4HPOL

Crystal structure of rv144-elicited antibody ch58 in complex with v2 peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords CH58 Fab heavy chain
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoL01
4D0DA 2C1PA 3MOBL 3D25A 5EU7E 4MJ4A 1F58L 3L9RB 3LKNB 5DHVB 2E6PA 3D25B 1GC1L 3WFEH 2ICWA 5JOPE 4JPIB 5GISL 2VLRD 5I75C 3QWOB 3HFML 1RJZA 4PRIE 1MCLA 1D6EA 3KS0H 3FN0H 4X7SH 4EOWH 2IPUK 3WCYA 3TCLA 3PABA 4NT6B 4L8CB 1IARB 3VGEA 3L3OA 3HE7B 4D9RE 5IVXF 4BQCA 3LPFA 3GJFB 3LEVL 2A9NH 3EOTL 4QXGL 4NWTH 1YEHL 4QXUL 2AEQH 3LKPA 1D9KD 2FO1A 3LB6C 4F7EA 5JOFB 4K3EL 2NNAB 5CZKA 3JV4A 3RIFK 1ED3A 3W11C 2G75A 3WLWC 4POZC 3KLHD 3FL7A 1EBAA 3HE6A 1KIUA 4FQ1H 2HJKB 3SJVA 5HDQH 2R2EB 2Z31A 4Y16C 2P8MB 1X4XA 4DKAA 2QKIA 4F3FA 1KGCE 3C08L 1BREA 2JK5A 1V3KA 2DBJA 3O6LH 3OAZK 4OFVA 4MA1C 1IVLA 4JFPB 3NACH 5CWSB 4A6YA 4TNVK 3T0EE 3QA3A 2DD8H 2X4OB 3IU4L 4U7KA 4R0LB 5GRJL 3W2DH 1HSAB 4KUZL 1ZGLM 4JFYA 3MGTA 1KGCD 4R26H 2H6PA 4JFEE 2PO6C 3TYFA 2E27L 3B3IB 3ZT6A 1K3ZA 5C0FB 1LK3L 4NRZA 4XRCA 3L3GB 1E28B 4L4VA 4ELMA 1D6VL 4RAVA 2CIIB 3BD4A 4PRPA 5I19H 4YZFF 2AK4A 3HI6L 3IT8D 2DDQH 3WHE0 1MIEH 2IPTH 5SWSE 1RU9L 3QIWB 3FOMA 1HWGB 4JM4L 4BKLB 1XR9A 4NWUH 5EUOE 4JO4L 3FKUS 5EPMB 5KJRL 4OZFG 4G3YL 1AXIB 3IAQA 2O5ZH 1BOGB 3AMLA 3FT3B 2QADB 5DQ9A 3B5GA 4PJBA 4OCSH 2X4QB 4HCRH 5DJYA 2ITDA 2Y6SC 5D7LD 3ZYOA 1GIGH 3BP6A 4I0PC 3BKJL 1RUQL 5GSRA 5GJSL 5HJ3A 3I9GH 4NHUA 3KPQA 1UADC 2VABA 1UA6L 1OTSD 3VW3L 4PY7A 1XZ0B 4FZ8L 5CEZE 2CUMA 3ARUA 3LOWA 5J6HB 3T0BA 1G7QA 3EFFA 5E99H 4PB9L 3EYUH 3RP1A 1OGAE 3LRSB 1NMBH 2Y5TA 5F9WB 2H6PB 2DQTL 1KCRL 1DR9A 3L7EB 2XZCH 3MJ9L 1R3HA 2VSDA 2NY7L 5D6DA 3CFEA 4NKIH 1F90L 4IJ3B 1I1AB 4P4RB 3WJJC 4PD4K 2GSGB 4P3CL 5A16B 4OBSA 4CADA 1S9XB 5FYJE 4QRRE 1C1EH 5DD5L 3VD3A 4JPVH 4U1HA 4PGZA 3GJFA 1RIUL 4P48A 4G80B 3AXLA 5DJXB 3CU1A 1S7XB 1AGFA 4AT6A 1KF9B 3HCVA 1OM3L 3JTSA 1P84J 1P4LA 3PJSB 3T4AB 2G75B 4PP1C 2BVEA 3EO9L 4PREB 5C07D 3Q6FA 4W6XB 4X4MA 5HGGS 1TJGL 4N0UA 2CLVA 4BELD 5D1XA 1HHHB 5DK2B 3ZT7A 2DWEB 2LV4A 1HH6A 2EDHA 3ROLB 1CU4H 3L1OH 4KK9D 1M7XA 4L8SC 5I2IA 4ZFFB 1TVDA 3QIWC 4GKNB 4YO0A 4MNGE 4WW2A 1FRGL 3WIIL 1ZLVK 4BQ9A 2W9LA 3REWB 5E2JA 3VGFA 5C7XL 3VI3E 1F4YL 8CGTA 1J86A 3GBMH 4JFED 1GPOL 3FFCB 1F6AA 1MCOH 3BUTA 4POUB 5I8OH 1CYGA 4U6HB 2F74B 2XZAL 3PQYB 1IC1A 3P4NB 4TULL 2RHEA 2HLFD 1KJ2A 1CGSL 1Y6MR 1IAOA 4LRNL 2BERA 4NBYB 2HAZA 5T5NG 4M6MH 4LU5L 3P9MB 5DHVH 1Z9SA 4J8RB 4QRUA 4IMLB 5K9JL 3VFNA 4PJ9C 5DRXA 1ZE3C 4JFDB 5IB3B 5E1HB 4DUWA 5E99L 3BRGC 2RCSL 3P4LA 1B0WA 4TSAL 2PTTA 2YPVH 1T04A 3ARVA 5TJWK 1EERB 4NJAH 4APQB 4M1GL 4Q2ZA 2A73A 2XN9B 1FZJB 4NKIL 5JXEA 3O3AB 1QPXA 1N59A 5SWSB 3PL6A 4MGXA 1CD1A 1NDGA 5EBMB 5T1KA 3RHWK 1W8OA 3GFUA 1DQDL 1P53A 5FKAB 1DLFL 2WV3A 3O45A 5F7DB 3ZDZE 3IDXH 3OKYA 5HI5C 1IE5A 1IL1A 4X4YB 4P2RD 1R5IB 3C5ZB 4UDUA 2ADIB 2ZJSL 5CSBA 1YUHB 4J4PD 5FA4A 1NAKL 1U0QA 2WBJC 2OTPA 2Q76A 3NFPA 3QG7H 2CDGB 2IAMA 3C6LD 4QWWD 3VXPA 4XPBL 3P3YA 3L5XL 4NQCA 3WJLC 1U3HA 1IAOB 1QFOA 4XNYH 1T2JA 3OAYH 5DMGC 5MI0B 2R23A 3HMWH 1JHKL 3MV9A 1U3ZA 3PNWA 4XP5L 4G8EB 2J4WH 1UWXH 1N4XH 4PRPB 5IFJA 5CS7A 3LZFH 4HS6B 1F90H 1B0GA 5EOQH 3KHOA 1ZLSL 4Z7UF 3T0WA 3P9LA 1VA9A 1NEZB 1UYWL 4I4WB 1HHIB 3TJEH 4CN1A 5FYJH 5FM8A 5E5MA 3TYGL 5DI8A 5SWSD 2ENYA 1MLBA 4JG0H 3MA9L 4FQCL 3RKDD 2QQKL 3O3BA 4CDHA 4RSVA 1CK0L 3H9SA 1UXWB 1TZHB 3RBGA 1KJ3H 1WWWX 5DVNA 3OX8B 1IGJA 3BYYA 3H9SB 4QGYA 4LVOC 4I18B 4ZNEA 2ZOKA 2VO5A 3RDTC 3T4YB 1IL1B 1S5IH 3P30L 1WWAX 1YMHA 4KKLD 1D5ZA 3BGMA 4GSDL 1VGKB 4M1GH 4JN2A 2VAJA 3CD4A 3QPXL 1ZLUH 3IFLH 1NEUA 4AENA 3HLAB 5B38B 5GGRY 2BOCA 4M7ZB 3U79A 1YECL 4PTUB 4ZOEA 4NKMB 1OAQH 5DR5H 3CH1B 1EAPA 2NZIA 4KTEH 5JNYA 4F33A 2PO6B 3MRDB 1K4DA 3SDCD 4WRLA 3THMH 4ONFL 1EH9A 3TVMA 2G60L 4RRPG 3MCKA 4K7PX 4HIXH 1UACL 2ADFL 4M9PA 1K4DB 3L3OB 3B5TA 1Z3GH 3G6JE 2EDKA 2HH0H 4OTXL 3SE4A 1HIMH 4NQEA 4WW2C 5DS8A 2YWZA 4JZNB 1NFDF 1T1XA 1X5IA 3K8MA 4ZAKD 1XH3A 5K9OB 1V3JA 2H32B 3MGOA 3UJJH 1B4JL 4Y19D 5E7BA 1FGNH 3CZFB 3FN0L 4NC1C 2PYEB 4X7SL 5GGUA 1DUZB 3TCLB 2V7HA 3O6FD 3UP1A 5SWSA 1Y0LB 2GJ6A 4LSTH 1EJOH 4B41A 5EA0L 2IC2A 2XNAB 1KBGH 4GBXB 3ET9F 1AHWA 1LO2H 2ESVE 1FFPA 2K7PA 1DQLL 5B8CB 3H3KA 5J13C 4XAWL 4DGVL 2B1HL 3L6FA 3QWQB 3ZKMC 5F71A 4XCCH 3FCTA 5JOPD 1KN2H 5IMOB 1INDH 2G5BA 4E5XA 2PNDA 4DFIA 1UVQA 2P47B 5IMOA 1XAUA 4KKBC 4Y4HA 3S35H 5J56B 3V6ZA 1T0NB 3O6LL 1WFOA 5F1SA 4Y4HC 4AMKL 3B3IA 1AO7D 1P1ZB 5F21B 3HUJB 4NZRH 3DV4B 1HK6A 2ED9A 5EU6A 4I48B 5DRNA 2EH7L 4IIQB 5JW5A 5EU5A 3P40A 4I9WD 3Q1SL 5T3ZH 1N6QL 5JHDD 1TTUA 1S7VB 4OGYH 3VWJB 3NA9H 4UNVA 1OAZH 2VR9A 5FYLD 3UTTD 2FBJL 3FQRA 4P0DA 3GNMH 4M7LT 3LD8C 3UZVB 5HI4C 5I1AB 2XTJC 5EO9A 4I0PA 5I76B 5I1EL 1S7SB 1O0VA 2DDQL 4GO6B 4HH8A 4UIMA 3OWEA 3THML 1U9KA 5JORA 1I1AA 3Q2CA 4KY1L 4P4RA 3SGJA 1D6VH 1IGIH 1TZIA 3BMVA 2C7UA 4NN6B 3NN8A 3S36L 1CFVL 1FFPB 4H8WC 4YHZH 2QEJA 3AFLA 3EDJA 1X4YA 2APFA 3DARA 5C0AD 4P5TB 1Q9KB 3LQZB 1FFOB 3AY4A 5K59E 3QCUL 5CGYC 4YUEL 2GK0A 3QEGL 2X41A 3O0RL 4EZMA 1FAIL 1MREH 4WHYH 2AEWA 4TVPL 