4HPAA

Crystal structure of nitrophorin 4 from rhodnius prolixus complexed with sulfide ion at ph 7.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Complexes of ferriheme nitrophorin 4 with low-molecular weight thiol(ate)s occurring in blood plasma
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 51
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4hpaA00
2AT3X 3BX7A 4UU3A 1LPJA 1HN2A 3FMZA 3O2YA 5HZQA 1B4MA 2Q9SA 1KGLA 1FDQA 4I3CA 2MO5A 1BSOA 4AW8A 4HFOA 3CBCA 2POAA 4NLIA 3NP1A 1KT3A 5LKFA 3WJFA 5F1EA 3U03A 3CQRA 1D3SA 3NR3A 2OVDA 5EEEA 3T1DA 1EPAA 5FAZA 4IAXA 1YWCA 5HCEC 5F6ZA 4YGHA 3NQ9A 2P8GA 5KIDA 1BWYA 3FEKA 1ALBA 2R74A 3EBWA 2NNQA 1MX8A 4OMXA 3P6HA 5IO6A 3VG2A 4YKMA 1EIOA 1U17A 4TJZA 3KFHA 4KIIA 2Q2PA 1E02A 1QY0A 3RSWA 3K3LA 1BRQA 3STKA 5D48A 3C78X 2RCTA 4TKJA 1BSQA 2A13A 1LIDA 1MUPA 1TOUA 4QYNA 1CBIA 3WJDA 4TQ2A 4ZGUA 1P6PA 3WXQA 1EIIA 3OJYC 1EPBA 1I04A 3C77X 1IIUA 1KT4A 1KT7A 3EM0A 3WJCA 1SY0A 2WUTA 1IFBA 4YKOA 5HA0A 4YH0A 1E06A 5BVQA 3TF6A 1TXLA 1KXOA 2CZTA 4LKTA 4ZHGA 1OEKA 3U9PC 5H9AA 5LJGA 5HZ9A 3AKNA 1KZWA 2WSJA 2NNDA 1LIEA 1KZXA 4EDEA 2K23A 3BSZE 1B0OA 3HK1A 3Q6LA 4I3BA 1GT5A 1KOIA 2LBVA 4IMNA 3KZAA 1QY2A 1BLRA 4RUNA 1FTPA 2AT8X 2YG2A 3JS1A 5EZ2A 1OEEA 4GE1A 3P6CA 4Y0RA 1IKJA 3WJGA 1O1UA 1BBPA 3MVFA 3VG7A 2HYSA 3KFGA 4O9SA 3EBKA 1UZ2X 2HZRA 1SXXA 1GM6A 2AT0X 3FR5A 4K19A 5BVTA 1ZRYA 1CBSA 3P6DA 1GT4A 4MVIA 5D45A 1ML7A 3IFBA 2DM5A 4PSQA 2FLJA 3F9DA 1ACDA 4GNWA 1G85A 5IO5A 4HPCA 4YBPA 1BM5A 3NX1A 1OPAA 4WFUA 1OBUA 2QO6A 3FR2A 3JSQA 4NNTA 4DQ3A 3KFFA 4M7MA 1PM1X 1IFCA 3UEXA 4AZNA 5H9NA 3SAOA 2JU7A 4XMHA 2AH7X 2L68A 3CBSA 4EFGA 1KQXA 1T8VA 4ZHHA 3P6FA 1EXSA 4AZQA 5HCDC 3PECA 2JN3A 3TZSA 4A1YA 3HWGA 5EDBA 1DF3A 4UU2A 2ACPX 4ORSA 4YBUA 4HPAA 4QYPA 1SY2A 2Q2MA 5LJBA 1AQBA 3BDRA 1PMPA 2FS6A 3KFIA 3EMMA 1DFVA 1BSYA 1SY1A 1MX7A 4A8ZA 1I06A 5HTDA 1CBQA 1GXAA 5C0NA 1Z24A 5KICA 1AVGI 1HMRA 4ZCBA 4A1HA 2XKLA 2K62A 1EALA 1ZNDA 3D95A 2G79A 1GGLA 4Y0PA 4YDAA 4I9SA 4IBAA 4WFVA 4YDBA 5D8JA 2WEWA 1L6MA 3BU1A 2JU8A 1ADLA 1R0UA 4QGXA 1S44A 3D96A 2L67A 1ZNKA 5HWZA 1X71A 2HLVA 5HZ8A 1G5WA 4Y0SA 2N93A 4TNNA 1ZNGA 4GETA 1BEBA 3B2IA 4IAWA 4XMEA 1BRPA 1DZMA 3UEUA 4EXZA 1MVGA 4IMOA 1DZKA 4MVKA 5HTEA 4ZHCA 2G78A 5L8NA 3VG4A 1D2UA 3FR4A 1G7NA 1AB0A 1YWBA 1EQDA 1X8UA 1G74A 4YGZA 4NP1A 1QG5A 1VYFA 3FLLA 3KQ0A 4IB9A 4IB8A 1DZPA 1X89A 1U0XA 2RCQA 3QKGA 5LJDA 5EEDA 1GX8A 2CBSA 1DZJA 2E4JA 3ZQ3A 3P6GA 5HZ6A 1ERBA 1X8QA 4ARHA 2R56A 3PPTA 3VG5A 1S7DA 4GRJA 4OS0A 4ORWA 1LKEA 5LJKA 2LKKA 3BU9A 4ALBA 4YMYA 2R73A 5BVSA 4YFRA 1LICA 5FENA 3FA7A 4YFPA 1TW4A 2L5PA 5D4AA 1XCAA 2WR6A 1IKEA 3ELZA 3AKMA 1HBQA 4ORXA 1N0SA 5HA1A 3VG6A 1ICNA 1OEJA 5EDCA 4QAEA 1JYJA 2FWVA 5L8IA 3B2KA 1E5PA 4N7CA 1QFTA 2RD7C 4QGWA 1TVQA 5H9LA 1LNMA 2OFMX 3APWA 2LFOA 1FEMA 1YUPA 3NQ3A 4LZUA 4YCEA 1A18A 1OBPA 3CMPA 5LKEA 2IFBA 1CJ5A 1JYDA 2OFRX 3FA8A 1HQPA 4ORRA 3FEPA 2NNEA 3NADA 3BLGA 3RZYA 1O1VA 4NYRA 3BX8A 2JU3A 1PEEA 2QOSC 2F73A 2WQ9A 2WWPA 1U18A 2WEXA 2KT4B 1UREA 3TGCA 2MM3A 1AELA 3UEWA 1FE3A 1PBOA 1KQWA 2EU7X 2LBAA 5F6BA 3PH5A 2Q39A 2GTFX 2W2BA 2WQAE 4ORUA 1I4UA 1CRBA 5D47A 3HWDA 3DSZA 1GT1A 4M6SA 4TLJA 3WJBA 2X45A 1H91A 4N7DA 2OVEA 2HNXA 5HZ5A 1BJ7A 1IW2A 1HBPA 1RLBE 4AZPA 2GC9A 3EYCA 1JZUA 3GAQA 5F7GA 2RQ0A 2PY1A 2OZQA 3MBTA 4GKCA 4YCHA 4AZMA 5DG4A 2HMBA 1HMTA 2A2GA 4BVMA 5LJCA 3WBGA 4NYQA 3B2LA 3ZUOA 4ZFXA 1X8OA 2QO5A 1NGLA 1ZNLA 1ERXA 2FT9A 3B2HA 1YP6A 2JOZA 1GT3A 2CM4A 4I3DA 2A2UA 1CBRA 4Y0QA 4NNSA 3D97A 1QABE 5DPQA 4A60A 4TKBA 3P6EA 4AZRA 1X8PA 3B2JA 1RBPA 3FW5A 4WBKA 3U0DA 3TGBA 1SA8A 2CM9A 3APXA 5LJEA 4D6AA 3FW4A 1LIFA 2OVAA 5H8TA 2FR3A 1QY1A 1T0VA 2GJ5A 4HPDA 3PP6A 4CK4A 1A3YA 4ZH9A 3FA6A 4XMDA 3O22A 1YWDA 3STMX 1QWDA 3TGAA 2AT5X 2ASNX 1SXYA 3WVMA 3FA9A 3I0AA 5LJHA 5FFHA 3S26A 1B8EA 5AQ6A 3ELXA 4GNYA 4QZUA 1LF7A 4TKHA 2AL0X 4RUUA 1DC9A 5K06A 4NLJA 3HWEA 4BOEA 2RA6A 2QM9A 3STNA 3BRNA 1JJXA 4HPBA 2FRSA 1ICMA 1YIVA 1I05A 1LFOA 2CZUA 4EEJA 4QZTA 1KT6A 4ZR2A 4ZJ0A 2W2FA 4ZH6A 5HAEA 2A3FX 1O8VA 2AKQA 4LZVA 4MVLA 1SXWA 3APUA 1DV9A 4YFQA 3FIQA 2AMMX 1A2DA 4XMFA 2L9CA 4IB7A 4ZHDA 4IB6A 3ZUIA 4OS3A 5L8OA 3IA8A 4LKPA 2ALLX 5KHPA 1E00A 1SY3A 3G7XA 3I17A 4ORYA 3DTQA 4ZHFA 1S2PA 1GX9A 1XKIA 3BY0A 1ZNEA 4GH7A 2LB6A 3WJEA 1OBQA 5HBSA 2ANSA 3F8AA 1JBHA 1EW3A 2X46A 4D6BA 4XMGA 5EPQA 2FR2A 2FS7A 1X8NA 4DQ4A 1ZNHA 2ACOA 5CE4A 1NP1A 1GKAA 1HMSA 5HCCC 4I9RA 2XSTA 1FENA 1OPBA 1QQSA 1B56A 3CR6A 3PEDA 4XMCA 1YWAA 4R0BA 5IO7A 1GKAB 3HWFA 2CBRA 5B27A 4QGVA 1T68X 2HZQA 3O19A 5JR8A 3BS2A 4OS8A 2QO4A 5F58A 5H9KA 1TOWA 1LIBA 2Q4NA 4ODDA 4AYHA 2AT6X 2G7BA 3NPOA 4BQUA 4ALOA 4YGGA 2FTBA 1MDCA 3FELA 1JV4A 1EUOA 1YP7A 3VG3A 2BLGA 1QFVA 1NP4A 3APVA 5B29A 1A57A 1KT5A 1FELA 3NX2A 1VPRA 3C76X 4ES7A 4OMWA 1VYGA 2NP1A 2MJIA 3PH6A 3FENA 2KTDA 2W2AA 3UEVA 4AZOA 3L4RA 2A0AA 1JJJA 3CWKA 3CQNA 2O62A 1SXUA
chains in the Genus database with same CATH superfamily
