4HPAA

Crystal structure of nitrophorin 4 from rhodnius prolixus complexed with sulfide ion at ph 7.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Complexes of ferriheme nitrophorin 4 with low-molecular weight thiol(ate)s occurring in blood plasma
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 51
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4hpaA00
1SXWA 2XSTA 1DFVA 5HZ9A 1HN2A 1ICMA 5HWZA 1TOUA 4YBPA 3EMMA 3FW4A 3TF6A 3CBCA 4IMOA 4AZMA 4QGXA 1OEJA 5HA0A 4GH7A 2LBVA 4N7CA 1AQBA 2CM4A 4ES7A 1CBQA 2GTFX 3WXQA 4AYHA 1SY2A 3D96A 3WJFA 2JU7A 4OMWA 1D2UA 4NYRA 3TGBA 4UU3A 4D6AA 2AT5X 3O19A 3B2KA 1OPBA 1YP6A 1GT4A 5HTEA 5BVQA 3BU1A 2MO5A 1IKJA 1U17A 3U03A 1PM1X 3UEXA 2MM3A 1X71A 3STNA 1YWAA 1B8EA 3HWDA 2RQ0A 5FFHA 2JN3A 4NNSA 5FENA 4KIIA 1KT3A 3FEKA 3P6HA 3APUA 3FR2A 2WQAE 2A13A 5HA1A 5HCEC 3HWFA 4YKOA 4LZUA 3IFBA 4RUNA 1KQXA 2RA6A 3PH6A 1LKEA 4ZH6A 5HTDA 1EW3A 4Y0RA 1LPJA 2LFOA 5LJHA 4YDAA 3CWKA 2AH7X 2Q4NA 3VG4A 1YUPA 4ZHGA 4CK4A 4EDEA 1KT5A 1FTPA 2L9CA 3FR4A 1OBQA 3D95A 5LJBA 3QKGA 1I04A 1O1UA 2QO6A 2WEWA 1SY3A 2AT3X 1HBPA 1YWDA 2R56A 3BSZE 1X8QA 1DV9A 1GX9A 5IO5A 3EBWA 1BSYA 2FR2A 1ALBA 1LNMA 5IO6A 2RCTA 1TW4A 3FA9A 4BQUA 1SXUA 4MVIA 4A60A 5K06A 4AZOA 1IFBA 3P6DA 1G5WA 1HMSA 3NQ9A 4HPBA 3BY0A 1SXYA 4XMDA 4ZHFA 1JJXA 1IKEA 3RSWA 3ZUOA 4I9SA 3KQ0A 3B2HA 4AW8A 4OS8A 5H9NA 1QY0A 3VG5A 4ZGUA 4WBKA 4XMGA 3UEVA 1A18A 1G85A 2CM9A 2E4JA 3PEDA 1H91A 1HQPA 3P6GA 2WWPA 4QYNA 2O62A 4IMNA 1EIOA 2QO5A 3Q6LA 2OVEA 1KZXA 1BBPA 3WBGA 3FA6A 2QM9A 1B4MA 1HMTA 1N0SA 2OFMX 3KFGA 3STMX 3NX1A 4ZR2A 1UREA 2A3FX 2R74A 4XMFA 4XMEA 1DZPA 1I05A 1KGLA 1A2DA 1XCAA 5H8TA 1I06A 2Q39A 1DF3A 1B0OA 1EIIA 4Y0PA 3NR3A 3FIQA 3FENA 4LKTA 1QY1A 4IAWA 3C77X 2F73A 5D8JA 2WR6A 4MVLA 4YFRA 4A1HA 3APVA 1IFCA 1BSQA 1NP1A 2FT9A 4DQ4A 3UEUA 4ORYA 1A57A 2WEXA 1MVGA 2FR3A 4ALOA 3TGAA 3ELZA 5KHPA 3BLGA 4GKCA 1S7DA 1QFTA 2QO4A 1ZNEA 5HCCC 1FE3A 3OJYC 4ARHA 5F1EA 2EU7X 1EALA 4BOEA 2NP1A 4TKHA 4WFVA 4ORXA 1TVQA 1FEMA 3U9PC 1GXAA 1KT4A 4PSQA 2K23A 2BLGA 4YCEA 4A8ZA 2AKQA 2FLJA 5D47A 3APXA 2OVDA 2LB6A 3F9DA 1ZNDA 1T68X 4M7MA 5LKFA 1PEEA 2AT8X 1GX8A 5L8NA 2CZUA 1BSOA 3TGCA 4O9SA 3KFHA 2DM5A 4Y0SA 1GM6A 1X8OA 4WFUA 1JZUA 4NNTA 4NLIA 3WJCA 3FW5A 2KTDA 1GGLA 4ODDA 1PMPA 2W2BA 3C76X 5HZ6A 5AQ6A 3P6EA 4TQ2A 1E00A 1FENA 1RBPA 4ORWA 1CBRA 3O22A 2QOSC 2WQ9A 3HWEA 4YH0A 1QQSA 1AVGI 3O2YA 3DTQA 5FAZA 3TZSA 1E02A 5D48A 4TKJA 5HBSA 2FTBA 2W2FA 3FR5A 5HZ8A 5HCDC 1FELA 2N93A 1PBOA 3ZUIA 2ACPX 4HPAA 5F7GA 5H9AA 1CRBA 5JR8A 3BS2A 3T1DA 1KOIA 1OBUA 1QY2A 1SY0A 1LIDA 2LBAA 2MJIA 3KFFA 3AKNA 3KZAA 1KXOA 4K19A 4YFQA 4RUUA 2KT4B 3AKMA 1ICNA 3MBTA 1GKAA 2A0AA 4TNNA 1TXLA 4HFOA 1IW2A 3D97A 3WVMA 3BRNA 5EDCA 1AELA 1AB0A 4ZCBA 1G7NA 1X8UA 4LZVA 1ACDA 2Q2PA 4YGGA 3S26A 5C0NA 5D4AA 1CJ5A 3BU9A 1KT7A 4R0BA 4AZQA 3P6CA 5DPQA 2AL0X 3JSQA 3K3LA 3EM0A 2Q9SA 3P6FA 2OZQA 4YFPA 4ALBA 1QFVA 3JS1A 3FA8A 1X8PA 5LJDA 1T8VA 3B2JA 3BX7A 3FA7A 3SAOA 5L8OA 1O1VA 1ZNHA 4ORRA 1MUPA 3B2IA 1KQWA 1EPAA 4YBUA 1E06A 1DC9A 3BDRA 4IB7A 4ZJ0A 1BEBA 2NNQA 1SA8A 4OS3A 4MVKA 1JV4A 1EXSA 1P6PA 4QGWA 1CBIA 3HWGA 3CQRA 2CBRA 1MDCA 5IO7A 1QG5A 1YWCA 3U0DA 3VG7A 5LKEA 1DZJA 5LJEA 5EPQA 5DG4A 2XKLA 4IB6A 1JJJA 4NLJA 4N7DA 5HZ5A 2JU8A 1ML7A 4DQ3A 3CQNA 3NADA 4IB9A 3CR6A 1I4UA 3L4RA 4YCHA 2HNXA 3PECA 5F6ZA 1VYFA 5F58A 1SXXA 3FEPA 1LIFA 5F6BA 4Y0QA 2ANSA 2FWVA 2JU3A 4D6BA 1E5PA 4EEJA 1BLRA 1T0VA 2W2AA 3DSZA 5CE4A 5H9LA 2OVAA 1VPRA 3WJDA 2HZRA 1KZWA 3PH5A 5EZ2A 1BRPA 1B56A 4ZH9A 1FDQA 2NNDA 2FRSA 3FELA 1OPAA 2L5PA 2NNEA 4I3DA 5D45A 3PPTA 3FMZA 2AMMX 1MX7A 1EQDA 2R73A 3ELXA 2G78A 5HZQA 4ZFXA 5B29A 1ERXA 1YP7A 1O8VA 4YKMA 1S44A 3I0AA 4EXZA 1KT6A 1NP4A 1GT1A 4NP1A 2JOZA 3APWA 5BVTA 2POAA 2AT6X 4YGZA 1MX8A 4AZPA 5LJKA 1X89A 2ALLX 1X8NA 2WUTA 3GAQA 3MVFA 4QAEA 1Z24A 1DZMA 4QYPA 1LFOA 2GJ5A 4XMHA 1YIVA 2A2GA 2RD7C 4AZNA 1ZRYA 4TLJA 3CBSA 3NQ3A 2G7BA 4I9RA 2X45A 1OBPA 2YG2A 4ORUA 2FS6A 1VYGA 5BVSA 3VG2A 2G79A 1RLBE 1NGLA 5H9KA 4OS0A 4QGVA 3EBKA 2K62A 4ZHCA 4ZHDA 3C78X 4UU2A 1UZ2X 4M6SA 4NYQA 4XMCA 2P8GA 1L6MA 1SY1A 4GE1A 2HLVA 4YDBA 3B2LA 4A1YA 4GRJA 1LIBA 2ACOA 1OEEA 1IIUA 4IB8A 1ZNLA 1LF7A 1S2PA 1YWBA 2L67A 3PP6A 4QZUA 2AT0X 5L8IA 2Q2MA 1R0UA 1TOWA 4OMXA 1LIEA 3NP1A 1BJ7A 5EEDA 2IFBA 1G74A 1CBSA 3VG6A 1LICA 1JYDA 1DZKA 3F8AA 3CMPA 3IA8A 3G7XA 3UEWA 2L68A 3WJBA 4YMYA 1HBQA 4TKBA 1A3YA 2CZTA 3NPOA 2GC9A 4ZHHA 4IAXA 1D3SA 3VG3A 4I3BA 3ZQ3A 2PY1A 1QWDA 3NX2A 1ZNGA 3HK1A 1U18A 3BX8A 5B27A 1BRQA 2HZQA 4I3CA 4HPDA 1JYJA 3STKA 2RCQA 1GKAB 3WJGA 1OEKA 3EYCA 4GNYA 5HAEA 1GT5A 4AZRA 4QZTA 2OFRX 3I17A 1GT3A 4BVMA 5LJCA 4LKPA 2FS7A 5LJGA 1BM5A 3KFIA 2X46A 4GNWA 2HYSA 1U0XA 2A2UA 4EFGA 3RZYA 1ERBA 4HPCA 3FLLA 5EDBA 5EEEA 5KIDA 2HMBA 5KICA 1EPBA 2ASNX 2WSJA 4TJZA 4YGHA 3WJEA 1EUOA 1ADLA 1ZNKA 4IBAA 2LKKA 1XKIA 4GETA 1HMRA 4ORSA 1BWYA 1QABE 2CBSA 1JBHA
chains in the Genus database with same CATH superfamily
