4HPOL

Crystal structure of rv144-elicited antibody ch58 in complex with v2 peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
b'NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoL01
1QLRB 3L3OA 2QSVA 5CD3B 2YZ8A 1WZLA 4NPYA 4OLZH 3LRSA 4LDEB 2HJFB 3PV6B 5CZXC 3MRMB 1OW0C 1BGXL 5IHZB 1B90A 5DT1L 1FYHB 4ODUA 1FAKT 1Q9OA 3ARPA 3KPSE 3WFZA 2VR9A 4NRZA 5D1XA 2BSSA 2QQKL 1PY4A 1JZ6A 4PJ8A 2J3SA 2WUBH 4M5ZL 1KPUA 2BVTA 1SYSA 3FCTB 4RFEA 3BESR 3MV8E 4U2ZA 1BQLL 3SDAA 3UTZB 3UDWC 5IQ9B 1LO5A 5EUOA 4BK4A 4JPVH 3DBXA 4MXWH 1RI8A 3QCTH 4PB0H 4NQCB 1T03H 3VFOB 3B3IB 4RA3A 43C9B 1UVQB 4I77L 4ZYKA 1U8MA 2ARJA 4PJCA 4LLYB 2KQNA 2NY6C 4G42B 5KW9L 3RKDC 1HHHA 1A9BB 1ZEAL 3KPOA 2PW1A 1U8LB 4OFPA 4WI6A 5C2BH 3QDGE 1HZHH 5HGAB 3RVXD 1AR1D 2AJXH 2CJUH 4PJ7F 2VXSH 4NZUH 2E9BA 1IQDA 3RL2B 2F53D 1HIMH 4W6YB 5JXEC 4EVNA 3P0VH 3QI9C 2VE6B 5ANMA 5J6GB 2A73B 4OZGE 4OZHB 3EO0B 1BQHG 4S1RH 5D70L 1ZTXH 5D1QA 5TE4H 2ZUQB 4H20L 1HINH 1SEQH 5J13C 5IROC 1JPGB 3HRPA 2DYPD 4X4ME 2BOCB 3O8XB 3DO7B 1IQWH 3WFDH 1CXHA 1KB9J 4JFXA 2RAMA 3C60B 1J0HA 1G9NL 5BO1L 4UDTB 4UT9H 3VWJA 1OLZA 3MR9A 1MQKL 2GITA 2E9IA 3QEUB 4JZNA 3BPLB 3WIFA 1DTUA 3U9UA 5BVPH 3GBLA 1L7TH 1WITA 3DMMB 4U1SA 1F3DJ 1I8MA 1VKXA 3CFKB 4N0CC 2NX5A 3ULVE 2AXGA 4NN7C 2R8SH 1I3VA 3SPVB 4XNUL 4UNTA 4YJZL 5DGQA 4Z95H 4JKPH 5JPMA 2OTPA 4FMFA 3DX6B 3T0AA 4RFOH 2ADFL 3KPQA 2IH3B 4UDUB 3NAAH 5FUZL 4B0MM 1P4BH 1RZ7H 4ZNEE 3Q1SL 5BRZA 3WYRA 5IB5A 2EYSA 3GKZA 5E95B 4C54A 4JR9H 1PQZA 4O2FB 3ARBB 4JO1H 3STZA 3GSNL 3T1FA 3FQXB 3D9AL 5EZIL 2UZYB 3KPMA 4LARH 4ELKA 3GSVA 1CIDA 1PG7X 5F9OL 1JZ8A 2PW2A 3KYMB 5A3IC 1WZMA 4P5KB 1JNHA 3ZLQC 1XGTB 5CBEA 4JB9H 1CFSB 1GIGH 2Q76B 3MNVB 4GW1B 4UV4H 4LL9A 4YPGB 1RUQH 3RI5K 4DN4L 5CKAA 1WFOA 3RX5A 1T0NB 1WIUA 2B2XH 3RKPA 2Z91A 4DEPB 2F53E 3A6CL 2PO6D 3R0MA 1LEKB 4M48H 1FGVH 4HWUA 1L6ZA 3B2VL 4FQLL 1NAKH 4HSQA 4NDMA 4IEFB 3NIFF 3QZWB 2IFFH 4UI2A 1VGEH 3H0TA 3KYOB 3E3QE 5C6WH 2ZUQC 9CGTA 4I13B 5IFAH 4X4XB 4OQTA 5GRZA 3C5ZD 1JHLH 3O8XC 4TSAH 1E4JA 2PYEA 3ULUD 2PKDA 3C60C 2CLZB 3ROLB 1WC7A 2XQBL 1ZLWH 2RGSA 3BPLC 1CZ8H 3RWCA 3DMMC 4HWZA 4HPOL 5JZ7C 3QIBA 5ECJE 2ADIB 5EZLA 2V5RA 4RZCA 3HI5H 3AAZA 2P4AB 4HLZH 4YXKH 2HFFA 4IDLA 4RGMB 2F8XC 1FVCB 5ITBH 3NBNA 1EHLL 2ZG2A 4ZFGL 5C0RH 2RJMA 1HH9A 5IUSA 1YJDH 3LKQA 3D18A 3SGKA 5KTEH 1R3KB 4L8CB 1DBJL 4X6CE 3MLUL 1UADC 4P23D 4KDTC 2KKQA 3C6LB 5DJ8A 3ARBC 3ZDXE 1LO3H 4KKLC 4H1LH 1IAIL 4RBPH 3OQ3B 2H6PA 3BQUD 3QH3B 3BZEB 3T3PF 1G6RL 4O51A 4L9LA 3O4OB 3DNKA 1Q9LB 1L0YA 3P9LA 4K3DH 3MRFB 5C6TH 1YZZA 3EGSB 2VLLA 4WDIB 3ZDZE 4OFYA 4LEOA 1EO5A 4AH2A 1X9QA 3ILPA 4QO1A 5ALCL 2EDNA 1A7QL 2XTJB 1XGUA 4DEPC 1NBVH 2QSCH 2AS5M 5HHPB 5TDOB 5HYSG 1JGVH 4HH9A 1EDQA 4M7LL 3O6FD 2HRPH 4X0KB 3B5TA 5FYJD 4NRXB 1A6UL 1T20A 2LU4A 1T0MA 4PRHB 4JZJA 4M6NH 4NFCA 3ULUE 5EUKA 2Q7NA 3W9EB 2R69H 2DRUA 1IGFH 5I1GL 5IVXF 4MXVF 4NT6B 4XWOC 4J2XA 5DQDH 1J1OL 2NY5L 1KTLB 2C1PB 4L8SA 3ZSSA 3EO1B 2QTEA 3QWOB 4OZIF 4K3EL 5FO9A 5EO9A 1MLBA 3CPLB 1LE5B 3VXRD 1JWSB 4OIAA 4LCCB 4O5LL 4JJ5B 3GSQB 2EDXA 1ZHBA 3HE7A 4X7SL 1CD1A 3PF2A 3OTTA 4G8GA 3DECA 4JRXD 5DF0A 4U6YB 1XEDA 3EJZC 4D0DA 5ETUB 3LV3B 3OGCB 5I1HL 3ABZA 4RGMC 4H8WH 5DTFA 2OR9H 3A6BL 4S1DD 4X4ZA 1MCKA 3DX8B 5J9PB 3D2UB 1FVDB 4RX4D 1KB5H 2EH8L 2LE9A 4WI8A 3L3HB 3QPQC 1JMZA 1WFTA 2B1AH 4KVNL 3WJLA 3LAFA 2VLMD 4HK3N 3QUYD 2CK0H 5JORA 1LMKA 3EYOA 3FT4A 1WT5C 4CN1A 3C6LC 3S35X 1XR8B 1GYAA 2LVEA 2GJZB 1T66C 1YY9C 5HHVL 1KULA 1WCQA 4KJPC 2IG2H 1MPAL 3BRDA 3CSYA 4ZOEA 4Z7VE 1MCEA 3F65A 3INUH 2JJTC 5IMLA 2E7MA 5IG7A 3O4OC 1IKFH 4HUXB 4CVUA 1ZGLA 4XVTH 3FTGB 2DLFL 4JQIH 3BXNB 4JY5L 1FZMB 4KJYB 4QT5B 1CGSH 1G1YA 2CRZA 3LPGA 1MJ7L 2DIBA 1S7QB 1IM9B 2XTJC 5FYJE 4E5XA 4ERSH 2XYCA 4BFBD 2AJUL 3I75B 3MJ9L 4U6TA 4Z7OF 4NO2A 2OR8A 4HFWB 4Z0XB 4PRDB 4QHKJ 5GGSA 1G7MB 1QRND 1FRGL 4ZDHB 1I8LC 4MD0A 1OSPH 3VXOB 2W0PA 1WBZA 4OZ4B 1KEML 1JBJA 3OKLA 1MSPA 1T04A 1K85A 3VXRE 5FK9B 4QF1A 4LLMA 4ELMF 5C6PB 2Z31B 3WL9B 3IDIA 2KUTA 3HB3D 1DE4B 4XVUD 2A1WH 4FZ8H 5EORL 4OLVH 2E7LC 2BCKA 