2AT3X 3BX7A 4UU3A 1LPJA 4CPHB 1HN2A 3AUMO 3FMZA 3O2YA 5HZQA 1B4MA 1A57A 3HPEA 1SWGA 2Q9SA 4O4UA 2X34A 1KGLA 1FDQA 4I3CA 4KC8A 3RDOA 1VWOB 2MO5A 1SWQA 1SWKA 1BSOA 4AW8A 4CPIA 4BBOA 4HFOA 2ZAGA 5FQ8E 3S60A 3CBCA 2POAA 1MK5A 4NLIA 3NP1A 1KT3A 5LKFA 3WJFA 5F1EA 3U03A 3CQRA 1D3SA 3NR3A 2OVDA 5EEEA 2OY5O 1EPAA 5FAZA 3T1DA 4IAXA 1YWCA 5HCEC 4O3WA 5F6ZA 1DF8A 4YGHA 1MM9A 3NQ9A 2P8GA 5KIDA 1SLFB 2VFBA 1ALBA 3FEKA 3T2XA 2R74A 1BWYA 2DJFA 3EBWA 4CPEA 1STRB 1VWCB 2RTFB 1UYNX 1VWIB 1MX8A 1VWNB 2NNQA 3P6HA 4OMXA 1VWHB 4Z2OA 5IO6A 3VG2A 4YKMA 4U46A 1U17A 1VWLB 3KFHA 4TJZA 3FDCA 1W4TA 2Q2PA 4KIIA 1EIOA 1E02A 1QY0A 3RSWA 2RTGB 3K3LA 1NC9A 1BRQA 4FBOA 3STKA 5D48A 3C78X 4BJ8A 2RCTA 4CPFA 4TKJA 4O3XB 1BSQA 2A13A 1LIDA 1N9YA 2WPUA 1MUPA 1TOUA 3MX7A 1CBIA 4QYNA 3WJDA 4TQ2A 4Z6JA 1P6PA 4ZGUA 4WFUA 3WXQA 1I78A 1EIIA 3OJYC 1EPBA 1I04A 2G5LA 3C77X 1IIUA 1KT4A 1SWRA 1KT7A 4U8UM 3EM0A 1SWPA 2C1QA 4BX6A 3WJCA 1SY0A 1N9MA 2VDFA 3D9WA 2OFAA 4BX6B 2WUTA 1IFBA 2GTLN 4YKOA 5FQ7E 5HA0A 2MWHA 4GJSA 4YH0A 1E06A 5BVQA 4I6SA 3TF6A 1TXLA 1KXOA 2CZTA 4LKTA 4NV8A 1OEKA 3U9PC 4ZHGA 2OL7A 1VWAB 5H9AA 5LJGA 1SRHA 2WQ9A 5HZ9A 3AKNA 2G8CO 3WZNA 5CSEA 2BHVA 2WSJA 2NNDA 1LIEA 4CDFA 1KZWA 4EDEA 2K23A 3BSZE 1KZXA 5K68A 1B0OA 1SWJA 3HK1A 3Q6LA 1N7YA 4ON1A 2FHNX 4I3BA 4NV7A 2GH7A 4U8UO 1GT5A 1KOIA 2LBVA 4IMNA 3KZAA 1NQNA 4Y59A 1QY2A 1Y53X 4DNEA 1BLRA 4RUNA 1KL4A 2I5VO 1FTPA 1Y0GA 2AT8X 2YG2A 3JS1A 1SLEB 2OL6O 5EZ2A 1OEEA 4GE1A 3P6CA 3ZW0A 4CDEA 4GD9A 4Y0RA 1IKJA 3RY2A 1O1UA 3WJGA 2FKJA 1BBPA 3MVFA 3VG7A 1VYOA 2HYSA 1KL3A 3KFGA 4O9SA 3EBKA 3PQSA 1UZ2X 4MVEA 1LCZA 4GDZA 4KH8A 2HZRA 1SXXA 1GM6A 2AT0X 3FR5A 3HOLA 4K19A 5BVTA 2M4LA 1ZRYA 4IRWA 1CBSA 2RTHB 3P6DA 1GT4A 4MVIA 4GGRA 5D45A 2C4IA 1ML7A 3IFBA 2DM5A 4PSQA 2FLJA 3F9DA 2IZDB 1ACDA 4GNWA 1G85A 1SWBA 3OE3A 4HPCA 4YBPA 5IO5A 3ZW0B 4L3RA 3NQKA 2UZ2A 1BM5A 1JJUA 1OPAA 1PTSA 3NX1A 1MOYA 2AVIA 3D4RA 1OBUA 2IZJA 2QO6A 2BC3A 3FR2A 3GE2A 3JSQA 3KFFA 4NNTA 4M7MA 1PM1X 1IFCA 1LCVA 5IRAA 3UEXA 4AZNA 2OL8O 5IRWA 5H9NA 1VWRB 3SAOA 1SLGB 2JU7A 4XMHA 2IZAA 2AH7X 3VPJE 2L68A 3CBSA 4EFGA 1KQXA 1T8VA 4ZHHA 3P6FA 1EXSA 1JMZA 4Z28A 4AZQA 5HCDC 3PECA 4I60A 4INNA 2JN3A 2UYWA 5JD2A 3HWGA 5EDBA 4A1YA 4UU2A 3TZSA 1DF3A 1SRIA 2ACPX 2IZLB 4ORSA 2IZKA 4HPAA 4YBUA 4QYPA 1SY2A 2Q2MA 5LJBA 1AQBA 1K3BA 3BDRA 1PMPA 2FS6A 3KFIA 3EMMA 1DFVA 1BSYA 1SY1A 4O49A 1MX7A 2RTJA 4A8ZA 1I06A 5HTDA 1CBQA 1GXAA 5C0NA 1Z24A 5KICA 1AVGI 1HMRA 4ZCBA 4A1HA 2XKLA 2K62A 1EALA 1ZNDA 5B2AO 1NQMA 1SWLA 3D95A 2OVSA 2G79A 2JMBA 1GGLA 4Y0PA 4CDCA 5HCCC 3SLTA 4YDAA 4I9SA 2RTBB 4OEMA 2C1SA 4IBAA 4WFVA 4YDBA 5D8JA 4JO6A 2WEWA 3KVNA 4U9CA 2RTLA 1L6MA 3ZW2A 3BU1A 2JU8A 1ADLA 1R0UA 2RTKA 4QGXA 1S44A 3D96A 3MG5A 2L67A 3HTYA 1ZNKA 1KFFA 1N43A 1VWMB 1X71A 2HLVA 5HWZA 2BS5A 2KW1A 4Y0SA 1UYOX 2N93A 4U8UN 5HZ8A 1G5WA 2X8FA 4TNNA 1ZNGA 4GETA 1Y9LA 5BYPA 1BEBA 3B2IA 4IAWA 4XMEA 3WZQA 1RSUB 1BRPA 1DZMA 3UEUA 4EXZA 3SZJA 4GUZA 1MVGA 3PDFA 4I95A 4BGFA 4IMOA 3T2WA 1DZKA 1HY2A 4MVKA 1SWOA 1W5RA 2G78A 5HTEA 4ZHCA 5L8NA 1EI5A 3VG4A 1D2UA 3FR4A 1G7NA 4DQ3A 5CYBA 1AB0A 1YWBA 1EQDA 1VWGB 1X8UA 1G74A 1VWJB 4NP1A 4YGZA 3CQNA 1QG5A 1VYFA 3FLLA 4MISA 3KQ0A 4IB9A 4IB8A 1DZPA 1X89A 1U0XA 4JNJA 2RCQA 3QKGA 5LJDA 1LDOA 5EEDA 4EQAC 3LV4A 1GX8A 5FQ6E 4Z27A 2CBSA 2X8SA 1DZJA 2E4JA 2KD2A 3ZQ3A 4ML7B 3P6GA 5HZ6A 3VGWA 1ERBA 1VWDB 1X8QA 2IZCB 4JGLA 3RDQA 4ARHA 1KL5A 2R56A 2RTIB 3PPTA 3VG5A 1S7DA 4GRJA 4OS0A 4ORWA 3SZHA 1JMXA 2I5ZO 1LKEA 5LJKA 2LKKA 3BU9A 4ALBA 4YMYA 1VWBB 1RXKA 2R73A 4GU8A 5BVSA 4YFRA 1LICA 4ZGFA 3FA7A 5FENA 1LCWA 4YFPA 3VU1A 1TW4A 2L5PA 3RY1A 5D4AA 3VHIA 4COTA 1XCAA 1Y55X 2RTPB 2WR6A 4OKAA 1IKEA 3ELZA 2BT9A 1HBQA 1JIWI 3AKMA 4ORXA 1N0SA 2IZIA 2A5CA 2MF6A 5HA1A 4EKVA 3VG6A 1ICNA 2FKGA 1OEJA 5EDCA 3OD9A 4QAEA 1JYJA 2FWVA 3RE6A 5L8IA 3B2KA 4YVBA 1SREA 3ZWEA 1E5PA 4N7CA 5IXGA 1QFTA 2RD7C 4QGWA 1TVQA 5H9LA 1LNMA 2OFMX 5B3MO 4FGIB 4BCSA 1RXHA 2LFOA 1WBIA 3APWA 1FEMA 1YUPA 2Y3FA 1LDQA 3NQ3A 4LZUA 4YCEA 1A18A 1OBPA 2IZHB 5AJCA 3CMPA 5LKEA 2IFBA 1RSTB 3VHHA 1CJ5A 2OF9A 1JYDA 2OFRX 3FA8A 4HWMA 1NDJA 4NW4A 2OY7A 3RE5A 1HQPA 4ORRA 5F2BA 3FEPA 1SRJA 3WZOA 2NNEA 3NADA 3BLGA 3RZYA 4GK9A 3S5XA 1O1VA 2OY1O 2PI3O 3BX8A 3LHNA 4NYRA 2JU3A 3T6FA 1PEEA 2QOSC 2F73A 1SLDB 1HXZA 1U18A 1I9HA 1SWCA 2KT4B 2RTNB 2WEXA 1UREA 2WWPA 1E2TA 2MM3A 4Y5DA 5K67A 3TGCA 3SLJA 1AELA 3UEWA 2Y3EA 1FE3A 1PBOA 2RTOB 1KQWA 2EU7X 4GGZA 4C5PA 2LBAA 5F6BA 3N91A 1SRGA 1SWDA 3PH5A 2Q39A 1SWSA 2GTFX 2W2BA 3LTWA 2WQAE 3ZI8A 4ORUA 1I4UA 1CRBA 5D47A 3HWDA 3EW2A 3DSZA 3RDXA 1GT1A 4M6SA 4BX5A 4TLJA 4FBVA 3WJBA 2X45A 1H91A 3CKGA 4BX5B 4N7DA 2OVEA 2HNXA 5HZ5A 1BJ7A 2RTRB 3WOVA 3SZIA 3X00A 1IW2A 1HBPA 2BS6A 1RLBE 4AZPA 2GC9A 3EYCA 1JZUA 3GAQA 5F7GA 2RQ0A 2PY1A 2OZQA 2Z4HA 3MBTA 4GKCA 4L1NA 4XMCA 4YCHA 1MEPA 5DG4A 2HMBA 4AZMA 1VWKB 1RXJA 1HMTA 2A2GA 4BVMA 5LJCA 3WBGA 4NYQA 3MM0A 3F6ZB 3B2LA 3ZUOA 4ZFXA 1X8OA 2QO5A 1NGLA 1VWEB 1ZNLA 1ERXA 2LA7A 2FT9A 3B2HA 1YP6A 3PK2A 2JOZA 2QMIA 1GT3A 2CM4A 4I3DA 2A2UA 1CBRA 3RDMA 4Z2PA 4Y0QA 4NNSA 3D97A 1QABE 5DPQA 2IZGB 4A60A 4TKBA 4LQZA 3P6EA 4AZRA 2FGSA 1X8PA 3B2JA 1AVDA 2OY8A 1RBPA 1SWEA 3FIDA 1NBXA 3FW5A 4U3QA 4WBKA 1SWAA 2OFBA 3U0DA 3TGBA 1HXLA 1IJ8A 1SA8A 2CM9A 3APXA 1RAVA 3NBXX 5LJEA 2DJGA 4D6AA 3FW4A 4GZVA 5AEOA 1LIFA 2IZEB 2OVAA 4GGTA 5H8TA 2FR3A 2RTCB 3SOTA 5B5GA 1QY1A 1T0VA 4KC7A 2GJ5A 4HPDA 3PP6A 4O4XA 3RBYA 2RTMA 4O3YA 3S5VA 4CK4A 1LUQA 1A3YA 4ZH9A 3FA6A 4XMDA 3O22A 1YWDA 2AF5A 3VE1A 3STMX 1QWDA 3TGAA 2AT5X 2ASNX 2F09A 1SXYA 1SWUA 3AEHA 3WVMA 2X56A 1VWPB 3EC5A 3FA9A 4MIRA 2OF8A 3I0AA 3VHMA 5LJHA 5B11O 5FFHA 1PBYA 1B8EA 5AQ6A 3S26A 4CSBA 3ELXA 2X8TA 4GNYA 4QQ1A 4CV7A 4QZUA 2X55A 1LF7A 3SLOA 4TKHA 1LELA 2AL0X 1SWTA 4RUUA 1DC9A 5IRUA 3V8UA 4OELA 4BX7A 4NLJA 2ZAIA 3HWEA 4QRLA 4BOEA 4DCBA 2RA6A 5K06A 3CKFA 2MHDA 2QM9A 3STNA 4BX7B 4FBRA 3BRNA 1JJXA 1SWHA 1SRFA 4HPBA 2FRSA 3T6LA 1ICMA 2YMSA 1YIVA 1I05A 1LFOA 2CZUA 4EEJA 2RN4A 4PJ2A 1KT6A 4QZTA 4ZR2A 4ZJ0A 2W2FA 4ZH6A 5HAEA 2A3FX 1O8VA 2AKQA 4O3ZA 4LZVA 