KNLA 3ZNQA 1DIRA 5LCXA 1HTBA 2DBRA 3BMQA 3INGA 3GDOA 3AOEC 2PKRA 2ZTUA 3IP1A 4RVUA 3DHNA 1DLIA 4GGOA 2VNAA 4WCFC 4FOSA 4YXFA 5F1OA 1LA2A 2HUNA 1UR5A 3FNEA 1WMBA 3NDIA 4O1MA 3ZN2A 4N5MA 4ROSA 2IDZA 4NU5A 5F5NA 3JQBA 9LDBA 3EYWA 2GN6A 2H63A 5EERA 1ADGA 3D5TA 4AJKA 4E4YA 5IJZA 3BMQB 1XELA 3PDJA 4CM4A 3OJFA 5I9NA 2AEFA 2PZMA 4FJ0A 4BGVA 1IB6A 4BB5A 4B4UA 1RYDA 1K6JA 2CSUA 2CD9A 1E5QA 4JXKA 2RH8A 2DTDA 2PLAA 3JQBC 5KVCA 2D1YA 1M76A 1O9BA 4RVGA 2C59A 3VH2A 4MP8A 2AXQA 3PI7A 4D46A 2Y1CA 2DVMA 2VT2A 3TJRA 1ADFA 2IZ0A 4BNXA 1A71A 2X0RA 3OM9A 4BKQA 4CM7A 4YPOA 3WR5A 1YBMA 4ND2A 3C7DB 3QVTA 1ZK2A 4KWHA 4YA6A 4LMRA 1R37A 1WZIA 4ZICA 4L9RA 1UAYA 5L40A 3LU1A 1R15A 4OHUA 3IUPA 4O63O 1MX3A 5TJ9A 4D3DA 4HADA 2DQ4A 1B14A 4XB2A 1ENYA 1PZGA 4XR4A 2DFVA 1UP7A 5CEEA 2BLLA 3BTOA 4I5FA 5TNXA 5IN4A 1LRJA 4NJMA 4FD3A 1VKOA 1R4MB 1HLPA 3AK4A 3QSGA 3VC7A 5DT9A 1VM6A 2EHDA 1EUDA 5HBRA 5JMPA 4C7JA 4YQYA 4CM3A 2D59A 2O3UA 2LDBA 1H2HA 1OFGA 3K31A 3OQ6A 2QG4A 4QEDA 4UUPA 3FBGA 5THQA 1KVSA 1SCUA 4TROA 3UHAA 4NJMB 1N2SA 5BSFA 3G3EA 6ADHA 1LI4A 3TDKA 3DR3A 2O3RA 2GGSA 3EMKA 2YV1A 4PRLA 1AN9A 1J4AA 3FPLA 4FCCA 1KOLA 3RKRA 4CMAA 4R5MA 1NBOA 3LVFO 7MDHA 3WYBA 1IOLA 3HDJA 2JHGA 2ZB4A 5JS6A 5KIAA 1B2LA 3ASUA 2AMFA 3S2IA 1HF3A 4GX1A 2PA3A 2QZ9A 2ILTA 3PWSA 2FN7A 3H3JA 3HDHA 3TL2A 2Q1UA 3AWDA 1KS9A 3WGHA 4K1LA 2DTEA 4J43A 4QUKA 1WAMA 2PZLA 4H16A 1I2BA 3PJFA 4IQ0A 4JIGA 4DTIA 4OJNA 1E7YA 1XHLA 4RDHA 3E1KA 3VPXA 4RPHA 4P4GA 5JBIA 2QYTA 4HKTA 5L4SA 1SOWA 2B37A 1GEGA 3EHEA 4WEQA 4OAQA 1ZW1A 4CR7A 3IMFA 3HADA 1U3WA 3EAGA 6LDHA 4CMCA 3L07A 5DCUA 2VYNA 2X9NA 2C54A 3ZHXA 2O2SA 4OH1A 4BHTA 3IJRA 4PG7A 3AI1A 5EQDA 5G4KA 2BGKA 2VZ9A 3SC6A 5B37A 5KVVA 5L7YA 1AE1A 2B4RO 2AQIA 2FP4A 4UEOA 1BXKA 1CERA 4YJDA 1QSGA 3MTGA 1F0YA 4KTVE 2Y93A 1ZEMA 2Z1NA 3H4VA 3PLNA 4YBZA 3FTPA 2AA3A 4II3A 4CQLA 4EEZA 2GN8A 3KLMX 4NHEA 3FWNA 3WMWA 1SEVA 2FMUA 1PGNA 4MP3A 3KRTA 4DUPA 2HK7A 3NTOA 3HDYA 1WWKA 4OL9A 1ZO8A 1Q7CA 2XXBA 1XSEA 3TOZA 2BMAA 4UVDA 1HDOA 4R1TA 1D7OA 2ZIZA 4UREA 2Q1TA 2J5RA 4GKBA 3DAFA 3PZRA 1GD1O 3U9LA 1A4IA 2WTBA 2CUKA 1A7AA 1VSVA 5DNAA 3FN4A 2I65A 3INRA 3KYCA 3EK2A 3ICPA 4MVJD 1LNQA 3ZH2A 3F4LA 3A1NA 2P9CA 4UAGA 2ZATA 4NNJA 4LSMA 4ND3A 5JCJD 3UCXA 4O6VA 5GY7A 4CMHA 2W4QA 1GQQA 4FFPA 4KOAA 2WWRA 3V1UA 3KZVA 1EVJA 1JKFA 1XKQA 3BMOB 3E8XA 1Y81A 1N7GA 4UUMA 4D0RA 5G2OA 4PLTA 1U4OA 4JROA 1JTVA 1PGQA 2JAHA 3ASVA 3H7AA 1PR9A 2I76A 3B1FA 3KYCB 4I9NA 1VI2A 1D3AA 3G1TA 4JP2A 4J9VA 2EW2A 3GA0A 1SBYA 2W98A 5I9MA 1DC4A 1F8GA 2V6FA 3BMNA 3JQAD 4BVAA 1T25A 4RZHA 3UF0A 2DT5A 3MJEA 4XGNA 2DAPA 4HX5A 3JQ8B 1MP0A 2O2YA 3S2FA 3DZIA 3FSRA 2PR2A 2HAEA 3L77A 3OQ1A 1LX6A 3SBOA 2D4AA 3PJDA 3PQFA 3E9NA 2O50A 3JQFA 1DLJA 1WDKA 3D3WA 3RUIA 3B70A 1PU2A 3QP9A 2FPPA 2Y99A 4XGKA 4L4XA 1U9JA 3I9KA 3KTDA 5EL0A 1XG5A 1KVUA 1VPDA 3LT2A 4NMHA 3JQFC 5ITWA 3NTQA 1S6YA 4M49A 5L7TA 3WIEA 2CF5A 3HG7A 2D8AA 3TNLA 1TEHA 3Q3CA 4PLGA 5FI3A 4WLUA 2X22A 1U3VA 2JCYA 4MDHA 4PLPA 5BR7A 5KJ6A 3T4EA 2IE0A 3Q6IA 3KYDA 4PLYA 4IDCA 4MVJI 1YL5A 2VOEA 2FSSA 1D1SA 1QKIA 4NU6A 4E6PA 1NPTO 3GZ4A 2FR8A 3GUYA 4Q3AA 1OMOA 5J23A 3LLVA 1WNTA 4NQZA 4EJ0A 5TQVA 3PDUA 2F1KA 1BGVA 4GQAA 4Q39A 4KQWA 5AXCA 1GU7A 1XA0A 3UW3A 5JW6A 4R3NA 3U5TA 1ULUA 4TRMA 1ZFNA 1R6DA 4QO8A 4CUZA 4DBZA 3Q1LA 4GGPA 1Y8QA 4LISA 1FK8A 1VRWA 3UICA 4J1QA 4BQRA 2VYVD 2EKLA 3ZHBA 4DYDA 4ONEA 3AOGA 4JK3A 4KUHA 4XZ3A 1U28A 3DMTA 3QRWA 3MJTA 4MVJP 4TRJA 1NQTA 4XJSA 2W2LA 1HE5A 4URFA 5DF1A 1LLCA 5AVOA 1YDWA 2PKQO 3D4NA 3JD1A 4XA8A 4Q3NA 3O8QA 4YDRA 3W8EA 4D43A 3DMTC 3DZJA 2H9IA 2PZJA 4ESOA 1KEVA 2RBEA 4CMKA 4AJJA 1GCUA 5BNFA 3AU9A 3PRJA 4R9RA 2XAAA 1P1RA 4LRTB 4LVCA 1B26A 4EEXA 4IIVA 3FNGA 1RYEA 1IL0A 2BGLA 5EESA 3DO5A 5DBFA 2YDYA 4Z0HO 1PEDA 4A26A 5HM8A 2VNSA 1QLJA 5G0SA 1LDGA 1I32A 4LRSB 1M2WA 4DIFA 1U2DA 5KOIA 3HUDA 2WD7A 3WSWA 1PZFA 1GR0A 1GY8A 4MKXA 1ISHA 5A04A 