3GSNA 5B3JE 1YECL 1H8OA 1V7NL 3IJHB 4FZEH 1CFVH 4LCCC 4RIRA 5J12B 5LGHL 5EU5A 4MNHB 4F7EB 5DUML 4LPWA 3MRIB 3MC0A 2HT2D 5IEHA 1BD2B 1WTLA 1KTRL 3PQYB 1EK3A 2GHWB 3D6GA 4OCXL 1EJOL 5KZCD 4HCRH 2NW2A 3H9SB 4QCIB 4C58B 4BSVB 5T33H 1BX2A 3U7WL 2NY1D 1EO8L 2VLME 1MCFA 3S36L 5JIPA 1C7TA 4HAGA 3AGVA 1BJ1J 1GL4B 3MUY1 4ODTH 5I16A 2R0WH 1XF5B 3P40A 4NQTA 5IEKB 4W6WB 3MRPA 2DI7A 5EIVA 4RQQA 4WUKH 5ICXB 4L3EB 1DL7L 5GS2D 4IRZL 1F90H 3P4LA 1N5YL 3ETBF 5KVGL 3FO2B 4FTVB 1GZQB 5DFWH 5AAWA 4X4YB 3VI3F 1K8DA 4EN3A 1EVTC 1CLOL 3BWAB 3MBXH 3NFNB 2APTA 1PKQE 3CUPA 3G5XA 3LQAL 4HX1A 3HMXH 1KXVC 4N5EC 2IBZX 1D9KB 4J12A 1BIHA 1QRNE 3GJFK 1Q0YH 1OP3K 4ORZC 5HY9A 5AUMB 4XCNA 1FVEB 1KG0A 1KIQA 1MHEA 1A1MB 1A6VL 4KQ4H 1XF1A 3DROB 4RAUA 2OI9B 1MJUH 1DQDL 2WW8A 2H8PA 1UFUA 2EEBA 2OBGA 1AE6H 4CJ0A 4FQXA 1INDH 4TPRH 2E7BA 4HWEL 1F4WL 5GRVL 3RVTD 1DSFH 2YUWA 3STBA 1CGWA 5EB9A 5AD0A 4NC1C 3ARDB 4P3DB 2Z31C 4OLXH 4ZFFB 3ZT6A 3G6JF 2FEDD 4JFED 4N1HB 1RJZB 4UT6L 3SDDB 1XF3B 3TIEB 2V7HA 5J12C 4P9MH 3O3DB 2F8OA 4IOFC 2VSCA 5EC1B 2QQNH 1PSKL 1JFQH 5KJRH 3AY4A 4PJAB 1SJEA 1ZLUH 4JM4H 4AM0A 4Z7UE 1NMBH 3BD3A 5IP4A 3UX9B 4JFZH 2W0KA 4ZS7L 3BOVA 5FV2A 2ZUVA 3QEHA 4X6EB 5T3ZH 3V4PH 2DD8L 1KPVB 3RVWC 3K46A 4X80L 2FLBT 2VL5B 1NGXA 1U8IA 3V52H 5MEOA 4P49A 3QPQD 4HUMB 4TVPH 4ODHH 4N5UA 4XTRD 3QIWA 3UTOA 1V7ML 2XI9A 4PTUA 4PJHB 1U8NB 4NZDA 5J6HB 3H42L 3UYPA 1YYML 1T1WB 4DGYH 4LQFL 1I8IB 3WFHA 5CP3A 3O6ML 1SJVA 3WBDA 2OP4H 4N68A 3SQOH 3D25A 5CCKH 3HC4H 1HEZA 2H3NB 3I2CH 1S7SA 2VSDA 4FQ2L 3JUZA 5E9DB 2DWDB 5FYKL 1WFUA 3U46A 3MNWA 1BMGA 2WV3A 4JG0L 4OZFB 2Y25A 1VFOA 4HJGB 4GBXA 1CDYA 1ZSDB 1C5CH 2FZ3B 3CLFL 4R7DA 2QR0A 1D9KC 3QIUB 3OX8A 3DXAD 1U8OB 2IPUG 2VXUL 2NQCA 2OTWA 1B6UA 2VDMH 3GI9H 4PRHD 1NC4D 4E42A 5IJVB 1RZKH 1MIEL 4JVWA 3CVHL 1F3JB 1Q0XL 2OI9C 5D2NA 4OLZL 1AC6A 5T5FH 3PWJB 4JLRB 1OWRM 2AXHA 3QT2A 4KK6C 4F9PC 2YBRB 4JFEE 1AFVH 2NY4D 2BY1A 2PYFA 4P4RB 3ARDC 3LEVH 3OR7A 2GSGA 4ZXBA 2H32A 2WWKO 4OJFH 1IKNA 4NNPH 5I0ZA 4DQOH 2GK2A 4MD4A 3WN5A 3SDDC 1OTUD 2AV1A 4ODWA 4PJ5B 1BVLA 2M26A 35C8H 2D9CA 4M7LT 2EE3A 4FQCL 5E00A 1FNGB 3VWKA 4MXWL 5DQJB 4CUCA 1Q9WB 1T03L 3J8F7 3IU4H 3CCHB 2CRIA 4YQXH 1PFCA 3GM0A 3LH2L 3F5WA 4WNQA 1NCCH 3RNKA 3CMOH 5C2BL 1YYLL 2VO5A 2CJUL 5LXGL 1I7ZA 4NZUL 2O93L 1KIPB 3TYGH 1TZGH 3P0VL 3WS6A 5AWNL 4AEEA 3V6OC 1MI5A 4S1RL 4NQXB 2XKSA 1ZTXL 4LCWA 1NEZG 5TE4L 3O3UN 4ZS6D 5L88H 1HINL 4GRWB 1SEQL 4V1DD 4RISL 1A7RH 5E0QA 2GY7B 1IQWL 5HGDA 4RAHA 2FATL 1WBYB 2X41A 3D69B 1C5BL 1PY9A 3DUUB 2HP4A 5J0BA 1SVCP 3PXHA 1AKJD 1U0QA 5CEZL 4JDVA 4X8XA 1NFDB 5BVPL 4OGYH 5IB3B 3PJSA 3WHXB 4WWKD 2EC9U 1KJ2A 1P7KB 1UWEH 1ZWIB 1N26A 3GMNA 1LK3H 3FQUB 4DZBA 1NLDH 2X6MA 2W65B 3S5LB 2YPKA 3DXAE 4XB7A 4Y16D 1OAYL 1Z0MA 1AY1L 5AZ2H 2CKNA 4Z95L 3QIUC 4GAYA 5EU6B 4WGVB 3D3VB 4RFOL 2OL3A 4G6JL 3N1GC 1UCBH 3NAAL 1P4BL 1RZ7L 3BGAA 1UZ6E 2ZSWA 3RWHA 3S96A 2BERA 1AXTH 1RK1A 4JR9L 4L1HA 1KJVB 3EYSL 1ZA6A 4JO1L 2VKXA 3CC5A 4JO2L 3P30H 3RA7H 1AHWA 1R24A 3MRNA 5E94A 5I6XB 4HFUH 4MB3A 4MMZC 2V2WA 3C6SA 4UU9A 4Y5VB 1A9EB 2A83A 1PJ9A 4HKJB 4X6DE 1YMMA 4PJ7B 5DDHB 4NZRH 4FFWD 4OD2B 1FG2A 3T8XA 3L6FB 5F7NC 4G80A 2XA8H 5BQ7B 4UV4L 3NCFB 4Z76A 2XWJA 3VFUA 2DM3A 1XR9B 1RUQL 2D0GA 2ESVD 2X70A 3SKNA 4LNVA 2B2XL 4R4FL 2AK4B 5TE7H 4M48L 4N8CH 2K7QA 3UP1A 4A6YH 1UB5A 2UZIH 5BW7A 1UH2A 4NM4H 3I3DA 4V1DE 3VCLA 4ZUUB 1CG9B 2AJSL 3BW9A 5IFAL 3G5VA 5TQ2H 4TVSa 1MCWM 2ZUYA 5DHVH 1JHLL 1J05B 4L3ED 4HS6A 3VGAB 2O61B 3CIQA 3HZKA 5E70A 1F6FB 1V05A 3IFLH 2V2XA 3UTQA 4TRPH 1D5XB 4AT6B 5F7EH 1PX4A 4KTDH 1CZ8L 1MY7A 3FB8B 4KJWD 4XCCH 3H3PL 4HBCL 2W07A 2DL2A 2ITDB 2PCPB 5DYOB 3LSOB 2ORBH 3HI5L 4L9DA 5HJ3B 2XQYG 4OI8A 4HHAA 2FX9L 1AQKH 3MLTA 1VA9A 3H7BB 4KDWA 3FT2A 3VGHA 4WI2A 5FUOH 4GRLD 1Z0NA 1FL6B 1AGEA 2FJGA 4XP5H 4ALAH 4O4YL 1TDQA 3RWIA 5D7IF 1YJDL 1CN4A 2AKRA 4GG6B 4HPYL 4URTB 4W81A 1Z3GL 3BT2L 1HOCB 3FO9B 4GW4A 5KTEL 3NCJH 2YEZA 5EOQH 4KK6D 3QRGH 1CFTB 5GIRA 5IB2B 1SM3H 1MH5B 5GGRB 5T1KD 1HHIB 1T1ZB 1I1FB 2WNGA 4MQ7B 4QXTB 5ICZA 1BREA 1QBAA 1WSST 