4MVLA 1SXWA 3APUA 3RWXA 4YFQA 1DV9A 3FIQA 2KTSA 5CE4A 2AMMX 1A2DA 2CAMA 4XMFA 4FQBB 2L9CA 5B10O 4IB7A 4O4SA 4IB6A 4ZHDA 2IZBA 3ZUIA 1SMPI 3Q34A 4MEEA 1VWQB 3WZPA 2ZSCA 4OS3A 1FJ1E 4QNIA 5L8OA 3UAQA 2OYBO 2A8GA 3IA8A 4LKPA 3ZW1A 2ALLX 3PQUA 5KHPA 1E00A 1SY3A 3G7XA 3I17A 1OSPO 5L3YA 3ZW1B 4ORYA 3DTQA 3P02A 4ZHFA 2GTLM 1S2PA 4O4OA 1XKIA 1GX9A 3BY0A 1ZNEA 4GH7A 3WYPA 2LB6A 3RDSA 4JHQA 1OBQA 3WJEA 5HBSA 3P24A 5AJBA 2ANSA 3F8AA 4CDDA 1JBHA 1EW3A 2X46A 4D6BA 4XMGA 2X4MA 2FR2A 2FS7A 5EPQA 1WUBA 2IZFB 3RDUA 1X8NA 3H3IA 4DQ4A 2RTQB 4ID2A 1ZNHA 2ACOA 3ZZVA 1STPA 1VWFB 1NP1A 1K24A 1GKAA 3FYFA 1HMSA 3QQ2A 2VFCA 2XSTA 1FENA 1OPBA 1QQSA 1B56A 2JGSA 3CR6A 3PEDA 4I9RA 1YWAA 3OBLA 4GDAA 4R0BA 3E3CA 5IO7A 1GKAB 3HWFA 2CBRA 2A5BA 4WHIA 5B27A 4QGVA 1T68X 2HZQA 1SWFA 3O19A 5JR8A 3BS2A 4OS8A 2QO4A 1Y52X 5F58A 4Z2VA 5H9KA 1TOWA 2Z4IA 1LIBA 2Q4NA 4ODDA 4AYHA 2AT6X 2G7BA 2GTLO 3NPOA 4BQUA 1SWNA 4ALOA 1W6FA 1HQQA 4YGGA 1GX3A 2FTBA 1MDCA 3FELA 1JV4A 2F01A 2X32A 1EUOA 1YP7A 1STSB 3JQOA 2QCBA 2FHLA 3VG3A 3EW1A 4IABA 2BSZA 2BLGA 1QFVA 1NP4A 2QOMA 1AVEA 2Y32A 4KT5A 3VE2A 3APVA 3WYQA 5B29A 1JQPA 1KT5A 1FELA 3NX2A 2HKDA 1VPRA 3C76X 4GJVA 5CHKA 4ES7A 4OMWA 4KCAA 1VYGA 2NP1A 5B5FA 2MJIA 3PH6A 3FENA 2KTDA 2W2AA 2JW1A 3HOEA 3UEVA 2RTAA 2RTEB 3RKGA 4AZOA 4B55A 1N4JA 1Y9TA 3L4RA 2A0AA 1JJJA 3CWKA 4CPHA 2RTDB 2O62A 1SXUA
chains in the Genus database with same CATH topology
2AT3X 3BX7A 4UU3A 1LPJA 1HN2A 3FMZA 3O2YA 5HZQA 1B4MA 2Q9SA 4O4UA 1KGLA 1FDQA 4I3CA 4KC8A 2MO5A 1BSOA 4AW8A 4HFOA 2ZAGA 3S60A 3CBCA 2POAA 4NLIA 3NP1A 1KT3A 5LKFA 3WJFA 5F1EA 3U03A 3CQRA 1D3SA 3NR3A 2OVDA 5EEEA 3T1DA 1EPAA 5FAZA 4IAXA 1YWCA 5HCEC 4O3WA 5F6ZA 4YGHA 3NQ9A 2P8GA 5KIDA 1BWYA 3FEKA 1ALBA 2R74A 3EBWA 2NNQA 1MX8A 4OMXA 3P6HA 5IO6A 3VG2A 4YKMA 1EIOA 1U17A 4TJZA 3KFHA 4KIIA 2Q2PA 1E02A 1QY0A 3RSWA 3K3LA 1BRQA 4FBOA 3STKA 5D48A 3C78X 2RCTA 4TKJA 4O3XB 1BSQA 2A13A 1LIDA 1MUPA 1TOUA 3MX7A 1CBIA 4QYNA 3WJDA 4TQ2A 4ZGUA 1P6PA 3WXQA 1EIIA 3OJYC 1EPBA 1I04A 3C77X 4U8UM 1IIUA 1KT4A 1KT7A 3EM0A 3WJCA 1SY0A 2WUTA 1IFBA 2GTLN 4YKOA 5FQ7E 5HA0A 2MWHA 4YH0A 1E06A 5BVQA 4I6SA 3TF6A 1TXLA 1KXOA 2CZTA 4LKTA 4ZHGA 1OEKA 3U9PC 5H9AA 5LJGA 5HZ9A 3AKNA 1KZWA 2BHVA 2WSJA 2NNDA 1LIEA 1KZXA 4EDEA 2K23A 3BSZE 1B0OA 3HK1A 3Q6LA 4ON1A 4I3BA 4U8UO 1GT5A 1KOIA 2LBVA 4IMNA 3KZAA 1QY2A 1BLRA 4RUNA 1FTPA 2AT8X 2YG2A 3JS1A 5EZ2A 1OEEA 4GE1A 3P6CA 3ZW0A 4Y0RA 1IKJA 3WJGA 1O1UA 1BBPA 3MVFA 3VG7A 2HYSA 3KFGA 4O9SA 3EBKA 3PQSA 1UZ2X 4GDZA 4KH8A 2HZRA 1SXXA 1GM6A 2AT0X 3FR5A 3HOLA 4K19A 5BVTA 2M4LA 1ZRYA 1CBSA 3P6DA 1GT4A 4MVIA 5D45A 1ML7A 3IFBA 2DM5A 4PSQA 2FLJA 3F9DA 1ACDA 4GNWA 1G85A 3OE3A 4HPCA 4YBPA 5IO5A 4L3RA 3NQKA 1BM5A 3NX1A 1OPAA 4WFUA 3D4RA 1OBUA 2QO6A 3FR2A 3JSQA 4NNTA 3GE2A 4DQ3A 3KFFA 4M7MA 1PM1X 1IFCA 3UEXA 4AZNA 5H9NA 3SAOA 2JU7A 4XMHA 2AH7X 3VPJE 2L68A 3CBSA 4EFGA 1KQXA 1T8VA 4ZHHA 3P6FA 1EXSA 4AZQA 5HCDC 3PECA 4INNA 2JN3A 3TZSA 4A1YA 3HWGA 5EDBA 1DF3A 4UU2A 2ACPX 4ORSA 4YBUA 4HPAA 4QYPA 1SY2A 2Q2MA 5LJBA 1AQBA 3BDRA 1PMPA 2FS6A 3KFIA 3EMMA 1DFVA 1BSYA 1SY1A 4O49A 1MX7A 4A8ZA 1I06A 5HTDA 1CBQA 1GXAA 5C0NA 1Z24A 5KICA 1AVGI 1HMRA 4ZCBA 4A1HA 2XKLA 2K62A 1EALA 1ZNDA 3D95A 2OVSA 2G79A 2JMBA 1GGLA 4Y0PA 4YDAA 4I9SA 4IBAA 4WFVA 4YDBA 5D8JA 2WEWA 4U9CA 1L6MA 3ZW2A 3BU1A 2JU8A 1ADLA 1R0UA 4QGXA 1S44A 3D96A 2L67A 3HTYA 1ZNKA 5HWZA 1X71A 2HLVA 5HZ8A 2BS5A 2KW1A 4Y0SA 2N93A 1G5WA 4U8UN 2X8FA 4TNNA 1ZNGA 4GETA 1Y9LA 5BYPA 1BEBA 3B2IA 4IAWA 4XMEA 1BRPA 1DZMA 3UEUA 4EXZA 1MVGA 4I95A 4IMOA 1DZKA 4MVKA 5HTEA 4ZHCA 2G78A 5L8NA 1EI5A 3VG4A 1D2UA 3FR4A 1G7NA 5CYBA 1AB0A 1YWBA 1EQDA 1X8UA 1G74A 4YGZA 4NP1A 1QG5A 1VYFA 3FLLA 4MISA 3KQ0A 4IB9A 4IB8A 1DZPA 1X89A 1U0XA 2RCQA 3QKGA 5LJDA 5EEDA 4EQAC 3LV4A 1GX8A 5FQ6E 2CBSA 2X8SA 1DZJA 2E4JA 2KD2A 3ZQ3A 4ML7B 3P6GA 5HZ6A 1ERBA 1X8QA 4JGLA 4ARHA 2R56A 3PPTA 3VG5A 1S7DA 4GRJA 4OS0A 4ORWA 1LKEA 5LJKA 2LKKA 3BU9A 4ALBA 4YMYA 2R73A 4GU8A 5BVSA 4YFRA 1LICA 4ZGFA 3FA7A 5FENA 4YFPA 3VU1A 1TW4A 2L5PA 5D4AA 4COTA 1XCAA 2WR6A 1IKEA 3ELZA 2BT9A 1HBQA 1JIWI 3AKMA 4ORXA 1N0SA 5HA1A 3VG6A 1ICNA 1OEJA 5EDCA 3OD9A 4QAEA 1JYJA 2FWVA 5L8IA 3B2KA 3ZWEA 1E5PA 4N7CA 1QFTA 2RD7C 4QGWA 1TVQA 5H9LA 1LNMA 2OFMX 4FGIB 3APWA 2LFOA 1FEMA 1YUPA 3NQ3A 4LZUA 4YCEA 1A18A 1OBPA 5AJCA 3CMPA 5LKEA 2IFBA 1CJ5A 1JYDA 2OFRX 3FA8A 4HWMA 4NW4A 1HQPA 4ORRA 3FEPA 2NNEA 3NADA 3BLGA 3RZYA 4GK9A 3S5XA 1O1VA 4NYRA 3BX8A 3LHNA 2JU3A 1PEEA 2QOSC 2F73A 2WQ9A 2WWPA 1U18A 2WEXA 4MVEA 2KT4B 5FQ8E 1UREA 3TGCA 2MM3A 1AELA 3UEWA 1FE3A 1PBOA 1KQWA 2EU7X 2LBAA 5F6BA 3N91A 3PH5A 2Q39A 2GTFX 2W2BA 3ZI8A 2WQAE 4ORUA 1I4UA 1CRBA 5D47A 3HWDA 3DSZA 1GT1A 4M6SA 4TLJA 4FBVA 3WJBA 2X45A 1H91A 4N7DA 2OVEA 2HNXA 5HZ5A 1BJ7A 3WOVA 1IW2A 1HBPA 2BS6A 1RLBE 4AZPA 2GC9A 3EYCA 1JZUA 3GAQA 5F7GA 2RQ0A 2PY1A 2OZQA 2Z4HA 3MBTA 4GKCA 4L1NA 4YCHA 5DG4A 4AZMA 2HMBA 1HMTA 2A2GA 4BVMA 5LJCA 3WBGA 4NYQA 3F6ZB 3B2LA 3ZUOA 4ZFXA 1X8OA 2QO5A 1NGLA 1ZNLA 1ERXA 2LA7A 2FT9A 3B2HA 1YP6A 2JOZA 2QMIA 1GT3A 2CM4A 4I3DA 2A2UA 1CBRA 4Y0QA 4NNSA 3D97A 1QABE 5DPQA 4A60A 4TKBA 4LQZA 3P6EA 4AZRA 1X8PA 3B2JA 1RBPA 3FW5A 4U3QA 4WBKA 3U0DA 3TGBA 1SA8A 2CM9A 3APXA 3NBXX 5LJEA 4D6AA 3FW4A 4GZVA 5AEOA 1LIFA 2OVAA 5H8TA 2FR3A 3SOTA 1QY1A 1T0VA 4KC7A 2GJ5A 4HPDA 3PP6A 4O4XA 3RBYA 3S5VA 4O3YA 4CK4A 1A3YA 4ZH9A 3FA6A 4XMDA 3O22A 1YWDA 3VE1A 3STMX 1QWDA 3TGAA 2AT5X 2ASNX 2F09A 1SXYA 3WVMA 4MIRA 3FA9A 3I0AA 5LJHA 5FFHA 3S26A 1B8EA 5AQ6A 4CSBA 3ELXA 2X8TA 4GNYA 4QQ1A 