4FFMA 2DBQA 4DWVA 5CEFA 5GMOA 1B7GO 2QQ5A 2HSDA 3WGOA 4II2A 4ZRMA 2CVQA 2VHWA 1LBEA 3DBRA 3C8MA 4LCJA 3WBFA 1MXHA 4BO1A 3I4CA 1R0SA 2VHXA 3DFUA 2JHFA 5JDIA 3CIFA 3ONDA 1QYWA 2VUUA 1HDZA 3IAHA 2A4KA 4JP3A 2WD7B 2IRWA 4MJLA 4MVJM 4ALMA 5KVSA 4IDEA 3A9WA 1DFGA 2FZWA 4XIJA 4N54A 1LRKA 3TZHA 1DHRA 2DUWA 2Y66A 1Q0QA 1JWAB 1RM0A 2NU8A 3ZWNA 1Z74A 4CPDA 3F1KA 4TRNA 1JA9A 1I3MA 3PHIA 3GVIA 4YR9A 2GPTA 3PHGA 1LSSA 3RC1A 1X0VA 4GI2A 2B35A 2Q46A 1OOEA 1ZNQO 2HQ1A 3ZU2A 3TZCA 5AXBA 1GEEA 4ZN6A 1BWSA 5CDUA 2V65A 4A73A 4TQGA 2PFGA 1KEUA 3JYNA 4YJHA 3TOXA 4DMLA 5BT9A 1EUZA 3BYZA 2ZTVA 4B4VA 1T1SA 5CPFA 2CDAA 4BS9A 4GAEA 5B4UA 4UEJA 4M54A 3VOSA 4YT2A 2B4TO 1ZH8A 2ZCUA 3I83A 5DDIP 5AXAA 5L95A 4QQRA 1I30A 4OOEA 5IG2A 3IL2A 4YJGA 2PGLA 1AXGA 4R68A 1I3KA 2C29D 1YGYA 2FOIA 3LF2A 4YJHB 1H6DA 1A5ZA 1UZLA 2D5AA 4W82A 3WGQA 1K6XA 2JJYA 1ENOA 1GFSA 3X2FA 2EWMA 2Q3EA 2OUIA 4K6CA 3DAGA 4R54A 5FI5A 3F47A 1DJQA 2ZYDA 3O4RA 4Y8VA 4E5YA 4JN6B 4E2YA 5HRUA 1GYRA 1N92A 1M6WA 2JD0A 2QIOA 2NV6A 5A03A 3DONA 4BO0A 4TZTA 4LW8A 2YHUA 1HE4A 4J2OA 4GH5A 1X14A 4RLSA 4CUJA 3C3XA 5A9SA 2VHZA 4HUJA 3WLEA 3ZGYA 1HE3A 1BVUA 1TT5A 4BNTA 1OBFO 3RUFA 1EEHA 4LSWA 2O7QA 3BHMA 3VTFA 4ALLA 3AY3A 1ENZA 3S1LA 1KY4A 3KLPX 1ZMOA 4FFLA 2AEMA 2VWQA 4J7CA 3MWDB 1H2BA 3AJRA 2O7SA 4P8RA 4IDAA 4J2HA 1EZ4A 3H5NA 4HFRA 1MGOA 5THKA 3RCBA 4A03A 4J1NA 2PWZA 4WJZA 2AG5A 2I3GA 4LMPA 3AFNA 5HA5A 4ZJUA 3O03A 4NBVA 3MJVA 4G2NA 4FFOA 1O95A 1Y9AA 4WLEA 3RVDA 2HRBA 4FC6A 3KEQA 3PIIA 5HS6A 1Z73A 2Y1EA 5G0WA 1LDNA 4MKZA 2GZ1A 4ID9A 3FR7A 3IQDB 4HNGA 3U3XA 1CQJA 4CMJA 3PWZA 4RV9A 4Z9FA 3ROKA 1MV8A 4RVHA 3WWYA 1QORA 1T4BA 1UH5A 3GNSA 4E5KA 3WFIA 4NBTA 3RUDA 1E6EA 1I10A 4DQXA 1ARZA 4YAEA 2WEKA 3L4SO 3AUAA 3Q11A 2CVZA 4IDFA 3RBZA 3TPCA 1HT0A 1E5LA 4NG5A 3IC5A 1LLQA 4QSMA 1DBVO 5TC4A 3EW7A 3LSYA 4W6ZA 3H9JA 1BDMA 3JD3A 3H9EO 2Y1GA 3PIDA 1EK6A 1XGKA 1DRVA 4MVJA 3STHA 4M89A 3OF2A 2WYVA 4BO9A 1PL8A 3RC9A 4CM1A 1PSDA 1X7DA 3GHHA 3JYOA 2YHIA 3LF1A 4FB5A 3GH3A 3W8DA 3OP4A 2J5KA 4L4SA 2RHRA 1T4DA 5K6AC 4MPDA 3TF5A 4EDFA 2AQHA 3OEWA 4IXTA 4B3JA 5JCXA 2E6UX 1BDBA 3IOYA 3PJGA 1TVEA 2B4QA 3PYXA 3QE3A 1WP4A 4E13A 4W7HA 4G81A 4WOJA 2HU2A 1T26A 2VN8A 4LGVA 1E92A 3KSZO 3HJAA 4L75A 3NKLA 5TF4A 1PJ4A 3UCFA 1WXDA 3I9LA 2Z95A 2VTDA 3RC7A 1LC3A 5A1TA 2I3AA 1DJNA 2YHIB 1IYZA 2Y1OA 4AFNA 1C1XA 4E3ZA 4FS3A 1R12A 5CAEA 4ZVVA 3K30A 1UJMA 3L4BA 3SJ7A 3S55A 1TA4A 3JYLA 4KP7A 2X5JO 4NR0A 4M1QA 5IN5A 3FNFA 3K2EA 3OMLA 1KERA 5IFLA 3ZV5A 4IS2A 5DN9A 4YYZA 3PXXA 4UVIA 5A3VA 3LC2O 5A4DA 1ISJA 3L4BC 2P5UA 4BNHA 4CV3A 3H9GA 1U3TA 4GSKA 4WASA 1C1XB 1P3DA 4U7WA 1V9LA 3QIVA 4FQ8A 1CWUA 3EGOA 1PIWA 2E37A 4YTEA 2UUOA 3V8BA 1B8PA 3CINA 4OOFA 2DBZA 3TN7A 3COSA 3R6DA 2IYPA 1DIAA 5TS3A 1P44A 3RD5A 3X2EA 4YAGA 3ZWPA 4F3YA 3F9IA 4NBUA 4QO7A 4BO7A 2C7GA 3B1KA 5TT0A 2B36A 5B4TA 4LVUA 1NQAO 4ZQHA 2FHSA 1PS0A 3PPIA 3UAGA 4PLCA 2W90A 1QYXA 3ADOA 4NDNE 2PTGA 3E6AA 3SXPA 2W8ZA 4H3VA 2IEDA 4I5GA 2E48A 5TIIA 2Y0EA 1CIVA 1E7SA 1G1AA 1DAOA 2I5PO 3JQGA 4EZBA 3DHEA 2HMVA 4W99A 3VPGA 3H5AA 4R9SA 1U7HA 3GEGA 3NT4A 3WG9A 3H3FA 4HXYA 3ZDFA 5C3MA 8ADHA 3WBBA 3P7MA 4A27A 4DXHA 1QYDA 1YL7A 5IF3A 3C1TA 3QWBA 4QFDA 2HMTA 4WCFA 1SAYA 2X4GA 2W2KA 4GBJA 1PL6A 1ZVMA 5MDHA 2O3TA 3PFWO 4IJVA 3KXDA 2AQ8A 3QVOA 4BMSA 4YAJA 2ZJ0A 3PZBA 5H81A 2IZZA 4PG5A 1BW9B 4EUEA 5CG2A 4DIOA 1LXCA 1DIBA 1MG5A 4WCFB 5CDYA 2Q49A 4XRGA 5LC1A 3FHLA 4E2XA 4JJGA 1GADO 1GV0A 3OJOA 4JCOA 3G0OA 5ICSA 2Z1MA 5L9AA 5DCYA 2VZ8A 2VT3A 3E5RA 2G0TA 3RUHA 3EY4A 4RF2A 3S2EA 4HV4A 1VJTA 2P9GA 1LU9A 1PL7A 4XQEA 1NQOA 4L73A 1WDMA 5TLSA 1DSSG 1BRMA 1QRRA 4PG8A 2RIRA 3GC6A 4RO0A 2B5VA 4CM4B 1HL3A 4PG4A 1DFHA 4J4HA 5FEUA 2VOJA 1GQ2A 1X7HA 2JD2A 1E6UA 4O5OA 4CQMA 4XQCA 1PQPA 2WYUA 3GPIA 3EC7A 3GF4A 2NNLD 3IKTA 5B4VA 3U4DA 4OGWA 4NI5A 2NADA 3WB9A 2C5EA 2P68A 4DC1A 1A72A 3GG9A 3FF4A 2B0JA 4CM9D 3LLSA 1D4FA 3UUWA 4EI2A 