1QQDA 4PY8I 1LO0L 1RK0B 5I6XC 4P57A 1NUFA 2NNAB 3QEQD 3QNXA 4MCYB 4LLQA 4NP4L 4Y5VC 2ED9A 4APQA 4JY6A 3VDAA 2HFEB 2AVGA 3RUGE 1NC2B 1AQDA 2WANA 4PJ9A 1BJ8A 3AUVA 5C6TL 2ESVE 4K3DL 5E5MB 2VABA 4PREA 5MEQB 1HHKB 8FABB 3AREA 1TZHA 3BX7C 5IVZB 1I9JH 3RBGA 2EE9A 5GS1B 1MCSA 2RFXA 2DQGH 4HV8A 4G8FB 4P5MA 2QSCL 3OF6A 1JGVL 5T3XH 5C8JB 3BZFA 3L9RA 5C09A 3EOBA 3N06B 2HRPL 1F02I 4KXZH 5GQBA 2XV6B 2XZQL 3NCMA 3MUGB 4LSSH 15C8H 1W72H 4NGHH 4UQ3B 1CE6A 4M6NL 3CMGA 1S9YB 1ZE3C 5E8PB 1NDMA 4P2QE 3SBWA 2AXFA 5KG9A 3WS3B 1IGFL 2X4UA 2H2PC 3CVHA 1RIUH 2NW3A 4BFIB 3VGAC 1HHJA 2EIDA 3THMH 3R8BB 5CS7A 4MQSB 2PXYB 1N3NA 1H0DA 2HVKB 2J8UF 4GMSH 4PGCB 4Z7WF 2P24A 1SMAA 1EO7A 2XTLA 4I5BB 3TESA 3QYCA 3C8HA 3SKMB 1NGYA 2WMPA 3FQWB 3P4OA 5IVNA 5JXAH 2DM4A 4PRIA 4YBLB 4Y88A 4NQSB 4L8DB 1FNAA 5F6HJ 4G43A 3MYJB 4Y4HA 3TBWA 1KB5L 3O3AA 3I50H 4OBSA 1KNOB 4UOW1 1TVBA 3SDCA 4NKMB 3FT3A 3DURA 3TNMA 2CK0L 4Y4KA 3QEQE 1YPZB 3OSKA 3P11H 4KAQL 4NM8H 3MUHL 3T0EB 1AXIB 1X5JA 2IG2L 3CFJB 4I48A 1Q72H 3CFDB 2IAMB 4JFOB 3D0LA 4MVBD 3INUL 2OLDA 4XP4L 4M61B 1QA9A 1IKFL 1JNLL 1NCWH 2NR6D 3MJ8B 4JQIL 4M7JH 2W0FB 1UYWH 4P5TD 4PJEF 1CGSL 4HXAH 4JFDB 4MA7L 1TTFA 2D4FA 4LGSB 1BOYA 2A0LD 5IVXB 2W38A 3MUJA 2P5EB 4OAWB 5GS1C 3UTSD 1X7QB 1J88A 1G84A 1S5IL 2LAAA 4R4BA 3BEWA 4XCFH 2X44D 1K4DB 2YUZA 4NOBA 4MNGB 5KSBA 1UWXK 5DS8B 5D8JH 2YSSA 4G7YH 5I1KH 4XHJD 3CGTA 3QEGH 2I07B 1KPRB 1RZJC 4HJ0D 5IW6B 2Y5TB 1C5DA 3IFNL 3MGAA 5DSCB 4AG4L 1OSPL 2AJZA 1ORQA 1S5HA 1NUNB 3LN5A 4J4PC 4L29A 1ZS8A 2P5WD 3K81A 3O4LB 5D1ZA 4HUWA 3O45B 4C56B 4NNXB 3SCMB 2FYYB 3FFDA 3GMOB 4J8RB 4QRRD 4HGWA 4NFBA 2PXYC 4WO4A 1LNUA 2A1WL 1MAKA 4FZ8L 3TBTB 4G9FB 2OR7A 4OLVL 4C57C 1IGTB 1D5BB 5C0NC 1CFVL 2FR4A 2BVEA 4XAKD 5DJZB 1Z9MA 5GS0C 1MHHB 1A6TA 3ZE2F 4UINL 1BZ7A 4OCYH 5E6IA 4K7FB 2NXZB 4HCRL 4QYOA 4Y1AB 4YBLC 5T33L 2F19H 1IGJA 5DJ6A 5DJYB 1N6QH 1CE1H 2ZWLT 3KPLB 3MA9H 2XWTA 2IH1A 3HUJA 4AEHH 2QHRH 4ODTL 5FCUH 1S7WA 3QXVA 4M8VA 4N8PA 3REWA 4MSWB 4KZDH 3GMLA 4GSDH 2VDLL 4S11A 1WBXB 3KWWB 5EBLB 5T5NG 3ZYOA 3T0EC 4FA8A 3PNWA 5F7UA 1RHHA 1ZT4B 2AQ2A 3KPNA 4WUKL 2FJFA 2FO4B 1URLA 3L3DB 3G5ZB 5BS0B 4K3HA 2DMBA 2IAMC 5BZDB 1HWHB 1F90L 4YHNA 3OR6B 2IQAA 3M8OH 4N90D 1HXYB 1IAMA 4Z77A 3UTSE 4TYUA 3RX7A 1MHCB 3K1KC 3UTPE 3PHOA 2P45B 1TLKA 5E8EB 1DP0A 1Z9LA 2HLAB 5MHSD 4L8BA 3U2SA 4OTXH 4ELMB 4D8PA 5E1AB 2ZNXA 3HMXL 4OT1H 1KSRA 3P0YH 3IJSB 3CSGA 1FYTD 2PTTA 2G60H 4U6HA 1KENL 1PLGH 1Q0YL 4Q2ZB 2EZ0D 3KJ6H 3NIDF 2E5EA 4KV5E 1EEUA 4TTDD 3FRUB 4JGUA 1HNFA 4KQ4L 2P5WE 4U1KB 3GSRB 4HMCA 3FZUC 4Z9KB 1XGYH 4LKXB 2R0ZH 2X4TA 1F4XH 4QRRE 2I26N 2Z93A 4J3UA 2XKUA 4ZFOL 2BDNL 4ZOCA 1DEEB 2FH6A 5HI3C 3ZHLA 3MRBB 2BSRA 1F00I 3DGCR 3OAUH 5CD5C 3SCMC 2GAZB 4KK8D 1IBGL 4KKNA 4XAKE 1OP5K 3P4NA 1MVUB 1KBGH 5IM7B 3B83A 3BEVB 3K2UH 3VFMA 2J6EH 1DQMH 4PJBF 2OTUB 5JNYB 1QSEB 4H1LA 3WKNA 4E41A 2QQNL 1JFQL 1Q94A 2J4WH 5KJRL 3VD3A 4JM4L 3MREA 3HE6B 3S37H 1NMBL 1BPVA 2NXZC 3PABA 1K8IA 4JFZL 5CJBA 3OKMA 4BYHA 4Y8DC 3Q5YA 5T3ZL 3V4PL 1NBYA 3MA7B 1BF2A 4XBPB 2JB6A 1NDGA 2VISA 2FBOJ 2B8OT 3JVGC 1M7DA 5DJ2B 1GJIA 1JJUA 1IAKA 4ODHL 4LSVH 4KRPD 2YPLB 3T4AA 1N0XH 4KKAD 4LHUA 5D5MF 3VI4F 2MKLC 3VFRA 1X5GA 4Y16A 4GKSA 3EW3B 1NEZA 4Y19A 1L7IH 2P47B 3W0WB 4CN6A 2XN9A 4K7PX 4QHNA 4R6UA 4N90E 3SQOL 3HR5A 4QXGL 4ZOAA 5EC2A 1JN6B 1NC2D 1U92B 2IFGA 5CCKL 3CX2A 2FCBA 2DM7A 2EDKA 1BLNA 1N7ML 2WWMD 3FHAA 3AVEA 2QADD 2P8LA 3L3JB 4JO4H 2Q7YB 5GXBB 3H9HA 3VMPA 1VFAA 1LP9B 5F3HA 1A64A 1KLFA 5I30H 4JPKH 1O7VA 4WUUB 5MHSE 3MRLB 5HYJA 2J8OA 1FYTE 4NYLA 4WI5A 4I4WB 5CEYA 3OXRA 4N8VB 4NC0B 3W39A 1C5CL 5DRNB 5EUOF 1U91B 3QCUH 3G6JB 3MFFB 4PJCF 4JKMA 2X4SB 2P7TA 4ZQKB 1EHAA 4QHUB 4YX2H 3GI9L 5EOCL 2G5RA 4XPTH 3RUGA 3CFBA 2LV4A 5C08D 5K9JH 1NQBA 1R3LB 1DLHB 5BVJA 2EE6A 1IJ9A 4QRPA 2C3VB 2W9DL 4ESKA 5E2TH 4BQ8A 3IAQA 5AG8A 3WXWH 3U6RB 3ALXA 1WCBA 3O3EB 3S88H 1KB5A 2XG4A 1AFVL 1DUYB 5BZWB 2IQ9H 4U33A 1R3HA 5DEGB 1SY6A 2R0KH 1X4YA 3PHQB 1TJHH 3OKKB 3CAFA 4OJFL 1CCZA 4LFHG 2VR5A 4NNPL 4DQOL 5JIIA 1GHFL 5B4MD 4CW1A 5CMAB 35C8L 