1SXWA 2XSTA 1DFVA 5HZ9A 4ZGFA 1HN2A 2RTJA 2JGSA 1ICMA 5HWZA 1TOUA 4YBPA 3EMMA 3FW4A 5FQ8E 3RDMA 2MF6A 3TF6A 3CBCA 4IMOA 4KT5A 4AZMA 4QGXA 1OEJA 5HA0A 4GH7A 3EW2A 2LBVA 2X56A 4N7CA 1AQBA 2CM4A 4ES7A 1CBQA 5F2BA 2GTFX 5AJCA 1W6FA 3WXQA 4AYHA 1SY2A 3D96A 3WJFA 2JU7A 4OMWA 1D2UA 4NYRA 5FQ6E 3TGBA 3FDCA 4UU3A 4FGIB 4D6AA 2AT5X 3O19A 3B2KA 2HKDA 1JMXA 4NW4A 1OPBA 2OF8A 1YP6A 1GT4A 5FQ7E 2IZIA 5HTEA 4Z2PA 5CHKA 5BVQA 3BU1A 3ZW0A 2MO5A 1IKJA 1U17A 3U03A 1PM1X 1E2TA 1RSUB 3UEXA 2MM3A 1X71A 3STNA 1YWAA 1LDQA 1B8EA 1STPA 2RQ0A 3HWDA 5FFHA 2JN3A 4NNSA 5FENA 4KIIA 2ZAIA 2GTLO 4U46A 1KT3A 3FEKA 3P6HA 1SWRA 3APUA 1UYOX 3FR2A 3WZNA 2BSZA 2WQAE 2A13A 5HA1A 2IZEB 5HCEC 3HWFA 4YKOA 3U0DA 4LZUA 3IFBA 4LQZA 1KQXA 4RUNA 2RA6A 3PH6A 1LKEA 4ZH6A 5HTDA 1EW3A 2IZDB 2VFBA 1VWPB 4Y0RA 1LPJA 2RTIB 2LFOA 3EW1A 3VPJE 5LJHA 1VWDB 3VU1A 4BX7A 4YDAA 3CWKA 2AH7X 2JW1A 2Q4NA 3VG4A 1YUPA 1MEPA 3VHIA 3V8UA 3WYQA 4CK4A 4ZHGA 4EDEA 4FBVA 1KT5A 4O3WA 1FTPA 3ZW0B 2L9CA 3FR4A 1OBQA 2IZJA 3D95A 5LJBA 1IJ8A 3QKGA 1I04A 5AEOA 4CDCA 1O1UA 4OEMA 2QO6A 2PI3O 1SY3A 2AT3X 1HBPA 1YWDA 2LA7A 2R56A 2WEWA 3BSZE 1X8QA 4QRLA 1SMPI 1VWMB 1GX9A 1KFFA 1DV9A 5IO5A 3EBWA 1BSYA 4U8UM 2FR2A 1ALBA 1SLFB 3PDFA 1LNMA 2RTRB 5IO6A 2RCTA 1TW4A 4EKVA 4Z6JA 1FJ1E 3RE5A 3FA9A 4BQUA 1SXUA 2RTCB 4MVIA 2X34A 5B11O 3NQKA 4U9CA 4A60A 4BCSA 5K06A 4AZOA 1IFBA 1VWAB 3RDXA 2Z4HA 3P6DA 1G5WA 2QCBA 1HMSA 3FIDA 2KW1A 3NQ9A 4GJVA 4DCBA 4HPBA 3BY0A 1SXYA 4XMDA 1NBXA 2C1SA 4ZHFA 1JJXA 3T6FA 1IKEA 3RSWA 3ZUOA 4I9SA 1W4TA 3B2HA 2RN4A 3D9WA 3KQ0A 4JNJA 4OS8A 5H9NA 4AW8A 2DJGA 1QY0A 3VG5A 4ZGUA 4WBKA 4XMGA 3UEVA 1A18A 1G85A 2CM9A 2E4JA 4MIRA 3PEDA 4PJ2A 1H91A 1HQPA 3P6GA 1NDJA 2WWPA 3T2XA 4GDAA 3AEHA 5IRUA 1VWCB 4QYNA 2O62A 4IMNA 4KH8A 1EIOA 2QO5A 3Q6LA 4BBOA 2OVEA 3P24A 4CPIA 1KZXA 1BBPA 4ON1A 3WBGA 4O3ZA 3FA6A 2QM9A 1B4MA 1HMTA 1N0SA 2VDFA 2OFMX 3KFGA 3STMX 3NX1A 1SLEB 4ZR2A 1UREA 2A3FX 2R74A 4XMFA 4XMEA 1DZPA 1I05A 1KGLA 2RTLA 1A2DA 1XCAA 2C1QA 2OVSA 1SWNA 5H8TA 4CV7A 4EQAC 1SWUA 1I06A 2Q39A 4COTA 1KL4A 3F6ZB 1DF3A 1B0OA 1EIIA 4Y0PA 4Z2VA 3NR3A 5B29A 3FIQA 4CPHA 3FENA 2IZHB 4LKTA 3T6LA 1QY1A 4IAWA 1VWEB 3C77X 4KC7A 3H3IA 4FBOA 5B10O 2F73A 4INNA 5D8JA 1VWIB 2QMIA 2WR6A 1Y9TA 2X32A 4MVLA 4FBRA 4A1HA 3APVA 1IFCA 4YFRA 1BSQA 1NP1A 4U8UO 2FT9A 1EI5A 1N9MA 4L1NA 4DQ4A 3UEUA 4GK9A 4ORYA 1A57A 3ZW1A 2WEXA 1MVGA 2FR3A 1SWCA 4ALOA 3TGAA 3ELZA 3SZIA 4YVBA 1RXHA 5KHPA 1JBHA 3ZI8A 3BLGA 4GKCA 2OYBO 1S7DA 1QFTA 2F09A 4OELA 2QO4A 1LCVA 1Y0GA 1ZNEA 5HCCC 1FE3A 3OJYC 4ARHA 5F1EA 2EU7X 1EALA 4O4XA 4CPHB 4BOEA 2NP1A 3PQSA 1Y55X 4TKHA 4WFVA 2G8CO 4ORXA 4GGTA 2Z4IA 4GD9A 1TVQA 1FEMA 4U8UN 3U9PC 1RXJA 1GXAA 3X00A 1KT4A 1SWAA 4PSQA 5CYBA 2K23A 2BLGA 4YCEA 4MISA 2AKQA 2IZGB 4A8ZA 2FLJA 5D47A 3APXA 2OVDA 1SRIA 2LB6A 3F9DA 2OL6O 1ZNDA 1T68X 3GE2A 4M7MA 1KL3A 2AT8X 5LKFA 1PEEA 2MHDA 5AJBA 3VHHA 1GX8A 1MK5A 3OBLA 5L8NA 2CZUA 1BSOA 2F01A 2UYWA 2RTNB 2Y3EA 1VWJB 3TGCA 2FGSA 3SLJA 2BHVA 4GU8A 4O9SA 3KFHA 2DM5A 1SWFA 4O4OA 4Y0SA 1GM6A 1X8OA 4WFUA 1JZUA 4NNTA 4NLIA 3WJCA 2BT9A 4BX6A 2OY1O 4Z28A 3FW5A 2KTDA 4Y59A 1GGLA 3LHNA 4ODDA 2X8FA 1PMPA 2RTKA 1LCWA 2W2BA 1AVEA 3C76X 4CSBA 1N7YA 4Y5DA 5AQ6A 3P6EA 4TQ2A 5HZ6A 1E00A 1JIWI 1FENA 1RBPA 2AVIA 1CBRA 3HOEA 2QOSC 3O22A 4ORWA 2WQ9A 2RTPB 1Y9LA 3HWEA 1QQSA 1AVGI 3O2YA 3DTQA 4WHIA 4YH0A 1HXZA 5FAZA 1E02A 1K3BA 2QOMA 2KTSA 1MOYA 5B3MO 3TZSA 5D48A 3WYPA 1VWQB 4TKJA 3S60A 5HBSA 2FTBA 2W2FA 3FR5A 1SRHA 3RBYA 5HZ8A 1RSTB 4GGZA 3SZHA 1FELA 3VGWA 3RDQA 3ZW2A 2N93A 5HCDC 2I5VO 1W5RA 1PBOA 3ZUIA 2ACPX 2AF5A 1N9YA 4I6SA 2JMBA 3VE2A 4BX7B 4B55A 1SRGA 1NQMA 4HPAA 2IZLB 5F7GA 1K24A 5H9AA 3VE1A 1CRBA 4CDEA 5B5FA 5JR8A 3SLTA 3BS2A 3D4RA 3RY1A 3T1DA 1KOIA 1OBUA 1QY2A 1SY0A 1LIDA 2LBAA 2MJIA 3KFFA 3AKNA 3KZAA 4JO6A 5CSEA 1KXOA 4K19A 3AUMO 5K68A 3HPEA 4YFQA 4RUUA 2KT4B 4O3YA 3AKMA 1ICNA 2RTMA 3MBTA 2MWHA 1GKAA 2A0AA 4TNNA 2A8GA 3CKGA 1TXLA 3P02A 4HFOA 1IW2A 3D97A 3WVMA 4CDFA 3BRNA 1VWRB 5EDCA 4GZVA 1AB0A 1AELA 4ZCBA 1G7NA 1X8UA 4LZVA 1ACDA 2Q2PA 4YGGA 3S26A 5C0NA 5D4AA 4Z2OA 1SRFA 1CJ5A 3BU9A 2ZAGA 1JJUA 1KT7A 3OE3A 4R0BA 4AZQA 4IRWA 3P6CA 5DPQA 4Z27A 2AL0X 3JSQA 3K3LA 3EM0A 2Q9SA 3S5XA 3P6FA 2OZQA 4YFPA 4ALBA 1QFVA 3JS1A 3FA8A 1X8PA 3ZZVA 1OSPO 2ZSCA 2RTEB 2VFCA 5LJDA 1LELA 1STSB 4BX5A 1T8VA 3B2JA 3BX7A 3FA7A 5K67A 3SAOA 3EC5A 5L3YA 1O1VA 1ZNHA 4ORRA 5L8OA 1MUPA 3B2IA 4DNEA 2G5LA 1KQWA 4I60A 4BJ8A 1EPAA 4KCAA 4YBUA 1E06A 1DC9A 2RTQB 3BDRA 4IB7A 4ZJ0A 1BEBA 2NNQA 1SWTA 1SA8A 2RTOB 4MVKA 4OS3A 1JV4A 1EXSA 1P6PA 3RDOA 4QGWA 1I78A 1CBIA 2WPUA 3CQRA 2CBRA 3HWGA 1JMZA 1MDCA 1QG5A 1SWSA 1YWCA 3MG5A 4NV8A 1DZJA 3VG7A 5IO7A 5LJEA 5LKEA 1SLGB 1AVDA 5EPQA 3RY2A 5DG4A 2XKLA 4IB6A 1JJJA 4NLJA 4N7DA 5HZ5A 2JU8A 1ML7A 3RDSA 4DQ3A 3CQNA 2BS5A 1PTSA 2RTFB 3NADA 4GUZA 4IB9A 3CR6A 1I4UA 1UYNX 3L4RA 1Y53X 3KVNA 2YMSA 3SOTA 3SLOA 4YCHA 2HNXA 2IZCB 2X55A 3PECA 1VYFA 5F6ZA 1SXXA 3FEPA 1LIFA 5F6BA 5F58A 4NV7A 3RKGA 1SWQA 4KC8A 5IRAA 4Y0QA 2ANSA 2OFBA 5IRWA 2FWVA 1SWGA 1KL5A 1E5PA 2IZBA 2JU3A 4OKAA 4D6BA 4EEJA 3SZJA 1T0VA 1BLRA 2W2AA 2IZFB 3DSZA 5H9LA 5JD2A 5CE4A 2OY8A 2A5BA 2OVAA 1VPRA 3WJDA 3WZOA 2HZRA 4O49A 3PH5A 5EZ2A 1KZWA 1BRPA 1SWJA 1B56A 3HOLA 1NC9A 4ZH9A 1FDQA 2NNDA 2FRSA 2RTBB 3N91A 3ZW1B 3FELA 1OPAA 4FQBB 2L5PA 3T2WA 2KD2A 2NNEA 1RAVA 4I3DA 5D45A 3PPTA 1JQPA 3FYFA 3FMZA 2AMMX 1MX7A 4MVEA 3WOVA 1EQDA 2R73A 3ELXA 2G78A 5HZQA 3ZWEA 4HWMA 1ERXA 4ZFXA 1YP7A 1O8VA 1SWKA 1STRB 1S44A 3I0AA 4YKMA 3QQ2A 2BC3A 4I95A 4EXZA 1KT6A 1NP4A 1GT1A 4NP1A 3LV4A 4BGFA 2JOZA 2OFAA 3PK2A 5IXGA 2FKJA 2IZAA 1PBYA 3APWA 5BVTA 1LCZA 2POAA 2AT6X 4YGZA 1MX8A 4AZPA 3NBXX 5LJKA 1X89A 2OF9A 2I5ZO 2ALLX 1X8NA 2WUTA 3GAQA 3MVFA 1LUQA 4IABA 1Z24A 4QAEA 1DZMA 2X8TA 4QYPA 1LFOA 2GJ5A 4XMHA 1YIVA 2A2GA 1RXKA 2RD7C 5B5GA 4ID2A 4AZNA 1ZRYA 3Q34A 4TLJA 2DJFA 3CBSA 5B2AO 3NQ3A 2G7BA 4I9RA 2X45A 2Y3FA 1OBPA 2YG2A 4ORUA 3WZPA 1MM9A 2FS6A 1VYGA 2GTLN 5BYPA 5BVSA 3VG2A 4JHQA 2G79A 1RLBE 1NGLA 1SWBA 2C4IA 4OS0A 5H9KA 1SREA 4QGVA 3EBKA 2K62A 3HTYA 4ZHCA 4BX6B 