2H5LA 2GSDA 3GZNA 2JCVA 4CR6A 3VKUA 4DPLA 1T1RA 1R4NA 4Y67A 3GVXA 1ZMTA 2Z5LA 3QLJA 2JFGA 1TB4A 2I6TA 3NAQA 4I9HA 4CQMB 3H5RA 4NK4A 2UUPA 2GYYA 3NDRA 2XXJA 4E2ZA 5I7FA 2DLDA 5DP2A 4FN4A 3VKVA 3GGOA 1R66A 3H65A 4YAIA 2IODA 4ITUA 1MG0A 1AHIA 1Y9EA 1JW9B 4IXWA 3WYCA 4Q3BA 4BNZA 5JO0A 1B3BA 2B69A 4YRBA 2FRDA 5JMWA 1KY5A 1FDVA 5JYDA 4Q3EA 4AJEA 1OC2A 4PLZA 4DREA 2OFPA 3GR6A 4IQ8A 2QHXA 3OA2A 2Y67A 4BNJA 1QV6A 1HYHA 1ADCA 1JN0A 3AI2A 2IYOA 4CLOA 5T64A 3FPCA 1QV7A 3ULKA 2J5QA 4TRRA 2HJRA 1L7DA 1PJSA 1Z82A 1ZXBA 3RROA 2YFQA 1DOHA 1RM4A 4F6CA 4Z0PA 1JKIA 1R0LA 3NT5A 1Y1PA 4LK3A 1DRUA 1MLDA 3DZKA 1K3TA 3JD4A 3F5SA 1UXGA 1CQIA 4B7UA 4C7KA 3NGLA 4ZHSA 1R0KA 4WECA 3OH8A 1P1KA 3H2SA 4Y98A 5TRTA 1P0CA 2P9EA 3F4BA 3IS3A 5FYDA 2VQ3A 3GGGA 4HY3A 4IDBA 1N8KA 2NTNA 3B1JA 3E5MA 2BFOA 4KTTE 2V6GA 1YDEA 3PQEA 5CDTA 4GX2A 2DU8A 1DO8A 4EUFA 5I8WA 3QWHA 3ZWMA 3LQFA 1F12A 5CEJA 3ONEA 4IINA 4MVJF 5CDSA 2BFAA 1X1TA 4I1IA 3GEMA 3IP3A 1NHGA 3O26A 5T6BA 3QQPA 4U5QA 2GRAA 4XRRA 4Y6PA 1CEQA 4UUOA 3RC2A 3JD2A 3JQDA 2VRCD 4J6FA 1A9YA 4OIMA 1UXKA 2ZTLA 4QX6A 3VPFA 1ZSYA 1XCBA 5C5IA 1UAGA 5K0ZA 3OSUA 4MKRA 3UFXA 3HZZA 4YB8A 2WD8A 2JKVA 3EZLA 3CH6A 4PRKA 3MJSA 4M86A 4RORA 4RVSA 4HWKA 4BOYA 4CLDA 4CLHA 2I66A 2O4UX 5G4KB 2BF7A 2LDXA 2WE8A 1P1HA 2D2IA 1X15A 1LDMA 3UH1A 4IZHA 4OM8A 1AUPA 3DDNA 1QYVA 4TWRA 4Q3DA 1U4SA 1ORRA 1HSOA 4CQLB 3DBLA 1C1DA 2X0JA 4GSLA 1HE2A 3L6DA 4YJFA 1UP4A 1GQYA 2C82A 4R51A 1ZIDA 1RWBA 3WNVA 4LN1A 4PCVA 4DBVO 1WVGA 3HWRA 3K2BA 5T57A 3RJ9A 1O94A 1NTOA 2GO1A 2E49A 4NK5A 5ICMA 4XB1A 1E7RA 3SLGA 1GUFA 1P1JA 2YQ5A 4M87A 5A5EA 4OKIA 3D64A 1FJHA 3PP8A 1SMKA 2BFPA 2I67A 3DBLB 4IGEA 4D0SA 4BKPA 4CM5A 3SC4A 4N18A 1GUYA 5ER6A 3CZRA 4J49A 2NQ8A 4FJ2A 4XYBA 3ZNNA 1VL8A 1UZNA 1A7KA 4J9UE 4NJOA 3A06A 3ENNA 4CLRA 4RJTA 4BNFA 3GFBA 2PK3A 4G65A 1PJCA 4XD2A 3QV1A 2BELA 3GN1A 2ZK7A 4JX8A 3WTCA 2OHXA 2VRBA 2ZB7A 4J7XA 1T2EA 4L74A 3RBXA 1FDWA 3BMNB 4NFYA 2WM3A 3UXYA 3NX4A 2OO5A 5EN4A 5IDWA 1NVTA 1AHHA 1NASA 4CLRB 3C85A 4BMVA 5F1KA 1NWHA 2BHLA 2EGHA 3DFZA 4AG3A 2O23A 3WTBA 4E5NA 1SNYA 3DBHA 4U0JA 2BRUA 5TJHA 1N5DA 2EIHA 4DIBA 1GZ6A 5JAIA 3ZV3A 2TMGA 1O5IA 2P2SA 4NBWA 3D3WB 4D3FA 2ZQYA 3ORFA 1EE9A 5G0TA 1MC4A 4BO4A 4INAA 4R1UA 3WLFA 3AFMA 1SEPA 1XQ6A 5A05A 1B3RA 2IEBA 3JQ9C 5BQFA 2J3JA 3DHYA 3WGGA 4WLOA 5FFFA 1YBVA 3HFSA 4JBHA 3FR8A 1E3WA 1BG6A 1Y5RA 4DRYA 1JQBA 1U5AA 1IUKA 2Y0CA 3DEYX 1UZMA 5KJFA 4ZQEA 3AI3A 1FXSA 4O0LA 3INTA 3TRIA 3GMDA 2A35A 1KEPA 2C0CA 2ZYGA 1EVZA 3L9WA 4CMBA 3JTMA 3KYDB 4HFMA 1P9LA 5JAQA 1ISMA 4HFNA 1Z6ZA 1H9AA 2IXAA 2O48X 2OMEA 5A9RA 4TKLA 2Q99A 3K9QO 2PH5A 4ZRNA 2DPHA 5AXDA 3ZW8A 3VZQA 1NAIA 4OO3A 4ALJA 4YRAA 2EEZA 3GEDA 1MUUA 1T2FA 1DIHA 3D7LA 4BNMA 5JO9A 4E31A 2J3HA 1PJTA 2Q45A 3AY7A 2EG9A 1K2WA 1WPQA 3DL2A 4E12A 1Y8QB 5AQ1A 2HCTA 4S3MA 3WXBA 3GG2A 2YW9A 1ML3A 1MFPA 5T5QA 3ZHZA 3ZWOA 5IDYA 3I23A 4NH4A 3I5MA 2EGGA 4BL5A 4N5LA 4WLVA 4XCVA 1SZJG 1U7TA 1EUCA 1DDOA 1V8BA 2ET6A 1KVTA 4XIYA 5JPIA 3P19A 1V6AA 2G76A 4WCDA 4DQUA 3O8QB 4GMFA 2Q4BA 4IMRA 3MOIA 1H93A 3BZUA 3MOGA 4IBOA 3WQSB 2BFMA 2FY8A 3N74A 3UKOA 1NM5A 4L76A 3PLRA 1VLLA 3BTSA 1JAYA 4R5HA 1EQUA 1YB4A 3CEAA 5FWNA 1KC1A 2DKNA 5DP1A 2Y68A 3ZU4A 1PQUA 2HMUA 2RCYA 2X1HA 1LDYA 5KJ1A 4KQXA 3RQSA 2R6JA 2QRJA 4QECA 1PJ3A 1FF9A 3KSUA 1P33A 3HFGA 4AJNA 1ZBQA 1P45A 4XYGA 4TSKA 4GX0A 1HDCA 2NTVA 4R41A 4BNGA 4UUNA 2JFFA 3CTMA 2CVOA 5DOZA 1BSVA 3TZKA 3DBRB 4XQ9A 1ZKMA 1E3LA 3E82A 4GMGA 1Q0HA 5FF9A 4CV0A 3CSDA 3RU9A 1V3VA 2ZB3A 4EUHA 2PNFA 2NU7A 3C24A 3WMXA 4TVOA 4BO6A 3DMYA 2UYYA 2NVUA 4D3SA 3ETEA 2GLXA 1PWZA 3W4KA 4WOKA 2P4HX 5TGDA 2CZCA 4XDZA 1YRLA 1L1FA 2G82A 1XQ1A 1H9BA 2A92A 1N9GA 4C4OA 3ZHYA 2YV2A 3O38A 3UVEA 1IZ0A 1W6UA 2FPIA 4E0BA 1MC5A 1Z75A 3N58A 3KM0A 1ZZEA 1NVMB 2WYWA 4IUYA 1RM5A 3D4PA 1PX0A 4MIEA 3WJAA 3UCEA 4RQTA 4MO2A 1OI7A 1HDXA 1Q7BA 2BD0A 2FPGA 4RPKA 1GL3A 1YQDA 1PZHA 1BMDA 2ZQZA 1N9GB 4I8XA 2AEJA 3K96A 4ND1A 4YRDA 2DM6A 3GAZA 3C7AA 3F46A 2NU6A 3O9ZA 2EJVA