3BPNB 5E5RB 5E5UB 3X3FH 5FKAA 4Y5XB 1UM4H 1LK2A 4P2QA 5A40E 3RDTA 5I1IH 3SE4A 3HE6C 5A2KH 4YQXL 3WUWB 1B0WA 1FGNH 4ZAKB 3VFTB 1L4IA 2EDWA 2DJSA 2F54A 1NCCL 2SEBB 1JWUB 3GEWB 3SJVD 3CMOL 2VDPL 4CVZA 3ARRA 1T89C 3QA3A 3NFPB 1CFQA 4M1CC 3FB5A 3HI6H 3TYGL 4MNQD 2BY2A 1UB6B 4YAQA 4KMQA 4BK5A 5IB1B 1ZHKA 2VLJA 1A22B 3WXVH 5TDPB 3DSNA 4G9DB 1BF8A 5I8OL 1PDKA 2WIIA 3NIFE 3BVNB 1A7RL 3TJEH 2BVPB 2I27N 1YNTA 5D9SB 3QUKA 1GPOH 5H94B 1I1AD 1I75A 2EDYA 1G9NC 2AEPH 4HIEA 5F88A 2BRQA 3NFSH 1I9IH 1MREH 4XPGH 3D85B 3MBEB 4G8IA 5FO7A 5JOFA 3BZ4B 3QUMB 3J7HA 1WZ1H 4QTHA 1G7JB 2Z92A 1UWEL 3KLHC 1LK3L 4QRQB 5GGTL 5I2IA 5GSVA 5EOTA 3DRQB 4IMLB 4UAOB 5DO2C 1U95B 3LMJH 3O6LH 5D6CB 3QJHB 5AEAA 3WO3B 4DJMA 5C08E 4ZPVB 5AZ2L 5C0BB 2A6JA 3QUZB 3WD5L 2VZ3A 4YWGH 4BH8B 2XKNA 4OLEA 4NWUL 5EPMA 1R3JB 1UCBL 3FZUD 4S0TD 4HCRA 3D87B 2XFXB 1OGAA 5C2UB 1G0XA 2OZ4H 5ID1B 5D96B 3TPUA 2VAAB 4NO3B 5T1LB 4QRTA 1DUZB 5L2KE 1YC8A 2B1HH 2NXYB 5DVKA 3P30L 3RA7L 4HFUL 4CADB 1MCPH 5ILTH 4WFHD 5EZJA 3OB0H 1AC0A 5EZOL 4NZRL 1FH5L 1MFCH 4NIKB 1G6RB 2VLRA 2ZOKB 4M7KL 1GSMA 3BPNC 2XA8L 3VXMB 4RMTA 3HPLA 5ADPH 3RWEA 2YD9A 3T3PE 1QFUH 3SJVE 3DTXA 4Y5XC 4LNRA 2CLRB 5FA3A 2BK8A 2G75B 2FJHA 3TA3B 2E27H 1BWMA 3S4SA 4XPAH 4KUCD 3LKRB 4ZAKC 5D7JB 4NQDA 3TVMA 5TE7L 4MNQE 4N8CL 3L95B 1MRCH 1C8PA 4A6YL 3QO0A 4NM4L 3FN3A 3IETA 2IADB 1MWAB 5HYFA 4TUJA 1TETH 4LOUD 2R2BB 4WRLA 3HI1A 3TCXA 5JW3L 5E7BA 5HPOA 5TQ2L 5ESVA 3HCVA 3PL6A 5H2BA 4LLUA 3MXWH 1GGIH 5EU3B 2OX5A 3EJYD 1YDPA 2VDNH 3O9WB 5EO1A 4Z0BH 5KSUB 4YXLL 3X17A 1X5IA 5I8CB 4P4KA 3V6FA 1DQLH 3IFLL 3QO1A 4MXVE 4TRPL 5HGGS 1KLGA 2VZ1A 5ERWA 5F7EL 5DRXA 1JZ7A 3MBEC 4XCCL 1FDLH 2WBWB 4OZIE 1WUNT 3LS4H 1FFQA 4EEEA 2VITA 1GAFH 1CL7H 3C09B 3MYZA 5DEFA 5H35B 5DD6A 4M4RA 4M93B 4UAOC 3PWNB 1AQKL 1HYSC 2YPVH 1J10A 1LWRA 1MCBA 2R29H 1QHPA 4UILH 2F15A 4KI5F 5FUOL 4QHKI 3ALPA 3QDJB 1MCHA 3KPPA 4U1HB 1RURH 3T1WA 3QUZC 4XP5L 4PY7A 4ALAL 4FQHA 2VWEC 4R96B 4U1NA 1C7SA 3BIBX 2B0SH 5HDLA 3NCJL 4JPIA 3GSWB 5JW5A 5EOQL 4NHCL 4GRMB 3QRGL 3GIZH 5D96C 1P2CB 3V0WL 5KS9E 3JV6A 4WFHE 2QSQA 1T6WA 2NXYC 5DJDA 2BNQA 4F37K 4DKDC 1B3JA 5C0JA 1M71A 4F33B 1A3LH 4KHXH 2GJ6A 1JZ5A 4HC1H 4RRPG 5CINL 4BELD 4YC2B 4KZEL 5TJWK 3MV9B 4YZFE 3MSPA 1I9JL 4XMLH 5IMOB 2R1XA 3TA3C 2DQGL 4HKBA 4JAMA 3GJFB 5DVMA 5T3XL 1P69B 5ESAB 2WM0A 3O3BB 4JQVA 1ZLSL 3P77B 3S98A 1YY8B 4AMKL 3P73A 4NQEA 4X98B 4FN0A 3KXFA 1DDHB 2F8VA 4PGEA 4X5LA 4WW1B 5FGCB 3OG6B 3MO1A 15C8L 4G6FB 1W72L 4OD3L 4HEPG 3IRZA 3TFKD 4Q9QH 1ZGLM 5ID0A 5DFTA 2K3TA 4Z7OE 4Z6AT 3ARFB 3NCYP 2ADJA 1NCTA 2ICES 1KTDA 4PRPB 3F12A 1MCOL 1Z6JT 4HXBH 3O9WC 4PBXA 2IANB 1XH3A 3UO1H 4U05A 4KH2A 4K8RC 4F8QA 2YK1H 4UZGA 3PGCB 2CXKA 3LDBB 5D7IB 4I0CC 4OZFH 2HT4D 2AERT 3QQ3A 4X9FA 3E8UH 4YDJB 3LQZA 5C70A 1RZIB 4XWGH 4HWBH 5F7KC 1YEDB 3CFCL 3C09C 1S7RB 3ZE1E 4P59H 4MJIB 5HVWA 1YNKH 4H5SA 4M93C 3AXLA 2NY0D 3OKNB 5CILL 1ZT7A 4LSTH 4EUPH 4HKZA 3IGAA 4DKFH 1U9KA 1QFOA 3EAKA 3CD4A 4LSPL 1CD0A 5ADOL 5IIEB 3H9ZA 4K3JH 3I50L 5GHWH 4MAYD 3QFJB 1EMTL 2D7TL 1J0ZA 1ROWA 1F6AA 3T77B 3P4MA 4CVWA 3TZVB 1FQ9C 3EFDH 3RZCB 3FQNA 5DQ9B 2YUXA 3KLAA 3LPWA 4PR5B 2W9EH 3X3GH 5TQ0H 5GRXG 1Q72L 2VZVA 2Q8AL 1JF5A 5TH2A 5H8DA 5J4MA 5L9DL 3LEYH 2CDGB 3ISWA 2VIRB 4F7CA 2BRRL 3B9KD 1U2HA 4JFQA 4LVOB 2B20A 5EBWA 4YC2C 4HXAL 5JMRA 3UMTA 3L5HA 1JPFB 1FL5B 2P1YA 5KN5A 1MLCB 1H3TA 1R5WA 4XZUA 3D39D 4GG8A 1XF4A 5I8EA 3SDXA 1CL7I 1D6EA 3NN8A 3VE0B 1EHXA 3AM8C 2UZXB 3LY6A 1EGJH 2ZNWA 4HMDA 3RGVA 4Q9CA 3OPZH 5D8JL 3L7FA 1FZKB 4G7YL 4FMKA 5I1KL 3QEGL 3FB7B 3ZHDA 4NBYB 1E28A 2EXWC 3ARFC 3FN0H 4PTTA 5T1DL 1BIIB 2EYTA 3TM6A 5MEPA 3ZTJG 4HIIA 4KVCH 2HTKD 1QR4A 3LDBC 4BQCA 2OMBA 1K9TA 4OCMC 5DLMH 5MENA 3GKWH 4NCDA 3SEPA 5HYQA 3WEXB 5C0CB 3WIIH 3GFUA 1CGXA 3KDMB 3Q6FA 1MFNA 3O2VH 3GI8H 4CMMB 1A6ZB 3QNYB 4JDZA 4PJIA 5I74B 4PRNA 2J8HA 3M17A 2F19L 3T09A 4LGRB 1RULH 1CE1L 2BZDA 5DMKA 3MA9L 3WNKA 1DLFH 1KF9B 4NN6B 1KJMA 2BC4B 1BFSA 5D7LD 4AEHL 5FCUL 2FBJH 1X5HA 4YDKL 5D7SL 5T1LD 5JW4M 3TJHC 4KZDL 4A6YA 2NXYD 4OFIA 1ACYL 5HDBF 3IFPB 