4JGLA 4ZHDA 3C78X 4UU2A 1UZ2X 4M6SA 4U3QA 2A5CA 2OL8O 3CKFA 4GGRA 2P8GA 4NYQA 1GX3A 4XMCA 3RE6A 1SRJA 1L6MA 2FHLA 1SY1A 2RTAA 4GE1A 2HLVA 4YDBA 1HXLA 3B2LA 3E3CA 4A1YA 4GRJA 1LIBA 2ACOA 1OEEA 1IIUA 3WZQA 3LTWA 4IB8A 3VHMA 1ZNLA 1LF7A 1S2PA 1YWBA 2FKGA 2L67A 3PP6A 2AT0X 4L3RA 4QZUA 5L8IA 2Q2MA 2UZ2A 2X4MA 1R0UA 1HQQA 1TOWA 4OMXA 1LIEA 3NP1A 1BJ7A 5EEDA 2IFBA 1G74A 1CBSA 3VG6A 1LICA 1JYDA 1DZKA 3F8AA 3CMPA 3IA8A 3G7XA 1VWKB 4O4UA 3OD9A 4MEEA 3UEWA 4C5PA 1VWOB 2L68A 3WJBA 1VWLB 4YMYA 1HBQA 4TKBA 1A3YA 2GH7A 2CZTA 3MX7A 2GC9A 1VWNB 2BS6A 3NPOA 4ZHHA 1I9HA 1DF8A 4IAXA 1D3SA 3VG3A 1NQNA 4CDDA 3RWXA 1SLDB 1WUBA 4I3BA 3ZQ3A 1N43A 2PY1A 1SWLA 1QWDA 2OY7A 3NX2A 1HY2A 1ZNGA 2GTLM 1N4JA 3HK1A 2FHNX 1VWGB 3UAQA 1VYOA 1U18A 3BX8A 5B27A 1BRQA 3PQUA 4QQ1A 2HZQA 4I3CA 1SWHA 1JYJA 1WBIA 4HPDA 3STKA 4GDZA 2RCQA 1GKAB 3WJGA 1OEKA 3EYCA 4GNYA 5HAEA 1GT5A 4AZRA 4O3XB 2OFRX 4QZTA 3I17A 1SWOA 1GT3A 2M4LA 4BVMA 4GJSA 2IZKA 5LJCA 4LKPA 2X8SA 2FS7A 5LJGA 1BM5A 3KFIA 2X46A 3JQOA 4GNWA 2HYSA 1U0XA 1VWHB 4ML7B 2RTGB 2A2UA 2OY5O 4EFGA 1SWPA 1Y52X 3RZYA 2OL7A 1ERBA 4HPCA 3FLLA 4O4SA 5EDBA 2Y32A 5EEEA 5KIDA 2CAMA 2HMBA 1LDOA 1VWFB 1SWEA 5KICA 3S5VA 1EPBA 2ASNX 2WSJA 4TJZA 4YGHA 1SWDA 3RDUA 4CPFA 3WJEA 1EUOA 1ADLA 1ZNKA 4IBAA 4CPEA 2RTHB 4QNIA 4BX5B 2LKKA 1XKIA 4GETA 1HMRA 4ORSA 1BWYA 1QABE 2CBSA 1VWBB 2RTDB 3MM0A
chains in the Genus database with same CATH topology
1SXWA 2XSTA 1DFVA 5HZ9A 4ZGFA 1HN2A 1ICMA 5HWZA 1TOUA 4YBPA 3EMMA 3FW4A 5FQ8E 3TF6A 3CBCA 4IMOA 4KT5A 4AZMA 4QGXA 1OEJA 5HA0A 4GH7A 2LBVA 4N7CA 1AQBA 2CM4A 4ES7A 1CBQA 2GTFX 5AJCA 3WXQA 4AYHA 1SY2A 3D96A 3WJFA 2JU7A 4OMWA 1D2UA 4NYRA 5FQ6E 3TGBA 4UU3A 4FGIB 4D6AA 2AT5X 3O19A 3B2KA 4NW4A 1OPBA 1YP6A 1GT4A 5FQ7E 5HTEA 5BVQA 3BU1A 3ZW0A 2MO5A 1IKJA 1U17A 3U03A 1PM1X 3UEXA 2MM3A 1X71A 3STNA 1YWAA 1B8EA 3HWDA 2RQ0A 5FFHA 2JN3A 4NNSA 5FENA 4KIIA 2ZAIA 2GTLO 1KT3A 3FEKA 3P6HA 3APUA 3FR2A 2WQAE 2A13A 5HA1A 5HCEC 3HWFA 4YKOA 4LZUA 3IFBA 4LQZA 1KQXA 4RUNA 2RA6A 3PH6A 1LKEA 4ZH6A 5HTDA 1EW3A 4Y0RA 1LPJA 3VPJE 2LFOA 5LJHA 3VU1A 4YDAA 3CWKA 2AH7X 2JW1A 2Q4NA 3VG4A 1YUPA 3V8UA 4ZHGA 4CK4A 4EDEA 4FBVA 1KT5A 4O3WA 1FTPA 3ZW0B 2L9CA 3FR4A 1OBQA 3D95A 5LJBA 3QKGA 1I04A 5AEOA 1O1UA 2QO6A 2WEWA 1SY3A 2AT3X 1HBPA 1YWDA 2LA7A 2R56A 4QRLA 3BSZE 1X8QA 1DV9A 1SMPI 1GX9A 5IO5A 3EBWA 1BSYA 4U8UM 2FR2A 1ALBA 1LNMA 5IO6A 2RCTA 1TW4A 3FA9A 4BQUA 1SXUA 4MVIA 3NQKA 4U9CA 4A60A 5K06A 4AZOA 1IFBA 2Z4HA 3P6DA 1G5WA 1HMSA 2KW1A 3NQ9A 4HPBA 3BY0A 1SXYA 4XMDA 4ZHFA 1JJXA 1IKEA 3RSWA 3ZUOA 4I9SA 3KQ0A 3B2HA 2RN4A 4AW8A 4OS8A 5H9NA 1QY0A 3VG5A 4ZGUA 4WBKA 4XMGA 3UEVA 1A18A 1G85A 2CM9A 2E4JA 4MIRA 3PEDA 4PJ2A 1H91A 1HQPA 3P6GA 2WWPA 4QYNA 2O62A 4IMNA 4KH8A 1EIOA 2QO5A 3Q6LA 2OVEA 3P24A 1KZXA 1BBPA 4ON1A 3WBGA 4O3ZA 3FA6A 2QM9A 1B4MA 1HMTA 1N0SA 2OFMX 3KFGA 3STMX 3NX1A 4ZR2A 1UREA 2A3FX 2R74A 4XMFA 4XMEA 1DZPA 1I05A 1KGLA 1A2DA 1XCAA 2OVSA 5H8TA 4CV7A 4EQAC 1I06A 2Q39A 4COTA 3F6ZB 1DF3A 1B0OA 1EIIA 4Y0PA 3NR3A 3FIQA 3FENA 4LKTA 1QY1A 4IAWA 3C77X 4KC7A 3H3IA 4FBOA 2F73A 4INNA 5D8JA 2QMIA 2WR6A 1Y9TA 4MVLA 4FBRA 4YFRA 4A1HA 3APVA 1IFCA 1BSQA 1NP1A 4U8UO 2FT9A 1EI5A 4L1NA 4DQ4A 3UEUA 4GK9A 4ORYA 1A57A 3ZW1A 2WEXA 1MVGA 2FR3A 4ALOA 3TGAA 3ELZA 5KHPA 3ZI8A 3BLGA 4GKCA 1S7DA 1QFTA 2F09A 2QO4A 1ZNEA 5HCCC 1FE3A 3OJYC 4ARHA 5F1EA 2EU7X 1EALA 4O4XA 4BOEA 2NP1A 3PQSA 4TKHA 4WFVA 4ORXA 4U8UN 2Z4IA 1TVQA 1FEMA 3U9PC 1GXAA 1KT4A 5CYBA 4PSQA 2K23A 2BLGA 4YCEA 4MISA 2AKQA 4A8ZA 2FLJA 5D47A 3APXA 2OVDA 2LB6A 3F9DA 3GE2A 1ZNDA 1T68X 4M7MA 5LKFA 1PEEA 2AT8X 2MHDA 5AJBA 1GX8A 3OBLA 5L8NA 2CZUA 1BSOA 3TGCA 2BHVA 4GU8A 4O9SA 3KFHA 2DM5A 4O4OA 4Y0SA 1GM6A 1X8OA 4WFUA 1JZUA 4NNTA 4NLIA 3WJCA 2BT9A 3FW5A 2KTDA 1GGLA 3LHNA 4ODDA 2X8FA 1PMPA 2W2BA 4CSBA 3C76X 5HZ6A 5AQ6A 3P6EA 4TQ2A 1E00A 1JIWI 1FENA 1RBPA 3HOEA 1CBRA 3O22A 2QOSC 4ORWA 2WQ9A 3HWEA 1Y9LA 4WHIA 1QQSA 1AVGI 3O2YA 3DTQA 4YH0A 5FAZA 3TZSA 1E02A 2KTSA 5D48A 4TKJA 3S60A 5HBSA 2FTBA 2W2FA 3FR5A 3RBYA 5HZ8A 5HCDC 1FELA 3ZW2A 2N93A 1PBOA 3ZUIA 2ACPX 4I6SA 2JMBA 3VE2A 4HPAA 5F7GA 5H9AA 3VE1A 1CRBA 5JR8A 3BS2A 3D4RA 3T1DA 1KOIA 1OBUA 1QY2A 1SY0A 1LIDA 2LBAA 2MJIA 3KFFA 3AKNA 3KZAA 1KXOA 4K19A 4YFQA 4RUUA 2KT4B 4O3YA 3AKMA 1ICNA 3MBTA 2MWHA 1GKAA 2A0AA 4TNNA 1TXLA 3P02A 4HFOA 1IW2A 3D97A 3WVMA 3BRNA 5EDCA 4GZVA 1AB0A 1AELA 4ZCBA 1G7NA 1X8UA 4LZVA 1ACDA 2Q2PA 4YGGA 3S26A 5C0NA 5D4AA 1CJ5A 3BU9A 2ZAGA 1KT7A 3OE3A 4R0BA 4AZQA 3P6CA 5DPQA 2AL0X 3JSQA 3K3LA 3EM0A 2Q9SA 3S5XA 3P6FA 2OZQA 4YFPA 4ALBA 1QFVA 3JS1A 3FA8A 1X8PA 3ZZVA 5LJDA 1T8VA 3B2JA 3BX7A 3FA7A 3SAOA 5L8OA 1O1VA 1ZNHA 4ORRA 1MUPA 3B2IA 1KQWA 1EPAA 4KCAA 4YBUA 1E06A 1DC9A 3BDRA 4IB7A 4ZJ0A 1BEBA 2NNQA 1SA8A 4OS3A 4MVKA 1JV4A 1EXSA 1P6PA 4QGWA 1CBIA 3HWGA 3CQRA 2CBRA 1MDCA 5IO7A 1QG5A 1YWCA 3U0DA 3VG7A 5LKEA 1DZJA 5LJEA 5EPQA 5DG4A 2XKLA 4IB6A 1JJJA 4NLJA 4N7DA 5HZ5A 2JU8A 1ML7A 4DQ3A 3CQNA 2BS5A 3NADA 4IB9A 3CR6A 1I4UA 3L4RA 2YMSA 3SOTA 4YCHA 2HNXA 3PECA 5F6ZA 1VYFA 5F58A 1SXXA 3FEPA 1LIFA 5F6BA 3RKGA 4KC8A 4Y0QA 2ANSA 2FWVA 2JU3A 4D6BA 1E5PA 4EEJA 1BLRA 1T0VA 2W2AA 3DSZA 5CE4A 5H9LA 2OVAA 1VPRA 3WJDA 2HZRA 4O49A 3PH5A 5EZ2A 1KZWA 1BRPA 1B56A 3HOLA 4ZH9A 1FDQA 2NNDA 2FRSA 3N91A 3ZW1B 3FELA 1OPAA 4FQBB 2L5PA 2KD2A 2NNEA 4I3DA 5D45A 3PPTA 3FYFA 3FMZA 2AMMX 1MX7A 4MVEA 3WOVA 1EQDA 2R73A 3ELXA 2G78A 5HZQA 3ZWEA 4HWMA 1ERXA 4ZFXA 1YP7A 1O8VA 5B29A 4YKMA 1S44A 3I0AA 4EXZA 4I95A 1KT6A 1NP4A 1GT1A 4NP1A 3LV4A 2JOZA 3APWA 5BVTA 2POAA 