5D2LB 4PJBB 4JEGB 2A1WL 1AKJB 3FB7A 2VLKA 2NY0B 2GJZA 4MAYD 1NGPH 3FT4A 4NFCA 2R0WH 1NUNB 2E9BA 1OM3H 2K9UA 3KHQA 1SY6L 1YZZA 4NC0B 2A38A 3MLZH 3QWRA 3WL9A 2Z8RA 5C09E 1I8KA 4G8GB 3VXUB 3DYPA 4V1DA 3HZVA 2Y25A 2YPLA 3PXJA 4WV1C 4UV4L 4PJ7A 4XXCC 3EJJX 4JO1H 4NCC2 4Q9QH 4JANB 3SO3B 4I4WA 1FJ1B 3OAYK 3L95B 4P3DA 4M43H 2F74A 1LP9A 4R90H 5C0FA 2QV2A 1RZJL 5DVLA 2AJ3A 4TSCH 1JNJA 5EBWA 4OTXH 1FE8H 1C1EL 1U36A 5DD5H 3CFDA 2E7LA 3IDUA 2QTEA 4XNMB 4XCNB 5EWIH 2VE6A 1E28A 5DD0L 1FYTE 3UROR 2EDQA 4ODHH 1I1AD 5FGBA 5C07B 2JJUA 3BE1H 3GUTB 2Z35B 1HWHB 1DL7L 1C16A 4PD4J 5IB4B 1A6UL 2R0LH 3KVQA 3R8BB 1IAII 4LSTL 3OKEB 2LVCA 3OKLA 2HKFL 3PXHA 4OIBA 1CQYA 3GI8H 3IFPB 4ZODA 5LGHL 4FFYH 3JTSB 5GS3A 5KN5B 2XTLA 1KYOK 4XPAH 4LVNC 1YEEH 3SJVB 3T65B 4X7DC 1CBVL 5FUOL 1M7IA 5T1LA 1GZPA 3SKOB 2VLKB 4OD1H 5FYJD 3U82B 4BH7B 3QG6A 25C8H 1OTUC 5FKAA 2JJWA 5FYKH 1RIVL 3BKYH 2GIYA 3OKOB 3KJ4C 3L5IA 2ICEB 1N0XL 5TE6L 5JIPA 1AE6H 3LIZL 4MAUL 3FOLA 3HG1D 5DHYA 1JBJA 4BQ6A 5HYSA 3HPJA 1H0DB 1RZKC 4Z7UB 4TUOA 3CH1A 2XA3A 4XC1H 3T3PF 3RWGB 3EFFB 1B0RB 2JCCE 1EEZB 1LEGA 2XKNB 4MNGB 3LH2L 5D96B 1DBML 4YX2H 3JWOH 3AB0B 4QY8A 1HNGA 4XCFL 2X9XA 1YEIH 4KC3B 1PDKA 3HMXH 5C0GB 5JPNB 2A74A 3TV3L 4RIRA 2HP4A 4LF3A 4GBXC 1G7PA 3EYSL 4IOIA 3GK8H 2R4SH 1UM5L 2QSQA 3ARBD 4L3ED 4BH8B 1R3JA 3B9KD 1ZGLA 3HAEB 2ESVD 4AM0A 2XN9A 4P46D 1BAFL 1JP5A 1WBXB 5EIIA 1S8DB 2LAAA 1ZLSH 4HKXA 4O02L 3TN0B 3MXVH 4H1LA 4XCEA 3MRHB 3HR5B 5FYKD 1BVKB 2FO4A 1ZLWK 3MLSL 1G7JB 2A0LD 4HXBH 3ZL4H 4S1QH 1V7NH 3C5ZA 4JRXB 1KCKA 3RTQC 3UTPE 5FGCB 2XWBA 5IF0A 5IROC 5EU3A 4U2YA 1OGAB 3F7PC 3KPOB 3INUL 5H35B 5I9QC 3MLZL 3P4NA 5IMKB 1OP5K 2AXFB 4QXUH 2BXYA 2R29L 3S4SA 2OSLB 1IGTA 4P59H 2XT1B 4YHYB 4WTWA 4JKWA 2EZ0D 1AD0A 5E56A 3TBSA 2X4SB 1KEML 2J8UE 5FYLE 2ZSVA 3GMLA 4K23H 3DNKA 1TJHH 1IFHH 4U1IA 2VXSH 1BQLL 3L3JB 5IBUB 4Y8DC 2QADC 4LSVL 1DBJH 4Y4HD 5AAMA 4KJWC 3KPRA 3OKNB 4P4KB 4HKJA 4YQXL 5EIQA 2O26U 2VDML 3F62A 3O3AA 3LQZA 4X98B 2W38A 2ZUTA 1F3DJ 2DOCA 2EEAA 1D7FA 4YHOH 3C5JB 2XKSA 5I74C 4F7CB 5GHWL 1FYTB 3BH8A 2YXMA 5I15L 1YEEL 4WTXA 4S2SA 1H5BB 1NCAL 5TDOB 1HEZB 3O9WC 4K9EH 5FKPB 1A4KB 2ZCLL 3KYKH 3GGWA 1BIHA 4GMTH 5FYKL 1SEQL 1U8PA 2F8OA 4HGKC 1A7RH 1WBZB 5IMKA 1S9WB 4FQXB 2I9LB 5KS9A 5JW3H 4JGUA 3AAZB 4NIKB 1DFBL 1ZSDB 1KIRB 1AD9B 2FSEA 3FAWA 1D9KC 4NRXA 3I9GL 3A6BH 5C2BL 3U36B 5EC2A 2FEDD 1A1OA 3CZFA 5GGUB 4KQ4H 1P84K 1HDMB 4QY8B 1NMAH 3OAUL 4OLVL 3TNMB 1V7NL 5B38G 3MLUH 3GSQA 5E94A 4ELMB 3O6FB 4ZQKA 4P4KD 2FL5A 3DOSA 2MSPA 2CRIA 2DWDA 5B3JF 2BRRH 1N6UA 4OB5L 3UCRA 3C2AL 4C59B 4LCIH 3TNNB 1RVFH 2IBGA 2NW2A 3DURA 4P9HH 2VRAA 4HWEL 4F57L 5L6YH 3B83A 4LOUD 4UB0H 2YEZB 5I66A 2W0KA 3VFSB 1HILB 1JGVL 2WQ8A 1J1OL 1WT5A 1UM5H 1ZA3A 1FGNL 4DEPC 1U91B 1QR4A 1YEJL 2QSTA 3SQOH 2P44B 2RAMA 2VKWA 4XP4H 2HN7B 3P0VH 3UEZA 2CPCA 4F58H 2Y36L 3KYNA 4PJDF 3QZWA 2ADGA 2AJZB 5FOJA 2HFGH 3WS6C 1FZMA 2R4RL 4PRIB 3KJ4B 5EUKB 2H1PH 2PETA 3GHEH 4FQLH 3ULVH 2J6EH 2ZUQB 3BSZL 1YEGH 1DBBH 1SJVA 4AENB 5ERWA 3IJYA 4X6CF 5E08H 4G7YL 1MFEL 4UNUA 5CSZA 3WFDH 2FJHB 4KJPC 5BS0E 3VDBA 3AREA 3HUJE 3B9DA 5CLTA 5FA3B 4AK1A 1DANT 2QADD 4HUWA 2LU7A 3N9GL 2ARJQ 3BDYH 2XOTA 2HFFB 4X6FB 3V7AE 1HQRA 2AGJH 4UBDC 5ESQB 1I3GH 2FIKA 4HMCA 1MQ8A 3BMWA 3RWFB 3QNZB 2BSRA 3RI5F 1AGDA 4K7FB 3IKCB 4GKSA 4EN3D 3G04A 1OAKL 2VAAA 1NCDL 4NRZB 2JE8A 3WNNA 1L6XA 3HN3A 2RJMA 4FZEL 4N0YH 5IKCA 3D0LB 3S37H 2GAZB 1A7NH 3QI9A 4Y8AA 3RWCA 2IPKB 1UXWA 1G7PB 3ARBB 4L3EB 3WO4C 1FFRA 2FX9H 2CR3A 5FK9B 4L5FH 5ADOL 4G9DA 4P2RE 3DRQB 4LSRH 2OZ4A 4TVSa 5TFSH 3KJ6L 1WIPA 3PGDB 1N7MH 1DE4B 5K33A 3O6KH 1BZ7B 3HC4H 4XI5D 3QEGH 1RUKH 1C5CL 1F42A 4UT7L 3I84A 4S11A 5D2LA 1F97A 2OX5A 5L2KD 1NCAH 2EDTA 3Q5OA 2IF7A 3M17B 5DZLA 1C12B 3N1PC 5T3XH 3WJLA 4DKDC 4BZYA 3FO9B 1VENA 3NFSL 5BS0B 2WBJA 5BOZG 4J23A 3MPCA 3VFUB 5FUOH 3ARGB 1EZVX 5MP6H 1LE5B 5CCKL 5MERB 4Z7VA 1E27B 1KJVB 3AMKA 4MA3A 4NM8H 2GTWA 5I8KL 3MRFB 3G5ZA 4ODUB 1P2CA 4LOUC 5E9DB 1VEOA 1D5IL 5HDQL 1AJ7H 3K2UL 4H26B 1EMTH 4ZXBD 1WIOA 4WI7A 5IB2A 4Z7OF 5GS0C 2AK4D 3AS3A 5IOPB 2VSCA 4EI5D 1U91A 5SWZB 1U42A 3G5XB 3KPSB 2AV7A 3D2UD 4E42A 3ZE0E 2VL5B 4LGRB 3MLTA 2GCYA 2BOBB 4I5BA 5C0IB 3DSNA 5IMMA 3N85H 5FHAL 2NNAA 4PFEA 5DK0A 4J3VA 1QHPA 3RX5A 3KPQB 2A6IB 2FWOB 4Y2DA 2EDYA 4OCLC 5IG7A 4QHUB 4HEME 3U0PA 2DMBA 3RL1A 4ZS6D 1EGJL 4OQTA 4PGCA 4MJ2A 2OZ4H 1QG3A 1RJLA 1S9WA 5TE6H 1PYWA 1RZ7L 1UM4L 5FYJL 3LKOB 5I19L 2IALB 5KSBA 5C0BD 4RX4A 4GRLC 2DQIH 4NRXB 1WBYA 1RIHH 1ORQB 2DTMH 4JR9L 4G6JH 3WFCL 4K2UL 4UINH 3RHWF 3MLRL 1NLDL 1PKOA 2IQAA 4PJ8A 1FFNB 1QSEB 4Y5YA 3F12B 4LF3B 2CDEA 3FN9A 2WBWB 5DK3A 4DKEL 5J9PA 5JQ6H 4Z7UA 4D0BB 4NO0A 2FATL 7FABH 1ZT4B 5AWNL 2C9AA 1RJYB 3B9KB 4WCYL 1JPGA 1R5WB 4EI5B 1C5DB 4XPFH 4NQUA 4KXZI 4WHYG 2PYEA 4O9HL 4IRJA 1JFQH 1S5HB 4ODBD 5GGTL 1T7VA 3QUZD 4X7FC 1HSBA 3I6LD 5F7EH 5D5MA 2F54A 1UCBL 1YYML 4P59L 1T7WA 3MJ9H 1FORL 1U3JA 3CSGA 3BPOB 4TQEH 4LPYA 1MRDL 3ES6B 3V6FA 3ARDC 4FFZL 1ZANH 2OJZH 3ULSB 5INDA 3ALWA 2H8PB 4OLYL 4Y5VA 1FFQA 4TN9A 3WLBA 3MUHL 3EKCA 5J89A 4G6AC 