4JFFA 1IAIM 3TZVC 3UBXB 3O41B 4LLDA 4NQUA 4N0FA 1XMWA 5C0AA 3RZCC 4CRPA 5I1AA 1FFOB 3HG1B 4DVBB 4PJGA 2YWZA 4CJ1A 3TWCH 5JLZB 4N9OB 4F7TB 5FV1L 3QHZH 2FIKB 4LPTA 5DHVA 3D39E 2DQFB 3X14B 2ARWA 4HWNA 4LVOC 3VFVB 4P2RD 3WO4B 5LKNA 2GK0B 3WIHA 1A1OA 5TGBA 4R4NC 5I15L 3OKDA 1N4XH 1LE9B 3SKOB 5JDSB 3D0VB 1DR9A 4YDVB 2Z35A 5L2KA 5DHXB 3ZHKA 1V5JA 4OT1L 3VG0L 4NBXB 1LEIB 2GUOA 2R23B 2G60L 1I8KA 1PLGL 4OV5B 1FLRH 3GSXB 3PWLA 1U93A 3TP4A 2NY2B 3IDNB 2CUIA 4IS6A 5I1LB 3VXPB 43CAA 1BVKB 1ZVSB 1YEGH 1SBSH 2R0ZL 4QRSB 3ARQA 4HQQH 5FA4A 4OLUL 3JTTB 3REVB 1CT8A 1XIWD 3B6SB 3A67H 2ICEB 4DZ8B 1OW0A 3WKMH 3G9VA 4OUUB 1B4RA 3C8KA 1NGWB 4XP1L 5DRZB 5AG9A 4JFHD 1KBGL 2EKSA 3ZZ1A 4OV6F 2R2EA 1MUJA 4LLAA 1DQML 1GXEA 4OKVB 4ZO8A 2EDEA 3PP3K 1OB1A 4JHAH 4NUJB 2I9TB 1QSFA 5SWZB 4LIQE 1IEAB 4F37F 4NRYB 2DQUL 3I9GL 2Y6SD 1EAJA 3WNPA 3BSZH 5J1SC 3LKSB 5HHMB 3QULB 1M7IA 1OT1A 1FIGL 2JCCE 3F58H 5I74C 4YFLF 5D7LE 2I60H 3WLBB 3SKJL 1DANU 3R06A 4NN6C 2HKHH 3PWPD 3TBSA 4LVEA 3QJFB 1MJJB 3DOSA 3SDYH 5JXEA 3QI9A 1H5BB 1L7IL 1B0RB 1UQSB 5IGXL 4MJ5B 1UA6H 2FLRT 5E08H 5IROA 5KBNC 1GC1L 3DV6A 3CZJA 4P2YA 4P2RE 3WDJA 1IEHA 5HI5C 4XRCB 5BCAA 3MGOB 4RNRB 5I30L 4JPKL 3U9PL 5H37G 2JIXA 2EDLA 3WO4C 3ROOA 3TN0B 1DBKH 5F3BB 3QISA 4F9LA 4N1EA 5F9JB 4ODXB 5KS9A 3VGGA 1H3UA 5FO8B 1H3XA 3MXVH 2GCYA 2OCFD 2KBGA 2HLFD 2NZ9C 3QCUL 1I3GH 2CMRL 3JWDC 1CXFA 2AEQL 5SWSD 1RZJH 4ZO9A 5CHNB 1FZJA 2MFNA 2WAHA 1SVZA 3EYVA 4XPTL 5GRUH 1UZ8B 3IDMB 3W2DH 4UTBH 4ZUSA 2X4OA 4PJBB 2EXWD 1FL3A 1U3HB 2NY2C 3EYFA 5DMGC 2R4SH 4FQJH 3NA9H 4XXDA 4IM8A 1ORSB 1QLRA 1MJ8H 5B39B 5CD3A 5E2TL 1T1YB 3QXWA 3WXWL 5DFVD 2HJFA 3MOBL 5JW4Q 3S88L 5E7FA 4JFHE 2A6DA 1R6VA 2IQ9L 3PV6A 1FHGA 2X4PB 3MRMA 5IHZA 4GKOA 1F97A 2DM2A 3S36X 5K9KB 4QRUB 3MOAL 4W68A 4XBEH 2BNRB 2N7BA 3VXTB 4D9LL 5GS0H 5J57B 2LTQB 5F9WB 5FYLH 3G6AB 5D5MB 1UM6H 3X3FL 3FCTA 1UM4L 2D2OA 3UTZA 3KVQA 5IQ9A 1J8HD 2DMCA 5GGRY 4NPYB 4XPFH 3LRSB 5IF0B 4NQCA 1R0AL 4LCYB 3B3IA 2BSED 3VFOA 43C9A 1LDPL 5A1AA 4LLYA 3L7EA 4PLOB 4G42A 1C1EH 3JUYA 4BZ1H 1S7XA 1A9BA 4PJXB 1U8LA 5E8DH 2CK2A 1MFAH 5HGAA 4GW5B 4FQPA 5K9QG 4Z7QE 5DXWA 3RL2A 2ICWJ 5I1JH 3LB6C 2VE6A 5J6GA 4TNWF 1JL8A 4B7LA 1H5BC 2A73A 1RJCA 4OZHA 4M62H 3EO0A 4P46B 5DD5H 4JG1H 1OARH 5KVDL 3DVNA 3GNMH 3N1MC 3HFMH 3PQYE 1JPGA 4LKCB 5JIHA 4NHUB 1TFHA 2BOCA 3H9SE 3O8XA 1IGIL 4ZODA 5B38G 4IRSD 1NSNH 4X83A 3C60A 4YO0B 2EC8A 1I9IL 4UDTA 2IBBA 5TF1L 4JANB 2EC9T 1MREL 3DARA 2QQQA 4S2SB 1CICD 3QEUA 3TN0C 3UZQA 1WZ1L 3RVVD 5DVNA 3DMMA 1AGFB 4CAGA 1P1ZB 1A7NL 5SWSE 3B2UC 2JELH 3LMJL 3O6LL 1LO4H 5TE6H 1RZ8B 3SPVA 1KFAH 4BKLB 3QG7H 4NSKB 1PKOA 5GS3A 4ZUWB 3DX6A 4PG2C 3MR9B 1U3HC 3O11B 2IH3A 5LGJB 4UDUA 3HZVB 1KJ3H 2C26A 3ECBB 4U1SB 3NACH 2BNUB 1GOGA 1XCTB 2B1HL 4K23H 2NX5B 1J1XH 2P42B 4KDTA 4O2FA 1RVFH 1RJLB 3H8NA 3ARBA 1OWWA 1MCPL 4TN9A 5CJXC 3ZKMC 3FQXA 1MCRA 5CSZB 3HS0B 1HWGB 1PBYA 2V17H 4PGJA 4OM0H 1MFCL 3QWRA 2I25N 1ZLWK 5HHOD 1SMOA 2HG5B 1J8HE 4P5KA 3DGGB 3HAEB 3U0WL 3VA2C 3C5SA 2LTQC 3FJTA 1XGTA 2EXYC 3JWNC 5F9WC 1CFSA 1CXEA 2Q76A 5ADPL 3MNVA 3FRPA 5F6HI 1BEYL 2CUMA 3QDMB 4GW1A 1FFNB 2IPUK 2E27L 4XPAL 2AAVA 1C12B 2CIKB 1PQZB 2EEDA 3VFGH 4YPGA 1OLLA 4MA1B 4ODSL 1T0NA 3W5MA 3LIZH 1MRCL 4TULH 5HGHB 3QP3A 1LEKA 4ELKB 3VXUE 2UWEB 3V4UH 4AENB 5LAXB 4CU6A 1QO3B 2DJUA 2CRYA 2VDRH 2Q86B 3NIGE 2CR3A 3QZWA 3QUXB 1U3YA 1QSZA 2WK2A 4FG6C 4W4NA 4EDXB 3KYOA 3SDAC 2GTWB 4P46C 1HHGB 4X4XA 4G6MH 1A6WH 2VDNL 2FO1A 1S3KH 1A6AB 5JOEA 4OB5H 5FGRA 1I7RB 1DQLL 2YD3A 2CLZA 3ROLA 4JRYD 5JHLL 2PR4H 3KPRB 1Y6NR 3KS0J 3S35H 1YN7B 3L3IB 2VN7A 1BAFH 3LS4L 1GAFL 1CL7L 1BHGA 2J8UE 2I9LB 4Z7WE 4GS7B 3LEXB 2IJ0C 3T0VA 5DWUH 2ADIA 1AO7D 5TDNB 4FFVD 2YPVL 2R39A 4F7MB 4XMKL 2R29L 1ITCA 2J6EA 4NOFA 4UILL 1OT2A 2Y72A 1RURL 2X9WA 1UKSA 1FVCA 3MNZA 2BJMH 2WBJB 5F1IB 1GH7A 2V7NB 4ONHB 1NGZB 4PJDB 4I2XB 3ALWA 1R3KA 4L8CA 3E6FB 5EZLB 1CTNA 1KOAA 1WT5A 3C6LA 2EDTA 5HHOE 4NO0D 2W1NA 4I0PD 2HFFB 1RUKH 4Z7UF 1VFMA 1GGBL 1AH1A 1A3LL 4KHXL 1Z9SA 1CVRA 3ZTNL 4HC1L 5JO5B 3QH3A 1VFBB 4PJFE 3EZ8A 3NOIA 