2AT6X 4YGZA 1MX8A 4AZPA 3NBXX 5LJKA 1X89A 2ALLX 1X8NA 2WUTA 3GAQA 3MVFA 4IABA 4QAEA 1Z24A 1DZMA 2X8TA 4QYPA 1LFOA 2GJ5A 4XMHA 1YIVA 2A2GA 2RD7C 4ID2A 4AZNA 1ZRYA 4TLJA 3CBSA 3NQ3A 2G7BA 4I9RA 2X45A 1OBPA 2YG2A 4ORUA 2FS6A 1VYGA 2GTLN 5BYPA 5BVSA 3VG2A 2G79A 1RLBE 1NGLA 5H9KA 4OS0A 4QGVA 3EBKA 2K62A 3HTYA 4ZHCA 4JGLA 4ZHDA 3C78X 4UU2A 1UZ2X 4M6SA 4U3QA 4NYQA 4XMCA 2P8GA 1L6MA 1SY1A 4GE1A 2HLVA 4YDBA 3B2LA 3E3CA 4A1YA 4GRJA 1LIBA 2ACOA 1OEEA 1IIUA 4IB8A 1ZNLA 1LF7A 1S2PA 1YWBA 2L67A 3PP6A 4L3RA 2AT0X 4QZUA 5L8IA 2Q2MA 1R0UA 1TOWA 4OMXA 1LIEA 3NP1A 1BJ7A 5EEDA 2IFBA 1G74A 1CBSA 3VG6A 1LICA 1JYDA 1DZKA 3F8AA 3CMPA 3IA8A 3G7XA 4O4UA 3UEWA 3OD9A 2L68A 3WJBA 4YMYA 1HBQA 4TKBA 1A3YA 2CZTA 3MX7A 2GC9A 3NPOA 2BS6A 4ZHHA 4IAXA 1D3SA 3VG3A 3RWXA 4I3BA 3ZQ3A 2PY1A 1QWDA 3NX2A 1ZNGA 2GTLM 3HK1A 3UAQA 1U18A 3BX8A 5B27A 1BRQA 3PQUA 4QQ1A 2HZQA 4I3CA 4HPDA 1JYJA 3STKA 4GDZA 2RCQA 1GKAB 3WJGA 1OEKA 3EYCA 4GNYA 5HAEA 1GT5A 4AZRA 4O3XB 2OFRX 4QZTA 3I17A 1GT3A 2M4LA 4BVMA 5LJCA 4LKPA 2X8SA 2FS7A 5LJGA 1BM5A 3KFIA 2X46A 3JQOA 4GNWA 2HYSA 1U0XA 4ML7B 2A2UA 4EFGA 3RZYA 1ERBA 4HPCA 3FLLA 4O4SA 5EDBA 5EEEA 5KIDA 2HMBA 5KICA 3S5VA 1EPBA 2ASNX 2WSJA 4TJZA 4YGHA 3WJEA 1EUOA 1ADLA 1ZNKA 4IBAA 4QNIA 2LKKA 1XKIA 4GETA 1HMRA 4ORSA 1BWYA 1QABE 2CBSA 1JBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SXW A;  2XST A;  1DFV A;  5HZ9 A;  1HN2 A;  1ICM A;  5HWZ A;  1TOU A;  4YBP A;  3EMM A;  3FW4 A;  3TF6 A;  3CBC A;  4IMO A;  4AZM A;  4QGX A;  1OEJ A;  5HA0 A;  4GH7 A;  2LBV A;  4N7C A;  1AQB A;  2CM4 A;  4ES7 A;  1CBQ A;  2GTF X;  3WXQ A;  4AYH A;  1SY2 A;  3D96 A;  3WJF A;  2JU7 A;  4OMW A;  1D2U A;  4NYR A;  3TGB A;  4UU3 A;  4D6A A;  2AT5 X;  3O19 A;  3B2K A;  1OPB A;  1YP6 A;  1GT4 A;  5HTE A;  5BVQ A;  3BU1 A;  2MO5 A;  1IKJ A;  1U17 A;  3U03 A;  1PM1 X;  3UEX A;  2MM3 A;  1X71 A;  3STN A;  1YWA A;  1B8E A;  3HWD A;  2RQ0 A;  5FFH A;  2JN3 A;  4NNS A;  5FEN A;  4KII A;  1KT3 A;  3FEK A;  3P6H A;  3APU A;  3FR2 A;  2WQA E;  2A13 A;  5HA1 A;  5HCE C;  3HWF A;  4YKO A;  4LZU A;  3IFB A;  4RUN A;  1KQX A;  2RA6 A;  3PH6 A;  1LKE A;  4ZH6 A;  5HTD A;  1EW3 A;  4Y0R A;  1LPJ A;  2LFO A;  5LJH A;  4YDA A;  3CWK A;  2AH7 X;  2Q4N A;  3VG4 A;  1YUP A;  4ZHG A;  4CK4 A;  4EDE A;  1KT5 A;  1FTP A;  2L9C A;  3FR4 A;  1OBQ A;  3D95 A;  5LJB A;  3QKG A;  1I04 A;  1O1U A;  2QO6 A;  2WEW A;  1SY3 A;  2AT3 X;  1HBP A;  1YWD A;  2R56 A;  3BSZ E;  1X8Q A;  1DV9 A;  1GX9 A;  5IO5 A;  3EBW A;  1BSY A;  2FR2 A;  1ALB A;  1LNM A;  5IO6 A;  2RCT A;  1TW4 A;  3FA9 A;  4BQU A;  1SXU A;  4MVI A;  4A60 A;  5K06 A;  4AZO A;  1IFB A;  3P6D A;  1G5W A;  1HMS A;  3NQ9 A;  4HPB A;  3BY0 A;  1SXY A;  4XMD A;  4ZHF A;  1JJX A;  1IKE A;  3RSW A;  3ZUO A;  4I9S A;  3KQ0 A;  3B2H A;  4AW8 A;  4OS8 A;  5H9N A;  1QY0 A;  3VG5 A;  4ZGU A;  4WBK A;  4XMG A;  3UEV A;  1A18 A;  1G85 A;  2CM9 A;  2E4J A;  3PED A;  1H91 A;  1HQP A;  3P6G A;  2WWP A;  4QYN A;  2O62 A;  4IMN A;  1EIO A;  2QO5 A;  3Q6L A;  2OVE A;  1KZX A;  1BBP A;  3WBG A;  3FA6 A;  2QM9 A;  1B4M A;  1HMT A;  1N0S A;  2OFM X;  3KFG A;  3STM X;  3NX1 A;  4ZR2 A;  1URE A;  2A3F X;  2R74 A;  4XMF A;  4XME A;  1DZP A;  1I05 A;  1KGL A;  1A2D A;  1XCA A;  5H8T A;  1I06 A;  2Q39 A;  1DF3 A;  1B0O A;  1EII A;  4Y0P A;  3NR3 A;  3FIQ A;  3FEN A;  4LKT A;  1QY1 A;  4IAW A;  3C77 X;  2F73 A;  5D8J A;  2WR6 A;  4MVL A;  4YFR A;  4A1H A;  3APV A;  1IFC A;  1BSQ A;  1NP1 A;  2FT9 A;  4DQ4 A;  3UEU A;  4ORY A;  1A57 A;  2WEX A;  1MVG A;  2FR3 A;  4ALO A;  3TGA A;  3ELZ A;  5KHP A;  3BLG A;  4GKC A;  1S7D A;  1QFT A;  2QO4 A;  1ZNE A;  5HCC C;  1FE3 A;  3OJY C;  4ARH A;  5F1E A;  2EU7 X;  1EAL A;  4BOE A;  2NP1 A;  4TKH A;  4WFV A;  4ORX A;  1TVQ A;  1FEM A;  3U9P C;  1GXA A;  1KT4 A;  4PSQ A;  2K23 A;  2BLG A;  4YCE A;  4A8Z A;  2AKQ A;  2FLJ A;  5D47 A;  3APX A;  2OVD A;  2LB6 A;  3F9D A;  1ZND A;  1T68 X;  4M7M A;  5LKF A;  1PEE A;  2AT8 X;  1GX8 A;  5L8N A;  2CZU A;  1BSO A;  3TGC A;  4O9S A;  3KFH A;  2DM5 A;  4Y0S A;  1GM6 A;  1X8O A;  4WFU A;  1JZU A;  4NNT A;  4NLI A;  3WJC A;  3FW5 A;  2KTD A;  1GGL A;  4ODD A;  1PMP A;  2W2B A;  3C76 X;  5HZ6 A;  5AQ6 A;  3P6E A;  4TQ2 A;  1E00 A;  1FEN A;  1RBP A;  4ORW A;  1CBR A;  3O22 A;  2QOS C;  2WQ9 A;  3HWE A;  4YH0 A;  1QQS A;  1AVG I;  3O2Y A;  3DTQ A;  5FAZ A;  3TZS A;  1E02 A;  5D48 A;  4TKJ A;  5HBS A;  2FTB A;  2W2F A;  3FR5 A;  5HZ8 A;  5HCD C;  1FEL A;  2N93 A;  1PBO A;  3ZUI A;  2ACP X;  4HPA A;  5F7G A;  5H9A A;  1CRB A;  5JR8 A;  3BS2 A;  3T1D A;  1KOI A;  1OBU A;  1QY2 A;  1SY0 A;  1LID A;  2LBA A;  2MJI A;  3KFF A;  3AKN A;  3KZA A;  1KXO A;  4K19 A;  4YFQ A;  4RUU A;  2KT4 B;  3AKM A;  1ICN A;  3MBT A;  1GKA A;  2A0A A;  4TNN A;  1TXL A;  4HFO A;  1IW2 A;  3D97 A;  3WVM A;  3BRN A;  5EDC A;  1AEL A;  1AB0 A;  4ZCB A;  1G7N A;  1X8U A;  4LZV A;  1ACD A;  2Q2P A;  4YGG A;  3S26 A;  5C0N A;  5D4A A;  1CJ5 A;  3BU9 A;  1KT7 A;  4R0B A;  4AZQ A;  3P6C A;  5DPQ A;  2AL0 X;  3JSQ A;  3K3L A;  3EM0 A;  2Q9S A;  3P6F A;  2OZQ A;  4YFP A;  4ALB A;  1QFV A;  3JS1 A;  3FA8 A;  1X8P A;  5LJD A;  1T8V A;  3B2J A;  3BX7 A;  3FA7 A;  3SAO A;  5L8O A;  1O1V A;  1ZNH A;  4ORR A;  1MUP A;  3B2I A;  1KQW A;  1EPA A;  4YBU A;  1E06 A;  1DC9 A;  3BDR A;  4IB7 A;  4ZJ0 A;  1BEB A;  2NNQ A;  1SA8 A;  4OS3 A;  4MVK A;  1JV4 A;  1EXS A;  1P6P A;  4QGW A;  1CBI A;  3HWG A;  