3WEXB 4NBXB 3V6OE 3VWJC 1X5JA 3TVMB 3W81A 3NCJH 1FNHA 5F72S 2ATKB 3MFFB 1P7KB 1QNZL 3X17A 3WIHA 5EU6E 3FJTA 5JNYB 1AC6A 1I9RL 1MRCL 4GG6B 3BHBB 4WU5A 2BC4B 2P24A 4Z8FL 5T1KD 1EGJH 1ULVA 3KPOA 3BO8B 3ALPA 5LAXA 2E5EA 4OQ1A 3OB8A 3JTTB 4XCYB 5D7JA 5L88H 2GI7A 2BNRE 4DUXA 4U1LA 1G7MB 1RZKH 3V9FA 1OAUL 3QRGL 2VXSL 3WXVH 4NC1E 3QXDA 2EH7H 1LP9F 3OR7A 1NFKA 3S37X 1G84A 3S35L 2E7HA 3V2AR 4JB9H 4UTBH 5IR1A 5JW3L 4OLUL 4OFYA 4EDWH 2GAZA 2QHLA 2N7BA 2MKWA 2RFXA 4NN7C 4KKBD 2IFFL 1EO8H 3FONA 3N1FC 2EDJA 4PJFF 1MHCB 1C7SA 1KIQB 2NY5L 1MCDA 4HUUA 3I6GA 5EZJA 3IETB 3SO5A 1TVBA 4PLNC 2DKMA 1E4XL 5E5MB 3ARTA 5F7YC 4UT6H 3STLB 5CFHA 4JZJC 3PWPD 1L7TL 3B43A 3MJ7B 3NA9L 4J3WA 1JCKA 1FO0H 1HOCA 3BRFA 4Z76A 1RUAL 3SKOA 1KB9J 1MOEA 1LILA 4QYOB 4ZUUA 4HUVB 5C9KA 3FQWA 2XY1A 4JFQA 3D18B 5IW1A 1IC5H 5GGQL 2WWMC 1OW0A 4X6BA 3HMWL 3MROA 5CMAA 5GGSB 1AY1L 1S78C 2Q86B 1N3NA 1ZHBA 4K9EL 4ZD3L 3GBLA 4OZIA 1K8IA 2R1XA 4K3EH 4JHWL 1FN4B 1FPTH 4PTUA 1AR1D 5DJCB 1UYWH 1AD0B 1ERNA 2QQNH 2ZWLT 2VR5A 5IFAH 3U36A 5C0AB 1JPSL 1JZ2A 4JFFE 1B88A 2D7OA 3PP3K 1IM9B 2F19H 4JFDA 5E6ZA 5IB3A 3OG4B 4X9BA 4XXDB 3U1SL 1P9MC 3VFNB 3FMGL 1RZJH 1MJUL 1V5JA 3QCTH 5GRZA 1LO4H 1VKXB 5E4EC 3GHBL 3E8UL 4H88H 4LCYB 3S34L 3TVMD 3UPCA 4NYLA 2YD2A 1RFDL 3N06B 3WYRA 1DN0A 2FH6A 3IU3A 3VWKB 2YPLD 3L3IB 5HHMD 3GMOB 3L5WA 2Q7NA 3DJ9A 3I85A 1JGVH 4KV5F 3K8KA 4HXAH 5HI3C 2W92A 5C07E 3X12B 3PGCB 1XGRA 4N0UB 2MPAL 1QLRA 5FYLL 3SQOL 3NABH 4LPCA 5LBSL 3X12A 5CBAA 2BVQB 3HI6H 4OZIF 3HZVB 3BH8B 4PRDA 1A1MB 1A7NL 4JLRA 4JY6A 3MTRA 4EI6A 4JM2C 4HWNA 5EZOH 2I07A 4FQXA 1F5WA 2YN5A 4M1DL 4D3CL 4EUPG 3FFCD 3B9AA 2X4TB 25C8L 1LP9E 1I1YA 3P4MB 4OM0L 2IALA 1X5HA 5E0QA 1LGVA 5T1MB 1WEJH 2AQ2A 3WE6A 4YE4L 3O3EA 4XPTH 1S7UB 2YS4A 4KI5C 3RZCB 2B20A 3X3GH 3OG6B 2F5AH 1VHPA 3K2MC 1Y18A 1IAKA 1T4KB 4FXGA 4OF5A 5ITBH 3BIBX 4GBXD 5F9JB 4NDMA 3RWDB 5J12C 4JFDD 4PJFA 4PJBE 2VXUL 1IGFH 2V6HA 4Q6IA 2EIBA 3C09C 4X6DF 4ZS7H 4G6AD 1OT2A 1B4RA 1DVFA 4XAKD 2GHWB 2VH5L 2P5ED 5CEYB 2V5TA 1YPZB 1CXKA 4NCC1 4OF0A 4M3KB 5FOBB 2KL6A 3BXNB 4YBQC 2E6JA 5JHLL 3IJSA 5IVNA 1MCFA 1K4CA 2FEEL 4JFQB 3FMGH 2B2XL 2Z93B 4P3CH 3FO1A 4WI4A 5BS0A 3BGMB 1NGQH 2D31B 4I48A 3QIUA 5DRNB 1RV6X 3IXAB 2NY7H 1T0MA 4XNXH 4E41B 3BAEL 4Z7VB 1XGPB 1KCLA 3KG5A 1N3NB 1ZHBB 3TV3H 4BK4A 1WCBB 4NHUB 4ONGH 4Y88A 3MLVH 1OB1B 3DXAD 5ICYA 5F44A 3MLPA 1I7ZA 4GW4B 4IRZH 3MODH 3UDWC 2BY2A 3BDBA 5DFWH 1DQJA 1KBGL 3QIBB 4NM8L 2Q6WB 3V5HA 1FQ9C 4Q97A 1DEDA 4ZXBA 4P46C 4NZUH 3JV5A 2OI9C 1FRGH 3MBXH 4HUUB 4AH2A 4U1LB 3FOMB 3QDJB 1AGEB 2P8LB 1SYVA 5I8KH 1EX0A 4G6JL 3F6LA 4CU8A 4P23A 1P4LB 1CDUA 1T21B 2HTKD 4N1CA 1KEMH 3TYFB 3W39A 5AG8A 1N6VA 2VITA 3HRZA 2MQ0A 4PJ5E 1JWSA 4MNQB 3ULVF 3GSWB 1UXSB 1ES0A 4LRNH 3EOBB 1DANU 1PG7W 2Y7QB 4Y4KA 5EN2B 2A1WH 4Z0BH 4FFVD 1PZ5A 2VDNH 4MLSA 3E8UH 4H88L 4PJHF 1OGAD 2ZSWA 4BSWB 3MMEA 4ZOAA 1KB5B 1DEEB 1VGEL 3S3JA 1EUUA 3AU1A 5DD6A 2BNQA 4QRPB 4F7TA 1KTLB 2DYPB 2R2BB 5IW6B 4RDQG 3VGBA 1NC4B 5HVHC 3NCEB 2PYEE 4KTDH 2QSCH 2W60A 4O9HH 3WS3B 5TDPA 4MMZC 4LLDA 2R1WA 3S36H 5KS9E 1LE9B 2PXYA 1OT1A 4DVRL 5HHME 2AQ3A 4OFPA 3O4LD 4WFGE 4KMTL 5EZOL 3OKMB 3D2UA 5ENWA 5L7XL 3AS1A 3RA7L 1MI5E 2YD8A 3CFDB 5EO1B 4MXWL 3STZA 3O9WB 4BZ2H 1S7QB 1H3PL 5C0CB 4OV6F 5KSBE 1WK0A 4XP6H 1FFNA 5DTFB 3DECA 4FXKB 4MXQD 1NGPL 4PG2A 3DVNB 3HFMH 5DRXB 3BP5A 4RFEB 4A2LA 4ZO9A 4FNLH 5E8DH 3GSNA 3LEVH 1KXQE 4U1JA 3L9RA 3LKNA 3O3UN 3L3HB 4Y19B 3OKLB 5AZEL 1SHMA 3HNTL 3IDIB 5ACZA 1U8HA 3PABB 2ED8A 4GAYA 4IRJB 4YHIB 1QBMH 4HGWA 5IR1B 5ID1B 4FFZH 4PRBA 4AJ0A 2OL3H 4EIZC 3I3EA 5D1XB 5JMOC 4HIJB 2X7LB 2Z93A 2GW5A 1YYMH 3LN9A 3RWEB 1A14L 3KS0J 3WN5C 4KH2A 4I0CC 4YO0B 2YD6A 2BNQD 1JVKA 4WNQB 4AEFA 5DQDH 3U0PB 4MX7B 4OLZH 5HPMA 1HINL 5DD0H 5TE7L 4ETYA 3EYQC 3TO4B 3EZ8A 4EI6B 5JW4M 4HWBA 3MO1B 4XMPH 1KIPB 4C83B 4J3OC 3V6BR 3H8NA 2Y36H 3U7AA 1TNNA 2R23B 3LKRA 1CK0H 1KJ2H 3RZCC 3RL2A 4OSUH 1BBJB 3EOAA 5FGSA 4KVNH 4IRZL 2ZUQC 1FV1B 1Q94A 5F6HI 1T3FA 1ZHKA 3VFOA 4R26L 2ID5A 5JZ7D 5LXGL 4ZFOB 3BIKA 1ZVHA 3HNSL 3R4DA 4HBQA 4MAYA 5CJOL 3W9DB 3BZEB 5CKAA 2DQEL 3N1GC 2H1PL 4WUKH 2XQYG 3W9DA 3BZEA 3SE3C 3FQUB 1FZJA 5CGMA 1U95A 1ONQB 5A2FA 5DR5L 1KXTB 3QHZH 3BKML 4Z76B 1CD1B 3IVKB 1BQSA 5DC0A 2YRLA 4U1IB 4X7TB 3R06A 1KB5L 4C58B 3JZ7A 4Q6IB 5DUPL 4KJYA 4L8DA 2BNQB 4OD3H 4P5TD 4NNPL 4QRPA 1M71A 4LDOB 2DM4A 1OAQL 3O4LB 5EZLA 1IRAY 4X6CB 1KJMA 2LE9A 1FL6B 3KPMB 5HJ3B 4MX7A 3P9WB 4F37K 1DTUA 1UVQB 1U3HC 2DLTA 4HEPG 4KRMB 4LLVB 4RZCA 4I3GA 1AXSA 1IM3B 4UDTA 4WEBL 3VH8G 1BOGA 3VXNB 4GOSA 1ZOXA 3V4VL 5D2NE 2NY0C 2OSLA 2VN7A 4PP2B 1A02N 3PE9A 3HUJA 1I7UB 1EAPB 3RZWA 5I6XC 5KVGH 4H0GA 3BRDA 5DD1H 4JLRB 1SQ2N 1OD9A 2EYSA 3L3KB 4KHTL 3X14B 3PQYE 4OZFA 1GAFL 1GZQA 5HGHA 3TIDB 1XF2A 1T5XB 1XCQB 3FZUD 3MCLL 3HNVH 4HF5H 2BNUB 4R96B 2E9WA 2BSTA 1RZFH 1A0QH 5IIEB 5BXFA 1CFTA 1DN0B 3IU3B 3VWKA 5GS0D 3QI9B 3TF7C 3L7EA 4M8VA 3OGCA 1N5YL 4ZAKB 1FL3B 4ZTOL 1DCLA 1B90A 1X5YA 5DJ2A 5BRZB 3CFIC 5HGDB 1JHLL 3EO0A 1Y0LA 5IB5A 5LXGH 4H25B 3V5KA 5TF1L 3EIFA 4X4ME 3VU2A 5ID0A 4JDZA 