3BZEA 4LASH 5I19L 3RZWA 2JJTA 5C0FA 5ISZB 1Q9LA 2EIBA 3MRFA 5F70A 4OM1H 5JOPE 4XMLL 3EGSA 3MCKB 1F4YH 1ZEAH 2HJLA 4M6MH 4WDIA 1JF1B 4PJEE 4MA1C 5DJ8B 1A7OH 5INDB 3F6LA 5HHPA 5TDOA 5D70H 1I7TB 4X0KA 4Y8AA 3MV11 3T0XA 4O51B 4NRXA 4Q9QL 4ZUVB 3QUXC 5MI0B 1G9NH 5ICYB 2DBLL 3QCVH 1EZVY 1I8LA 3W9EA 4JRYE 1NMAH 4HXBL 2JK5B 5DZLA 4ONFH 1GVIA 3UO1L 4NT6A 3DHMA 4QEGA 4L4TB 1EFXB 1MRDH 1KTLA 2C1PA 2FDBP 2RR3A 2BXZA 2YK1L 1T3FB 2R4RH 3EO1A 3QWOA 3FFCB 3E8UL 3OJMB 4MXQD 1AO7E 4XWGL 3CPLA 1LE5A 1CGUA 4HWBL 2E7LA 1JWSA 1G7LB 3OKOA 4GS7C 4LCCA 4JJ5A 3SGJC 1YNKL 3GSQA 2ZOLB 1VEMA 4OLYH 4GRWE 2DKSA 4LSTL 5GPRA 4QOKD 1VGKA 4U6YA 4PBWD 5F7DB 5ETUA 5FUZH 3LV3A 2XXCB 3ILQD 3OGCA 3Q1SH 5K93A 2VERN 4K3JL 2BOBB 3B9EA 2DMKA 5CKGA 5GHWL 2WBJC 3DX8A 5J9PA 5KSBF 5EO9B 3D2UA 2QQLH 5IHUH 1ZANL 3L3HA 5EZIH 4Z78A 4N0UE 4P2OD 3V95A 1G9MC 5DUPH 4Z8FH 4GMTL 3K8LA 3X3GL 5TQ0L 4EI5B 4YHYB 4JM2B 4Q6IA 4HGMA 4R0LB 4L4VD 1XR8A 2GJZA 3DJ9A 3VXSB 3LEYL 4AEFA 4WI3A 4JHWH 2XQYK 5KSAD 2EDBA 1RD6A 2CDFB 4M9PA 3K7UA 4HUXA 3FTGA 3BXNA 1FZMA 2A9ML 4KJYA 1UWGH 3VMOA 3FT4B 4FQLH 5D1XD 4MDJB 4OGAC 1IM9A 3X13A 3ZKND 3OPZL 4PJ8D 4MA8H 3TO4D 1I85C 1ZA3A 3VGEA 4X6FB 2H1PL 3RWJB 3SDAD 3U83A 3ARGB 4HFWA 5MI0C 4Z0XA 3NIDE 4PRDA 3HUJF 1G7MA 3FN0L 1BOGB 1NEUA 4ZDHA 3VXOA 1JPSH 4ZFOB 2XQBH 1CLYH 4OZ4A 2IC2A 3QB7C 4Y4FA 2OZ4A 2CXGA 3OXSB 3KPSB 3QUMH 2Z31A 4AIZB 3WL9A 1LO2H 1DE4A 3GKWL 1ZV5A 4QOKE 4NZTH 3IJHA 1INEH 5KANG 4KK5D 4MNHA 5D1QD 4F7EA 3O2VL 2CSPA 3MV8B 4UTAL 4UT7H 3MRIA 1IGYB 1NFIB 1BD2A 1HN1A 3PQYA 2D7PA 1MAMH 5JPNB 1AJ7H 3H9SA 3IS1X 3VWJD 5IFHL 4QCIA 4ENEC 4BSVA 4RGND 3MLUH 4MZ3A 1G7PB 2WQ8A 3QDGB 2FBJL 1G7IA 3ES6B 3RTQB 3N9GH 4R26L 3RWDB 5EU5B 4L4VE 1IAIH 4RMVA 4OZGB 4HIHA 4IMKC 5FM8A 1XF5A 3PGDB 1MRFL 3VI4E 1G6RH 4FRWA 5IEKA 1N2RB 2N4IA 4YHYC 4JM2C 4R0LC 2YA0A 5IR1B 3TWCL 4N9GB 2AABH 3QHZL 5ICXA 2D7NA 1DBMH 1VHPA 3K74B 2X05A 3IDUA 2MCPH 5BRZD 3FO2A 1SJHB 1GZQA 1QG3A 4MA3B 1N4XL 4YHLH 5I16B 1ZLUK 5LG1A 3WNNA 3P0GB 1YN6B 3NFNA 1MWAH 1A6UH 3OKYA 4M8QB 1FLRL 5J3HC 1HI6B 2VZTA 5GGQH 5EUOE 1D9KA 2AW2A 1H8SA 1CYGA 5AUMA 5GSRB 1FVEA 3IAPA 1CR9L 1UCTA 4PJCE 5I1GH 2FSEB 3ARGC 5FXCH 1YEGL 1SBSL 1HXMB 1T22A 4HQQL 3DROA 4XP9H 2MSPA 4K8RH 4NKDB 3MLRH 3MV7E 3RWGB 3RBSA 3WKML 2YZ1A 1M05B 3CUPB 3T4YA 5ANME 4MDIB 2KPNA 1B88A 2A6KB 4Q74A 3VXUA 3UC0H 2ZSVB 5IBTH 1RJZA 1KIQB 4JHAL 3SDDA 1XF3A 3RIAK 3TIEA 3TLRA 5GRJL 4YHPB 3BSZL 5EC1A 4IRSA 4XI5C 1SEBB 3EOYG 4RGNE 4PJAA 2PYED 1QVOB 3F58L 3VJ6B 1HH6B 1I4FB 4EJ1C 3UJIH 4LP5A 4X6EA 3TYFB 1CI5A 1KPVA 4KVNH 2F53B 1A4JA 1NAML 3RY4A 1T2XA 4NO5B 2MWCA 1R5VB 3RUGF 1T6VN 3RTQC 3QIBD 4HS8H 4PJHA 2V7HB 4P3CL 5J6HA 5FYKU 4HIJB 3V6OA 2IF7A 2B4CL 1UA6L 4KRNA 1T1WA 4KMTH 3BKCH 3Q6GH 3VXNB 1MCJA 1I8IA 3KPTA 2ARJQ 2YA1A 2RHEA 5CEXA 5EBMB 1N64L 4GQPH 4JY5H 2BVOA 3DYPA 3C9NA 1NGXB 5F1OB 1PD6A 2H3NA 1J8KA 1FC1A 4IOSD 1DBKL 4JKKA 3GJFH 5E9DA 2DWDA 5I76B 1D6VH 4LF3B 3MXVL 1WWCA 1ZAGA 4OGAD 4OZFA 1BQHB 3CH1A 2COQA 2AJUH 4HJGA 3ULVC 3MJ9H 1QEWA 2CLVB 3GMRB 3WFHB 4HWBA 2FZ3A 4NCC1 3FN9A 1RZJL 1OCWL 5FKPB 5GRUL 1WAAA 3QIUA 3W2DL 4UTBL 1U8OA 1LHZA 1P5VA 4OCSH 4PJFA 2R4SL 4ZTOH 1M6OB 1V3MA 1KEMH 3NA9L 1F3JA 5TPWH 3IDYB 3LCYA 4OFYD 4KI5D 4U6VL 12E8L 1YQVH 2ED8A 4O02L 2YR3A 3PWJA 4JLRA 4X6CB 1OQOA 1SBBA 4OF6A 7FABH 1FG9C 5EORH 2YBRA 1V3KA 1YECH 4KPHH 4P4RA 3QNZB 1QZ1A 4JGMA 3AMLA 4C55A 4HUUB 1T7WA 5DUMH 2XZCL 4CKVX 3BUYB 1F42A 4M6AA 1CTOA 5BV7B 2GI7A 5FYLL 1P6AB 1UM6L 4E42B 4MS8D 3V7AG 2L0DA 4OCXH 4RFNB 2PYEE 4PJ5A 5EFIA 1VEOA 5JIKA 1FNGA 1BFOB 4NQVB 1HCFX 2JTDA 3BP5B 3LQMA 3T0BA 1Q9WA 2PO6B 1S8DA 3CCHA 4LK4A 3RY6C 1Q9KB 2NCMA 1C1EL 1AR1C 3RVXC 5F7FA 4NJ9L 3LHPL 2HRLA 3CDGB 3IF1B 5JUEL 5E8DL 3MMEB 3WNLA 1DVFA 1RIVL 3BJLA 5BOZG 3VW3H 4GAJH 3ZE0F 1KIPA 4MD4B 1EGJA 3HE7D 4S0SD 1BVLB 4YDIH 3BDYL 3ARVA 4G8GD 2H9GB 1E4XI 3C5ZB 4NQXA 1NL0H 3MLZH 1OARL 4JG1L 4CDGC 3E3QC 3GNML 2CRMA 1N5YH 4OGXH 2G9HB 2WSKA 1NSNL 1WBYA 3UPAA 3D69A 1KN4H 3DUUA 2OK0L 3V6ZB 1AD9B 4BZ2L 3BIKB 1I7ZB 5DI8B 1EERB 4PV8B 1NFDA 3O2WH 4ZPTB 5C0GB 2IMNA 