3CQR A;  2CBR A;  1MDC A;  5IO7 A;  1QG5 A;  1YWC A;  3U0D A;  3VG7 A;  5LKE A;  1DZJ A;  5LJE A;  5EPQ A;  5DG4 A;  2XKL A;  4IB6 A;  1JJJ A;  4NLJ A;  4N7D A;  5HZ5 A;  2JU8 A;  1ML7 A;  4DQ3 A;  3CQN A;  3NAD A;  4IB9 A;  3CR6 A;  1I4U A;  3L4R A;  4YCH A;  2HNX A;  3PEC A;  5F6Z A;  1VYF A;  5F58 A;  1SXX A;  3FEP A;  1LIF A;  5F6B A;  4Y0Q A;  2ANS A;  2FWV A;  2JU3 A;  4D6B A;  1E5P A;  4EEJ A;  1BLR A;  1T0V A;  2W2A A;  3DSZ A;  5CE4 A;  5H9L A;  2OVA A;  1VPR A;  3WJD A;  2HZR A;  1KZW A;  3PH5 A;  5EZ2 A;  1BRP A;  1B56 A;  4ZH9 A;  1FDQ A;  2NND A;  2FRS A;  3FEL A;  1OPA A;  2L5P A;  2NNE A;  4I3D A;  5D45 A;  3PPT A;  3FMZ A;  2AMM X;  1MX7 A;  1EQD A;  2R73 A;  3ELX A;  2G78 A;  5HZQ A;  4ZFX A;  5B29 A;  1ERX A;  1YP7 A;  1O8V A;  4YKM A;  1S44 A;  3I0A A;  4EXZ A;  1KT6 A;  1NP4 A;  1GT1 A;  4NP1 A;  2JOZ A;  3APW A;  5BVT A;  2POA A;  2AT6 X;  4YGZ A;  1MX8 A;  4AZP A;  5LJK A;  1X89 A;  2ALL X;  1X8N A;  2WUT A;  3GAQ A;  3MVF A;  4QAE A;  1Z24 A;  1DZM A;  4QYP A;  1LFO A;  2GJ5 A;  4XMH A;  1YIV A;  2A2G A;  2RD7 C;  4AZN A;  1ZRY A;  4TLJ A;  3CBS A;  3NQ3 A;  2G7B A;  4I9R A;  2X45 A;  1OBP A;  2YG2 A;  4ORU A;  2FS6 A;  1VYG A;  5BVS A;  3VG2 A;  2G79 A;  1RLB E;  1NGL A;  5H9K A;  4OS0 A;  4QGV A;  3EBK A;  2K62 A;  4ZHC A;  4ZHD A;  3C78 X;  4UU2 A;  1UZ2 X;  4M6S A;  4NYQ A;  4XMC A;  2P8G A;  1L6M A;  1SY1 A;  4GE1 A;  2HLV A;  4YDB A;  3B2L A;  4A1Y A;  4GRJ A;  1LIB A;  2ACO A;  1OEE A;  1IIU A;  4IB8 A;  1ZNL A;  1LF7 A;  1S2P A;  1YWB A;  2L67 A;  3PP6 A;  4QZU A;  2AT0 X;  5L8I A;  2Q2M A;  1R0U A;  1TOW A;  4OMX A;  1LIE A;  3NP1 A;  1BJ7 A;  5EED A;  2IFB A;  1G74 A;  1CBS A;  3VG6 A;  1LIC A;  1JYD A;  1DZK A;  3F8A A;  3CMP A;  3IA8 A;  3G7X A;  3UEW A;  2L68 A;  3WJB A;  4YMY A;  1HBQ A;  4TKB A;  1A3Y A;  2CZT A;  3NPO A;  2GC9 A;  4ZHH A;  4IAX A;  1D3S A;  3VG3 A;  4I3B A;  3ZQ3 A;  2PY1 A;  1QWD A;  3NX2 A;  1ZNG A;  3HK1 A;  1U18 A;  3BX8 A;  5B27 A;  1BRQ A;  2HZQ A;  4I3C A;  4HPD A;  1JYJ A;  3STK A;  2RCQ A;  1GKA B;  3WJG A;  1OEK A;  3EYC A;  4GNY A;  5HAE A;  1GT5 A;  4AZR A;  4QZT A;  2OFR X;  3I17 A;  1GT3 A;  4BVM A;  5LJC A;  4LKP A;  2FS7 A;  5LJG A;  1BM5 A;  3KFI A;  2X46 A;  4GNW A;  2HYS A;  1U0X A;  2A2U A;  4EFG A;  3RZY A;  1ERB A;  4HPC A;  3FLL A;  5EDB A;  5EEE A;  5KID A;  2HMB A;  5KIC A;  1EPB A;  2ASN X;  2WSJ A;  4TJZ A;  4YGH A;  3WJE A;  1EUO A;  1ADL A;  1ZNK A;  4IBA A;  2LKK A;  1XKI A;  4GET A;  1HMR A;  4ORS A;  1BWY A;  1QAB E;  2CBS A;  1JBH A; 
#chains in the Genus database with same CATH topology
 1SXW A;  2XST A;  1DFV A;  5HZ9 A;  4ZGF A;  1HN2 A;  2RTJ A;  2JGS A;  1ICM A;  5HWZ A;  1TOU A;  4YBP A;  3EMM A;  3FW4 A;  5FQ8 E;  3RDM A;  2MF6 A;  3TF6 A;  3CBC A;  4IMO A;  4KT5 A;  4AZM A;  4QGX A;  1OEJ A;  5HA0 A;  4GH7 A;  3EW2 A;  2LBV A;  2X56 A;  4N7C A;  1AQB A;  2CM4 A;  4ES7 A;  1CBQ A;  5F2B A;  2GTF X;  5AJC A;  1W6F A;  3WXQ A;  4AYH A;  1SY2 A;  3D96 A;  3WJF A;  2JU7 A;  4OMW A;  1D2U A;  4NYR A;  5FQ6 E;  3TGB A;  3FDC A;  4UU3 A;  4FGI B;  4D6A A;  2AT5 X;  3O19 A;  3B2K A;  2HKD A;  1JMX A;  4NW4 A;  1OPB A;  2OF8 A;  1YP6 A;  1GT4 A;  5FQ7 E;  2IZI A;  5HTE A;  4Z2P A;  5CHK A;  5BVQ A;  3BU1 A;  3ZW0 A;  2MO5 A;  1IKJ A;  1U17 A;  3U03 A;  1PM1 X;  1E2T A;  1RSU B;  3UEX A;  2MM3 A;  1X71 A;  3STN A;  1YWA A;  1LDQ A;  1B8E A;  1STP A;  2RQ0 A;  3HWD A;  5FFH A;  2JN3 A;  4NNS A;  5FEN A;  4KII A;  2ZAI A;  2GTL O;  4U46 A;  1KT3 A;  3FEK A;  3P6H A;  1SWR A;  3APU A;  1UYO X;  3FR2 A;  3WZN A;  2BSZ A;  2WQA E;  2A13 A;  5HA1 A;  2IZE B;  5HCE C;  3HWF A;  4YKO A;  3U0D A;  4LZU A;  3IFB A;  4LQZ A;  1KQX A;  4RUN A;  2RA6 A;  3PH6 A;  1LKE A;  4ZH6 A;  5HTD A;  1EW3 A;  2IZD B;  2VFB A;  1VWP B;  4Y0R A;  1LPJ A;  2RTI B;  2LFO A;  3EW1 A;  3VPJ E;  5LJH A;  1VWD B;  3VU1 A;  4BX7 A;  4YDA A;  3CWK A;  2AH7 X;  2JW1 A;  2Q4N A;  3VG4 A;  1YUP A;  1MEP A;  3VHI A;  3V8U A;  3WYQ A;  4CK4 A;  4ZHG A;  4EDE A;  4FBV A;  1KT5 A;  4O3W A;  1FTP A;  3ZW0 B;  2L9C A;  3FR4 A;  1OBQ A;  2IZJ A;  3D95 A;  5LJB A;  1IJ8 A;  3QKG A;  1I04 A;  5AEO A;  4CDC A;  1O1U A;  4OEM A;  2QO6 A;  2PI3 O;  1SY3 A;  2AT3 X;  1HBP A;  1YWD A;  2LA7 A;  2R56 A;  2WEW A;  3BSZ E;  1X8Q A;  4QRL A;  1SMP I;  1VWM B;  1GX9 A;  1KFF A;  1DV9 A;  5IO5 A;  3EBW A;  1BSY A;  4U8U M;  2FR2 A;  1ALB A;  1SLF B;  3PDF A;  1LNM A;  2RTR B;  5IO6 A;  2RCT A;  1TW4 A;  4EKV A;  4Z6J A;  1FJ1 E;  3RE5 A;  3FA9 A;  4BQU A;  1SXU A;  2RTC B;  4MVI A;  2X34 A;  5B11 O;  3NQK A;  4U9C A;  4A60 A;  4BCS A;  5K06 A;  4AZO A;  1IFB A;  1VWA B;  3RDX A;  2Z4H A;  3P6D A;  1G5W A;  2QCB A;  1HMS A;  3FID A;  2KW1 A;  3NQ9 A;  4GJV A;  4DCB A;  4HPB A;  3BY0 A;  1SXY A;  4XMD A;  1NBX A;  2C1S A;  4ZHF A;  1JJX A;  3T6F A;  1IKE A;  3RSW A;  3ZUO A;  4I9S A;  1W4T A;  3B2H A;  2RN4 A;  3D9W A;  3KQ0 A;  4JNJ A;  4OS8 A;  5H9N A;  4AW8 A;  2DJG A;  1QY0 A;  3VG5 A;  4ZGU A;  4WBK A;  4XMG A;  3UEV A;  1A18 A;  1G85 A;  2CM9 A;  2E4J A;  4MIR A;  3PED A;  4PJ2 A;  1H91 A;  1HQP A;  3P6G A;  1NDJ A;  2WWP A;  3T2X A;  4GDA A;  3AEH A;  5IRU A;  1VWC B;  4QYN A;  2O62 A;  4IMN A;  4KH8 A;  1EIO A;  2QO5 A;  3Q6L A;  4BBO A;  2OVE A;  3P24 A;  4CPI A;  1KZX A;  1BBP A;  4ON1 A;  3WBG A;  4O3Z A;  3FA6 A;  2QM9 A;  1B4M A;  1HMT A;  1N0S A;  2VDF A;  