5CEXA 3PHQA 3N50A 4H25A 2R1WB 3QYCA 5CCKH 1BP3B 1LO4L 4MD4B 3ZTJG 3IS0X 2NR6D 3BWAA 1ES0B 3LN4B 3VI3F 1J5OH 5ALCH 4YXKH 4TULH 2PR4L 3C8KB 2G2RB 3VA6A 3CXDH 3U4AA 2NY2D 2GT9A 4V1DE 2HN7A 1K8DA 3VJ6A 1IM9D 2YUVA 4JREB 2K3TA 5FYLH 5C09A 2XY2A 1W0WA 3FB5A 3WIFB 2AJZA 1CN4A 4TUJA 4FN0A 4LLDB 1CQKA 1JNLL 1T4KA 1PW3A 4IRSD 4OM1H 4QHLA 2FX7H 3QUKA 2YD7A 3F12A 1D5XA 1DDHB 3MRNB 1U8JA 3RVUC 1XCQA 4HUKB 1IGMH 5H37H 3NIFE 3U9UA 3PWNB 3E1F1 3KPNB 2DQGH 4R7NB 2RCSH 5KANG 1DBAH 4HWEH 2BVYA 3L5JA 4KK6D 1REIA 1CFSA 3OXRA 2CKBA 3OGCB 1X7QA 4LAQL 5C3TA 1WSST 4JFZL 2X70A 1MH5B 5BV7B 4TTDC 1AGCA 1V05A 3MODL 4FMKA 1H8OA 1U8QA 3HG1B 2VH5H 4Z6AT 5AWNH 2EDOA 3O4LA 1NC2B 1QFPA 3HE7C 4X0KA 43CAB 4NQVB 3GMOA 4WU7A 1EHNA 5E00B 4U1KA 4PJEB 1KSRA 4RMSA 2QSVA 3MCG1 1GGIL 1MFBL 1P4IH 5FUZL 4J3TA 3E3QC 3QUML 3CU7A 3HE6B 2D7TL 2Y07H 5JZ7C 4F57H 1CT8A 3LB6D 4X99A 1I8KB 2AK4E 1H5BA 1PYWB 1ZA6B 1FIGH 3FFDA 2MHAA 1HXMB 2J4WL 5ETUB 5BQ7B 5DMIL 5CILH 5GGTH 4ZTPL 1T0MB 2QJDA 4JFEB 4OLXH 1NAML 3QI9D 2YZ8A 1TJIL 4LHUB 5FXCH 5C0DB 3ZHDA 2WWKT 4JE4B 4U2ZA 4QRQB 4PBWD 4F58L 3MLVL 1F13A 4XBGA 3EDDA 3T1WA 3ARWA 2R4RH 4OF3A 1I1YB 5IEKA 4UV7L 4KDTC 1S7UA 4PJGF 4UMGA 4M48L 4UIKH 4IM8A 4ZS6C 4XP1L 1I7TB 1R24A 5EG6C 1F3JA 1QLEL 1NPUA 3ZYZA 3QPQD 4KVCL 4CNIB 3CX5K 1P4BL 3OAZH 2HRLA 4PS4H 2BNRD 1EHAA 1F3JB 3V4UL 3LIZH 3D5OF 3SHSA 5C0RH 3DRQA 43C9A 1LNUB 3VXSA 4NUJB 1UZ8B 3DYMA 3HPLB 1IGCL 4FQXD 1NFIA 4WU7B 1MCEA 4JY4B 1T03H 5F3HB 4C4KT 1A6VH 4R6UA 4M62L 4OT1H 1UZ8A 2C4FU 4OF8A 4NQEE 5JORB 2P46B 2W9EL 5DJYB 1JRHH 1I3GL 1QQDA 3UTQB 3PGCA 2FJFA 4NHCH 2W65B 2BVPA 2UZYB 1AO7E 4XC1L 4LEOA 1JUFA 2ICES 3O11B 3EDFA 1K9TA 3ARGC 3TGXA 5JUEL 3LH2H 3QUYC 1YMMD 1YPZF 2BVTA 5EIVA 1Q9WB 3QUZC 3CMOL 3QEQB 4IJ3C 3NPZB 5CUSH 1EDQA 3HI5H 4WWKC 2Y5EA 2OP4L 4MNGA 4XC3L 2EDWA 4ZMAT 1D9KB 1BOYA 1UJTA 4XT1C 4CMHB 2KDGA 4WWKB 3NZ8A 4GAYB 4E0RA 5KZCB 4JPVL 1BIIB 4ZD3H 5MEND 5T5FL 2EIZB 1WAAF 3V4PH 2GJ6B 4G6KL 4RGMC 1ZHLB 2P7TB 1J88A 5HHVL 4CVXA 4IBLT 5C0ND 4RX4D 4MA1B 4AT6B 3W0WD 2NY2C 3BEWB 1T83C 4DW2L 2DTSA 2P5EE 4Y5XA 1I3UA 1SM3L 3D9AL 5L8KB 1WZLA 3WNOA 5KS9F 4M5ZH 3T65A 4F8TA 5ACLA 5FDWA 3OR6B 1QHOA 2R2EA 1BZQK 4ONHA 3SKNB 4DN4L 2YPKA 1Z9LA 1MFDH 3V5KB 5HYEA 5I1JL 5IM7B 2BK8A 1BVLA 4Y0GA 4U1MB 1P4IL 5FUZH 3FB5B 3WIFA 1RHHA 6FABH 3DETD 5B4MD 4NQCE 3FOLB 5I8OL 1QRNE 1OTTC 5K9KB 3MREB 2W9EH 4CRPA 2XWBB 3SBWA 1UFUA 4PJ9B 1A7PL 3TO2A 1ZT4A 3QJFA 5HHPA 1IEAB 3OKDB 3VFGH 3QG6B 4FFWD 1HCFX 5F1NB 1OTUD 3DVGB 3HNSH 1MI5A 2A6JA 1U58B 3BVNB 3T8XA 2FD6H 3B2UD 3VGAB 3OKKA 1OGTA 3AS0A 1T1YA 2AABL 1ZHLA 3TBWA 4KHXH 2KUTA 3FTGA 4U1GC 5EBLB 3PV6B 3VXSE 1HYRC 4OV5A 3DTXB 4YPGA 1V3MA 3TEUA 2F5BH 1OWWA 3QR2A 1Q72H 2AV1B 4JY4A 4YUEH 1RZ7H 5K9QI 5ITBL 4NKDB 2FZ3B 2AEQL 4F7CA 1JZ4A 4RGNE 4LCCC 2YPKB 4LEXL 5IHZA 2BHZA 1S9KC 4LLUA 1KG0B 1S3KH 4UINL 2H41A 4P99A 5D1QB 1H8NA 4N8CL 3K7UA 5IGXH 5LCVH 5DFVC 5DVMA 3O45B 2A9NL 2J5LB 3CMGA 5JQ6L 2X1OA 5I17A 1MRCH 1PX4A 4L3AA 1MAJA 1KYOJ 4Q9QL 1G1CA 1SM3H 3D9AH 4OFIA 3T77A 2IAMB 1F4WL 2WINB 3Q6GL 5F89A 4UB0L 4A6YB 4FG6D 1A64A 1ZHNA 4R3SB 4XPFL 4R96A 4PP1D 2FYYB 8FABB 3RKPA 4HMEA 1FNEA 3QPQC 4L29B 4CJ0A 1RZKL 4LCIL 3GO1H 2DD8L 4MB5A 4XWGH 2FRGP 1MRFL 2OR8A 4UV4H 5H8DA 1CVSC 1U2HA 4PB0H 1II4E 4ZQKB 3CDFA 4PJGA 4XGZA 5CD5C 5HYJD 1SJEB 2V2WB 1NGXB 3V6OA 1U92B 1PQZB 3F8UB 4YPJA 2EDFA 4IRSC 3UTTB 3BI9X 2OXGA 4LSSH 1IKNA 4KI5D 1DLHB 4PJEE 2V5YA 1RJYA 2AXFA 4QHKI 1F6LL 3RVXD 3FN3A 5CAYB 4D0BA 2HFGL 3MV7D 4EVNA 3VFPA 1CFTB 4H0IA 1OSPL 1EFXB 2GITA 3BE1L 1WV7T 2OTWA 3GSUA 3B9KA 1CDBA 3HG1E 2ESVA 4GW5B 5IHZB 4GRMB 1FVDA 1JF5A 1M71B 4ISVA 1NBVL 2QQKH 1U8QB 4YK4B 1YN6B 3REVA 4JKKA 1E4JA 1UM6H 5HGAB 1F4XH 1QSVA 2AQ1A 5DJ0A 5JDSA 4LHQB 4XI5C 4PY8J 1OTTD 1H3XA 2DQCH 3UJIL 4I18C 4X7EC 2G5BB 1QFWI 3GMMA 4LQFH 4YK4C 5C0CD 1ND0B 5CD3A 4KKCD 2AJUH 4K71B 4OCWL 3SY0B 4F7PA 4WFGD 4EXPX 1LDPH 1RJLB 4F7MA 1A6PA 1CD9B 3QBTB 5T1DH 2ADFH 2XZQL 3DSFL 3QDMB 5ILTL 3H9ZA 2ZSVB 1DP0A 1CL7L 2P8PB 5JW4Q 3AREB 4PJCB 2VWEE 5DD3L 2VDPL 4O4YH 4XPHL 3MRKA 4HDIB 1D5XB 1TPXC 1A1NB 2JKXA 4HIXL 4S0TD 1C8PA 3UJTH 1TVHB 1FNSL 3GK8L 5KANI 1CGYA 3HZYA 4YFEA 1S9YB 3W11D 1HHGB 5CIPH 3VI4E 1U8HB 4GMSH 2N4IA 2OK0H 4Y16D 2L4OA 5JPNA 5IFHH 4HBCH 3TZVD 2WIIB 5IV2B 4IEFB 3U9PL 4OD2A 4TRPL 5I71C 2DLFH 5FDWB 4GRWE 4GLRI 3F7YA 2V9RA 4LSSL 4NQCD 5FYJU 5CSGA 3RJDA 4RQQB 2FO4B 5B3JE 2LU4A 1YEDB 2Y72A 4Z77A 5T3XD 1RURH 4G8FA 5IBTH 4FQIL 1CG9B 2JELL 4WY7L 2V17L 3QULB 2KPNA 1H3GA 4OGAC 4QTHB 1UB6A 1XF5A 2CDFB 4DZBB 4I13B 2ZUXA 1PAMA 3H2WA 1MAKA 3TIEB 1MHEB 4A6YL 3CJJA 3Q0HA 1HH9B 2IADA 4PJCE 4CDGC 4DVBB 1G7JA 2Y9RT 3G5YB 2AJVL 3D85A 2Y06L 2LABA 3SE3A 4PJGE 5A43C 2IPUG 3E0GA 4JFFA 1HINH 4F9LA 4QXWA 2CO6B 2BMKA 4HG4J 2COQA 4UQ3B 3UJIH 2R8SH 4WU5B 3TJHC 5ISZA 4NQDB 2E9IA 4K8RC 4YH6A 1LEIA 4U6VH 4PRPD 5HDBE 3QAZB 3L95A 4YWGH 2R39A 5HHNB 1OOAA 1EHLH 4LHJB 4OV5B 1P7QA 1INEH 4X6EA 4X6CE 5FV1L 2C26A 1I1RA 4P2QE 4CW1A 5ACZB 3FT3A 3MOBH 3H3BC 3ULUH 1E6JL 1T1YB 3X13B 5KSAA 3I6KA 5DSCB 1QOKA 1JV5A 1QSFB 1WCQA 4I2XE 4Y4KD 4FFWC 