4CV7A 4QZUA 1LF7A 4TKHA 2AL0X 4RUUA 1DC9A 3V8UA 5K06A 4NLJA 2ZAIA 3HWEA 4QRLA 4BOEA 2RA6A 2MHDA 2QM9A 3STNA 4FBRA 3BRNA 1JJXA 4HPBA 2FRSA 1ICMA 2YMSA 1YIVA 1I05A 1LFOA 2CZUA 4EEJA 2RN4A 4PJ2A 1KT6A 4QZTA 4ZR2A 4ZJ0A 2W2FA 4ZH6A 5HAEA 2A3FX 1O8VA 2AKQA 4O3ZA 4LZVA 4MVLA 1SXWA 3APUA 3RWXA 4YFQA 1DV9A 3FIQA 2KTSA 2AMMX 1A2DA 4XMFA 4FQBB 2L9CA 4IB7A 4O4SA 4IB6A 4ZHDA 3ZUIA 1SMPI 4OS3A 4QNIA 5L8OA 3UAQA 3ZW1A 3IA8A 4LKPA 2ALLX 3PQUA 5KHPA 1E00A 1SY3A 3G7XA 3I17A 3ZW1B 4ORYA 3DTQA 3P02A 4ZHFA 2GTLM 1S2PA 4O4OA 1GX9A 1XKIA 3BY0A 1ZNEA 4GH7A 2LB6A 3WJEA 1OBQA 5HBSA 3P24A 5AJBA 2ANSA 3F8AA 1JBHA 1EW3A 2X46A 4D6BA 4XMGA 5EPQA 2FR2A 2FS7A 1X8NA 3H3IA 4DQ4A 4ID2A 1ZNHA 2ACOA 3ZZVA 5CE4A 1NP1A 1GKAA 3FYFA 1HMSA 5HCCC 4I9RA 2XSTA 1FENA 1OPBA 1QQSA 1B56A 3CR6A 3PEDA 4XMCA 3ZW0B 1YWAA 3OBLA 4R0BA 5IO7A 3E3CA 1GKAB 3HWFA 2CBRA 4WHIA 5B27A 4QGVA 1T68X 2HZQA 3O19A 5JR8A 3BS2A 4OS8A 2QO4A 5F58A 5H9KA 1TOWA 2Z4IA 1LIBA 2Q4NA 4ODDA 4AYHA 2AT6X 2G7BA 2GTLO 3NPOA 4BQUA 4ALOA 4YGGA 2FTBA 1MDCA 3FELA 1JV4A 1EUOA 1YP7A 3JQOA 3VG3A 4IABA 2BLGA 1QFVA 1NP4A 4KT5A 3VE2A 3APVA 5B29A 1A57A 1KT5A 1FELA 3NX2A 1VPRA 3C76X 4ES7A 4OMWA 4KCAA 1VYGA 2NP1A 2MJIA 3PH6A 3FENA 2KTDA 2W2AA 2JW1A 3HOEA 3UEVA 3RKGA 4AZOA 1Y9TA 3L4RA 2A0AA 1JJJA 3CWKA 3CQNA 2O62A 1SXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AT3 X;  3BX7 A;  4UU3 A;  1LPJ A;  1HN2 A;  3FMZ A;  3O2Y A;  5HZQ A;  1B4M A;  2Q9S A;  1KGL A;  1FDQ A;  4I3C A;  2MO5 A;  1BSO A;  4AW8 A;  4HFO A;  3CBC A;  2POA A;  4NLI A;  3NP1 A;  1KT3 A;  5LKF A;  3WJF A;  5F1E A;  3U03 A;  3CQR A;  1D3S A;  3NR3 A;  2OVD A;  5EEE A;  3T1D A;  1EPA A;  5FAZ A;  4IAX A;  1YWC A;  5HCE C;  5F6Z A;  4YGH A;  3NQ9 A;  2P8G A;  5KID A;  1BWY A;  3FEK A;  1ALB A;  2R74 A;  3EBW A;  2NNQ A;  1MX8 A;  4OMX A;  3P6H A;  5IO6 A;  3VG2 A;  4YKM A;  1EIO A;  1U17 A;  4TJZ A;  3KFH A;  4KII A;  2Q2P A;  1E02 A;  1QY0 A;  3RSW A;  3K3L A;  1BRQ A;  3STK A;  5D48 A;  3C78 X;  2RCT A;  4TKJ A;  1BSQ A;  2A13 A;  1LID A;  1MUP A;  1TOU A;  4QYN A;  1CBI A;  3WJD A;  4TQ2 A;  4ZGU A;  1P6P A;  3WXQ A;  1EII A;  3OJY C;  1EPB A;  1I04 A;  3C77 X;  1IIU A;  1KT4 A;  1KT7 A;  3EM0 A;  3WJC A;  1SY0 A;  2WUT A;  1IFB A;  4YKO A;  5HA0 A;  4YH0 A;  1E06 A;  5BVQ A;  3TF6 A;  1TXL A;  1KXO A;  2CZT A;  4LKT A;  4ZHG A;  1OEK A;  3U9P C;  5H9A A;  5LJG A;  5HZ9 A;  3AKN A;  1KZW A;  2WSJ A;  2NND A;  1LIE A;  1KZX A;  4EDE A;  2K23 A;  3BSZ E;  1B0O A;  3HK1 A;  3Q6L A;  4I3B A;  1GT5 A;  1KOI A;  2LBV A;  4IMN A;  3KZA A;  1QY2 A;  1BLR A;  4RUN A;  1FTP A;  2AT8 X;  2YG2 A;  3JS1 A;  5EZ2 A;  1OEE A;  4GE1 A;  3P6C A;  4Y0R A;  1IKJ A;  3WJG A;  1O1U A;  1BBP A;  3MVF A;  3VG7 A;  2HYS A;  3KFG A;  4O9S A;  3EBK A;  1UZ2 X;  2HZR A;  1SXX A;  1GM6 A;  2AT0 X;  3FR5 A;  4K19 A;  5BVT A;  1ZRY A;  1CBS A;  3P6D A;  1GT4 A;  4MVI A;  5D45 A;  1ML7 A;  3IFB A;  2DM5 A;  4PSQ A;  2FLJ A;  3F9D A;  1ACD A;  4GNW A;  1G85 A;  5IO5 A;  4HPC A;  4YBP A;  1BM5 A;  3NX1 A;  1OPA A;  4WFU A;  1OBU A;  2QO6 A;  3FR2 A;  3JSQ A;  4NNT A;  4DQ3 A;  3KFF A;  4M7M A;  1PM1 X;  1IFC A;  3UEX A;  4AZN A;  5H9N A;  3SAO A;  2JU7 A;  4XMH A;  2AH7 X;  2L68 A;  3CBS A;  4EFG A;  1KQX A;  1T8V A;  4ZHH A;  3P6F A;  1EXS A;  4AZQ A;  5HCD C;  3PEC A;  2JN3 A;  3TZS A;  4A1Y A;  3HWG A;  5EDB A;  1DF3 A;  4UU2 A;  2ACP X;  4ORS A;  4YBU A;  4HPA A;  4QYP A;  1SY2 A;  2Q2M A;  5LJB A;  1AQB A;  3BDR A;  1PMP A;  2FS6 A;  3KFI A;  3EMM A;  1DFV A;  1BSY A;  1SY1 A;  1MX7 A;  4A8Z A;  1I06 A;  5HTD A;  1CBQ A;  1GXA A;  5C0N A;  1Z24 A;  5KIC A;  1AVG I;  1HMR A;  4ZCB A;  4A1H A;  2XKL A;  2K62 A;  1EAL A;  1ZND A;  3D95 A;  2G79 A;  1GGL A;  4Y0P A;  4YDA A;  4I9S A;  4IBA A;  4WFV A;  4YDB A;  5D8J A;  2WEW A;  1L6M A;  3BU1 A;  2JU8 A;  1ADL A;  1R0U A;  4QGX A;  1S44 A;  3D96 A;  2L67 A;  1ZNK A;  5HWZ A;  1X71 A;  2HLV A;  5HZ8 A;  1G5W A;  4Y0S A;  2N93 A;  4TNN A;  1ZNG A;  4GET A;  1BEB A;  3B2I A;  4IAW A;  4XME A;  1BRP A;  1DZM A;  3UEU A;  4EXZ A;  1MVG A;  4IMO A;  1DZK A;  4MVK A;  5HTE A;  4ZHC A;  2G78 A;  5L8N A;  3VG4 A;  1D2U A;  3FR4 A;  1G7N A;  1AB0 A;  1YWB A;  1EQD A;  1X8U A;  1G74 A;  4YGZ A;  4NP1 A;  1QG5 A;  1VYF A;  3FLL A;  3KQ0 A;  4IB9 A;  4IB8 A;  1DZP A;  1X89 A;  1U0X A;  2RCQ A;  3QKG A;  5LJD A;  5EED A;  1GX8 A;  2CBS A;  1DZJ A;  2E4J A;  3ZQ3 A;  3P6G A;  5HZ6 A;  1ERB A;  1X8Q A;  4ARH A;  2R56 A;  3PPT A;  3VG5 A;  1S7D A;  4GRJ A;  4OS0 A;  4ORW A;  1LKE A;  5LJK A;  2LKK A;  3BU9 A;  4ALB A;  4YMY A;  2R73 A;  5BVS A;  4YFR A;  1LIC A;  5FEN A;  3FA7 A;  4YFP A;  1TW4 A;  2L5P A;  5D4A A;  1XCA A;  2WR6 A;  1IKE A;  3ELZ A;  3AKM A;  1HBQ A;  4ORX A;  1N0S A;  5HA1 A;  3VG6 A;  1ICN A;  1OEJ A;  5EDC A;  4QAE A;  1JYJ A;  2FWV A;  5L8I A;  3B2K A;  1E5P A;  4N7C A;  1QFT A;  2RD7 C;  4QGW A;  1TVQ A;  5H9L A;  1LNM A;  2OFM X;  3APW A;  2LFO A;  1FEM A;  1YUP A;  3NQ3 A;  4LZU A;  4YCE A;  1A18 A;  1OBP A;  3CMP A;  5LKE A;  2IFB A;  1CJ5 A;  1JYD A;  2OFR X;  3FA8 A;  1HQP A;  4ORR A;  3FEP A;  2NNE A;  3NAD A;  3BLG A;  3RZY A;  1O1V A;  4NYR A;  3BX8 A;  2JU3 A;  1PEE A;  2QOS C;  2F73 A;  2WQ9 A;  2WWP A;  1U18 A;  2WEX A;  2KT4 B;  1URE A;  3TGC A;  2MM3 A;  1AEL A;  3UEW A;  1FE3 A;  1PBO A;  1KQW A;  2EU7 X;  2LBA A;  5F6B A;  3PH5 A;  2Q39 A;  2GTF X;  2W2B A;  2WQA E;  4ORU A;  