chains in the Genus database with same CATH superfamily
2PO7A 5DVZA 4DLKA 3I5YA 2WWVD 4YJGB 1MHTA 4FYYA 3ND5A 1VL6A 3DKVA 1KMMA 3U4AA 2QM3A 2ZRMA 4ILKA 4ALNA 3QENA 5G0UA 1MTZA 2W2QA 3CH5A 3IBYA 1RQRA 5T6MA 2HTEA 4PLVA 5LKRA 1U8XX 2AMJA 4BFSA 2ZITA 1SG0A 2J48A 3CXRA 4I6JA 2XOXA 1ONBA 4QNRA 3WWZA 1L5HB 3EGWA 5P8WA 4ZJPA 4FCVA 4H9GA 1IZ7A 2I1WA 3GFFA 2C95A 4P3OA 4RD6A 4JOBA 3ER9A 1KEWA 1GGHA 3SY8A 4UUBA 4F11A 2VEDA 2GZRA 4FDUA 4WPGA 2R11A 4G26A 1KJ9A 5A9SB 3ZWAA 1U0NA 2A1TR 1Z2DA 2W6OA 3SJAA 2WJVA 5A4JA 2D3TA 3EW9A 3OX4A 1PTJC 5DIFA 2DKOA 4FW8A 3H11A 4N7RA 3A1UA 3T52A 3TBKA 4NU0A 2ODAA 1JAZA 1HDEA 4FGWA 1KPGA 2B1GA 2XB8A 1EWQA 3HWX1 4PIMA 1JFSA 4H1WA 2Q6VA 4OJQA 1KJNA 4QULA 4NLLA 2JI6A 2E4AA 4DY6A 1TYCA 3CPSA 5EG5A 4TXJA 3WGTA 1YB5A 1P1IA 3BWMA 3MWYW 4FHZA 4BVKA 4B87A 4CKZA 5KCZA 1PZEA 1NMYA 1XZPA 5HFJA 2O3QA 3NO4A 4CFYA 2ZRLA 2LUOA 3KVOA 3NG1A 2YS6A 3AR9A 3VSEA 4YAUA 1QH0A 3EVNA 3IDAA 5L45A 3IQWA 5C5EA 1UK7A 3N2ZB 4JC5A 3FYHA 2YOHA 2EP5A 4ZAYA 4WZ6A 4CMIA 4EBFA 1QGED 4QQKA 4B3RB 1CKEA 1DOAA 2YMLA 5AKGA 1CJCA 1QBKC 2OKCA 4FMDB 1XKXA 2ANBA 2QN7A 3QELA 1MIOA 3IKLA 4DR1B 4NOLA 5BVGA 3W2EA 4EB0A 4J03A 5TPWA 4TV8B 1VGRA 4D0LB 2B5WA 5HF5A 3DP7A 1D6NA 2KW5A 4DIBA 1PVOA 5F2OA 2QUJA 1FLDA 1VDZA 3DOCA 5KNCD 5IYZA 4CT5A 2KSQA 3RTBA 2R5NA 3LY9A 4PQEA 1Y3IA 2P91A 1LVGA 4KRGA 1E6WA 3TUJC 1RADA 4AM8A 5HWSA 2AE2A 4WZAE 4PVDA 1QPGA 2BMDA 1ZJZA 5TEVA 3HN7A 3BWYA 5FYQA 3ZD9A 3KUXA 3DP9A 4V39A 4AY5A 2J41A 2CNBA 2AFVA 4B6OA 5BNZA 5JI3E 1YE3A 3PUHA 3ZCQA 1WXHA 1B0AA 2ZBEA 5M04A 1IOZA 4OF4A 3BTUA 2OA0A 1ZR4A 1JE1A 1LJ8A 3NCTA 2HJGA 2VK1A 4OXNA 1T3HA 2JFVA 2OD7A 4LXIA 5AYVA 1F48A 1SQ5A 5BPHA 5CLFA 3AM1A 4GXTA 5EUMA 3JYPA 2LRHA 3F4KA 2VF2A 1I33A 2CLKB 2OHJA 5EE3A 2I33A 3PF9A 3A2MA 4HDSA 3LJKA 3NHBA 3GGPA 1V25A 2DFPA 5K0SA 1RYFA 2JFOA 4KW7A 4AWBA 3TG8A 4IQGA 4QATA 1XNJA 4E51A 2BJVA 3DH0A 3FSJX 1MOQA 4IIXA 5F9HA 1BN7A 3I0MA 3L6UA 4GVXA 5EA2A 2ZZKA 3UUGA 1GLVA 1BS1A 3WQHA 5LQNA 3K6JA 3ISTA 2VXBA 2YZGA 3KHKA 5T41A 1WU8A 4P4LA 1XRRA 5B1YA 5LQJA 5JLAA 3OAAA 3OG9A 1T4CA 1W73A 5FLEX 3IUYA 3LK7A 1Z45A 4YWJA 4BEJA 1GCAA 5EIEA 3FVRA 4B82A 2TYSB 1NZFA 2G5CA 2GEDA 1SHJA 2VDJA 4WWHA 2E5WA 3HXKA 5KDLA 4X94A 2B8TA 2HYDA 1ZN7A 3OD5A 1Q0ZA 5GJCA 2XSZD 4OHXA 5PGMA 4NXMB 3EPKA 2VJDA 2VJMB 4G07A 4F9FA 1EGQA 3OIYA 1OAOA 3FPKA 3T3NA 2QVGA 3WVNA 4D8WA 3FGNA 4WKGA 3ONWA 1NUTA 3PRYA 4PPNA 3ECCA 3EEQA 4BV9A 3GCGA 3OC6A 3WIVA 2FEOA 2WKPA 3SZRA 3QWFA 2OBNA 4CM8B 1JDPA 3EULA 2VQEB 1N2JA 1H1LB 1MC8A 1D4OA 1N34B 1ZJ6A 1ZA2A 3MD0A 4JI6B 1NVDA 2JCGA 1E7QA 1U1IA 4HLQB 1RAFA 1PZMA 2DXIA 1H8HA 3OFSA 1OWOA 1QBGA 1Z2CA 3JYQA 2ZRFA 5CFQA 4S1OA 2WMDA 2C96A 4JWTA 2FMKA 2RAUA 1G2IA 4KGDA 2Q1SA 5A4KA 3HACA 1TM1E 2XV1A 3PEVA 3QLVC 2P6UA 2R62A 4IV0A 3JQCA 5GWXA 1SHZA 2H06A 3VVCA 5LQMA 3ZDCA 4M1SA 4RZ3A 1ZIYA 2IVFA 2IDKA 2A86A 2GA9A 2XI4A 3C43A 4Y9TA 3WDSA 4UEKA 3U9TA 2JKYA 1H2RS 2V97A 2BKLA 4L8VA 4JS0A 4TMFA 1J8DA 5FBKA 4COOA 4PO1A 5CB4A 1JQAA 1PW7A 2VK2A 3AZPA 2GPNA 4MWTA 4HQFA 4KE7A 5J2UB 1ZOLA 2NVWA 3VR1A 5DCWA 4BMNA 2F3RA 2YYZA 4JLMA 1LW7A 1LK0A 2G28A 1GQFA 2XDYA 3LY5A 3LH5A 1DAGA 2I2AA 1Y3BE 5LNK1 5IABA 4BNKA 3LCUA 1YBAA 3I3OA 3BEDA 4YLYA 2FCRA 2FVYA 4JNCA 2YQ4A 3L7LA 1TM3E 2CFTA 4IXMA 5JAUA 3ND8A 1WUYA 2ZCVA 4GXQA 5GM1A 3SJZA 3LWZA 3SD7A 2JLXA 4Z3KA 1FP1D 1G16A 2HHHB 4WNIA 3NATA 2A9PA 3SC2B 5HG0A 2PUTA 1CETA 4N6OA 3UW1A 1CUUA 1J49A 3QKSA 4RVDA 4DR7B 1U0EA 4DW8A 2PBFA 2V3WA 1YK1A 3AW9A 4GLLA 3IO5A 3SG0A 4EP1A 3AF6A 3QF4A 4Q37A 4YHHB 2WA2A 1C7IA 1NPYA 4UTXA 1RWVA 2INGX 3U49A 2AN5A 1AZLA 2WE7A 4RA6B 4QM6A 2BKUA 1U9CA 4I5DA 4TM8A 3I5XA 1KL7A 1M1YE 4OQZA 1YS1X 5LYJF 2XITA 4GDFA 4ML3A 4G0UA 1KS2A 3O4GA 3JQ7A 4PLFA 1SOMA 1F17A 1NMXA 3CMMA 2YL2A 4DSNA 1JTFA 3C70A 1B6GA 1K92A 4AICA 2B1IA 4LJLA 2HSEA 