1U8LA 1IGIL 2B2XH 3BN9D 3ZE1E 1F6FB 2DJUA 3W82A 2GJJA 1RK1B 4QTHA 3SDXB 3BAEH 4GRLD 5I1CH 3HRZB 4G6KH 5GHWH 4HIHA 3KLSA 3VXPB 5T3ZE 2EC8A 1T03L 2I9TA 5DJ8A 4XZUA 1U8KA 3CXHJ 5DQJA 3C8KA 1PG7X 3VXQB 1RZJC 5ERWB 1UJ3B 5C1MB 3WEXA 2JK5B 3LRHA 2E7MA 2WQRA 2GJZB 5DT1H 1E4XI 3PDGA 1FO0B 3CK0H 4BZ1L 2ICEA 5IQ9B 3ZKSD 1I9IH 3U6RA 5E6ID 1HXYA 4P2OA 3QUYB 5CUSL 4TSCL 4Q74A 5TH2B 3RBSA 3IDYC 3EOYG 4ODSH 4M93B 5D1ZA 1XIWC 4GS7B 1ROWA 3BZFB 1S9YA 2VWEC 1QLFA 1S5HA 4MQSB 3MRBB 3ARFD 3DUSA 2EE3A 3ELAT 5E8OB 4OLEA 1Q0YL 1JE6A 2R0ZH 4MNHB 5LVEA 1HHJB 1Q9LB 2BHUA 4HX1B 5L2JB 2YBRA 1OARH 4MLIA 3TWCL 3NCYP 5C07A 2R1YB 4Z5RB 4PJDA 1NFIB 4OGAD 2Y6SD 3MBEC 3GMMB 4EVNB 1KJMB 3DMMC 3LHPL 43C9B 4M61B 3GB7B 2MQCA 2X4RA 4NO5B 3ULUL 1LEKB 4M5ZL 3RGVB 3OQ3B 3T3MF 2F54E 4LLVA 2L7JA 4LASL 5BW7A 5I1GL 4PTTA 4FQLL 5DJZA 3SGEH 3DUUB 4E41A 1FO0A 3S88H 3KYOB 4HJGB 4NJ9L 4NO2B 3EJYD 1HEZA 4IRSA 5MERA 1RU9H 1ZV5A 1JN6A 1JPTL 4Y2DB 1RUML 4HK0B 1A4JA 2X1PA 1XF4B 4QOKA 1YY8B 5HHMB 2GEEA 3WHXB 2HVJB 2ZOLB 2QSCL 3E6HA 1DBMH 4FG6C 5DS8B 4S1RH 1K2DB 5JXED 4GQPH 4D8PA 5JR1L 1M7DA 2NY3B 4LP4A 1T1WA 3LMJH 1F4WH 3Q6GH 1WTGT 3BX7C 4ELKA 3SDYL 2APWA 1A9EB 4I3RL 4N0YL 9CGTA 3HRPA 1KG0A 1PQZA 5LGKA 4XXDA 5HI5D 3SKMA 5AD0A 5DGQA 2DBLL 3KPRB 4RWYH 1XH3B 4MNQE 3TN0C 1JRHI 5DDHB 3QIUC 3K4AA 5CZVL 1I9JH 5FYKU 1EO5A 2D3VA 4PJIF 4S0SD 4NQSB 1RUKL 2IAMD 4V1DD 3EYUL 1FHGA 3BJ91 3EYOA 1V7MH 2NMSA 3KPRE 1CI5A 1KN2L 1MCRA 1VACA 3STBA 1EUTA 3ESVF 5DHXB 3UXFA 3BUYA 2DIBA 3ILPA 3V52H 3DV4A 4LVHB 1TMCB 4HC1H 2J8UA 3WS3A 3I50H 1EV2E 5C08E 4D2NA 2DIJA 3MBEA 4BM7A 5KSVB 4OFYD 5BO1L 4Q6IC 4EUPH 3SOBL 4DN3H 3RVVD 4AEEA 1BLNA 5FCUH 5JHDA 2DKSA 3GSOB 2D7TH 5DJCA 1QKZL 4KK9C 1ODAA 3T0EA 1FVEA 3QEQE 1WGOA 3LPGA 4LASH 4Z7VE 1R5VA 1MJUH 4MJIE 4HUXB 4R2GB 1I3RB 3H7LA 3CFCL 2FHBA 1JNNL 3VFTA 3V5DA 4YIQB 5F1NA 3MCKB 1Q38A 4LSPL 4K71C 2BY1A 1U58A 5BVJA 2NY4C 1KPUB 5ESQA 1OSPH 3TT3L 5HYQB 4RBPH 3IDIA 2OMNA 5TQ0L 5HHOA 4XMPL 2NXYC 2FBJH 4Z0XA 1R3IH 1G7LB 1RZ8A 4MDIA 5E70A 5JW4R 3GM8A 1J0YA 1YN7A 4XP1H 5CEYA 4IDJH 3LEYH 1M1SA 2Z31B 4XHJD 5KN5A 2AW2A 3BGAA 3I6KB 2WIIA 3BXNA 1MCQA 3N85L 4OZHB 1PZ5B 3HC3L 5HYJA 1ZT1B 4RISL 6CGTA 4KK5C 2RFXB 3ZKXC 3ZE1F 1JNHB 2P45B 3C6LC 1MVUB 1BVLB 1L9MA 1OLZA 4RFOL 32C2A 3CAFA 1KPVA 1LO3H 3P0YH 4N0FB 4IIQC 4D9LL 4TRPH 4NQED 2I9TB 1KPVB 3MRKB 4LPTA 1BLNB 2PXYB 4TVPH 1QACA 5T5NF 2NXZB 2VC2L 2WBKA 5SX5K 3JTTA 4XCYA 5D7JB 5ILTH 2UUDK 2EH8H 3RX7A 5CP3H 3VRLE 4ALAH 4P3DB 3MLYH 3RL2B 3O2WH 1JZ5A 3ZHKA 4FQ1L 3S9DB 3EOTH 4FA8A 4YDIL 5FM4A 3PIQA 5F7NC 2JTDA 1NCCH 4Y7MA 1JHTA 2YPLB 1A9EA 4IIQA 5JW5B 3UMTA 3VXRB 5ANMB 1CD8A 1CL7H 5F3BB 3QQ3B 4G6MH 4MA8L 3FQXA 3GSNL 4GMSL 4WTZG 1ACZA 3JWDC 1XR9B 3ZKMD 1OQOA 3CVHL 2ICWB 5FB8B 1DUYB 1TETL 2AJ3B 3QEHA 4MHHI 1QEWB 2BVOB 2CXGA 1EIBA 1R5WA 4FABL 1GYAA 4LLMA 3RAJL 1NFDB 4WEBH 3LEXA 3NZHH 1LK2A 1QQDB 4G42B 1I8LA 4GRMA 3PDOB 4JRWA 1JGLH 3H9SD 5DUML 1KLGB 5C9JB 2BVPB 1BD2B 2GITB 4IS6A 2ORBL 3C9NB 3IDGB 1FYTA 1W0VB 3TZVB 3IAGC 2GCYB 1AFVL 2JJTA 3NCJL 4GLRH 4O00A 2DLFL 3T2PA 1INQA 3D85B 5B8CA 4FQ2H 2HT4C 3O41A 1DBKH 3GIZL 4S1SL 5C0AE 1XGPA 4U1MA 1N5YH 3TBTB 5IESL 1JHLH 5IBLD 1E4KA 1L6ZA 3E6FB 1MFDL 3MOAL 4LK4A 1J1XL 3S5LA 4R3SA 4PGCB 2A77L 3W9EA 4YEFA 4QTIH 2HVJA 4NNYB 1OAUH 4DCQA 4YFLF 2AAVA 5A16A 1MHHA 1YEFL 5D7JC 3DGGB 5E5RB 2HKHL 5D2NA 4LHUA 4RMQA 2EIZA 3ESUF 5AYUL 1S7XA 1JIBA 3HZYB 2CLZA 3FB8B 2DI7A 5KSAD 2PTTB 3V0WL 2FJGB 5ALBL 1WZ1L 4Z95L 4YHPA 2VXTL 2AV1A 4POZD 3KLHC 1HKLH 2BVUA 1BD2D 3PDOA 3UTPD 2MNUA 2HRPH 2Z8VC 4BSWA 1V8HA 3ARSA 3NIFF 2EO1A 3PWVA 5ECJE 3MZTA 1HOCB 5HYJE 5D4QA 1IQDB 4ZFFA 1TITA 3TN0A 2BOBA 4I5BB 4XBEH 3HA0A 2OLDA 2CLVB 3RU8H 3O6FC 4R4NC 5EU3B 4JO2L 3UTSB 1IEHA 3G9VA 3G6AA 5EC1B 2GUOA 3KJ6H 3QJFB 1C12A 3NVQA 3DUHA 3GBNH 2JJSC 1A3RL 1UG9A 1WQVT 4K3DH 4MWFA 3RY6C 4O2EA 3M8OL 4L9LA 2CUHA 3MJ6A 4YFLI 1IAIL 3QIBA 2Q6WA 1KCUH 2EXWD 5FA3A 2E8ZA 1AXTH 4YGAB 3VFMB 4X4ZA 1IT9H 4MNHA 1DDHA 2CGRL 1PG7L 3ARED 2H2SC 3MLYL 2C3VA 2YD5A 2VQTA 2UY7A 2L0DA 4WENB 4KVCH 3GSNB 1G9NL 3X11A 1BFTA 1NAMA 5EORH 3EYVA 3DVNA 3PHOA 5C70A 5HVHB 3LRSA 5K93A 5GS2H 3SCMA 4MJ5A 4L9LC 2UVEA 1MLCB 1NAMH 1U41A 4H26A 1F11A 1A3LL 4YDVB 1OARL 3TWCH 4JQIL 2BJMH 1VFMA 1HYSD 1FIGL 3VI4F 3RAJH 4B0MM 5F6HJ 5CP3A 4NZRL 2EXYD 1MIMH 2ZCHL 3RWJB 1T7YA 2RBLA 3NZHL 5DO2D 4HIIA 2J2ZA 3CDCA 4JDZB 2OXHA 3Q1SH 5T3ZL 5CEXB 1MPAH 3KGRA 4EEEA 3MV01 4TVPD 5ISZD 2F53B 4PRNB 4PJFE 3DBXA 4HUMB 3IF1B 1CDGA 5JOFA 1JWSB 4MNQA 3M17A 4YHOL 3VWKC 4QYOA 2DI8A 1QSEE 2DQIL 4RMTA 3FQNA 3VXRE 3RGVC 5L2KA 3MRJB 4X9FA 1P4BH 4LARL 5A2JH 5DJ6B 1YYLL 2HG5A 3QIBD 1QA9B 5MENB 3U0TB 4UQ3A 4ZO6A 5F70A 5IT2H 3RWIB 3L3KA 4GMTL 4GAJL 3GMPB 3WNPA 5JR1H 1RUMH 3KYKL 4AH2B 4YE4H 1V3LA 3BPLC 4JM2B 1IGFL 3SPVB 1DFBH 1BF2A 1MWAB 5JUEH 1N64H 3P4OB 1GOGA 2D4DA 4DN3L 4KDVA 2BHYA 3O3BB 4W4OA 3G04B 4DQOH 2VE6B 4CW1B 3VFTB 1GSMA 3JVGA 4KUCD 1MLBB 4P23D 1QKZH 1JK8A 3V0WH 5IW3A 3ZSTA 3D39D 3QZWB 2DIAA 3T0XA 2EO9A 4LCUB 2BRRL 4OB5H 1HH6B 3W0WA 1BF8A 4EUPA 1UCTA 3BPLB 5F93C 5F96H 4HX1A 5C71A 