1I4U A;  1CRB A;  5D47 A;  3HWD A;  3DSZ A;  1GT1 A;  4M6S A;  4TLJ A;  3WJB A;  2X45 A;  1H91 A;  4N7D A;  2OVE A;  2HNX A;  5HZ5 A;  1BJ7 A;  1IW2 A;  1HBP A;  1RLB E;  4AZP A;  2GC9 A;  3EYC A;  1JZU A;  3GAQ A;  5F7G A;  2RQ0 A;  2PY1 A;  2OZQ A;  3MBT A;  4GKC A;  4YCH A;  4AZM A;  5DG4 A;  2HMB A;  1HMT A;  2A2G A;  4BVM A;  5LJC A;  3WBG A;  4NYQ A;  3B2L A;  3ZUO A;  4ZFX A;  1X8O A;  2QO5 A;  1NGL A;  1ZNL A;  1ERX A;  2FT9 A;  3B2H A;  1YP6 A;  2JOZ A;  1GT3 A;  2CM4 A;  4I3D A;  2A2U A;  1CBR A;  4Y0Q A;  4NNS A;  3D97 A;  1QAB E;  5DPQ A;  4A60 A;  4TKB A;  3P6E A;  4AZR A;  1X8P A;  3B2J A;  1RBP A;  3FW5 A;  4WBK A;  3U0D A;  3TGB A;  1SA8 A;  2CM9 A;  3APX A;  5LJE A;  4D6A A;  3FW4 A;  1LIF A;  2OVA A;  5H8T A;  2FR3 A;  1QY1 A;  1T0V A;  2GJ5 A;  4HPD A;  3PP6 A;  4CK4 A;  1A3Y A;  4ZH9 A;  3FA6 A;  4XMD A;  3O22 A;  1YWD A;  3STM X;  1QWD A;  3TGA A;  2AT5 X;  2ASN X;  1SXY A;  3WVM A;  3FA9 A;  3I0A A;  5LJH A;  5FFH A;  3S26 A;  1B8E A;  5AQ6 A;  3ELX A;  4GNY A;  4QZU A;  1LF7 A;  4TKH A;  2AL0 X;  4RUU A;  1DC9 A;  5K06 A;  4NLJ A;  3HWE A;  4BOE A;  2RA6 A;  2QM9 A;  3STN A;  3BRN A;  1JJX A;  4HPB A;  2FRS A;  1ICM A;  1YIV A;  1I05 A;  1LFO A;  2CZU A;  4EEJ A;  4QZT A;  1KT6 A;  4ZR2 A;  4ZJ0 A;  2W2F A;  4ZH6 A;  5HAE A;  2A3F X;  1O8V A;  2AKQ A;  4LZV A;  4MVL A;  1SXW A;  3APU A;  1DV9 A;  4YFQ A;  3FIQ A;  2AMM X;  1A2D A;  4XMF A;  2L9C A;  4IB7 A;  4ZHD A;  4IB6 A;  3ZUI A;  4OS3 A;  5L8O A;  3IA8 A;  4LKP A;  2ALL X;  5KHP A;  1E00 A;  1SY3 A;  3G7X A;  3I17 A;  4ORY A;  3DTQ A;  4ZHF A;  1S2P A;  1GX9 A;  1XKI A;  3BY0 A;  1ZNE A;  4GH7 A;  2LB6 A;  3WJE A;  1OBQ A;  5HBS A;  2ANS A;  3F8A A;  1JBH A;  1EW3 A;  2X46 A;  4D6B A;  4XMG A;  5EPQ A;  2FR2 A;  2FS7 A;  1X8N A;  4DQ4 A;  1ZNH A;  2ACO A;  5CE4 A;  1NP1 A;  1GKA A;  1HMS A;  5HCC C;  4I9R A;  2XST A;  1FEN A;  1OPB A;  1QQS A;  1B56 A;  3CR6 A;  3PED A;  4XMC A;  1YWA A;  4R0B A;  5IO7 A;  1GKA B;  3HWF A;  2CBR A;  5B27 A;  4QGV A;  1T68 X;  2HZQ A;  3O19 A;  5JR8 A;  3BS2 A;  4OS8 A;  2QO4 A;  5F58 A;  5H9K A;  1TOW A;  1LIB A;  2Q4N A;  4ODD A;  4AYH A;  2AT6 X;  2G7B A;  3NPO A;  4BQU A;  4ALO A;  4YGG A;  2FTB A;  1MDC A;  3FEL A;  1JV4 A;  1EUO A;  1YP7 A;  3VG3 A;  2BLG A;  1QFV A;  1NP4 A;  3APV A;  5B29 A;  1A57 A;  1KT5 A;  1FEL A;  3NX2 A;  1VPR A;  3C76 X;  4ES7 A;  4OMW A;  1VYG A;  2NP1 A;  2MJI A;  3PH6 A;  3FEN A;  2KTD A;  2W2A A;  3UEV A;  4AZO A;  3L4R A;  2A0A A;  1JJJ A;  3CWK A;  3CQN A;  2O62 A;  1SXU A; 
#chains in the Genus database with same CATH topology
 2AT3 X;  3BX7 A;  4UU3 A;  1LPJ A;  4CPH B;  1HN2 A;  3AUM O;  3FMZ A;  3O2Y A;  5HZQ A;  1B4M A;  1A57 A;  3HPE A;  1SWG A;  2Q9S A;  4O4U A;  2X34 A;  1KGL A;  1FDQ A;  4I3C A;  4KC8 A;  3RDO A;  1VWO B;  2MO5 A;  1SWQ A;  1SWK A;  1BSO A;  4AW8 A;  4CPI A;  4BBO A;  4HFO A;  2ZAG A;  5FQ8 E;  3S60 A;  3CBC A;  2POA A;  1MK5 A;  4NLI A;  3NP1 A;  1KT3 A;  5LKF A;  3WJF A;  5F1E A;  3U03 A;  3CQR A;  1D3S A;  3NR3 A;  2OVD A;  5EEE A;  2OY5 O;  1EPA A;  5FAZ A;  3T1D A;  4IAX A;  1YWC A;  5HCE C;  4O3W A;  5F6Z A;  1DF8 A;  4YGH A;  1MM9 A;  3NQ9 A;  2P8G A;  5KID A;  1SLF B;  2VFB A;  1ALB A;  3FEK A;  3T2X A;  2R74 A;  1BWY A;  2DJF A;  3EBW A;  4CPE A;  1STR B;  1VWC B;  2RTF B;  1UYN X;  1VWI B;  1MX8 A;  1VWN B;  2NNQ A;  3P6H A;  4OMX A;  1VWH B;  4Z2O A;  5IO6 A;  3VG2 A;  4YKM A;  4U46 A;  1U17 A;  1VWL B;  3KFH A;  4TJZ A;  3FDC A;  1W4T A;  2Q2P A;  4KII A;  1EIO A;  1E02 A;  1QY0 A;  3RSW A;  2RTG B;  3K3L A;  1NC9 A;  1BRQ A;  4FBO A;  3STK A;  5D48 A;  3C78 X;  4BJ8 A;  2RCT A;  4CPF A;  4TKJ A;  4O3X B;  1BSQ A;  2A13 A;  1LID A;  1N9Y A;  2WPU A;  1MUP A;  1TOU A;  3MX7 A;  1CBI A;  4QYN A;  3WJD A;  4TQ2 A;  4Z6J A;  1P6P A;  4ZGU A;  4WFU A;  3WXQ A;  1I78 A;  1EII A;  3OJY C;  1EPB A;  1I04 A;  2G5L A;  3C77 X;  1IIU A;  1KT4 A;  1SWR A;  1KT7 A;  4U8U M;  3EM0 A;  1SWP A;  2C1Q A;  4BX6 A;  3WJC A;  1SY0 A;  1N9M A;  2VDF A;  3D9W A;  2OFA A;  4BX6 B;  2WUT A;  1IFB A;  2GTL N;  4YKO A;  5FQ7 E;  5HA0 A;  2MWH A;  4GJS A;  4YH0 A;  1E06 A;  5BVQ A;  4I6S A;  3TF6 A;  1TXL A;  1KXO A;  2CZT A;  4LKT A;  4NV8 A;  1OEK A;  3U9P C;  4ZHG A;  2OL7 A;  1VWA B;  5H9A A;  5LJG A;  1SRH A;  2WQ9 A;  5HZ9 A;  3AKN A;  2G8C O;  3WZN A;  5CSE A;  2BHV A;  2WSJ A;  2NND A;  1LIE A;  4CDF A;  1KZW A;  4EDE A;  2K23 A;  3BSZ E;  1KZX A;  5K68 A;  1B0O A;  1SWJ A;  3HK1 A;  3Q6L A;  1N7Y A;  4ON1 A;  2FHN X;  4I3B A;  4NV7 A;  2GH7 A;  4U8U O;  1GT5 A;  1KOI A;  2LBV A;  4IMN A;  3KZA A;  1NQN A;  4Y59 A;  1QY2 A;  1Y53 X;  4DNE A;  1BLR A;  4RUN A;  1KL4 A;  2I5V O;  1FTP A;  1Y0G A;  2AT8 X;  2YG2 A;  3JS1 A;  1SLE B;  2OL6 O;  5EZ2 A;  1OEE A;  4GE1 A;  3P6C A;  3ZW0 A;  4CDE A;  4GD9 A;  4Y0R A;  1IKJ A;  3RY2 A;  1O1U A;  3WJG A;  2FKJ A;  1BBP A;  3MVF A;  3VG7 A;  1VYO A;  2HYS A;  1KL3 A;  3KFG A;  4O9S A;  3EBK A;  3PQS A;  1UZ2 X;  4MVE A;  1LCZ A;  4GDZ A;  4KH8 A;  2HZR A;  1SXX A;  1GM6 A;  2AT0 X;  3FR5 A;  3HOL A;  4K19 A;  5BVT A;  2M4L A;  1ZRY A;  4IRW A;  1CBS A;  2RTH B;  3P6D A;  1GT4 A;  4MVI A;  4GGR A;  5D45 A;  2C4I A;  1ML7 A;  3IFB A;  2DM5 A;  4PSQ A;  2FLJ A;  3F9D A;  2IZD B;  1ACD A;  4GNW A;  1G85 A;  1SWB A;  3OE3 A;  4HPC A;  4YBP A;  5IO5 A;  3ZW0 B;  4L3R A;  3NQK A;  2UZ2 A;  1BM5 A;  