2JJVA 2CDEB 1YUHA 3WHXA 5IB3A 5KVMC 2JELL 1P7KA 1ZWIA 4OCWL 2A38A 1LO4L 3FQUA 2YXFA 5TE6L 2W65A 5SV3A 4OF3A 3QG7L 1CDBA 3H3BC 5BS0E 5INCB 3IS0X 5EU6A 3D3VA 4KI5E 1F4WH 4JDVB 4P23B 1FNHA 1KJ3L 4NWTL 3IDYC 3VGDA 1T83C 5E99H 1WISA 4WENB 1KJ2B 2DKUA 3BHBB 4WW2B 2BVQB 3U4EA 3T08A 1RVFL 1KJVA 4ZD3H 3BWUC 3BQUB 1OSZB 4PV9B 1I9EA 3QHFH 5JW4R 3WNMA 1A9EA 3BE1H 3QXTA 4FFYH 2Q3AA 4HKJA 1W0WB 4PJ7A 1A4KB 5DDHA 5DMJB 5DZOA 5BV7C 4MJ6B 4Z7VB 2ZCHH 2R9HD 4J3WA 3SGEH 4XPBH 4OD2A 4RFNC 4CBPA 1PVHA 4ZS7H 5BQ7A 2DD8H 3AS0A 5L8KB 1RK1B 2PO6C 4Z18A 3VFGL 1XR9A 3WUWG 1EV2E 3LIZL 2V6HA 4U3CA 4TULL 3O6FB 1V7MH 3CC5B 3VXQB 5C92A 4BZYA 2AK4A 3V4UL 2DF3A 4EBQH 5EULV 4G8GE 4ZXBC 1S7TB 3OGOE 5CLWA 2VDRL 3PP4L 3V7AE 4KKBC 4ZUUA 1CG9A 4OKDA 2RBLA 5DMIH 3C5ZC 4MB4A 3F7YB 4UOW0 3ULUC 4G6ML 3G6DH 1A6WL 3R4DA 1QD0A 1J05A 1S3KL 4R2GD 4OB5L 4DOHE 5FYKH 4HG4K 2L4OA 4R3SB 5D2LE 3VXRB 2O61A 4KU1A 2BHYA 5HYSB 4NNYB 3Q3GB 4AT6A 3S35L 1D5XA 1J9CT 1BAFL 4KV5F 3FB8A 3IDGB 3VCLB 1I7UA 4PGDB 5DWUL 2HT3D 3JWDH 2LU7A 4F7PB 5KSVA 2PCPA 2ITDA 5DYOA 3LSOA 5HJ3A 1ZHLA 1G0DA 2D0HA 4WHYG 2MQ0A 3H7BA 4PP2B 3B5GA 1MIEH 4WFGD 3KJ4B 1Q0XH 4Z5RB 1FL6A 1NGQH 4UBDD 2BJML 1JMXA 3MRRB 3RIAF 1JZ3A 1KEGH 4LDLB 2DQTL 1XAUA 3QUYB 3TBYB 4P23C 4GG6A 3TPKA 1CXIA 1HOCA 3FO9A 4EN3D 1JV5B 5I8KL 4MJ2A 3VRJA 4WW2C 1CFTA 4LDOB 2VXVL 2JJWA 4FP8H 5IB2A 1MH5A 1JYXA 3EKCA 1HHIA 1T1ZA 1I1FA 3BQUC 4MQ7A 4QXTA 1KCKA 3TO4A 4LLWB 1RUKL 2YC1B 1P84K 1RK0A 2NNAA 4FQCH 2R1WB 3C2SA 2HFEA 1M4KA 3ESVF 4LASL 1UACL 1KIRB 2GY5A 2AKRB 2VAJA 5E5MA 5MEQA 4OM1L 5C0IA 1HHKA 3LH2H 4UQ2B 8FABA 4FQXD 1F4YL 2CGRL 1TQCB 4M6ML 4OIBA 1YYLH 2KDGA 2C3GA 1L0XA 5IVZA 5GIRB 3MV7A 3BGMB 5LXGH 1A7OL 5LBSH 5GS1A 5HXMA 3O6FC 4G8FA 1PKQB 3FAWA 4LU5H 3CJJA 3VGFA 5AWNH 5C8JA 3NPZB 1RUMH 1Q38A 5J56B 1QRNB 3HR6A 1AQDB 3LN9A 3MUGA 4RISH 5GRYA 1V3JA 2OJEA 4UQ3A 2FATH 2ATPA 3QCVL 1C5BH 1S9YA 5E8PA 1NMAL 3WS3A 3FO1A 4J4PA 4ONFL 5CEZH 5I1EL 1Y6MR 1MRDL 5T5NF 4HBQA 4P5MB 4OSUH 2R4RL 2X1XR 2F5AH 3QIWD 2PXYA 2HVKA 4QXWA 1A21A 4JDTH 1UXWB 1QBLH 3L5JA 3OHXB 4I5BA 4LSRH 2D9QB 1OAYH 4TUOB 4OLYL 4WFGE 1AY1H 3HZYB 3SKMA 5KZCB 3SGEI 4M3KB 1FFPB 3QDHA 2NY1B 4G6JH 4S1DC 4M1GH 1VB9A 4U0RB 4Z7UB 3IXTB 4L8DA 3KJ4C 3UJJL 4PLKD 1F58L 5GGVY 4X5WB 4G7VH 1BJMA 3ULSB 1OTTD 3MYJA 2YHGA 2QQLL 3EYSH 3QUYC 5IHUL 1TNMA 1NCDH 2ZP0T 1KNOA 3F7QA 5E2VH 2Y07H 4IDJL 4JO2H 4NKMA 1CQKA 3UBXI 2HA1A 4FQ1H 5DUPL 4GBXD 1EAPB 1YPZA 4ISVB 4WV1B 1QBBA 4Z8FL 4U31A 2W0LA 5HDBE 2E6PA 2E6QA 5SWQB 3CFJA 4RGOH 3CFDA 4JHWL 5CGYD 2IAMA 2GTZB 1PW3A 3RY5A 5LCVH 4M61A 2RB8A 3LKOB 3MJ8A 4R4FH 3AC0A 2W0FA 5C7XL 1UWGL 4H25B 5I1DB 3IDJB 1TQCC 2VYRE 4JFDA 3V5DB 3DI2B 4OAWA 2BFVH 1X7QA 2R0LL 4Q0XL 4XBGB 4PLJD 4ZXBD 4MA8L 1ULVA 1K4DA 2AJSH 4J3OC 4MNGA 1B0GB 2DQEL 5IB4B 4KKBD 4U1IB 5I17B 1HYRC 4G5ZH 3VXME 1QA9B 3VWKD 4N1CA 2I07A 1KPRA 1A0QH 5IW6A 2Y5TA 5DSCA 1HQ4B 4DAGH 5F7YC 5FDWB 4DW2H 3V2AR 2A6IB 1S7VB 4TQEH 1JPSL 1CLYL 3A0OA 4GFTB 3O4LA 3HB3C 4O9HH 4XVUC 3ARZA 3O45A 1P4LB 4JFEB 4R7NB 3QUML 4C56A 3H3PH 4NNXA 4HBCH 1CFBA 1LO2L 4J8RA 3GMOA 2FH8A 1CGTA 5K59F 3FONB 3TBTA 3MCLL 4G9FA 2A77H 1IGTA 1D5BA 2FX9H 4NZTL 1EBPA 1MI5D 2HT2C 3V5KB 1T4KB 1INEL 4LHJB 4LCWD 4YIQA 1AI1L 3MROB 3X11B 2FWOB 1C5DB 4UT7L 1MHHA 1E6OH 4GKZB 2PNDA 5IMMB 2CIIB 1IARB 4L29B 3TBVB 4O4YH 4K7FA 2NY1C 5E24E 4Y1AA 2D03H 4U0RC 1MAML 5LWYH 3W82A 1AJ7L 4HPYH 2F58H 4GXUN 1Z3GH 3BT2H 1FN4B 5DJYA 2FHBA 3KR3H 3JVGA 2XA3A 3KPLA 4JKLA 3TCLB 3N9GL 4WCYH 3KS0H 1OD7A 5F97E 1LO0H 4BSWB 5FM4A 4NP4H 1U2CA 4WV1C 3DYOA 1A6TB 1NGPH 1WBXA 3KWWA 5EBLA 1BBJB 1OVZA 2XPGB 3RGHA 5L2JB 3HAEH 4QYOB 3QQ4B 1ZGLP 4PBVC 2AABL 5D2NE 2FO4A 5B3NA 3L3DA 5BS0A 1CFNB 1DBML 5BZDA 3K2MC 3O2DA 3S3JA 3OR6A 1S9KC 5FM5O 2MCPL 1HXYA 4JVUA 3BD5A 3OWEA 4YFDB 5ACLA 4YHLL 1MHCA 1S7WB 3IT8D 1IAOA 4ORGB 5E8EA 3JWOC 1MWAL 2HLAA 5SX5H 2XZQH 5F1NB 4JE4B 3DXAB 4CGTA 3PNWB 3QQ9D 3S3PA 5E1AA 2ICWI 1NC4B 1YMMD 3IJSA 3PXJA 5GGQL 2EICA 2MHAA 4Q2ZA 1E4XL 3PE9A 2Z8VC 3FRUA 3GBML 2EYRA 3ZYJA 1JYWA 2B5IB 2J88H 4U1KA 3RVTC 4XP9L 1P5UA 3GSRA 5E4IA 