2H8PA 4PJ5A 1X4ZA 3OMZA 5DK0B 1CFNB 5I8CB 4I77L 2GK0B 1HILA 4LSPH 3WUWG 4CVUA 2F53A 1SBBA 4PRNA 4P9MH 4RZCB 4WWID 1AR1C 4OQTH 4FXLA 3IJYB 1SEBA 3FO2B 1IBGL 5D1ZD 3RIAK 4M6NH 5LG1A 3TYGH 5GJTL 2VXVH 4LDLB 4NSKB 2EZ0C 2KZ1B 2ATKA 3QDMA 4H1LH 1RZGB 3T0VA 2IFGA 3ARFA 4QEGA 3VMNA 4KKCC 4XVSL 5TF1H 4OLWH 3QT2A 2IQ9L 4H8WL 5GS1A 1QFUL 5DEFA 1ZHKB 4WIQA 5E2WH 3T77B 3Q5TA 5CINH 1KIPA 4C83A 2AJVH 3X3FH 4KI1A 5J11C 2VLRB 1UQSB 1W2KT 4WY7H 3D1MC 4P2RA 3A6CH 3GSVB 1WWBX 5ICXB 5I1JH 4C56A 4XAKE 3K3QA 4QHMB 2W0FB 3H9HB 4BK5A 1YEKH 3UTZB 5FECB 1JZ7A 2QHRH 4D9RD 4KMLB 1F00I 3JUYA 1T3FB 2H26A 1G9NC 1ZVYA 5GRYA 3QUZA 3RX8A 3ARBA 1TQCB 4J7RA 4L3EA 1MFCL 5LCVL 1DE4A 1GCFA 3NCFB 1RUQH 2DQTH 5C86A 1JWMB 1CR9L 4W4OC 1XEDA 2WMPA 4GQ9L 1A2YB 1GOFA 2Z92B 3L3IA 4Q0XH 2OR7A 3WDHA 2HA1A 4I2XA 3L3DA 1WT5C 3H3PL 4JRXD 4PREA 3KDMB 1PJ9A 3PGDA 4KHXL 4P2QA 2O5YH 4X6CA 3BOVA 5TPWL 1J11A 4X80H 5JDSB 5ANMA 4Z7QF 2JIXB 3GM0A 3M1BA 3BO8A 4N8CH 5DZNA 1CXEA 4CL7A 5KOVC 1XIWD 3S4SB 1UJ3C 4TUOB 4U0RB 5AZEH 3BQUD 3SPVA 2WWMD 1ZKAA 1MWAL 4H1LG 3JWDH 2FNBA 4MDJB 4GAJH 4HXBL 3VD7A 1PKQA 2OMBA 3TJHD 2IG2L 4AIZA 5D71H 3CFEB 3RGHA 2VL5A 3CVHH 3T2NH 1UACH 5ACMA 2MCG1 2B1AL 2B4CL 2GSGA 2WW8A 1OCWL 5JQHC 3WFBH 4LVOB 4PGBB 3VGGA 2QQQA 5IB5B 4RIRB 4WW2F 3H0TA 4XWOC 1I4FA 2XYCA 4NQEB 3RNQB 1I85C 4KRPB 3CK0L 4KZEH 1YPZE 3KNBA 1Q1JH 1TVBB 3V8CA 3WNMA 1T21A 3PV6A 5DMGD 4AM0B 2R0ZL 5E95B 3W0WE 1A5FL 5F96L 4FQHA 3LD8B 1UXSA 2AK1H 1YEKL 5FO8B 2XTJB 1BGXH 5J1TC 3V7AG 4LKCB 1UWGH 3MO1A 4UV7H 1A21A 3LN5A 4IDLA 4RNRA 5CIPB 3SJVD 3VFRB 1NC4D 4BH7A 5C0JA 1QUNA 5FEBA 5E8EB 3GMNA 3C2SA 5GSRB 4K23L 5CP7A 5F9OH 4F15C 4WNQA 2A83A 3LHPH 3RWIA 3PHQB 5J0BA 3ROOA 3KYMB 4EN3B 4LIQL 2P8PA 2WLYA 5DJ6A 1ZWIB 3PDDA 4WJ5A 4KPHL 5J9PB 4XPHH 3U30B 5E2TL 3ZTNL 3ULVC 2EEDA 5D7SL 2JB5L 4X8XA 4WUKL 3G6JA 4EN3C 1FYHB 1EVTC 1Q8MA 2IADB 4DVBA 3WFHB 4HH9A 1A1OB 1KLFA 5BXFB 4YXLL 1MAML 1AKJD 5D8JH 4R2GD 3CVIL 3LKQB 5ICZB 2EDBA 4ORGB 2NZ9D 2AK4B 3MLRH 1BIIA 3PHSA 3PIQB 3GUTA 2FECI 5ADPL 4W6WB 4Z95H 1JTPA 3M8OH 5J6GB 1WICA 2ZCKH 2AEIT 5EFIA 1W72B 4NWTL 2V5MA 3FTGB 3BPOC 4W70A 3DX6B 4G9FA 4B7LA 2CLZB 5I0ZA 1NBYA 3KPNA 4R7NA 3VH8B 4WO4C 3LDBC 1A7RL 1JZ3A 1NMCB 5EC1A 4TQEL 2DJ4A 5SWZD 3IFPA 2EEBA 2R9HC 4UTAH 3IVKA 5DEGA 3NFNB 1CD0A 3ARXA 4OLYH 1U2CA 3LQMA 4H20H 5D6CB 1QSFE 2AXGA 1VESA 3GKWL 3RPIA 4YHZL 4HIIB 1DJSA 5HHQA 3QIUB 2D31A 1R6VA 2ZUVA 4X83A 1FL6A 3KPMA 2IH1A 4MQ7B 1A3LH 5GS1B 3HUJF 1JTTA 4JFPA 1YUHA 5KVFL 5I30L 3VFVB 1EGJA 2BNRA 4IRJD 3MNVB 4HFWA 3E6HB 2X4TA 1FCCA 2HKFH 3TA3A 1YY8A 1X6LA 3NACL 4NQDE 3S5LB 2P8MA 4DUVA 3EUUA 4JRXE 1IC4H 3TN0D 3ARRA 1H3TA 5EC2B 3MV9E 1CZ8L 1OSZA 4NKOA 3QHTC 4JJHA 2DB8A 1S7RB 2H9GB 4G43B 2D9CA 1I8MA 5I1DB 4FQIH 3NN8B 1LK3H 4MZ3A 4BFIA 1G9NH 5E6IC 3MFGB 5IIEA 1GGUA 3EGSA 4Y2OA 3FAXA 3QRGH 2X4PA 2FWOA 1A7PH 1CDIA 2WUCH 2W0FA 5KW9H 2MFNA 2ZCHH 3S35X 4JB9L 2WM0A 2YRPA 1DQTA 1VFUA 4UUJB 4XCEB 3L5WB 4YHIA 4UBDD 4NQTA 3SDXF 2N56A 2H26B 4C54A 1R24B 5HVFB 1S8DA 1XGRB 5IKCB 1TZGH 4OZ4B 3VRIA 2VIRA 3PP4H 1MFNA 1R3IL 4KROD 2R0LL 1ACYH 2EDRA 3BW9B 2VDQL 4PGEB 1JWMA 3S8WA 3VXUA 3EJZC 4KXZH 1QA9A 5MENA 2A6IA 5AZ2L 4FFVC 3FCTB 1L0YA 4Z7UE 1T0NA 3O6MH 2Q20A 2XA8H 3BP7B 4ZUTA 5D7LB 2KBGA 3CUPA 3P11H 4U1NA 1W0WB 1KXVC 1KELL 3JBG7 1H3PH 1H15A 4XBPB 3CNKA 5F9DC 3ZTNH 1EZVY 3MNWB 5I1CL 3CSPA 3QFJE 4ZUVB 1QFWL 4LCWA 1BBDL 5GS1C 3KPLB 5M95B 4XCCL 1SMAA 1AY1H 2VUOA 4YXLH 4P4KA 5KJRH 2EH8L 3P77A 2W91A 3HNTH 1OW0C 1S3KL 4MB4A 3KAAA 3WHXA 4M7LH 3D0VB 4YDIH 4XVJL 3D85D 1NSNL 1F11B 3HAEG 4YDVA 3W39B 1P2CB 1X5ZA 3JV6A 4L9DA 3D39E 4DGVH 3H7BA 4JAMA 2R56L 1RD6A 2Y7QA 4ZYKA 4MA8H 3MUZ1 1IAIM 3VXSD 3QAZC 3IGAB 4KUCF 3L7FB 1U6AL 2IPKA 1BPVA 1INQB 3X13A 5DUBA 1A6TB 4AMKH 1EEYA 2W60B 1JJUA 5E8NA 5CBAB 1B2WL 3P73B 2PCPB 3ROOB 3SO3C 2MCPH 3S34H 3C60D 5CGTA 5DRWB 1C08A 2GK2A 1AFVH 2OM5A 1T20B 2VDLL 5DRWA 4J1UA 4JRYB 1I1AC 3D48R 4JVWA 1DBJL 1Z5LB 2NY3C 4KROB 1MJJA 2VDOH 5EU4B 1HDMA 3IRPX 5C09B 3MUJA 5HGBA 2J7LA 1I1CA 3ULUF 4GRWF 2K1MA 4UQ2A 4N9GB 4YGVA 1J1XH 5T3XE 2XI9A 2BC4A 5AG9A 1E4KC 4YGVB 2DM3A 1HQRB 5D2LE 5F3BA 4RWYL 5ELIA 4LRIA 2BSTB 3ZHLA 3OKDA 2BSRB 4PR5B 2EKJA 3VMOA 4PGJA 2OTUA 1DVFB 1UZ6E 5T3ZD 3ARYA 3VE0A 4WI8A 3T08A 1AO7A 1FSKB 1I7RB 5ABDE 2X1QA 4I18A 1F3DH 2HJLA 4PJBF 1RSFA 4Z9KB 1AC0A 5DD3H 2ZZUT 5FHBH 4Q0XL 1YDPA 1Q9KA 3QDGA 2B4CC 4HC1A 1UB6B 2CDFA 2NXYD 4KI5E 4DZBA 5I71B 1JFQL 2DN7A 3QXWA 3MRIB 2YXFA 2DQFB 4C56D 5MI0C 2CDGA 4Y5VB 5TGBA 2OP4H 5E8PB 2EXWC 1HQ4A 1TCMA 3PL6D 4PUBH 5KSUB 5LQBH 4PJIE 4PV8B 3MYJA 1A6ZB 5C0CE 3C2AH 1CLYL 3CMOH 4KRNA 4PRHD 5CJQH 2XA8L 1WBYB 1PSKL 4GAGH 5GZOD 4ZUVA 4HKZA 4HWZA 3QEUA 4Z78B 3QEQA 2UWEA 2P5WD 5FGRA 1UWGL 4FMFA 1IC7H 4D0DB 5CLWA 4P5KB 5GGVY 2I07B 3I2CL 4XPGH 4U49A 1IEBB 1S7VA 4M5YH 1GVIA 4XC3H 5ESAB 3WKMH 4PRID 2JJVA 4HIEA 2XKUA 2XFXA 1BHGA 2PUQT 12E8L 1EXUB 3DYOA 3OR7B 1KIRA 4KTYA 5HD8C 3WE6B 3MA9H 4ZAKA 1MF2L 1S7SA 4K94H 3BEVA 2X4PB 4C55A 2WLZA 4HS3B 2IG2H 3MV7E 1YNTB 2AXJA 2OTWB 5C6TH 3MLUL 1IQDA 1EAJA 1XGQA 3VRIB 4BFIB 1P5UA 