1JJU A;  1OPA A;  1PTS A;  3NX1 A;  1MOY A;  2AVI A;  3D4R A;  1OBU A;  2IZJ A;  2QO6 A;  2BC3 A;  3FR2 A;  3GE2 A;  3JSQ A;  3KFF A;  4NNT A;  4M7M A;  1PM1 X;  1IFC A;  1LCV A;  5IRA A;  3UEX A;  4AZN A;  2OL8 O;  5IRW A;  5H9N A;  1VWR B;  3SAO A;  1SLG B;  2JU7 A;  4XMH A;  2IZA A;  2AH7 X;  3VPJ E;  2L68 A;  3CBS A;  4EFG A;  1KQX A;  1T8V A;  4ZHH A;  3P6F A;  1EXS A;  1JMZ A;  4Z28 A;  4AZQ A;  5HCD C;  3PEC A;  4I60 A;  4INN A;  2JN3 A;  2UYW A;  5JD2 A;  3HWG A;  5EDB A;  4A1Y A;  4UU2 A;  3TZS A;  1DF3 A;  1SRI A;  2ACP X;  2IZL B;  4ORS A;  2IZK A;  4HPA A;  4YBU A;  4QYP A;  1SY2 A;  2Q2M A;  5LJB A;  1AQB A;  1K3B A;  3BDR A;  1PMP A;  2FS6 A;  3KFI A;  3EMM A;  1DFV A;  1BSY A;  1SY1 A;  4O49 A;  1MX7 A;  2RTJ A;  4A8Z A;  1I06 A;  5HTD A;  1CBQ A;  1GXA A;  5C0N A;  1Z24 A;  5KIC A;  1AVG I;  1HMR A;  4ZCB A;  4A1H A;  2XKL A;  2K62 A;  1EAL A;  1ZND A;  5B2A O;  1NQM A;  1SWL A;  3D95 A;  2OVS A;  2G79 A;  2JMB A;  1GGL A;  4Y0P A;  4CDC A;  5HCC C;  3SLT A;  4YDA A;  4I9S A;  2RTB B;  4OEM A;  2C1S A;  4IBA A;  4WFV A;  4YDB A;  5D8J A;  4JO6 A;  2WEW A;  3KVN A;  4U9C A;  2RTL A;  1L6M A;  3ZW2 A;  3BU1 A;  2JU8 A;  1ADL A;  1R0U A;  2RTK A;  4QGX A;  1S44 A;  3D96 A;  3MG5 A;  2L67 A;  3HTY A;  1ZNK A;  1KFF A;  1N43 A;  1VWM B;  1X71 A;  2HLV A;  5HWZ A;  2BS5 A;  2KW1 A;  4Y0S A;  1UYO X;  2N93 A;  4U8U N;  5HZ8 A;  1G5W A;  2X8F A;  4TNN A;  1ZNG A;  4GET A;  1Y9L A;  5BYP A;  1BEB A;  3B2I A;  4IAW A;  4XME A;  3WZQ A;  1RSU B;  1BRP A;  1DZM A;  3UEU A;  4EXZ A;  3SZJ A;  4GUZ A;  1MVG A;  3PDF A;  4I95 A;  4BGF A;  4IMO A;  3T2W A;  1DZK A;  1HY2 A;  4MVK A;  1SWO A;  1W5R A;  2G78 A;  5HTE A;  4ZHC A;  5L8N A;  1EI5 A;  3VG4 A;  1D2U A;  3FR4 A;  1G7N A;  4DQ3 A;  5CYB A;  1AB0 A;  1YWB A;  1EQD A;  1VWG B;  1X8U A;  1G74 A;  1VWJ B;  4NP1 A;  4YGZ A;  3CQN A;  1QG5 A;  1VYF A;  3FLL A;  4MIS A;  3KQ0 A;  4IB9 A;  4IB8 A;  1DZP A;  1X89 A;  1U0X A;  4JNJ A;  2RCQ A;  3QKG A;  5LJD A;  1LDO A;  5EED A;  4EQA C;  3LV4 A;  1GX8 A;  5FQ6 E;  4Z27 A;  2CBS A;  2X8S A;  1DZJ A;  2E4J A;  2KD2 A;  3ZQ3 A;  4ML7 B;  3P6G A;  5HZ6 A;  3VGW A;  1ERB A;  1VWD B;  1X8Q A;  2IZC B;  4JGL A;  3RDQ A;  4ARH A;  1KL5 A;  2R56 A;  2RTI B;  3PPT A;  3VG5 A;  1S7D A;  4GRJ A;  4OS0 A;  4ORW A;  3SZH A;  1JMX A;  2I5Z O;  1LKE A;  5LJK A;  2LKK A;  3BU9 A;  4ALB A;  4YMY A;  1VWB B;  1RXK A;  2R73 A;  4GU8 A;  5BVS A;  4YFR A;  1LIC A;  4ZGF A;  3FA7 A;  5FEN A;  1LCW A;  4YFP A;  3VU1 A;  1TW4 A;  2L5P A;  3RY1 A;  5D4A A;  3VHI A;  4COT A;  1XCA A;  1Y55 X;  2RTP B;  2WR6 A;  4OKA A;  1IKE A;  3ELZ A;  2BT9 A;  1HBQ A;  1JIW I;  3AKM A;  4ORX A;  1N0S A;  2IZI A;  2A5C A;  2MF6 A;  5HA1 A;  4EKV A;  3VG6 A;  1ICN A;  2FKG A;  1OEJ A;  5EDC A;  3OD9 A;  4QAE A;  1JYJ A;  2FWV A;  3RE6 A;  5L8I A;  3B2K A;  4YVB A;  1SRE A;  3ZWE A;  1E5P A;  4N7C A;  5IXG A;  1QFT A;  2RD7 C;  4QGW A;  1TVQ A;  5H9L A;  1LNM A;  2OFM X;  5B3M O;  4FGI B;  4BCS A;  1RXH A;  2LFO A;  1WBI A;  3APW A;  1FEM A;  1YUP A;  2Y3F A;  1LDQ A;  3NQ3 A;  4LZU A;  4YCE A;  1A18 A;  1OBP A;  2IZH B;  5AJC A;  3CMP A;  5LKE A;  2IFB A;  1RST B;  3VHH A;  1CJ5 A;  2OF9 A;  1JYD A;  2OFR X;  3FA8 A;  4HWM A;  1NDJ A;  4NW4 A;  2OY7 A;  3RE5 A;  1HQP A;  4ORR A;  5F2B A;  3FEP A;  1SRJ A;  3WZO A;  2NNE A;  3NAD A;  3BLG A;  3RZY A;  4GK9 A;  3S5X A;  1O1V A;  2OY1 O;  2PI3 O;  3BX8 A;  3LHN A;  4NYR A;  2JU3 A;  3T6F A;  1PEE A;  2QOS C;  2F73 A;  1SLD B;  1HXZ A;  1U18 A;  1I9H A;  1SWC A;  2KT4 B;  2RTN B;  2WEX A;  1URE A;  2WWP A;  1E2T A;  2MM3 A;  4Y5D A;  5K67 A;  3TGC A;  3SLJ A;  1AEL A;  3UEW A;  2Y3E A;  1FE3 A;  1PBO A;  2RTO B;  1KQW A;  2EU7 X;  4GGZ A;  4C5P A;  2LBA A;  5F6B A;  3N91 A;  1SRG A;  1SWD A;  3PH5 A;  2Q39 A;  1SWS A;  2GTF X;  2W2B A;  3LTW A;  2WQA E;  3ZI8 A;  4ORU A;  1I4U A;  1CRB A;  5D47 A;  3HWD A;  3EW2 A;  3DSZ A;  3RDX A;  1GT1 A;  4M6S A;  4BX5 A;  4TLJ A;  4FBV A;  3WJB A;  2X45 A;  1H91 A;  3CKG A;  4BX5 B;  4N7D A;  2OVE A;  2HNX A;  5HZ5 A;  1BJ7 A;  2RTR B;  3WOV A;  3SZI A;  3X00 A;  1IW2 A;  1HBP A;  2BS6 A;  1RLB E;  4AZP A;  2GC9 A;  3EYC A;  1JZU A;  3GAQ A;  5F7G A;  2RQ0 A;  2PY1 A;  2OZQ A;  2Z4H A;  3MBT A;  4GKC A;  4L1N A;  4XMC A;  4YCH A;  1MEP A;  5DG4 A;  2HMB A;  4AZM A;  1VWK B;  1RXJ A;  1HMT A;  2A2G A;  4BVM A;  5LJC A;  3WBG A;  4NYQ A;  3MM0 A;  3F6Z B;  3B2L A;  3ZUO A;  4ZFX A;  1X8O A;  2QO5 A;  1NGL A;  1VWE B;  1ZNL A;  1ERX A;  2LA7 A;  2FT9 A;  3B2H A;  1YP6 A;  3PK2 A;  2JOZ A;  2QMI A;  1GT3 A;  2CM4 A;  4I3D A;  2A2U A;  1CBR A;  3RDM A;  4Z2P A;  4Y0Q A;  4NNS A;  3D97 A;  1QAB E;  5DPQ A;  2IZG B;  4A60 A;  4TKB A;  4LQZ A;  3P6E A;  4AZR A;  2FGS A;  1X8P A;  3B2J A;  1AVD A;  2OY8 A;  1RBP A;  1SWE A;  3FID A;  1NBX A;  3FW5 A;  4U3Q A;  4WBK A;  1SWA A;  2OFB A;  3U0D A;  3TGB A;  1HXL A;  1IJ8 A;  1SA8 A;  2CM9 A;  3APX A;  1RAV A;  3NBX X;  5LJE A;  2DJG A;  4D6A A;  3FW4 A;  4GZV A;  5AEO A;  1LIF A;  2IZE B;  2OVA A;  4GGT A;  5H8T A;  2FR3 A;  2RTC B;  3SOT A;  5B5G A;  1QY1 A;  1T0V A;  4KC7 A;  2GJ5 A;  4HPD A;  3PP6 A;  4O4X A;  3RBY A;  2RTM A;  4O3Y A;  3S5V A;  4CK4 A;  1LUQ A;  1A3Y A;  4ZH9 A;  3FA6 A;  4XMD A;  3O22 A;  1YWD A;  2AF5 A;  3VE1 A;  3STM X;  1QWD A;  3TGA A;  2AT5 X;  2ASN X;  2F09 A;  1SXY A;  1SWU A;  3AEH A;  