2OFM X;  3KFG A;  3STM X;  3NX1 A;  1SLE B;  4ZR2 A;  1URE A;  2A3F X;  2R74 A;  4XMF A;  4XME A;  1DZP A;  1I05 A;  1KGL A;  2RTL A;  1A2D A;  1XCA A;  2C1Q A;  2OVS A;  1SWN A;  5H8T A;  4CV7 A;  4EQA C;  1SWU A;  1I06 A;  2Q39 A;  4COT A;  1KL4 A;  3F6Z B;  1DF3 A;  1B0O A;  1EII A;  4Y0P A;  4Z2V A;  3NR3 A;  5B29 A;  3FIQ A;  4CPH A;  3FEN A;  2IZH B;  4LKT A;  3T6L A;  1QY1 A;  4IAW A;  1VWE B;  3C77 X;  4KC7 A;  3H3I A;  4FBO A;  5B10 O;  2F73 A;  4INN A;  5D8J A;  1VWI B;  2QMI A;  2WR6 A;  1Y9T A;  2X32 A;  4MVL A;  4FBR A;  4A1H A;  3APV A;  1IFC A;  4YFR A;  1BSQ A;  1NP1 A;  4U8U O;  2FT9 A;  1EI5 A;  1N9M A;  4L1N A;  4DQ4 A;  3UEU A;  4GK9 A;  4ORY A;  1A57 A;  3ZW1 A;  2WEX A;  1MVG A;  2FR3 A;  1SWC A;  4ALO A;  3TGA A;  3ELZ A;  3SZI A;  4YVB A;  1RXH A;  5KHP A;  1JBH A;  3ZI8 A;  3BLG A;  4GKC A;  2OYB O;  1S7D A;  1QFT A;  2F09 A;  4OEL A;  2QO4 A;  1LCV A;  1Y0G A;  1ZNE A;  5HCC C;  1FE3 A;  3OJY C;  4ARH A;  5F1E A;  2EU7 X;  1EAL A;  4O4X A;  4CPH B;  4BOE A;  2NP1 A;  3PQS A;  1Y55 X;  4TKH A;  4WFV A;  2G8C O;  4ORX A;  4GGT A;  2Z4I A;  4GD9 A;  1TVQ A;  1FEM A;  4U8U N;  3U9P C;  1RXJ A;  1GXA A;  3X00 A;  1KT4 A;  1SWA A;  4PSQ A;  5CYB A;  2K23 A;  2BLG A;  4YCE A;  4MIS A;  2AKQ A;  2IZG B;  4A8Z A;  2FLJ A;  5D47 A;  3APX A;  2OVD A;  1SRI A;  2LB6 A;  3F9D A;  2OL6 O;  1ZND A;  1T68 X;  3GE2 A;  4M7M A;  1KL3 A;  2AT8 X;  5LKF A;  1PEE A;  2MHD A;  5AJB A;  3VHH A;  1GX8 A;  1MK5 A;  3OBL A;  5L8N A;  2CZU A;  1BSO A;  2F01 A;  2UYW A;  2RTN B;  2Y3E A;  1VWJ B;  3TGC A;  2FGS A;  3SLJ A;  2BHV A;  4GU8 A;  4O9S A;  3KFH A;  2DM5 A;  1SWF A;  4O4O A;  4Y0S A;  1GM6 A;  1X8O A;  4WFU A;  1JZU A;  4NNT A;  4NLI A;  3WJC A;  2BT9 A;  4BX6 A;  2OY1 O;  4Z28 A;  3FW5 A;  2KTD A;  4Y59 A;  1GGL A;  3LHN A;  4ODD A;  2X8F A;  1PMP A;  2RTK A;  1LCW A;  2W2B A;  1AVE A;  3C76 X;  4CSB A;  1N7Y A;  4Y5D A;  5AQ6 A;  3P6E A;  4TQ2 A;  5HZ6 A;  1E00 A;  1JIW I;  1FEN A;  1RBP A;  2AVI A;  1CBR A;  3HOE A;  2QOS C;  3O22 A;  4ORW A;  2WQ9 A;  2RTP B;  1Y9L A;  3HWE A;  1QQS A;  1AVG I;  3O2Y A;  3DTQ A;  4WHI A;  4YH0 A;  1HXZ A;  5FAZ A;  1E02 A;  1K3B A;  2QOM A;  2KTS A;  1MOY A;  5B3M O;  3TZS A;  5D48 A;  3WYP A;  1VWQ B;  4TKJ A;  3S60 A;  5HBS A;  2FTB A;  2W2F A;  3FR5 A;  1SRH A;  3RBY A;  5HZ8 A;  1RST B;  4GGZ A;  3SZH A;  1FEL A;  3VGW A;  3RDQ A;  3ZW2 A;  2N93 A;  5HCD C;  2I5V O;  1W5R A;  1PBO A;  3ZUI A;  2ACP X;  2AF5 A;  1N9Y A;  4I6S A;  2JMB A;  3VE2 A;  4BX7 B;  4B55 A;  1SRG A;  1NQM A;  4HPA A;  2IZL B;  5F7G A;  1K24 A;  5H9A A;  3VE1 A;  1CRB A;  4CDE A;  5B5F A;  5JR8 A;  3SLT A;  3BS2 A;  3D4R A;  3RY1 A;  3T1D A;  1KOI A;  1OBU A;  1QY2 A;  1SY0 A;  1LID A;  2LBA A;  2MJI A;  3KFF A;  3AKN A;  3KZA A;  4JO6 A;  5CSE A;  1KXO A;  4K19 A;  3AUM O;  5K68 A;  3HPE A;  4YFQ A;  4RUU A;  2KT4 B;  4O3Y A;  3AKM A;  1ICN A;  2RTM A;  3MBT A;  2MWH A;  1GKA A;  2A0A A;  4TNN A;  2A8G A;  3CKG A;  1TXL A;  3P02 A;  4HFO A;  1IW2 A;  3D97 A;  3WVM A;  4CDF A;  3BRN A;  1VWR B;  5EDC A;  4GZV A;  1AB0 A;  1AEL A;  4ZCB A;  1G7N A;  1X8U A;  4LZV A;  1ACD A;  2Q2P A;  4YGG A;  3S26 A;  5C0N A;  5D4A A;  4Z2O A;  1SRF A;  1CJ5 A;  3BU9 A;  2ZAG A;  1JJU A;  1KT7 A;  3OE3 A;  4R0B A;  4AZQ A;  4IRW A;  3P6C A;  5DPQ A;  4Z27 A;  2AL0 X;  3JSQ A;  3K3L A;  3EM0 A;  2Q9S A;  3S5X A;  3P6F A;  2OZQ A;  4YFP A;  4ALB A;  1QFV A;  3JS1 A;  3FA8 A;  1X8P A;  3ZZV A;  1OSP O;  2ZSC A;  2RTE B;  2VFC A;  5LJD A;  1LEL A;  1STS B;  4BX5 A;  1T8V A;  3B2J A;  3BX7 A;  3FA7 A;  5K67 A;  3SAO A;  3EC5 A;  5L3Y A;  1O1V A;  1ZNH A;  4ORR A;  5L8O A;  1MUP A;  3B2I A;  4DNE A;  2G5L A;  1KQW A;  4I60 A;  4BJ8 A;  1EPA A;  4KCA A;  4YBU A;  1E06 A;  1DC9 A;  2RTQ B;  3BDR A;  4IB7 A;  4ZJ0 A;  1BEB A;  2NNQ A;  1SWT A;  1SA8 A;  2RTO B;  4MVK A;  4OS3 A;  1JV4 A;  1EXS A;  1P6P A;  3RDO A;  4QGW A;  1I78 A;  1CBI A;  2WPU A;  3CQR A;  2CBR A;  3HWG A;  1JMZ A;  1MDC A;  1QG5 A;  1SWS A;  1YWC A;  3MG5 A;  4NV8 A;  1DZJ A;  3VG7 A;  5IO7 A;  5LJE A;  5LKE A;  1SLG B;  1AVD A;  5EPQ A;  3RY2 A;  5DG4 A;  2XKL A;  4IB6 A;  1JJJ A;  4NLJ A;  4N7D A;  5HZ5 A;  2JU8 A;  1ML7 A;  3RDS A;  4DQ3 A;  3CQN A;  2BS5 A;  1PTS A;  2RTF B;  3NAD A;  4GUZ A;  4IB9 A;  3CR6 A;  1I4U A;  1UYN X;  3L4R A;  1Y53 X;  3KVN A;  2YMS A;  3SOT A;  3SLO A;  4YCH A;  2HNX A;  2IZC B;  2X55 A;  3PEC A;  1VYF A;  5F6Z A;  1SXX A;  3FEP A;  1LIF A;  5F6B A;  5F58 A;  4NV7 A;  3RKG A;  1SWQ A;  4KC8 A;  5IRA A;  4Y0Q A;  2ANS A;  2OFB A;  5IRW A;  2FWV A;  1SWG A;  1KL5 A;  1E5P A;  2IZB A;  2JU3 A;  4OKA A;  4D6B A;  4EEJ A;  3SZJ A;  1T0V A;  1BLR A;  2W2A A;  2IZF B;  3DSZ A;  5H9L A;  5JD2 A;  5CE4 A;  2OY8 A;  2A5B A;  2OVA A;  1VPR A;  3WJD A;  3WZO A;  2HZR A;  4O49 A;  3PH5 A;  5EZ2 A;  1KZW A;  1BRP A;  1SWJ A;  1B56 A;  3HOL A;  1NC9 A;  4ZH9 A;  1FDQ A;  2NND A;  2FRS A;  2RTB B;  3N91 A;  3ZW1 B;  3FEL A;  1OPA A;  4FQB B;  2L5P A;  3T2W A;  2KD2 A;  2NNE A;  1RAV A;  4I3D A;  5D45 A;  3PPT A;  1JQP A;  3FYF A;  3FMZ A;  2AMM X;  1MX7 A;  4MVE A;  3WOV A;  1EQD A;  2R73 A;  3ELX A;  2G78 A;  5HZQ A;  3ZWE A;  4HWM A;  1ERX A;  4ZFX A;  1YP7 A;  1O8V A;  1SWK A;  1STR B;  1S44 A;  3I0A A;  4YKM A;  3QQ2 A;  2BC3 A;  4I95 A;  4EXZ A;  1KT6 A;  1NP4 A;  1GT1 A;  4NP1 A;  3LV4 A;  4BGF A;  2JOZ A;  