3BH6A 4F5DA 5FOTA 3QVMA 2WD9A 2GASA 5AH0A 2G80A 4RE6A 5DYYA 4PSDA 2FR0A 3JD0A 2W2MA 2QTGA 1Z07A 3K1ZA 1USWA 3GCZA 5JCZA 1ZK1A 4JJ6A 3VU8A 4CF5A 2OXIA 1JEAA 4RUKA 5BRJA 2YBDA 2R4UA 3GUHA 4P7BA 2DLNA 1DHTA 2HPZA 3O2QB 3IMGA 1T6BY 3BILA 5CLLA 5JSYA 4XWKA 4YR7A 4R4JA 5F7XA 3F3YA 4AVYA 1YQWA 3ZDXB 5JT1A 3FD8A 2BSQA 1G3MA 2O0MA 3FWHA 5K8UA 1XU7A 5K8TA 1GNSA 2LGJA 2WHQA 4DG9A 5GTDA 4IG4A 4UHHA 3S7ZA 1G8AA 1XA4A 1C8KA 1VQ1A 4HMPA 3RI3A 4HDRB 3QVGA 4IGIA 1ZIOA 3QFFA 2P9TA 3WYGA 3NBFA 3KKLA 3GQVA 3HXQA 2NYUA 3TFWA 5FUMA 2G9UA 4B3GA 1DJMA 4YUVA 4RJIA 3OOYA 5E7JA 1NYTA 4ABTA 3CY6A 2HV9A 2PJDA 4FX2A 4MQMA 5G3ZA 3VDXA 2FOLA 4EMBA 3QHPA 5TR9A 2XD9A 4MICA 5G4LA 4ENTA 4PFSA 1U63A 5HNKA 1VPVA 4PO3X 1I0LA 5KNBH 3BGWA 2O07A 2TMYA 1RPAA 3MOSA 4WERA 2YUTA 5FPPA 2YHBA 4PZCA 4WVLA 3WL4A 1Q5PA 2BMVA 4B4DA 4CMEC 2G40A 3UWOA 2J6IA 3UGJA 3T7AA 2DEUA 3RS3A 3SLKA 3HU5A 1T24A 1U8FO 3R40A 4UUQA 3WQQA 2VQFB 1ZIPA 1U0OC 2BAGA 2OFXA 5EPEA 3HYNA 4JR0A 4BWGA 3GLGE 5LIRA 3R74A 4PZ0A 3ZTTA 3K09C 1KIFA 3HPQA 5ALNA 2BTOA 2W7TA 4RF4A 3KAQA 4URUR 4UVEA 1SBIA 3KAKA 5K2MA 3B9RA 3L82B 4E5PA 3NGXA 3PC8C 4PZEA 4UW9A 3PKJA 1GL9B 1PCXA 1E3QA 3G0HA 3OZEA 4DV4B 1XRPA 3NV9A 4YQFA 3QWAA 5DI3A 1CQIB 3EDYA 3ZWVA 3NPAA 3SOPA 2JHCA 1HZZC 3CMCO 1QVWA 4B79A 1ZOSA 1C8LA 1N3BA 3GLQA 1N78A 1FZQA 4ENUA 1YULA 1QFMA 1LF5A 4CCWA 2RONA 3EXHC 2X7HA 4ZREA 4EW1A 4F45A 5ITVA 2O8EA 4TZKA 2C4TA 1V5GA 2QUKA 4DYVA 3VHRA 4LNUB 4NPCA 1U2GA 5BMVA 3K0AB 1IIBA 2BPOA 4K9PA 1UDCA 3PD1A 1VL1A 3AETB 3ZHSA 1A1SA 3L6CA 4KI0A 3RUPA 5IHXA 1XNRB 3CW2A 5E0OA 5J2TA 1WJGA 3CUKA 3QJ5A 3RVRA 3VGJA 2C98A 3ESXA 4ARIA 3AEKA 5I8ZA 2HA2A 2QTCA 4M99A 1F06A 2I2FA 4Y1RA 2QLJA 4NMWA 2G9VA 1K97A 3ZDAA 3I42A 5ESWA 4QM7A 4RF5A 1FS6A 2EW8A 3E8SA 2WSLA 3CNBA 4U7JA 4CG2A 3RO7A 4E30A 1WRBA 4EHKA 1EXVA 5KU1A 3NHJA 4RDXA 3WAKA 1SVMA 2IXBA 4AK9A 1K4YA 5IXSA 2FI1A 1TOAA 1PHRA 2N1MA 5HRCA 5AVJA 4KIUA 3UFXB 2BEVB 3QSYA 2B20A 3JWIA 1KDRA 1QTIA 4OY3A 3QW2A 3PGVA 3HNRA 1Z18A 4X66B 2JG3A 5KQRA 2XHEA 2PGOA 4KZPA 1P31A 3IT0A 4YV2A 2VZLA 4L5AA 2FUCA 2Q3CA 3DKPA 3DTTA 3ZD6A 1NAHA 1ZUD1 4NONA 1M6NA 2PUWA 1OAAA 1VA5A 4F4HA 3LHDA 2YV3A 3AL2A 4NBRA 4CG0A 5B1EA 3GJZA 1NX6A 4EX6A 2H1IA 5LKAA 4MLDA 2PAFA 2JVJA 2RGXA 1C1DB 1ADBA 3HB9A 1S2OA 2YWBA 1KYIA 1ABEA 1ZNZA 4O4LA 3OX3A 4LE1A 1KYQA 3SMVA 1JAHA 2WY2D 1A5SB 1IATA 2XNSA 1QE5A 1XAIA 3CG0A 4OSOA 4PBTA 4Q1FA 4R1PA 3V6MA 2BFFB 5KYGA 5KYWB 4Q4HB 3UJ7A 2JNWA 2C8VA 3N7TA 1STOA 3TXYA 3ELDA 4HH4A 4C6SA 1HFKA 1NF9A 2HHJA 1E2DA 5GZ6A 1FFYA 3IEMA 1YVRA 1O4WA 3DGFC 4HDAA 3JARA 5ALXA 1AQUA 1H6AA 3GLVA 1SU7A 3WJ1A 4BQEA 4ZCIA 2PUJA 4RGBA 2GWHA 3JQ8A 1XNGA 3LDFA 4D56A 1U0HC 5GZ1A 4F3CA 1MA0A 2OBMA 1TDJA 1OZHA 2VRNA 2IYVA 1W8IA 1GIAA 1NVVQ 2P3QA 1AO3A 2Q21A 2ZIFA 3PNKA 3PUWA 2NQTA 4XI9A 2IEZA 4AKGA 5AKYA 1FDIA 4PC1A 3AKCA 4A2CA 1W0KD 5EUQB 3I58A 5EFOA 1AC5A 1Y6RA 3BK7A 2IPAB 1SHKA 1ZWLA 4LEIA 4FLFA 1TU4A 3STVA 2XYVA 3T4PA 3DXFA 1X13A 3CKMA 3HCPA 2BDTA 4PAMA 1V3TA 3UHJA 2CXUA 2GHQA 2GLTA 2VK8A 4HNSA 4MGEA 4R6XA 4IDDA 1YOBA 3P9CA 4J1TA 3M6UA 2JEOA 2ONCA 1U04A 1NWCA 3RTEA 5FPKA 4UZEA 4C0WA 2SICE 3ROPA 1Y5MA 1T2AA 3G2QA 5J4LA 1NR7A 3IVMA 3UAYA 1GGNA 2CFCA 3LCMA 2QTRA 4RHCA 3ZWQA 2JFBA 2XSZA 5E95A 3H75A 1RPTA 3L5KA 4BKUA 1L4GA 1JQ5A 3K9LA 3DDWA 3PVSA 4R8RA 5LQUA 1BHSA 3W6NA 4CF6A 4BLSA 1BXGB 2SECE 2OT3B 1XTTA 1LC0A 2XMCA 3D5QA 4OI0A 1JIKA 1XYGA 4DMGA 3IHLA 2LIVA 3JZAA 1JL3A 1IY1A 1CY8A 3U5ZB 1AQ6A 3G0GA 4O8CA 3UAVA 1OFUX 3IUSA 1U9IA 1EFVA 3Q9UA 2BGNA 2RHOA 5ILGA 2J87A 5L3QA 5CVJA 2JIMA 3AFIA 5C51B 2QX7A 2QJOA 3RRNA 4TT3A 1VE9A 4ZI2A 2IP2A 4A1FA 4FDAA 4PGFA 5ICGA 4PLHA 1FRNA 1ZU4A 4HT3B 1S9DA 1P4HA 1Y80A 1RQNA 1D1QA 1EEXB 1E3SA 2X19A 2Z9CA 3RDPA 4N3AA 3HDGA 3K2IA 4RAQA 2HT1A 3DGEC 4PIVA 3OBBA 1QYRA 1DDGA 3HKCA 4M1ZA 4CI9A 2GN9A 2A88A 1E3WB 1ENPA 1UJNA 1TKRA 5JDCC 1T8UA 3AJ8A 4HFJA 3HPRA 3QFTA 4QGGA 5IW8A 3R76A 