3WVM A;  2X56 A;  1VWP B;  3EC5 A;  3FA9 A;  4MIR A;  2OF8 A;  3I0A A;  3VHM A;  5LJH A;  5B11 O;  5FFH A;  1PBY A;  1B8E A;  5AQ6 A;  3S26 A;  4CSB A;  3ELX A;  2X8T A;  4GNY A;  4QQ1 A;  4CV7 A;  4QZU A;  2X55 A;  1LF7 A;  3SLO A;  4TKH A;  1LEL A;  2AL0 X;  1SWT A;  4RUU A;  1DC9 A;  5IRU A;  3V8U A;  4OEL A;  4BX7 A;  4NLJ A;  2ZAI A;  3HWE A;  4QRL A;  4BOE A;  4DCB A;  2RA6 A;  5K06 A;  3CKF A;  2MHD A;  2QM9 A;  3STN A;  4BX7 B;  4FBR A;  3BRN A;  1JJX A;  1SWH A;  1SRF A;  4HPB A;  2FRS A;  3T6L A;  1ICM A;  2YMS A;  1YIV A;  1I05 A;  1LFO A;  2CZU A;  4EEJ A;  2RN4 A;  4PJ2 A;  1KT6 A;  4QZT A;  4ZR2 A;  4ZJ0 A;  2W2F A;  4ZH6 A;  5HAE A;  2A3F X;  1O8V A;  2AKQ A;  4O3Z A;  4LZV A;  4MVL A;  1SXW A;  3APU A;  3RWX A;  4YFQ A;  1DV9 A;  3FIQ A;  2KTS A;  5CE4 A;  2AMM X;  1A2D A;  2CAM A;  4XMF A;  4FQB B;  2L9C A;  5B10 O;  4IB7 A;  4O4S A;  4IB6 A;  4ZHD A;  2IZB A;  3ZUI A;  1SMP I;  3Q34 A;  4MEE A;  1VWQ B;  3WZP A;  2ZSC A;  4OS3 A;  1FJ1 E;  4QNI A;  5L8O A;  3UAQ A;  2OYB O;  2A8G A;  3IA8 A;  4LKP A;  3ZW1 A;  2ALL X;  3PQU A;  5KHP A;  1E00 A;  1SY3 A;  3G7X A;  3I17 A;  1OSP O;  5L3Y A;  3ZW1 B;  4ORY A;  3DTQ A;  3P02 A;  4ZHF A;  2GTL M;  1S2P A;  4O4O A;  1XKI A;  1GX9 A;  3BY0 A;  1ZNE A;  4GH7 A;  3WYP A;  2LB6 A;  3RDS A;  4JHQ A;  1OBQ A;  3WJE A;  5HBS A;  3P24 A;  5AJB A;  2ANS A;  3F8A A;  4CDD A;  1JBH A;  1EW3 A;  2X46 A;  4D6B A;  4XMG A;  2X4M A;  2FR2 A;  2FS7 A;  5EPQ A;  1WUB A;  2IZF B;  3RDU A;  1X8N A;  3H3I A;  4DQ4 A;  2RTQ B;  4ID2 A;  1ZNH A;  2ACO A;  3ZZV A;  1STP A;  1VWF B;  1NP1 A;  1K24 A;  1GKA A;  3FYF A;  1HMS A;  3QQ2 A;  2VFC A;  2XST A;  1FEN A;  1OPB A;  1QQS A;  1B56 A;  2JGS A;  3CR6 A;  3PED A;  4I9R A;  1YWA A;  3OBL A;  4GDA A;  4R0B A;  3E3C A;  5IO7 A;  1GKA B;  3HWF A;  2CBR A;  2A5B A;  4WHI A;  5B27 A;  4QGV A;  1T68 X;  2HZQ A;  1SWF A;  3O19 A;  5JR8 A;  3BS2 A;  4OS8 A;  2QO4 A;  1Y52 X;  5F58 A;  4Z2V A;  5H9K A;  1TOW A;  2Z4I A;  1LIB A;  2Q4N A;  4ODD A;  4AYH A;  2AT6 X;  2G7B A;  2GTL O;  3NPO A;  4BQU A;  1SWN A;  4ALO A;  1W6F A;  1HQQ A;  4YGG A;  1GX3 A;  2FTB A;  1MDC A;  3FEL A;  1JV4 A;  2F01 A;  2X32 A;  1EUO A;  1YP7 A;  1STS B;  3JQO A;  2QCB A;  2FHL A;  3VG3 A;  3EW1 A;  4IAB A;  2BSZ A;  2BLG A;  1QFV A;  1NP4 A;  2QOM A;  1AVE A;  2Y32 A;  4KT5 A;  3VE2 A;  3APV A;  3WYQ A;  5B29 A;  1JQP A;  1KT5 A;  1FEL A;  3NX2 A;  2HKD A;  1VPR A;  3C76 X;  4GJV A;  5CHK A;  4ES7 A;  4OMW A;  4KCA A;  1VYG A;  2NP1 A;  5B5F A;  2MJI A;  3PH6 A;  3FEN A;  2KTD A;  2W2A A;  2JW1 A;  3HOE A;  3UEV A;  2RTA A;  2RTE B;  3RKG A;  4AZO A;  4B55 A;  1N4J A;  1Y9T A;  3L4R A;  2A0A A;  1JJJ A;  3CWK A;  4CPH A;  2RTD B;  2O62 A;  1SXU A; 
#chains in the Genus database with same CATH homology
 2AT3 X;  3BX7 A;  4UU3 A;  1LPJ A;  1HN2 A;  3FMZ A;  3O2Y A;  5HZQ A;  1B4M A;  2Q9S A;  4O4U A;  1KGL A;  1FDQ A;  4I3C A;  4KC8 A;  2MO5 A;  1BSO A;  4AW8 A;  4HFO A;  2ZAG A;  3S60 A;  3CBC A;  2POA A;  4NLI A;  3NP1 A;  1KT3 A;  5LKF A;  3WJF A;  5F1E A;  3U03 A;  3CQR A;  1D3S A;  3NR3 A;  2OVD A;  5EEE A;  3T1D A;  1EPA A;  5FAZ A;  4IAX A;  1YWC A;  5HCE C;  4O3W A;  5F6Z A;  4YGH A;  3NQ9 A;  2P8G A;  5KID A;  1BWY A;  3FEK A;  1ALB A;  2R74 A;  3EBW A;  2NNQ A;  1MX8 A;  4OMX A;  3P6H A;  5IO6 A;  3VG2 A;  4YKM A;  1EIO A;  1U17 A;  4TJZ A;  3KFH A;  4KII A;  2Q2P A;  1E02 A;  1QY0 A;  3RSW A;  3K3L A;  1BRQ A;  4FBO A;  3STK A;  5D48 A;  3C78 X;  2RCT A;  4TKJ A;  4O3X B;  1BSQ A;  2A13 A;  1LID A;  1MUP A;  1TOU A;  3MX7 A;  1CBI A;  4QYN A;  3WJD A;  4TQ2 A;  4ZGU A;  1P6P A;  3WXQ A;  1EII A;  3OJY C;  1EPB A;  1I04 A;  3C77 X;  4U8U M;  1IIU A;  1KT4 A;  1KT7 A;  3EM0 A;  3WJC A;  1SY0 A;  2WUT A;  1IFB A;  2GTL N;  4YKO A;  5FQ7 E;  5HA0 A;  2MWH A;  4YH0 A;  1E06 A;  5BVQ A;  4I6S A;  3TF6 A;  1TXL A;  1KXO A;  2CZT A;  4LKT A;  4ZHG A;  1OEK A;  3U9P C;  5H9A A;  5LJG A;  5HZ9 A;  3AKN A;  1KZW A;  2BHV A;  2WSJ A;  2NND A;  1LIE A;  1KZX A;  4EDE A;  2K23 A;  3BSZ E;  1B0O A;  3HK1 A;  3Q6L A;  4ON1 A;  4I3B A;  4U8U O;  1GT5 A;  1KOI A;  2LBV A;  4IMN A;  3KZA A;  1QY2 A;  1BLR A;  4RUN A;  1FTP A;  2AT8 X;  2YG2 A;  3JS1 A;  5EZ2 A;  1OEE A;  4GE1 A;  3P6C A;  3ZW0 A;  4Y0R A;  1IKJ A;  3WJG A;  1O1U A;  1BBP A;  3MVF A;  3VG7 A;  2HYS A;  3KFG A;  4O9S A;  3EBK A;  3PQS A;  1UZ2 X;  4GDZ A;  4KH8 A;  2HZR A;  1SXX A;  1GM6 A;  2AT0 X;  3FR5 A;  3HOL A;  4K19 A;  5BVT A;  2M4L A;  1ZRY A;  1CBS A;  3P6D A;  1GT4 A;  4MVI A;  5D45 A;  1ML7 A;  3IFB A;  2DM5 A;  4PSQ A;  2FLJ A;  3F9D A;  1ACD A;  4GNW A;  1G85 A;  3OE3 A;  4HPC A;  4YBP A;  5IO5 A;  4L3R A;  3NQK A;  1BM5 A;  3NX1 A;  1OPA A;  4WFU A;  3D4R A;  1OBU A;  2QO6 A;  3FR2 A;  3JSQ A;  4NNT A;  3GE2 A;  4DQ3 A;  3KFF A;  4M7M A;  1PM1 X;  1IFC A;  3UEX A;  4AZN A;  5H9N A;  3SAO A;  2JU7 A;  4XMH A;  2AH7 X;  3VPJ E;  2L68 A;  3CBS A;  4EFG A;  1KQX A;  1T8V A;  4ZHH A;  3P6F A;  1EXS A;  4AZQ A;  5HCD C;  3PEC A;  4INN A;  2JN3 A;  3TZS A;  4A1Y A;  3HWG A;  5EDB A;  1DF3 A;  4UU2 A;  2ACP X;  4ORS A;  4YBU A;  4HPA A;  4QYP A;  1SY2 A;  2Q2M A;  5LJB A;  1AQB A;  3BDR A;  1PMP A;  2FS6 A;  3KFI A;  3EMM A;  1DFV A;  1BSY A;  1SY1 A;  4O49 A;  1MX7 A;  4A8Z A;  1I06 A;  5HTD A;  1CBQ A;  1GXA A;  5C0N A;  1Z24 A;  5KIC A;  1AVG I;  1HMR A;  4ZCB A;  4A1H