3O6FA 5C8JB 1W0YT 2AV7B 1RI8A 3NMEA 4YHLL 5DGRA 2NX5E 3O4OB 1JYWA 4OD1L 2XNAA 4NZTL 5IQ7L 1JL8A 3E3QE 3MBXL 4BUHA 2WK2A 4J4PC 4WFFD 5E6IA 5ITFA 3VXOB 3DRTA 5AUMB 3EYOB 1D5BA 3ZKND 3TO4A 4K7PH 4NPYB 1YECH 3V7MA 3OF6A 4R97B 3O2VL 3QDJE 2WP3T 4JQVC 3ILPB 5J3HC 1A2YA 5MEQB 3ROLA 4Y4HB 1F45A 2FJFB 3PV7A 4RGOH 4P2OC 3STZB 3TFKC 2EKSA 3MYJB 2CLRB 5GGSA 3KPSD 3TM6A 2RB8A 4M7KL 3MRMB 2SEBB 3A6OA 1ZLUK 4OIIL 1CVRA 5SWQB 3DV6B 1HZHH 2X10A 2HFEA 3ULVL 2IWGA 1MCSA 4BZ2L 3VD9A 4G8IA 2BZDA 4FQCH 1ZAGA 5SV4A 2LVEA 1BFOA 1OGAA 2F5BL 2GTWB 5HHXH 2BDNL 4L8SB 3CCHA 4PRAB 2EYTB 1F6AB 5I18H 4M8QA 4E41E 3EW3B 4DZ8B 2XWTB 1G6VK 4JFZH 4G42A 5IEKB 3QDGE 2O5ZL 3H9SE 1ZK9A 2YSSA 1AO7B 1IAKB 5DT1L 4ZUSB 1M6OB 5BS0D 4WV1B 5CJ8A 1IGJB 2YBRB 5FCSH 1H3WM 5I1KL 3F58H 4P2QD 5B39B 1DBKL 4GXUM 1YYLH 3RTQB 1YDPB 4OJFL 2CMRL 1UWXK 4K7FA 1FVCB 4WWKD 5D9SB 2FEDC 4CU6A 3LKSA 4PY8I 1I8LC 3ZTJH 1WBXA 5EIIB 4ODWA 3NFNA 1N5AA 1HNFA 2VYRE 4X99B 1GL4B 2DYPD 3DO7A 5TDNA 3HZKB 3O8XD 1KN4H 4LBEB 2YMXH 5DMIH 4MSWB 5GS2D 3AU1B 5DD6B 1KULA 2DLIA 4K3HA 5F9WC 4NZTH 5IQ7H 3KYMA 1Z5LA 5EU4A 4EN3A 5HY9B 1VFBB 4LBEA 5IHUH 3LQAC 4Y89A 4WEUD 3C87A 3U4BL 4WW2B 1HI6A 5CP7B 3K1DA 4AY0A 1RK0B 4HWUA 4MA7H 2VXQL 3S96A 5IK3A 32C2B 1IBGH 1FJ1A 3IXTB 1KV3A 3J7HA 1P5VA 4JFYB 4TNWF 2VLJA 1MRFH 1RFDH 5LBSH 3F5WA 4FTVB 1DLHA 2P43B 1B0RA 5ALBH 5AAWA 3IKCA 4GKSB 2DS4A 1TCRB 3K46A 4HXAL 5A1AA 3GSRB 3AS2A 4XVTL 3T2OA 1JF1B 3ZE2F 4XRCB 4BYHA 4J2XA 4CJ1A 5IVXB 2A74B 4HS6A 1J0HA 5IJKC 3BPCB 1UKQA 4Z7QE 3WS6A 4OBRA 4JZOA 2OZ4L 3D0VA 2XN9E 4P23B 4MCYB 4P5MA 4Z7WB 4NNPH 2A6KB 3BPNC 4HIHB 1M7IB 2AJUL 4ZSOB 1LE9A 5KW9L 3N0PB 1KPRB 3GBML 3MRRA 5LJYH 1T2QL 4PLKC 5CEZD 3GBNL 4Z7WF 4AZ8A 1FGVH 5GS0H 3QHZL 3WLBB 1CLOH 1UM6L 1ZT1A 5DEGB 5T1DL 1N6QH 4H5SB 2V9QA 2XZQH 4ZS7L 1CIUA 3PQYD 3R1GL 2CLRA 3PWLA 2DYPA 2R2BA 1NGWB 4L4TA 3BW9A 1NCWL 4PGEA 3KYNB 2BMKB 4NRYB 2Q8AH 1T2XA 5D1ZC 3D6GA 1ND0A 2ZNWA 5LAXB 1PG7H 4GW1A 1NDMA 1CICB 4OLVH 2XQBL 5DC9B 4TVPE 5ISZE 1U8OB 3WFZA 3FFCE 1ZANL 3ORJA 4U6HA 2HLAA 2UZXB 2ICCA 4RWHA 2ARJA 3ALXA 3P11L 5D6DC 2CRMA 3CLEL 1FG2B 3VXRD 4CBPA 2NXZC 2R2HA 2WUBL 1MFAH 4UQ2B 3U83A 3D3VE 2X9WA 3KPPB 3KR3H 1AH1A 2BXZA 3MLTB 4K3DL 4Y5YB 3LS5H 2D0GA 5FECA 2BNUA 5JMRA 3PP3H 2RR3A 3IFNH 2OK0L 1RZIA 1BQHG 1A6WH 1NEZA 5HPOA 4NO3B 1AQDA 1MELA 1A0QL 2JELH 4R7DA 3I02A 1TENA 4MQXC 1XR8B 1NAKH 4ORZC 2APVA 1XF5B 1IAIH 1CTOA 3IAPA 5GGTA 3NCMA 4QRRB 4P23C 4G7VH 3MLXL 5BRZE 3WDJA 4QXTA 3ME0A 3FO1B 5DUBB 2IBZX 4JM4H 1X5AA 3WNLA 3QULA 5IWLC 3NH7H 4ZFGL 5C09D 1QR1B 3EYFB 3K0WA 4MAUH 4ZXBC 5GGSY 2JCCB 5DURB 1K8IB 2R1XB 4ETQA 3NPSB 1BFOB 2BNRB 2CDEB 3RVWD 1OAKH 3QWRD 3ZSSA 3MLWH 3ECBA 5I1IH 5EWIL 1SEBB 2EDXA 3FO2A 4DZ8A 3UO1L 2EKSB 4UOJA 4PJ7E 1XF1A 4GXVL 5J57B 2NY4D 4X5XB 4AEIH 1OP3K 1E6OH 5TQ0H 5EU6B 3HC3H 2LTQC 1A6AA 3U2SB 3R0MA 4HFUH 5GRJH 3BH9B 4HV8B 2HFEB 1GGYA 4BFBD 4UOW0 5D2NB 1GHFH 3MR9B 3NPSC 2VLKE 3JXAA 4K3JL 1Q9OA 4GKZB 4X0KB 4QOKB 1JV5B 1QSFA 2DQDH 4BQ8A 3MJ8A 5EUOA 2M26A 5KVEL 4APQA 3RA7H 4JKLA 4J3UA 3CVIH 4KI5F 1E6JH 1I8IB 4L5FL 5ADOH 4Z7WE 4LLMB 4X4XA 4AIOA 2DQUL 4HGWB 5GRVK 1KFAH 2OQJA 2JIXD 4JO3H 4ZFZA 2JB5H 2BNQE 2HTLD 4ZOBA 1BVKA 3C9NA 2BRQA 5IVXE 5GRXG 2DLHA 5EU7C 2Z31D 3MLSH 1FNGB 4LEXH 2FCBA 1A7QH 4IOIB 4EJ1C 3MXWH 3GSNH 2AI0L 2D0HA 3HAEA 4FHBD 4PRDB 4YJZL 1IKFH 3F6IA 2FB4H 1MCWW 1MHPL 3GKWH 3HB3C 3FT2B 3AB0C 3IF1A 3SBWC 3U7WH 2GT9B 2XQYK 1U8KB 1ZMYA 4X5XA 3RWHB 3MRGB 4X5WB 3A6CL 1JHTB 3VRJA 1SY6A 1XGYL 4DKFH 3WFHA 2PW2B 1OWRM 1G6RB 3CC5B 5DC4B 1U92A 5A2KH 3DVGA 4MVBC 5H94A 1G9EA 3A0OA 3BPCA 4XWGL 4RMUA 2ZG2A 4MS8C 1TJIH 3IDNB 3QUKB 2X4OA 4ZTPH 1EFQA 1CDCA 2X42A 3QDAA 2C4XA 3RVVC 5DQDL 5ID0B 5E1AB 2WSKA 3ILQD 2MPAH 2Z4QA 3GIZH 4MDIB 1UH3A 1PKQB 3OKEA 3B6SA 4WVRA 2GKIA 4LLQA 4AEHH 5IESH 4ZSOA 1A6WL 5GSVB 4LLQB 2MWCA 5KSBF 3KPSE 4M62H 4F37F 4BUGA 1I75A 4WTZA 1IC4L 1YMHB 1XF3B 5IB1A 5I1GH 3FRUA 1AP2A 4PRIA 3CLFL 1S78D 4APQC 5L0QC 4LL9A 1RK1A 5DWUL 1G7LA 1RZ8B 2EDLA 5DMKA 3TCXA 1IGCH 5HSFA 2I9LA 2ZP0T 1HHKA 1QO3A 3W5MA 4NBZB 3T3PE 3JWDL 4ODVL 2NX5D 5DEZA 3MJ9A 3RY6A 4KQ4L 1X5XA 3FZUC 5E8EA 5IVZB 1LQSR 3KXFE 4LMQI 4N5EC 4YR6A 2P24B 1MI5B 5E2UL 1DZBA 4JY6B 4WV1A 5IK3B 4L4JA 3WXWL 4OIIH 3MR9A 3GMPA 1CWVA 3QA3B 1Z9OA 2A6DA 4I3SH 1Z6JT 2C3GA 1L4IA 1NGYB 2ADJB 1OPGL 5AD0B 4Z7NF 1HHIA 2CRZA 3SN6N 1P7QD 3VRLF 4ENED 1B6UA 1YJDL 2X1XR 2VISB 4P2RB 4GG8A 2F5AL 4M3JA 4PJXA 4ODWB 3S98A 2DBLH 1A9BB 2AKRB 4WDIA 4XTRD 2G9HA 4LKCA 3SKMB 3WD5H 4NNXB 1WJ3A 1UT9A 4L3EE 3OSKA 1EEUA 4CVXB 1I9JL 3AY4C 1QPPA 3GMNB 1J7VR 5D1XD 5EZLB 1NBQA 1VFAB 1UC6A 3DURB 4KDTA 4DW2H 3SGKA 1JMXA 5BV7C 5D7LA 4ZTOH 4N9OB 5CHNA 1YNKL 1FH5L 2V7NB 3BT2L 2DAVA 3O2DH 2XWJB 2FYYA 8FABA 2H2SD 3JWOC 3NA4A 5E08L 1K4CB 2WANA 3PWJB 3GMQA 1G9ML 1TCRA 1RZGA 5KBNC 5L88L 4MVBD 1FAKT 3O8XB 3DUUA 4M9OA 3QQ9C 1MHHB 3KXFB 1A5FH 4QT5A 4DWHA 1HXMA 1P1ZA 1T2QH 4ESKA 1ZTXL 1BGXL 1VEMA 2C4FT 4PG2C 1H5BC 3DX8B 1MCPH 1CTNA 2OJEA 3UC0H 4IMLA 4M7ZC 3GZKA 4ODHL 2AERT 5EU5B 3FQRB 4JJ5A 3GJEB 2AJXL 5GJSH 1C5BL 3BYTA 4OZIE 2B5IB 5LWYL 