1HEIA 2O0JA 3ESBA 2PZGA 4OFXA 4XB6B 4XEUA 1KEZA 1WUTA 1J56A 2GNAA 3DM9B 3OVMA 1NXPA 1RJ9B 3QVLA 3QU7A 2R6GA 4KR7A 3BL8A 4ZDIA 3VSCA 4BNYA 4TSRA 5T4FA 4NC9A 1KAMA 5AVUA 4ALIA 3ADPA 3I6BA 2DFDA 4WZBB 1QIJA 2XT0A 3BJEA 4JKYA 1F4LA 4RQUA 3ZIUA 4HNUA 5T7BA 2MINA 1YFZA 2G6TA 3KTFA 3QMMA 4GKKB 2ADFA 4I46A 2NZJA 3DAPA 1ONOA 1SFRA 3SE0A 4L4RA 1UFKA 1LPPA 3BREA 3BDAA 3VDRA 4BP3A 1NJSA 4EEKA 3SYRA 2P9BA 1S8OA 2Q4OA 2WDZA 4G1MB 3TOCA 5K8VA 4MW9A 2QI9C 3FM9A 2D0IA 1VE6A 2NW6A 4NARA 3CLKA 4Q5IA 1EVQA 3EGXB 1N1GA 1I9CA 3L7CA 1IN5A 4UD6A 4ZVMA 3HN2A 4ATNA 3IA2A 3NKFA 3VMMA 4TL7A 4NU8X 1RWMA 2RI0A 3MTBA 1V4VA 1ESDA 3RJTA 1NSTA 1I6LA 4HBGA 4PS0A 2CMHA 4GE3A 3P9RA 3X1KA 2BKEA 3RVMA 1NBAA 1P6UA 4RLHA 3OKAA 2NU9A 4KWIA 3T0FA 3QLEA 1YVPA 1CD5A 3LZCA 3WKEA 1QGDA 2DZDA 1U9YA 4WK2B 4RHYA 3RSCA 2JGFA 4BJ6A 1VC2A 3PQDA 4Z7JA 1AGRA 3GLIB 1XDSA 1ANKA 3D8TA 1DZIA 3M83A 3C1OA 5HBGA 2CBXA 1N6OA 1V35A 1ORWA 3J80A 4ZD6A 1L7PA 3W2IA 4B0OA 1M34B 1MQAA 3DHWC 2AE1A 1HE8B 5EIXA 1EHIA 1Z9BA 2VDNB 2X3FA 3M4XA 1Q15A 4DPMA 2C2YA 4MRRA 3PTAA 4TXLA 5LSAA 1UM8A 2R8ZA 4B0PA 1Z4JA 3WXMA 1BQ4A 1U2DC 1PK9A 3NV7A 2GLUA 4Y6SA 1RWOA 4CQMD 1NJ6A 4M8KA 4CLXA 5KSZA 1KWKA 1ZK3A 2FQYA 1NVGA 2NMVA 2BY4A 2V6JA 4U4AA 2PD3A 2CDBA 3IP7A 3G0BA 4R3WA 3GJ5A 4ETWA 5EINA 5HR5A 1CUYA 2EJWA 3U09A 5AUOB 2MYNA 4GU5A 1JIJA 2CD7A 3IQIX 2X6RA 3DZGA 1P7ZA 1E3JA 4J75A 4EUKA 5BN1A 4OHVA 3KVRA 1FFDA 4TQUS 621PA 3P96A 4ZOLF 5DI9A 2WMOB 1FMCA 2QRMA 3VPCA 3V4PB 4HO1X 3S2ZA 2C5LA 4QPZA 2NVUB 3BAZA 5JV5A 1RKBA 3V8VA 1KXJA 3ZYZA 1YHNA 4E7PA 1G63A 2I03A 3UG6A 1VE1A 5JRZA 3G9ZA 1Q83A 2QRHA 3N8KA 4GVPA 2B9VA 3I9V6 2C9BA 4M9UA 1WSWA 1NXQA 1DRKA 1RW4A 2WA1A 4G1BA 4IH9A 5DHFA 5C7OO 3MT7A 3OFKA 2JJ2A 3CKYA 1V1RB 2YIDA 3EC1A 2B0CA 2A0WA 1GGFA 2FW8A 1KAEA 1W1WA 3JVVA 4DMKA 3NIDB 5TQ2A 3ZQ6A 3FLEA 4W4TA 1RRFA 4FEYA 3H1PA 3TTXA 3K73O 2WV9A 1XWFA 1I80A 4W9NA 1F0PA 1JHMA 2QPOA 3MF4A 3GGCA 4FR2A 4OG2A 4DLRA 1YR7A 3B3AA 3LYUA 2ZJBA 4LZNA 2WUVA 4ERXA 4GMKA 5HZKA 3C4JA 5DMHA 3GY0A 2ZJ3A 2G3YA 2IUSA 1C7EA 4AMZA 1VLJA 1VSTA 3OHSX 4FP9A 1NNUA 4YCCA 2PWBA 3PCTA 1ISGA 2WTEA 4OAOA 4ZJYA 4EL0A 2QD5A 4Q18A 3B20A 4BFLA 3S8EA 3CKLA 3I12A 4BMXA 1TQ6A 2FNAA 2X5OA 1OFVA 4DVGA 1UMKA 3NFRA 1E1YA 3K8YA 2NU6B 1J0EA 1ZM2A 5ALIA 1DAIA 4FS8A 3E3AA 3J7TA 1ORDA 2ADOA 2JBAB 2OBLA 2ZRDA 4L2IB 2P4SA 2YY5A 5MN6A 3DVAA 3ITDA 3TW8A 2I9PA 1TA0A 3VBEA 3H5IA 1X7ZA 2JI7A 4FBGA 3FIUA 1ISFA 3K1YA 5KYXA 3VR2D 3E9RA 5AKIA 3R9IA 1A69A 3HFRA 1V8FA 5EIBC 3GRFA 2FG5A 2PQ2A 1V5FA 3DQPA 3H4IA 4LXHA 5CTAA 1X9HA 4GMXA 1Q7RA 4GXNA 4WUVA 3HCFA 5JD3A 2QP4A 4KQ9A 3FJOA 3U7EB 4I55A 2FQ1A 2VYND 3KZMA 2ATCA 2ZPAA 4ETIA 4F93B 4ZIRB 1E5XA 3TJZA 1SPBS 3DBIA 5IJ0B 4H6VA 4N82A 1JS1X 2PCLA 3K6KA 1IZZA 4PVCA 4F3RA 1MT3A 1Z88A 3M2TA 5I9BA 1NXSA 3FPSA 5C8YB 2W0MA 4PGAA 5IU6A 2C8JA 1AKYA 3NP9A 3LBYA 1Y8RB 2I34A 3B1VA 1ILEA 1CF2O 5KQPA 4YJ3F 3QZUA 1U81A 5LB4A 1MQ8B 4BC1A 2JFNA 1PGJA 1QCYA 1C1HA 2G36A 2HC9A 5FBQB 3NCHA 1ZR2A 2XW6A 1Q3HA 1C1YA 4DNPA 2V7EA 4RKYA 3WMFA 4H7PA 5HQJA 4RYLA 4XDYA 2UYCA 3Q41A 1NDQA 2PH1A 4IJUA 1U0LA 5ES4B 1P77A 5DW3A 2JIZA 4JJ4A 1AZTA 1OYOA 4R1SA 3H99A 3GZJA 4QHTA 3EYAA 3OFVA 3JZIA 2AYYA 1I0ZA 5ALHA 1YQXA 2ECOA 3KBOA 4ZO6A 1EFLA 4B7XA 2AOXA 1C7ZA 1OXXK 4D96A 4DMRA 3FDFA 3SQWA 1BKYA 1L1EA 1E1KA 3EB9A 3M7IA 3K4QA 4U9IS 2N47A 3KPJA 1EAMA 2AQKA 3FKQA 4HWSA 1KQGA 4X65B 2ZJYA 5GVRA 2OQ2A 4L5JA 4KYUA 3WYEA 3LGAA 4A2WA 4XIGS 4QJ3A 4LCEA 4C20A 1OWNA 2F6RA 4O4IF 4N03A 4XGRA 2QRZA 4GPAA 4D0NA 3QVXA 2FJUA 3O84A 2H31A 2WFLB 1UMBA 2FZEA 1HKHA 3HE3A 5FJJA 1YZLA 3A1DA 4HDOB 4QIHA 2J46A 4WXPA 4K6FA 4EUNA 1YE5A 4M9ZA 1JTEA 1B0UA 4B8WA 4QT4A 1PJ2A 4XD7D 1B8VA 5E9JA 3VYSB 1ZUWA 4KVZA 3RRFA 2AJCA 3V1LA 4Q3CA 4H77A 1ZI8A 1W5TA 4ZZ3A 2H65A 3U7RA 1ZHFA 2JKZA 3TFOA 3NBZC 4Y7CA 1ZNXA 1NR1A 3BCRA 1YF3A 5KNBD 1WW3A 4YCNA 4G0XA 3ER8A 2O0HA 3I76A 3ROMA 3I28A 2AHRA 4ZI5A 3CH7A 