A;  2XKL A;  2K62 A;  1EAL A;  1ZND A;  3D95 A;  2OVS A;  2G79 A;  2JMB A;  1GGL A;  4Y0P A;  4YDA A;  4I9S A;  4IBA A;  4WFV A;  4YDB A;  5D8J A;  2WEW A;  4U9C A;  1L6M A;  3ZW2 A;  3BU1 A;  2JU8 A;  1ADL A;  1R0U A;  4QGX A;  1S44 A;  3D96 A;  2L67 A;  3HTY A;  1ZNK A;  5HWZ A;  1X71 A;  2HLV A;  5HZ8 A;  2BS5 A;  2KW1 A;  4Y0S A;  2N93 A;  1G5W A;  4U8U N;  2X8F A;  4TNN A;  1ZNG A;  4GET A;  1Y9L A;  5BYP A;  1BEB A;  3B2I A;  4IAW A;  4XME A;  1BRP A;  1DZM A;  3UEU A;  4EXZ A;  1MVG A;  4I95 A;  4IMO A;  1DZK A;  4MVK A;  5HTE A;  4ZHC A;  2G78 A;  5L8N A;  1EI5 A;  3VG4 A;  1D2U A;  3FR4 A;  1G7N A;  5CYB A;  1AB0 A;  1YWB A;  1EQD A;  1X8U A;  1G74 A;  4YGZ A;  4NP1 A;  1QG5 A;  1VYF A;  3FLL A;  4MIS A;  3KQ0 A;  4IB9 A;  4IB8 A;  1DZP A;  1X89 A;  1U0X A;  2RCQ A;  3QKG A;  5LJD A;  5EED A;  4EQA C;  3LV4 A;  1GX8 A;  5FQ6 E;  2CBS A;  2X8S A;  1DZJ A;  2E4J A;  2KD2 A;  3ZQ3 A;  4ML7 B;  3P6G A;  5HZ6 A;  1ERB A;  1X8Q A;  4JGL A;  4ARH A;  2R56 A;  3PPT A;  3VG5 A;  1S7D A;  4GRJ A;  4OS0 A;  4ORW A;  1LKE A;  5LJK A;  2LKK A;  3BU9 A;  4ALB A;  4YMY A;  2R73 A;  4GU8 A;  5BVS A;  4YFR A;  1LIC A;  4ZGF A;  3FA7 A;  5FEN A;  4YFP A;  3VU1 A;  1TW4 A;  2L5P A;  5D4A A;  4COT A;  1XCA A;  2WR6 A;  1IKE A;  3ELZ A;  2BT9 A;  1HBQ A;  1JIW I;  3AKM A;  4ORX A;  1N0S A;  5HA1 A;  3VG6 A;  1ICN A;  1OEJ A;  5EDC A;  3OD9 A;  4QAE A;  1JYJ A;  2FWV A;  5L8I A;  3B2K A;  3ZWE A;  1E5P A;  4N7C A;  1QFT A;  2RD7 C;  4QGW A;  1TVQ A;  5H9L A;  1LNM A;  2OFM X;  4FGI B;  3APW A;  2LFO A;  1FEM A;  1YUP A;  3NQ3 A;  4LZU A;  4YCE A;  1A18 A;  1OBP A;  5AJC A;  3CMP A;  5LKE A;  2IFB A;  1CJ5 A;  1JYD A;  2OFR X;  3FA8 A;  4HWM A;  4NW4 A;  1HQP A;  4ORR A;  3FEP A;  2NNE A;  3NAD A;  3BLG A;  3RZY A;  4GK9 A;  3S5X A;  1O1V A;  4NYR A;  3BX8 A;  3LHN A;  2JU3 A;  1PEE A;  2QOS C;  2F73 A;  2WQ9 A;  2WWP A;  1U18 A;  2WEX A;  4MVE A;  2KT4 B;  5FQ8 E;  1URE A;  3TGC A;  2MM3 A;  1AEL A;  3UEW A;  1FE3 A;  1PBO A;  1KQW A;  2EU7 X;  2LBA A;  5F6B A;  3N91 A;  3PH5 A;  2Q39 A;  2GTF X;  2W2B A;  3ZI8 A;  2WQA E;  4ORU A;  1I4U A;  1CRB A;  5D47 A;  3HWD A;  3DSZ A;  1GT1 A;  4M6S A;  4TLJ A;  4FBV A;  3WJB A;  2X45 A;  1H91 A;  4N7D A;  2OVE A;  2HNX A;  5HZ5 A;  1BJ7 A;  3WOV A;  1IW2 A;  1HBP A;  2BS6 A;  1RLB E;  4AZP A;  2GC9 A;  3EYC A;  1JZU A;  3GAQ A;  5F7G A;  2RQ0 A;  2PY1 A;  2OZQ A;  2Z4H A;  3MBT A;  4GKC A;  4L1N A;  4YCH A;  5DG4 A;  4AZM A;  2HMB A;  1HMT A;  2A2G A;  4BVM A;  5LJC A;  3WBG A;  4NYQ A;  3F6Z B;  3B2L A;  3ZUO A;  4ZFX A;  1X8O A;  2QO5 A;  1NGL A;  1ZNL A;  1ERX A;  2LA7 A;  2FT9 A;  3B2H A;  1YP6 A;  2JOZ A;  2QMI A;  1GT3 A;  2CM4 A;  4I3D A;  2A2U A;  1CBR A;  4Y0Q A;  4NNS A;  3D97 A;  1QAB E;  5DPQ A;  4A60 A;  4TKB A;  4LQZ A;  3P6E A;  4AZR A;  1X8P A;  3B2J A;  1RBP A;  3FW5 A;  4U3Q A;  4WBK A;  3U0D A;  3TGB A;  1SA8 A;  2CM9 A;  3APX A;  3NBX X;  5LJE A;  4D6A A;  3FW4 A;  4GZV A;  5AEO A;  1LIF A;  2OVA A;  5H8T A;  2FR3 A;  3SOT A;  1QY1 A;  1T0V A;  4KC7 A;  2GJ5 A;  4HPD A;  3PP6 A;  4O4X A;  3RBY A;  3S5V A;  4O3Y A;  4CK4 A;  1A3Y A;  4ZH9 A;  3FA6 A;  4XMD A;  3O22 A;  1YWD A;  3VE1 A;  3STM X;  1QWD A;  3TGA A;  2AT5 X;  2ASN X;  2F09 A;  1SXY A;  3WVM A;  4MIR A;  3FA9 A;  3I0A A;  5LJH A;  5FFH A;  3S26 A;  1B8E A;  5AQ6 A;  4CSB A;  3ELX A;  2X8T A;  4GNY A;  4QQ1 A;  4CV7 A;  4QZU A;  1LF7 A;  4TKH A;  2AL0 X;  4RUU A;  1DC9 A;  3V8U A;  5K06 A;  4NLJ A;  2ZAI A;  3HWE A;  4QRL A;  4BOE A;  2RA6 A;  2MHD A;  2QM9 A;  3STN A;  4FBR A;  3BRN A;  1JJX A;  4HPB A;  2FRS A;  1ICM A;  2YMS A;  1YIV A;  1I05 A;  1LFO A;  2CZU A;  4EEJ A;  2RN4 A;  4PJ2 A;  1KT6 A;  4QZT A;  4ZR2 A;  4ZJ0 A;  2W2F A;  4ZH6 A;  5HAE A;  2A3F X;  1O8V A;  2AKQ A;  4O3Z A;  4LZV A;  4MVL A;  1SXW A;  3APU A;  3RWX A;  4YFQ A;  1DV9 A;  3FIQ A;  2KTS A;  2AMM X;  1A2D A;  4XMF A;  4FQB B;  2L9C A;  4IB7 A;  4O4S A;  4IB6 A;  4ZHD A;  3ZUI A;  1SMP I;  4OS3 A;  4QNI A;  5L8O A;  3UAQ A;  3ZW1 A;  3IA8 A;  4LKP A;  2ALL X;  3PQU A;  5KHP A;  1E00 A;  1SY3 A;  3G7X A;  3I17 A;  3ZW1 B;  4ORY A;  3DTQ A;  3P02 A;  4ZHF A;  2GTL M;  1S2P A;  4O4O A;  1GX9 A;  1XKI A;  3BY0 A;  1ZNE A;  4GH7 A;  2LB6 A;  3WJE A;  1OBQ A;  5HBS A;  3P24 A;  5AJB A;  2ANS A;  3F8A A;  1JBH A;  1EW3 A;  2X46 A;  4D6B A;  4XMG A;  5EPQ A;  2FR2 A;  2FS7 A;  1X8N A;  3H3I A;  4DQ4 A;  4ID2 A;  1ZNH A;  2ACO A;  3ZZV A;  5CE4 A;  1NP1 A;  1GKA A;  3FYF A;  1HMS A;  5HCC C;  4I9R A;  2XST A;  1FEN A;  1OPB A;  1QQS A;  1B56 A;  3CR6 A;  3PED A;  4XMC A;  3ZW0 B;  1YWA A;  3OBL A;  4R0B A;  5IO7 A;  3E3C A;  1GKA B;  3HWF A;  2CBR A;  4WHI A;  5B27 A;  4QGV A;  1T68 X;  2HZQ A;  3O19 A;  5JR8 A;  3BS2 A;  4OS8 A;  2QO4 A;  5F58 A;  5H9K A;  1TOW A;  2Z4I A;  1LIB A;  2Q4N A;  4ODD A;  4AYH A;  2AT6 X;  2G7B A;  2GTL O;  3NPO A;  4BQU A;  4ALO A;  4YGG A;  2FTB A;  1MDC A;  3FEL A;  1JV4 A;  1EUO A;  1YP7 A;  3JQO A;  3VG3 A;  4IAB A;  2BLG A;  1QFV A;  1NP4 A;  4KT5 A;  3VE2 A;  3APV A;  5B29 A;  1A57 A;  1KT5 A;  1FEL A;  3NX2 A;  1VPR A;  3C76 X;  4ES7 A;  4OMW A;  4KCA A;  1VYG A;  2NP1 A;  2MJI A;  3PH6 A;  3FEN A;  2KTD A;  2W2A A;  2JW1 A;  3HOE A;  3UEV A;  3RKG A;  4AZO A;  1Y9T A;  3L4R A;  2A0A A;  1JJJ A;  3CWK A;  3CQN A;  2O62 A;  1SXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...