2OFA A;  3PK2 A;  5IXG A;  2FKJ A;  2IZA A;  1PBY A;  3APW A;  5BVT A;  1LCZ A;  2POA A;  2AT6 X;  4YGZ A;  1MX8 A;  4AZP A;  3NBX X;  5LJK A;  1X89 A;  2OF9 A;  2I5Z O;  2ALL X;  1X8N A;  2WUT A;  3GAQ A;  3MVF A;  1LUQ A;  4IAB A;  1Z24 A;  4QAE A;  1DZM A;  2X8T A;  4QYP A;  1LFO A;  2GJ5 A;  4XMH A;  1YIV A;  2A2G A;  1RXK A;  2RD7 C;  5B5G A;  4ID2 A;  4AZN A;  1ZRY A;  3Q34 A;  4TLJ A;  2DJF A;  3CBS A;  5B2A O;  3NQ3 A;  2G7B A;  4I9R A;  2X45 A;  2Y3F A;  1OBP A;  2YG2 A;  4ORU A;  3WZP A;  1MM9 A;  2FS6 A;  1VYG A;  2GTL N;  5BYP A;  5BVS A;  3VG2 A;  4JHQ A;  2G79 A;  1RLB E;  1NGL A;  1SWB A;  2C4I A;  4OS0 A;  5H9K A;  1SRE A;  4QGV A;  3EBK A;  2K62 A;  3HTY A;  4ZHC A;  4BX6 B;  4JGL A;  4ZHD A;  3C78 X;  4UU2 A;  1UZ2 X;  4M6S A;  4U3Q A;  2A5C A;  2OL8 O;  3CKF A;  4GGR A;  2P8G A;  4NYQ A;  1GX3 A;  4XMC A;  3RE6 A;  1SRJ A;  1L6M A;  2FHL A;  1SY1 A;  2RTA A;  4GE1 A;  2HLV A;  4YDB A;  1HXL A;  3B2L A;  3E3C A;  4A1Y A;  4GRJ A;  1LIB A;  2ACO A;  1OEE A;  1IIU A;  3WZQ A;  3LTW A;  4IB8 A;  3VHM A;  1ZNL A;  1LF7 A;  1S2P A;  1YWB A;  2FKG A;  2L67 A;  3PP6 A;  2AT0 X;  4L3R A;  4QZU A;  5L8I A;  2Q2M A;  2UZ2 A;  2X4M A;  1R0U A;  1HQQ A;  1TOW A;  4OMX A;  1LIE A;  3NP1 A;  1BJ7 A;  5EED A;  2IFB A;  1G74 A;  1CBS A;  3VG6 A;  1LIC A;  1JYD A;  1DZK A;  3F8A A;  3CMP A;  3IA8 A;  3G7X A;  1VWK B;  4O4U A;  3OD9 A;  4MEE A;  3UEW A;  4C5P A;  1VWO B;  2L68 A;  3WJB A;  1VWL B;  4YMY A;  1HBQ A;  4TKB A;  1A3Y A;  2GH7 A;  2CZT A;  3MX7 A;  2GC9 A;  1VWN B;  2BS6 A;  3NPO A;  4ZHH A;  1I9H A;  1DF8 A;  4IAX A;  1D3S A;  3VG3 A;  1NQN A;  4CDD A;  3RWX A;  1SLD B;  1WUB A;  4I3B A;  3ZQ3 A;  1N43 A;  2PY1 A;  1SWL A;  1QWD A;  2OY7 A;  3NX2 A;  1HY2 A;  1ZNG A;  2GTL M;  1N4J A;  3HK1 A;  2FHN X;  1VWG B;  3UAQ A;  1VYO A;  1U18 A;  3BX8 A;  5B27 A;  1BRQ A;  3PQU A;  4QQ1 A;  2HZQ A;  4I3C A;  1SWH A;  1JYJ A;  1WBI A;  4HPD A;  3STK A;  4GDZ A;  2RCQ A;  1GKA B;  3WJG A;  1OEK A;  3EYC A;  4GNY A;  5HAE A;  1GT5 A;  4AZR A;  4O3X B;  2OFR X;  4QZT A;  3I17 A;  1SWO A;  1GT3 A;  2M4L A;  4BVM A;  4GJS A;  2IZK A;  5LJC A;  4LKP A;  2X8S A;  2FS7 A;  5LJG A;  1BM5 A;  3KFI A;  2X46 A;  3JQO A;  4GNW A;  2HYS A;  1U0X A;  1VWH B;  4ML7 B;  2RTG B;  2A2U A;  2OY5 O;  4EFG A;  1SWP A;  1Y52 X;  3RZY A;  2OL7 A;  1ERB A;  4HPC A;  3FLL A;  4O4S A;  5EDB A;  2Y32 A;  5EEE A;  5KID A;  2CAM A;  2HMB A;  1LDO A;  1VWF B;  1SWE A;  5KIC A;  3S5V A;  1EPB A;  2ASN X;  2WSJ A;  4TJZ A;  4YGH A;  1SWD A;  3RDU A;  4CPF A;  3WJE A;  1EUO A;  1ADL A;  1ZNK A;  4IBA A;  4CPE A;  2RTH B;  4QNI A;  4BX5 B;  2LKK A;  1XKI A;  4GET A;  1HMR A;  4ORS A;  1BWY A;  1QAB E;  2CBS A;  1VWB B;  2RTD B;  3MM0 A; 
#chains in the Genus database with same CATH homology
 1SXW A;  2XST A;  1DFV A;  5HZ9 A;  4ZGF A;  1HN2 A;  1ICM A;  5HWZ A;  1TOU A;  4YBP A;  3EMM A;  3FW4 A;  5FQ8 E;  3TF6 A;  3CBC A;  4IMO A;  4KT5 A;  4AZM A;  4QGX A;  1OEJ A;  5HA0 A;  4GH7 A;  2LBV A;  4N7C A;  1AQB A;  2CM4 A;  4ES7 A;  1CBQ A;  2GTF X;  5AJC A;  3WXQ A;  4AYH A;  1SY2 A;  3D96 A;  3WJF A;  2JU7 A;  4OMW A;  1D2U A;  4NYR A;  5FQ6 E;  3TGB A;  4UU3 A;  4FGI B;  4D6A A;  2AT5 X;  3O19 A;  3B2K A;  4NW4 A;  1OPB A;  1YP6 A;  1GT4 A;  5FQ7 E;  5HTE A;  5BVQ A;  3BU1 A;  3ZW0 A;  2MO5 A;  1IKJ A;  1U17 A;  3U03 A;  1PM1 X;  3UEX A;  2MM3 A;  1X71 A;  3STN A;  1YWA A;  1B8E A;  3HWD A;  2RQ0 A;  5FFH A;  2JN3 A;  4NNS A;  5FEN A;  4KII A;  2ZAI A;  2GTL O;  1KT3 A;  3FEK A;  3P6H A;  3APU A;  3FR2 A;  2WQA E;  2A13 A;  5HA1 A;  5HCE C;  3HWF A;  4YKO A;  4LZU A;  3IFB A;  4LQZ A;  1KQX A;  4RUN A;  2RA6 A;  3PH6 A;  1LKE A;  4ZH6 A;  5HTD A;  1EW3 A;  4Y0R A;  1LPJ A;  3VPJ E;  2LFO A;  5LJH A;  3VU1 A;  4YDA A;  3CWK A;  2AH7 X;  2JW1 A;  2Q4N A;  3VG4 A;  1YUP A;  3V8U A;  4ZHG A;  4CK4 A;  4EDE A;  4FBV A;  1KT5 A;  4O3W A;  1FTP A;  3ZW0 B;  2L9C A;  3FR4 A;  1OBQ A;  3D95 A;  5LJB A;  3QKG A;  1I04 A;  5AEO A;  1O1U A;  2QO6 A;  2WEW A;  1SY3 A;  2AT3 X;  1HBP A;  1YWD A;  2LA7 A;  2R56 A;  4QRL A;  3BSZ E;  1X8Q A;  1DV9 A;  1SMP I;  1GX9 A;  5IO5 A;  3EBW A;  1BSY A;  4U8U M;  2FR2 A;  1ALB A;  1LNM A;  5IO6 A;  2RCT A;  1TW4 A;  3FA9 A;  4BQU A;  1SXU A;  4MVI A;  3NQK A;  4U9C A;  4A60 A;  5K06 A;  4AZO A;  1IFB A;  2Z4H A;  3P6D A;  1G5W A;  1HMS A;  2KW1 A;  3NQ9 A;  4HPB A;  3BY0 A;  1SXY A;  4XMD A;  4ZHF A;  1JJX A;  1IKE A;  3RSW A;  3ZUO A;  4I9S A;  3KQ0 A;  3B2H A;  2RN4 A;  4AW8 A;  4OS8 A;  5H9N A;  1QY0 A;  3VG5 A;  4ZGU A;  4WBK A;  4XMG A;  3UEV A;  1A18 A;  1G85 A;  2CM9 A;  2E4J A;  4MIR A;  3PED A;  4PJ2 A;  1H91 A;  1HQP A;  3P6G A;  2WWP A;  4QYN A;  2O62 A;  4IMN A;  4KH8 A;  1EIO A;  2QO5 A;  3Q6L A;  2OVE A;  3P24 A;  1KZX A;  1BBP A;  4ON1 A;  3WBG A;  4O3Z A;  3FA6 A;  2QM9 A;  1B4M A;  1HMT A;  1N0S A;  2OFM X;  3KFG A;  3STM X;  3NX1 A;  4ZR2 A;  1URE A;  2A3F X;  2R74 A;  4XMF A;  4XME A;  1DZP A;  1I05 A;  1KGL A;  1A2D A;  1XCA A;  2OVS A;  5H8T A;  4CV7 A;  4EQA C;  1I06 A;  2Q39 A;  4COT A;  3F6Z B;  1DF3 A;  1B0O A;  1EII A;  4Y0P A;  3NR3 A;  3FIQ A;  3FEN A;  4LKT A;  1QY1 A;  4IAW A;  3C77 X;  4KC7 A;  3H3I A;  4FBO A;  2F73 A;  4INN A;  5D8J A;  2QMI A;  2WR6 A;  1Y9T A;  4MVL A;  4FBR A;  4YFR A;  4A1H A;  3APV A;  1IFC A;  1BSQ A;  1NP1 A;  4U8U O;  2FT9 A;  1EI5 A;  4L1N