3SFZA 3TLXA 3JCZA 2P6RA 3LKZA 4BLRA 4OHFA 2W71A 5FNVB 3ROQA 1IJEA 4A16A 5LQKA 1UANA 3N0RA 2R9VA 3ZE7A 5JFOA 4DUYB 4QAQA 1OH7A 1JU3A 2PIAA 3AFOA 5K0TA 5B3KA 1HLGA 4FHFA 1RKQA 2FWMX 3JQAB 3NTUA 4KQ1A 3G7UA 4JLPA 1E2BA 4Z0TA 1CRPA 1F20A 1U0GA 1KRWA 4CODB 2IPNA 4GL4A 5CDFE 1FS5A 5JPCA 5BW4A 3DFMA 4I36A 4M0CA 2D5CA 3ZW7A 4YV0A 3K9GA 2QI9F 3QOWA 2QMYA 3D3EA 4FYKA 4JLJA 1GAEO 1UBGA 3NUZA 3MXTA 4ZVOA 3WLHA 1XU9A 1L4UA 2DX7A 1VBKA 3I92A 3NYWA 4GM1A 1XZ8A 3C4VA 4LXTA 4ND5A 4Y6RA 5KOJA 1DXYA 3ZY4A 4YREA 2NAFA 4H35A 3WQBA 3VH4A 2OG1A 2EERA 3HRKA 2UZ3A 1A8PA 4JZYA 2Q3JA 2ZTMA 1DT5A 1E5DA 2B83A 5I9IA 2J3QA 4AMYA 2J08A 2EBWA 1DKPA 4ALKA 4DIMA 1CY2A 3ZV6A 1I8TA 3R6WA 3CWQA 3LXRA 3FPBA 2YJTD 1PFQA 3JRXA 3N2GB 4JLUA 1OAKA 4JUBA 2C20A 3C7CB 3FOWA 2ZSKA 3ZBQA 4DABA 2Q1WA 4YAKA 2O0KA 5IX8A 1ONNA 2R8XA 1OXVA 3KJGA 5FQOA 4EM6A 2WRZA 5LXTA 2Q5FA 4G0YA 1HDYA 1RC1A 3VC2A 1JIXA 3PFFA 3B5EA 2Y1DA 1Z5NA 3K35A 4S05A 3NEAA 2YNMC 2WSIA 1ACLA 4MI3A 1E8DA 1VYTA 2QL6A 3IKVA 4PZPA 4W63A 2PMKA 3O95A 1U5BA 2R7MA 2QY6A 3ESCA 5MGBA 1KQOA 4H7HA 4R2MA 1UBFA 4LWZA 1G6KA 1YCGA 3IVGA 2P27A 1L5NA 3SKVA 2V7WA 4MJXA 1ISIA 1XL0A 4CTJA 5C7IO 1HT3A 2OBBA 2GK6A 1CS0B 1FCJA 2CWDA 2EF1A 1JJIA 2P5YA 4P0PB 1RPNA 1QG2A 4W5WA 1PK7A 4J0QA 4XXHA 5E6UB 2VXCA 2Z57A 2PX6A 4UHDA 5IVIA 4YUWA 2I78A 3DS8A 3OT1B 3KJIA 5AOAA 2FUNB 2HPHA 1RXYA 3BSWA 3WOHA 5F7JA 1CFZA 1VTKA 4KXNA 3OE7A 4EYQA 1LQUA 1I2ZA 4QTYA 3NHZA 4TM7A 1IEWA 2AR9A 3N9IA 4QU5A 4Z9BA 1QG6A 2JD1A 3RFVA 3EQZA 5IAJA 4PHHA 2JASA 4BN0A 4M38A 1LK5A 1HTBA 1V7CA 2R44A 1BQEA 1CY6A 2VTVA 2GO7A 1IHPA 1KTVA 2PKRA 4KLAA 2OMKA 1KO1A 4JENA 1Z68A 4EQ6A 5BYJA 1SXPA 4XTCS 4BB9A 2Y6VA 2QTMA 2FTKE 4YRSA 2EKZA 2HUNA 3TD2A 1K88A 1WY5A 1G9SA 3HCDA 1WMBA 3O9VA 4EYGA 5AVTA 3TJMA 2NP6A 1ULHA 1X7XB 4KJXA 5E2BA 3QX3A 4LTDA 3EYWA 5I5GA 2XZTA 5EERA 1X86B 4JI2B 2FX2A 4JXZA 1OU4A 1ADGA 2HDWA 4M36A 1CF9A 2WHEA 2O1WA 3D5TA 4AJKA 3BMQB 5FPTA 1XELA 4CE6A 3TRHA 3EUEA 3OJFA 2AEFA 2H57A 2PZMA 3TVDA 4NAHA 4KO3S 3VTKA 4B4UA 4WDRA 1I6KA 1ZCBA 3FOEC 3W77A 3DLTA 2DHEA 4P5DA 1E5QA 4UMVA 5CLGA 1P75A 2RH8A 3JQBC 3O2JA 4CFZA 5KVCA 1UMCB 5DYTA 2JFUA 2JAOA 2XCLA 4Y2PA 4EATA 2X8JA 3DHVA 2C59A 5KTSA 2NV0A 3DXZA 4MP8A 1QIGA 4I50F 4B09A 4EAAA 1E4YA 4HMOA 4D46A 1KMCA 2WPDA 5CFRA 5DRTA 3DAYA 1SA0B 4E1BA 4B7AA 5DNUA 1LBQA 1N2EA 4AC9A 1ADFA 1UKCA 2AFIE 4JODA 4QYIB 3CZPA 2YASA 4TSFA 3FPFA 1KKUA 4JJEA 4B83A 4BNXA 3FUVA 3JAWB 3C7DB 1D2CA 4BMYA 3GJ4A 4QXRA 1T9HA 1ZK2A 5FQNA 3DJYA 4KWHA 1M2OA 1ZY2A 3K9FC 3IKMB 1EGAA 3F49S 1XRQA 3ROEA 2OBXA 3IEVA 5CX4A 3C3AA 1XTKA 1Z0AA 3ZJUA 3NZEA 3SPXA 2LR0A 5E9AA 5KC9A 4DB4A 3IUPA 4QOEA 5TJ9A 1ZJWA 4LJRA 5F76A 4D3DA 3DE7X 2JIPA 4KO8A 5H70A 1E2UA 4XB2A 5DBOA 1PZGA 1L5GB 3ZXYA 5J4VA 1UP7A 2PQMA 1B4DA 4IWNA 2BLLA 4YROA 5TNXA 5AVSA 1DXOA 1LRJA 1H22A 1IDOA 4O2BF 2JGMA 3L2OB 3NIGB 1OE0A 2IOQA 1HLPA 1PYDA 1R0RE 3O8OB 3HVJA 4IYRA 4CU2A 5ICCA 1RBYA 1GUBA 2OK7A 5HBRA 3TSWA 2P2CA 2H29A 1NUSA 2A3NA 3T94A 2WBLC 5AOCA 2IU4A 4FCTA 5DLQC 4QL3A 5T4HA 4QUAA 2LDBA 1L7XA 1DTWA 1RLOA 4WK0B 5MGNA 2V0GA 2VT6A 4HF7A 3UHAA 1D07A 1G8SA 4LMBA 5AW3A 1DC7A 1ESNA 1RVDA 2JAQA 5BSFA 1P0PA 1LI4A 3VVLA 1NI4B 4MR7A 2YHAA 1ODSA 2YV1A 3DF7A 3CF4A 3BJMA 5FTKA 4ZYVA 4QQ8A 3REOA 2V0CA 2X8BA 3DO8A 3AXSA 4R1MA 4ARCA 1NJFA 2W6QA 3NNNA 3X1JA 5F64A 2ZT7A 5KIAA 1XVUA 2AMFA 4L5CA 4LQ4A 3S2IA 4LHVA 1ETHA 4GX1A 1H69A 3A6EA 2QZ9A 3LOQA 2HT6A 3ABZA 1P4RA 4AS3A 2Q6OA 2WU8A 3PJFA 4RY2A 4RGQA 3V7YA 2ZSEA 4JIGA 5K5EA 4Q82A 2HIMA 2ZSDA 1E7YA 2H92A 4F7DA 4FIDA 4TWBA 4AUEA 2UXCB 2JH9A 3BXZA 4P4GA 1G20E 4GOJA 4WJKB 1JR4A 2XWJI 3EXHB 4MA5A 2QYTA 5IVHA 1XBTA 2N1BA 1N3YA 1GA4A 5AHKA 3B85A 4GPZA 1SY7A 1TGVA 4RS4A 1M7GA 1KNXA 2J0UA 1DQPA 5JJLA 2OXRA 6LDHA 2C0QA 5EKUA 4AP5A 3L07A 1N6PA 3PL1A 1UWCA 2VYNA 3TGLA 1K0FA 1RNLA 4JUAA 1YZYA 4KC0A 3ZHXA 4OH1A 4BHTA 2IF0A 3F7OA 3CZAA 2B5OA 2AKYA 4MGKR 1FDRA 1GTJ1 