4KROC 3VWJA 4Q2ZB 3O2DA 2W0PA 2UV3A 4MJ6B 4ODVH 3MRFA 5C08D 4D8PB 1YQVL 5L8LB 1IC5L 3P9MA 4LKXA 1Y6NR 4PJHA 5EOQL 3WDIA 2FX7L 3RVWC 1RJZB 4UTAL 1NCTA 4E42B 2GTZB 4MQTB 4NUGL 2CKBB 3TJEL 1HHJA 3KPRD 3TZVA 1KCRH 3C60B 1IGYB 4G9FD 4JG0L 4QRPD 2AABH 3HB3D 5TE4H 5HI3D 5FO9B 2VL4A 5EOCL 2DL9A 4WFFE 4LAQH 5IJKA 1J8HA 3B9KC 5D7IE 4OI8A 3GI9L 4WUUA 4XNQA 4Y4KC 1KTDB 3R1GH 4LGSB 3WBDA 3T0DA 5D70L 2F9BT 4QHUA 4XP9H 2NW3A 1XFPA 4PRPE 3ZL4L 3RUGF 4DK3A 1KCSH 2Q8BL 2V9TA 1FGVL 5GS0L 4JHWH 4ELME 4HCRL 5CSZB 1BX2B 3FO9A 1SYSB 4CVZA 1G9MC 5I2IB 4JFEA 2R2HB 4PB9H 1FC2D 1FZOB 3QIWD 1NMBL 2Q86A 4JFFD 2MHAB 2E7BA 3N1QC 4GW1B 2ATPB 2UVFA 1ZHNB 4BZ1H 3VXRA 4JPWH 1T6WA 3O2DL 1A7OH 5KOMC 2JJSA 2VZSA 1TFHA 2OTUB 1AGFB 5EUOF 5I76A 1MLCA 5GIRA 1MFBH 4Y5XB 3HC0B 3WUZA 4PGDB 1IC7L 2IANA 4MXVF 4YC2C 1IAMA 1MQKL 4Q9BA 2J3SA 4Y16B 1FZKA 4N0UE 1LVEA 4EIGB 1CE6B 4D3CH 4RCAA 5T33L 4XNUH 2BY0A 4KWUA 5EFIB 3WD5L 3NIDF 4YXHL 3SDXA 1YN7B 4MS8D 5IEHB 3PWPE 5E00A 2V2TA 3VG9B 3HMXA 5DJ8B 3BP6B 5B38A 12E8H 4QKXB 1IEAA 3TA3C 1BQHB 2X1WL 3DROA 3G5VA 3VXUD 1FNLA 1OP5H 5KVDL 3QFJB 3T0EC 5I1LA 4JFFB 1GPOH 3WL9B 5C6WH 3DROB 3G5VB 4N0RA 1W72H 3TBYB 1KB5H 3EFDH 4HG4K 1RHHB 3DIFB 3K4ZA 4YR6B 4PJ7B 4YFDB 1X3DA 5C7XH 4DAGH 4NHCL 3D87B 1LDPL 2XTJD 1OP3H 4QWWC 1VB9A 2UZIH 1U3HB 4HUXA 4LVNB 5IV2A 3QZWG 2DM7A 3L3GA 5BV7H 1QBLL 3SCMD 4LNRA 3BZ4A 3NIGE 5B8CC 1UEYA 4HQQL 4L3CA 2ERJB 3LAFA 4AG4L 3I6LE 4HLJA 3ZE2E 1I4FB 4K3JH 3C8HA 4J4PA 5B22A 4MAYB 5JLZB 1UM4H 5FA4B 3VFWA 3BEWA 3MZGB 4JO2H 1CFVH 4G8FB 3QFDB 4X4XB 3VFSA 5MEQA 2NTSP 2FECL 1YJDC 2HT2C 4Y5XC 1RIHL 2DTML 2DF3A 2Q76B 4MAYC 3F7YB 3IKKA 3QDHA 3QCUH 3B8YA 4LHUG 1J0IA 5IW6A 2V7NA 5DUPH 3LDBB 4ZAKC 3OR6A 2I25N 4QF1A 4MSWA 3ARFB 1IMHC 1DQDH 3U0WH 3HNVL 4HF5L 1KLUA 1QSFD 3KDMA 2D03H 1BBJA 3LV3A 5IWLA 1ZLWH 4JFOB 4UZGA 2VZVA 5FM5M 4A6YH 5SWQA 1WVZA 5B21A 4W68A 5FGBC 4PRAA 5BZWB 2WNGA 2YKLL 3VXTB 4EDXB 4YHMH 5F6IC 1IM3A 3AAZA 4UIMB 1JNNH 2X4UB 5T1MA 5BW7C 1WITA 4JPIA 3DXAE 4XMLL 3CUPB 5AYQA 3UBXI 2MCPL 4WWKA 3QNYB 1T22B 1CFBA 2NTFA 5LGJA 1RUPL 1K5NA 3BQUC 3GSQB 1OF2A 1INEL 3HZMB 4KRPC 5KVMC 4ISVB 3SDAB 1YEJH 3OZ9H 3QQ3A 5FO9A 1OF2B 1I85A 5TF0A 4KTEL 1TTFA 4IOFD 3SJVE 3QP3A 3VFGL 1AIFA 3D39A 2FJGA 4P46B 3MUY1 4OI9A 3LPWA 2H32A 3MGOB 1CLZH 4ZFZB 2FX9L 5E5UB 5J12B 3IGAA 3IU4H 1WUNT 4QHMA 5D9SA 5D72L 4DFHA 4KGJA 4X98A 1G0XA 1VACB 2WP3O 3DVIA 5JDJA 1LMKA 4XH2A 4YAQA 1N7ML 5KSUA 4LCWE 1YMME 5MEPB 2DI9A 2C3XA 5I0DA 3SDCB 2X89D 4MQ7A 4HPYH 4WFED 1R0AH 1MI5D 2HT3C 1WWCA 1FCGA 3S4SG 1A3QA 2FHFA 5ETUA 5GGVH 3O4OC 1J5OL 4OCRH 5DQJB 3LQAL 2Z91A 3B2VL 5BZWA 2LQRA 4ZG1A 2HLAB 4UNTA 2QL1A 1KACB 1UQSA 4O5LH 1H15B 4XBPA 4DEPB 2EYRB 1T80A 4ODXB 3VXUE 4G8GE 3WSQH 5F8RC 4GG8B 5D7JD 3TO4D 1FV1A 1Q94B 4B53A 3C6SA 4FZ8H 4CN6A 1PY4A 4M1CD 4GG6F 3MGAA 1HXYB 4CVWA 4OLZL 1SJEA 2V2WA 3V8OA 1QSZA 1B4JH 1NBYB 5KVFH 5BOPA 3ARBC 4U7MA 3VFOB 3RVTD 5JXAH 3W0WB 4QCIA 1NCWH 3L6FB 2N7AA 4HS8L 2Y4SA 1OPGH 3MRPA 2NR6C 1CGVA 2Y07L 2YRZA 4HQQH 5FB8A 3VFWB 4PJ7F 4UILL 4BKLA 1E4WL 2DQJH 3OXRB 3UJJL 5HYSG 15C8H 2V5RA 4NZDA 2YEZA 5GJTH 1W0VA 3IDGA 4Y5VC 1BQHA 4LLUB 1L7IL 3IFNL 3FQWB 1JK8B 3JUZA 1JYNA 3TBYA 1D5ZB 4NN7B 4R4ND 4E9LA 1SMOA 4XAWH 1MFAL 1Z0MA 4JRXA 1OB1A 2X5PA 2DQFA 2H3NA 2PCPA 2IQ9H 4H8WH 5E9DE 4UT9L 3FO0L 4RFNC 4GW4A 5L9DL 1EEZA 5DMKB 5HHXL 1DSFH 3FQNB 1FP5A 4HH9B 5I18L 2PO6A 1HHKB 1QO3B 1G7MA 2UY6A 2CXKA 4Y4FD 5C0RL 4ZDHB 4LAJH 4ZXBB 2EDNA 2ZNXA 5IROA 2VDKH 2AJXH 4KRLB 1F4YH 1HI6B 1MNUH 3PGFL 3CFJA 3A67H 3HHRB 3MC0A 3H6JA 5I1HL 4DOHE 4GG6A 3TT1H 4CADB 1Q9OB 4GKZA 2EECA 4HW6A 4I3RH 1CGSH 4LLYA 4GRLA 3TVMC 4PYGA 4KU1A 3SCMB 4HSQA 2WAHA 3BD3A 1WLHA 2PN5A 3OTTA 5ESVA 3C6LA 4U31A 4G9FE 1HYSC 1NMAL 3OAUH 4FQHB 5F8QC 3RUGE 3PL6B 3J8F7 3BDXA 1HKLL 5IJVA 4OZHA 3RY5A 5BJTA 4GXVH 1Q0XH 5GPRA 2BDNH 1HKFA 2YUZA 3T2QA 4OD2B 1JNHA 3RUGB 2ADGB 3CDGA 5CJBA 2ARWA 4PLJD 5D1QD 1IZKA 4YEEA 4J12A 2FH8A 4G9FB 1IJ9A 1CIDA 2NXYB 4MD4A 3WFCH 4MCYA 4P5MB 3MRQA 3V4PL 2IGFH 5TPWH 3MJ7A 1CXHA 4MA7L 4YC2B 2OBGA 3U4EB 1RPQA 4FP8L 3UBXA 3E6FA 1SVZA 5DLML 1J12A 1JZ8A 2RIKA 2GUOB 4YBHA 5JTWA 3UPAA 1J05A 1I7ZB 1URLA 4HAGA 4FTVA 3VXNA 1MUJA 1ZSDA 4YXHH 2QR0B 4KJWD 4X6DA 1BMGA 3V5DB 1KC5H 5LGHH 5FUCE 2PW2A 1JUFB 2B4CH 2BFVL 4JZJB 1Y18B 2HT4D 4FQJL 5FO7B 5D2LF 3QNYA 2JIXA 4LQ1A 3GHEL 5E4IA 3H42H 4YIQA 2J6EL 3GSOA 4KK6C 4WHDA 1A4JB 1NBZB 1B2WH 4PPTA 2APTA 4HMDA 4KZEL 5SX4I 3LS4L 1Q1JL 2ZPKH 2XXMB 3QEHB 1D6EB 5SX4H 4NWUL 4NQXA 2BSSA 2CIKB 5F1OB 2OS7A 1YPZA 4NFBA 2GTZA 1U95B 1DL7H 5L0QB 2J8UF 2XWTA 4Z0BL 3ZDXE 1S7RA 2C7UB 3CFCH 4G43A 4WW1A 5T5FH 1D5MA 2X4NB 5L6YL 4OM1L 3SCMC 4LPXA 3OXSB 3WIHH 4S2SB 1AR2A 1UKSA 4WO4A 1O7VA 2VZ3A 1WC7B 1N2RB 2XN9D 2O61B 3O11A 1JGDB 5HGAA 3WO3B 2EE2A 1PKQE 3H0TB 1R3KB 4MCZB 2Z8WC 4AEHL 4KKAC 4YZFE 5E2TH 4GJTB 5TDOA 2A9ML 3QHFL 3QQ4A 1JNLH 3N1MC 3P0YL 3QIBC 4HUNB 4WEMB 3ULVE 2WINA 3PL6C 2Z91B 5F6IB 5IW1B 4OZ4A 2XZCL 2PW1A 3WXVL 5BQ7A 1UH2A 2VC2H 3ETBF 2F8XC 2WBJD 3KXFA 5J1SC 5FM5O 2H9GA 3MROB 3KPLA 3QEUB 4O02H 1KENL 2JCCA 4NM4L 4ZPVB 1KJVA