A;  4DQ4 A;  3UEU A;  4GK9 A;  4ORY A;  1A57 A;  3ZW1 A;  2WEX A;  1MVG A;  2FR3 A;  4ALO A;  3TGA A;  3ELZ A;  5KHP A;  3ZI8 A;  3BLG A;  4GKC A;  1S7D A;  1QFT A;  2F09 A;  2QO4 A;  1ZNE A;  5HCC C;  1FE3 A;  3OJY C;  4ARH A;  5F1E A;  2EU7 X;  1EAL A;  4O4X A;  4BOE A;  2NP1 A;  3PQS A;  4TKH A;  4WFV A;  4ORX A;  4U8U N;  2Z4I A;  1TVQ A;  1FEM A;  3U9P C;  1GXA A;  1KT4 A;  5CYB A;  4PSQ A;  2K23 A;  2BLG A;  4YCE A;  4MIS A;  2AKQ A;  4A8Z A;  2FLJ A;  5D47 A;  3APX A;  2OVD A;  2LB6 A;  3F9D A;  3GE2 A;  1ZND A;  1T68 X;  4M7M A;  5LKF A;  1PEE A;  2AT8 X;  2MHD A;  5AJB A;  1GX8 A;  3OBL A;  5L8N A;  2CZU A;  1BSO A;  3TGC A;  2BHV A;  4GU8 A;  4O9S A;  3KFH A;  2DM5 A;  4O4O A;  4Y0S A;  1GM6 A;  1X8O A;  4WFU A;  1JZU A;  4NNT A;  4NLI A;  3WJC A;  2BT9 A;  3FW5 A;  2KTD A;  1GGL A;  3LHN A;  4ODD A;  2X8F A;  1PMP A;  2W2B A;  4CSB A;  3C76 X;  5HZ6 A;  5AQ6 A;  3P6E A;  4TQ2 A;  1E00 A;  1JIW I;  1FEN A;  1RBP A;  3HOE A;  1CBR A;  3O22 A;  2QOS C;  4ORW A;  2WQ9 A;  3HWE A;  1Y9L A;  4WHI A;  1QQS A;  1AVG I;  3O2Y A;  3DTQ A;  4YH0 A;  5FAZ A;  3TZS A;  1E02 A;  2KTS A;  5D48 A;  4TKJ A;  3S60 A;  5HBS A;  2FTB A;  2W2F A;  3FR5 A;  3RBY A;  5HZ8 A;  5HCD C;  1FEL A;  3ZW2 A;  2N93 A;  1PBO A;  3ZUI A;  2ACP X;  4I6S A;  2JMB A;  3VE2 A;  4HPA A;  5F7G A;  5H9A A;  3VE1 A;  1CRB A;  5JR8 A;  3BS2 A;  3D4R A;  3T1D A;  1KOI A;  1OBU A;  1QY2 A;  1SY0 A;  1LID A;  2LBA A;  2MJI A;  3KFF A;  3AKN A;  3KZA A;  1KXO A;  4K19 A;  4YFQ A;  4RUU A;  2KT4 B;  4O3Y A;  3AKM A;  1ICN A;  3MBT A;  2MWH A;  1GKA A;  2A0A A;  4TNN A;  1TXL A;  3P02 A;  4HFO A;  1IW2 A;  3D97 A;  3WVM A;  3BRN A;  5EDC A;  4GZV A;  1AB0 A;  1AEL A;  4ZCB A;  1G7N A;  1X8U A;  4LZV A;  1ACD A;  2Q2P A;  4YGG A;  3S26 A;  5C0N A;  5D4A A;  1CJ5 A;  3BU9 A;  2ZAG A;  1KT7 A;  3OE3 A;  4R0B A;  4AZQ A;  3P6C A;  5DPQ A;  2AL0 X;  3JSQ A;  3K3L A;  3EM0 A;  2Q9S A;  3S5X A;  3P6F A;  2OZQ A;  4YFP A;  4ALB A;  1QFV A;  3JS1 A;  3FA8 A;  1X8P A;  3ZZV A;  5LJD A;  1T8V A;  3B2J A;  3BX7 A;  3FA7 A;  3SAO A;  5L8O A;  1O1V A;  1ZNH A;  4ORR A;  1MUP A;  3B2I A;  1KQW A;  1EPA A;  4KCA A;  4YBU A;  1E06 A;  1DC9 A;  3BDR A;  4IB7 A;  4ZJ0 A;  1BEB A;  2NNQ A;  1SA8 A;  4OS3 A;  4MVK A;  1JV4 A;  1EXS A;  1P6P A;  4QGW A;  1CBI A;  3HWG A;  3CQR A;  2CBR A;  1MDC A;  5IO7 A;  1QG5 A;  1YWC A;  3U0D A;  3VG7 A;  5LKE A;  1DZJ A;  5LJE A;  5EPQ A;  5DG4 A;  2XKL A;  4IB6 A;  1JJJ A;  4NLJ A;  4N7D A;  5HZ5 A;  2JU8 A;  1ML7 A;  4DQ3 A;  3CQN A;  2BS5 A;  3NAD A;  4IB9 A;  3CR6 A;  1I4U A;  3L4R A;  2YMS A;  3SOT A;  4YCH A;  2HNX A;  3PEC A;  5F6Z A;  1VYF A;  5F58 A;  1SXX A;  3FEP A;  1LIF A;  5F6B A;  3RKG A;  4KC8 A;  4Y0Q A;  2ANS A;  2FWV A;  2JU3 A;  4D6B A;  1E5P A;  4EEJ A;  1BLR A;  1T0V A;  2W2A A;  3DSZ A;  5CE4 A;  5H9L A;  2OVA A;  1VPR A;  3WJD A;  2HZR A;  4O49 A;  3PH5 A;  5EZ2 A;  1KZW A;  1BRP A;  1B56 A;  3HOL A;  4ZH9 A;  1FDQ A;  2NND A;  2FRS A;  3N91 A;  3ZW1 B;  3FEL A;  1OPA A;  4FQB B;  2L5P A;  2KD2 A;  2NNE A;  4I3D A;  5D45 A;  3PPT A;  3FYF A;  3FMZ A;  2AMM X;  1MX7 A;  4MVE A;  3WOV A;  1EQD A;  2R73 A;  3ELX A;  2G78 A;  5HZQ A;  3ZWE A;  4HWM A;  1ERX A;  4ZFX A;  1YP7 A;  1O8V A;  5B29 A;  4YKM A;  1S44 A;  3I0A A;  4EXZ A;  4I95 A;  1KT6 A;  1NP4 A;  1GT1 A;  4NP1 A;  3LV4 A;  2JOZ A;  3APW A;  5BVT A;  2POA A;  2AT6 X;  4YGZ A;  1MX8 A;  4AZP A;  3NBX X;  5LJK A;  1X89 A;  2ALL X;  1X8N A;  2WUT A;  3GAQ A;  3MVF A;  4IAB A;  4QAE A;  1Z24 A;  1DZM A;  2X8T A;  4QYP A;  1LFO A;  2GJ5 A;  4XMH A;  1YIV A;  2A2G A;  2RD7 C;  4ID2 A;  4AZN A;  1ZRY A;  4TLJ A;  3CBS A;  3NQ3 A;  2G7B A;  4I9R A;  2X45 A;  1OBP A;  2YG2 A;  4ORU A;  2FS6 A;  1VYG A;  2GTL N;  5BYP A;  5BVS A;  3VG2 A;  2G79 A;  1RLB E;  1NGL A;  5H9K A;  4OS0 A;  4QGV A;  3EBK A;  2K62 A;  3HTY A;  4ZHC A;  4JGL A;  4ZHD A;  3C78 X;  4UU2 A;  1UZ2 X;  4M6S A;  4U3Q A;  4NYQ A;  4XMC A;  2P8G A;  1L6M A;  1SY1 A;  4GE1 A;  2HLV A;  4YDB A;  3B2L A;  3E3C A;  4A1Y A;  4GRJ A;  1LIB A;  2ACO A;  1OEE A;  1IIU A;  4IB8 A;  1ZNL A;  1LF7 A;  1S2P A;  1YWB A;  2L67 A;  3PP6 A;  4L3R A;  2AT0 X;  4QZU A;  5L8I A;  2Q2M A;  1R0U A;  1TOW A;  4OMX A;  1LIE A;  3NP1 A;  1BJ7 A;  5EED A;  2IFB A;  1G74 A;  1CBS A;  3VG6 A;  1LIC A;  1JYD A;  1DZK A;  3F8A A;  3CMP A;  3IA8 A;  3G7X A;  4O4U A;  3UEW A;  3OD9 A;  2L68 A;  3WJB A;  4YMY A;  1HBQ A;  4TKB A;  1A3Y A;  2CZT A;  3MX7 A;  2GC9 A;  3NPO A;  2BS6 A;  4ZHH A;  4IAX A;  1D3S A;  3VG3 A;  3RWX A;  4I3B A;  3ZQ3 A;  2PY1 A;  1QWD A;  3NX2 A;  1ZNG A;  2GTL M;  3HK1 A;  3UAQ A;  1U18 A;  3BX8 A;  5B27 A;  1BRQ A;  3PQU A;  4QQ1 A;  2HZQ A;  4I3C A;  4HPD A;  1JYJ A;  3STK A;  4GDZ A;  2RCQ A;  1GKA B;  3WJG A;  1OEK A;  3EYC A;  4GNY A;  5HAE A;  1GT5 A;  4AZR A;  4O3X B;  2OFR X;  4QZT A;  3I17 A;  1GT3 A;  2M4L A;  4BVM A;  5LJC A;  4LKP A;  2X8S A;  2FS7 A;  5LJG A;  1BM5 A;  3KFI A;  2X46 A;  3JQO A;  4GNW A;  2HYS A;  1U0X A;  4ML7 B;  2A2U A;  4EFG A;  3RZY A;  1ERB A;  4HPC A;  3FLL A;  4O4S A;  5EDB A;  5EEE A;  5KID A;  2HMB A;  5KIC A;  3S5V A;  1EPB A;  2ASN X;  2WSJ A;  4TJZ A;  4YGH A;  3WJE A;  1EUO A;  1ADL A;  1ZNK A;  4IBA A;  4QNI A;  2LKK A;  1XKI A;  4GET A;  1HMR A;  4ORS A;  1BWY A;  1QAB E;  2CBS A;  1JBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...