2QL9A 4ZOLB 1GFIA 3PWTA 1LI5A 3MQ2A 4YXWA 3ICWA 2XYPA 4PSKA 2AQIA 5T4BA 2G88A 1O95D 2FP4A 2P67A 3UIEA 3T5PA 1QSGA 2WIKA 2R6AA 3DUFA 4Q1EA 3LBHA 1KJIA 4MI6A 5DEIA 5FB3A 3THWB 2Y93A 1LPBB 2Z1NA 3H4VA 4FXPA 1AUOA 5FUBA 3SEQA 2GN8A 4EEZA 3IRVA 2AD5A 1KP2A 4KWTA 1PGNA 1Z5GA 1XRLA 4OHWA 1NVVR 3OJWA 2NAPA 4DUPA 4BQNA 4U9UA 4GUDA 3AF3A 2VBGA 1FLAA 5EOVA 4ZVQA 1Z36A 4DSUA 3AJAA 5F9FA 4UVDA 4WV3A 4R1TA 2G70A 2Q1TA 3B6IA 1RZ3A 4O29A 3Q15C 4GKBA 3RRYA 2JDIA 5IH7A 2IHKA 6PFKA 1OX4B 4QBHA 4CKCB 4PV7A 3U9LA 4B34A 1A4IA 4B85A 1XLWA 2WTBA 1VXRA 5FOQA 1WG8A 2A1UA 3QUCA 5DNAA 3EFOA 4B35A 5E3JA 3HEBA 3QLTA 2AI3A 5TGZA 2J9ZB 3O8DA 4AP6A 4QRHA 3V7FA 2SCUB 1W9MA 2XUKA 1ZVQA 3H83A 4N6GA 4WBNA 1LNQA 5B55A 2X7XA 4P34A 1Y6ZA 3O4HA 1JX6A 4X5OA 2LWIA 1NVAA 3LRTA 4B6QA 4RTPA 4ZVNA 1CUJA 4NYMQ 3UCXA 4ZCSA 5DSZA 3SK0A 2CNOA 3EVEA 2IY8A 3NC4A 4G8JA 2C7PA 2WWRA 2O8FA 2R47A 1WHSA 3L41A 3UH0A 3KR9A 5E7IA 2O1XA 1YBFA 3V34A 1XKQA 3IV6A 1YQ9A 3B3QA 3BMOB 1WDTA 2C9CA 4D0RA 4PLTA 1U4OA 3RRZA 3KYCB 4UD2A 3H7AA 2H4JA 4I9NA 2P65A 3LKBA 2EW2A 2GRJA 3GA0A 3M1IA 5ALJA 5I9MA 3O8CA 2IC5A 1SKMA 1DC4A 1F8GA 1EFUA 4KBYA 1UFOA 1Q7EA 5KNBA 2BONA 3JQAD 3OZUA 3BFKA 5E9WA 4RZHA 5LJLA 1KFBB 3VKHA 4E09A 2HEGA 4Q24A 2HWKA 3N8IA 2IPOA 2PQ6A 4F2PA 4HX5A 2O2YA 4Z7QB 5KQGA 4P0TA 1Y5IA 4MUBA 3DZIA 3QLUC 2HAEA 2WF9A 1LX6A 2WVHA 3PQFA 4YJ3B 2AMVA 2MSDB 2HSZA 2RGBA 2Z5FA 2OM6A 4U00A 4QTUB 2HA5A 1N4DA 1DLJA 1Y9DA 1WDKA 3D3WA 2CXXA 4B5LA 1XZMA 3B70A 3QP9A 5CMLA 3WRYC 2D06A 3I5AA 4G0QA 4MQ6A 3E1SA 1CCWA 3TRKA 5EPUA 1E3MA 3TG2A 4MB0A 4FYJA 2BMFA 4L4XA 2PXCA 1K8QA 1U7OA 1VPTA 1EGHA 2ZBRA 2Z3WA 3KTDA 3LECA 2J7KA 1KVUA 3FDXA 3LT2A 2R85A 2RH5A 3NHLA 4NMHA 1II8A 3T1NA 3JU3A 5C35A 1EFAA 4XIFA 3A3PA 3ZOZA 1FFAA 3RYCB 4M53A 3KZCA 4D97A 1F7UA 1R1DA 4M49A 5CLHA 4DJTA 4JQYA 5DM4A 3HG7A 1AB5A 2D8AA 3Q12A 1TEHA 3TNLA 3K8QA 3DEFA 4PLGA 1YU6A 5JCOC 2GAFA 1IPHA 2EWWA 4RA9A 4X84A 4MDHA 5BR7A 5KJ6A 5DM2A 4KLNA 2Q5EA 3MCAA 3LLCA 5D1NA 3L43A 1E0AA 4H4CA 2YJNA 1X39A 2HD4A 1IY9A 1HL7A 3A1WA 3LW8A 1ORTA 3ZZ1A 2VOEA 1WTAA 1QKIA 1JFFA 1NPTO 3EF1A 4A15A 2FR8A 1NYRA 4Q3AA 3IBGA 3QKWA 4C2UA 1OMOA 2FPOA 3KKZA 5EYPA 1WNTA 2FV8A 4KXYA 5BSUA 3KEGA 3AHIA 3LX6A 5ALFA 5FPHA 1C8BA 2F1KA 5TQVA 1BGVA 4Q39A 1FPQA 1QWSA 1XA0A 5JW6A 1IN1A 1WBDA 1D04A 3BXHA 3Q8WA 1MNQA 4K8RB 4R7TA 4RK5A 3RYIB 4JL5A 1R6DA 3QPWA 2ZFUA 4O25A 4W5OA 3Q1LA 1QIEA 1Y8QA 2FWAA 1FK8A 1US8B 3EZ6A 3BWCA 1WCXA 4IDHA 1EGMB 1MZVA 1RDFA 2PGNA 5E2IA 3BFJA 1F8YA 4PFQA 4PEVA 5J5CA 4XZ3A 1AT1A 1U28A 3DMTA 2XNCA 3WA7A 3U9SA 1B76A 3MJTA 3MPUA 4D0GA 3CX3A 2HSWA 5HM6A 4DV6B 1NR5A 3ELBA 2B99A 4IL5A 4GZ5A 4YMHA 2PKQO 3D4NA 4UDXX 2R2AA 2QGFA 3G8YA 2NX2A 3PIRA 2XGJA 4OLAA 2M1XA 2N42A 4EG3A 5HKKA 4MI9A 4YCMA 1TD9A 3I8XA 2WNSA 3W8EA 4ESOA 3KD3A 3G9QA 2ZJ4A 3QE4A 4QVIA 1NVWQ 2CXRA 2LCQA 4AJJA 4EG1A 4B76A 1Y7PA 5BNFA 3K2QA 4EFMA 1K68A 4K86A 1J0DA 1ZYUA 3AR3A 3P9XA 1ZBDA 5KTOA 4RESA 4IIVA 2WZBA 1YASA 3C0KA 3FNGA 1SQ0A 3PXAA 1ZGHA 5DBFA 3P2EA 1O9HA 5CK5A 4KSYA 1RHQA 2O5RA 3QEJA 3W2FA 3CHYA 1QKJA 3HSSA 2VNSA 4ADSG 3UJAA 1ONSA 2P4UA 5G0SA 2VQDA 5IKEA 3M6VA 4BMPB 1M2WA 3L0CA 4M8LA 4DYHA 5KOIA 1RC8A 1JLLB 1JDZA 3HUDA 2XUOA 4RMIA 3SZ3A 3SQLA 3T7TA 2RCNA 3AY0A 5A4IS 2G5GX 2O1EA 4N5HX 3ZV7A 3TW0A 2QQ5A 3ZJVA 1AKEA 4RX1A 3WGOA 1ZESA 4DLSA 3IE1A 4JXJA 5JALA 5AM5A 1IVSA 3GYGA 4OYYA 3LPMA 5K6TA 2BR4A 2J9XB 3DWGA 5C9ZA 3GB9A 2ERXA 3EX7C 4G97A 2ZW9A 5CFLA 4G4IA 2VDVE 2RGUA 3KXLA 1R0SA 3DFUA 3PFIA 3HKEB 2JGNA 3BZBA 5ALDA 5I9SA 3TLJA 4WT7A 1FQKA 3MHTA 1HDZA 3IAHA 4MVJM 4A1OA 5EJ4A 5KVSA 1F7VA 2FZWA 4FI3C 1CPYA 1OGJA 3ESZA 1GOTA 1DQZA 2XE4A 4HLNA 2XNDA 5L3RA 1VJ5A 3H8WA 1YI0A 3G0CA 1ECCA 4GWLA 1CLUA 1NBME 1Q0QA 4G1FA 5ECYA 4G0OA 3ES9A 2HQRA 1N4AA 5GINE 3P26A 1I3MA 5HX7A 3FOCA 2GPTA 2X14A 3PHGA 2J5XA 1X0VA 3KJHA 4PICA 3ZDQA 1ZHOA 4HRAA 3S40A 1ZNQO 5MFPA 2HQ1A 3CX4A 3T3MB 4Q1DA 3U13A 3SDZA 3V97