1TCMA 4K8RL 3I02B 4LKXA 2NY4B 3MLRL 3OZ9L 1KLUB 1BWWA 1TCRB 3WV0A 1DEEA 2FEDC 4XT1C 1MI5E 3OAZH 4TSCH 4LCWE 2V5TA 2GAZA 2EH7H 1Y0LB 3UC0L 1UXSA 5IBTL 3V8OA 1MVUA 4X6DB 5IM7A 1YEHH 1YMHB 3BEVA 2IALB 2OTUA 5JNYA 4YBQD 1QSEA 3Q5TA 1YEKH 3UTTE 4MHHG 5C3TA 1OTSD 5KS9F 1ED3B 3HE6A 2Z93B 3M1BB 3QXUA 1DANT 3MX0A 3UJIL 2R2CA 2BSRB 1CU4H 2O5XH 2WLYA 4KTYA 4XBPA 4XTRC 5D2LA 3BZDA 1T89A 4KAQH 1G9MH 2Y9RT 4DFIA 1WWWX 4HS8L 2YPLA 4KMLB 3U4BL 5HHQA 4V1DB 3AU1A 4GAGL 1JRHH 3I6LD 3BMWA 4MD5B 2IGFH 1GZPB 1E4WH 2NY3D 4KUCF 4F57H 4M02A 5IT2H 4KMTL 3BKCL 3Q6GL 4YZFF 1YQ2A 3H7LA 3W0WA 1GC1C 4XP4H 4HDIB 1K8IB 3LRGA 4HF5H 1JNLH 1AKJB 1JN6A 5CSBA 1U92A 1X6LA 5F21B 5CBAB 3V79C 4TSBL 1I1YB 3L3JA 4MA7H 5ELIA 4WWKB 1LP9A 3ET9F 3SY0A 1TPXB 3T0DA 1NBQA 4NKQB 4WUUA 1S5IH 3MRLA 1D6VL 3G08B 3V0VB 1JTTA 4Y16B 1YMME 4GKSB 1S9XB 1D5IH 4I4WA 4S1QH 2DQDL 3HMWH 4N8VA 5DRNA 1U91A 4RWYH 2Q87A 5HYEA 2GEEA 4APQD 3MRHB 1PYWB 2ZUWA 3IFNH 4PJ9D 1C16A 4OCSL 4AG4H 2X4SA 4IOIB 4EQ3A 4ZQKA 4QHUA 4V2CB 2GFBB 4XH2B 1MCNA 4ETYA 4ZTOL 4MWFA 1EUTA 3ARED 4ODBD 4XPHH 5TPWL 3TO2B 3PV7A 2B5IC 4HK0B 3VFSB 1R3LA 1DLHA 1TITA 1YQVL 2C3VA 2NY4C 4MCZB 4PRBB 3U4AA 4NYLB 5EN2B 3W5NA 7FABL 3ZE1F 3U6RA 4OZHF 1FO0B 2WUCH 3PDGA 3O3EA 3MCG1 3ME0A 3OF6D 1DUYA 1JE6A 5BZWA 5C09D 4KPHL 3ZKXB 4Q6YA 1OTUC 2X1PA 1T21B 3PHQA 4UINH 3RUGB 2HH0H 5CMAA 3OJVC 3K80A 3VU2A 2ESVB 3TH2T 4KQ3H 4IHOB 3ZSTA 4Y5XA 2QV2A 5LQBH 1FCCA 5C07E 5D6DC 5ACMA 2V9TA 3WUWA 1WCBB 3G5YB 4ZAKA 3VFTA 2E8ZA 2MKWA 2SEBA 1JWUA 5E1HB 3I6LE 1RJYB 2ZCLL 3NFPA 3VW3L 4GAJL 3JZ7A 2VDLH 3BYTA 5DK2B 4X7TB 4ZS6C 2Q8BH 4RCAA 2ZZUT 3U30B 1N5AB 4F8TA 4YDIL 1UB6A 5IB1A 1P9MC 1VEPA 1NL0L 3MLZL 5TDPA 1A7PH 4G9DA 1OAZH 1JK8B 4MLSA 1K4CB 4PRID 3MQIA 3BVNA 4OGXL 3IVKB 2BVPA 1AGDB 4NKIH 5D9SA 5H94A 4Y4HD 1KN4L 4CVZB 5HPMB 1NCNA 2GSIB 4WWKC 3SDCD 1X5XA 1HSAA 3DRTB 1TPXC 3D85A 3MBEA 3O2WL 4NC2B 4Y4KD 2DQHL 3BZ4A 3UPRB 3QUMA 1G7JA 2ADGB 4QRQA 4Y16C 3UJTH 1KENH 3GMPB 1Q1JH 4GRLB 3DRQA 4IMLA 1VACB 5CWSB 1EA9C 5B21A 1U95A 3EDEA 5D6CA 3QJHA 3NGBB 1J86A 3QUKB 2A9NH 1MCLA 4ZPVA 3DUSA 4Q7DA 2VN4A 5C0BA 1AGCB 3QUZA 4KGJA 1GOHA 1VADB 2FB4H 4HUNB 4CMHB 1R3JA 4LLVB 4X7CC 1GGUA 4KI1A 4JY4A 4JVPA 3S37X 3UXFA 4DGIH 2BDNH 5JOFB 1MFDH 2XFXA 2CPCA 5E99L 5T1KB 3TT1H 5C09E 4QTHB 5ID1A 2YRLA 2VAAA 3BN9C 4NO3A 1IBGH 4C59B 3QEQB 1DUZA 4ZD3L 1JRHI 4DUVA 4JQXC 4N0YH 5FB8B 4WEMB 3QHFL 4FFWC 1UG9A 3JTSB 4CADA 3ZKXC 2B39A 3BE1L 1MIMH 4FFYL 1BFVH 4Z7NF 3NZHH 1U3JA 2ZCHL 1V8HA 3GM8A 5EPMB 1G6RA 2ZOKA 4XPBL 3U36B 5E6ZA 3VXMA 1RUAH 4U1MB 5F89A 1JUFB 3EDDA 3S34L 2CLRA 5D1ZD 8CGTA 1T1XB 1EUUA 2G75A 2K7PA 3TA3A 4P2CG 2V9RA 3LKRA 4OIIH 5D7JA 4WO4D 1QFWH 1JPST 1UGNA 3L95A 4EBQL 5I73B 4HZLB 3L3KA 2HJKB 4PRIE 3U30C 1W8OA 5IBUG 2R2BA 3I3EA 5DMIL 4QXGH 4KROD 3RWEB 4LRIC 5E6ID 4C83B 4HKXB 1N7MH 3CSPA 3G6DL 4LNRB 4UB0L 5L8JB 1GOFA 3MRQB 4H0GA 3SE4C 1J87A 3O9WA 2DLTA 1WJ3A 5I8CA 4KJWC 3QPXH 3HC0B 1UENA 2DLHA 2UYLB 4LMQI 4AIOA 3L3GB 1HQRB 3ULVH 1O0VA 4TUJB 4K07A 4GXUM 3JWDL 1XZ0B 2LABA 4CL7A 3IJYB 3RPIB 5ESVB 4GRLC 4EUPB 1A5FH 1W2KT 4HLZG 3PWNA 3S8WA 5EOCH 1II4E 4K3GA 3NGBC 2HTLD 5C0DB 5E03A 1YDPB 5EO1B 3QDJA 4RWHA 4U1HA 1NGQL 5K9OB 4HJJH 1KEGL 2W9DH 2V2TB 1LEGB 4CU7A 1CK0H 5GZND 4CMHC 5DRXB 4U1JB 5DA4A 3U0TB 4WHDA 2N1KA 3GSWA 4GRMA 1SQ2N 1OF2A 1P2CA 5KSBE 5GGVL 4FP8L 4NCC2 2DWEB 1GHFH 4H1LG 1QPPA 5FECB 1TJGL 4YFEA 4F33A 3IDXL 2JCCF 2EIZB 5F8RC 1B2WH 2LAGB 5FYJU 4P5TB 3D1MC 2X4NA 3KG5A 1HILB 3N1PC 1OAKH 4DN3H 2F74A 5GJTH 3RWFA 2VOTA 4N0RA 3UTSB 4JPIB 3MV9A 2VDPH 3MJ7A 5IBLD 3JV6B 5IMOA 5LBSL 1DBAH 3GJFA 3PIQA 2DQIH 4QY8B 4LHUG 3AM8A 4LU5L 2PN5A 5C3LD 6FABL 5IHBA 2EO9A 5ESAA 3O3BA 1RUML 3P77A 4WU7B 1YY8A 4HMEA 5I73C 3R0NA 4KHTH 4X98A 5I8OH 1DDHA 3MJ9A 2AGJL 4WW1A 4YHKH 4E41D 5FOBA 2OQJB 2YMXH 3SN6N 1U8HB 3MPCA 2P5WB 1OHQA 4YH6A 1UKQA 3TV3H 3UTTA 3ARFA 3I3BA 4PB9L 5DURD 4QRRB 4PRPA 3HUJE 5IV2A 4OSUL 3BD4A 2VMFA 2D7MA 2F5AL 4LSDA 2XZAH 2C4FU 4PJXE 5GGTH 3MRCB 5HD8D 4YNYB 3PGCA 4JDTL 3VD9A 2EDFA 3MRDB 4LHUD 1QBLL 4LSRL 1RZIA 1UT9A 3GIVB 5I71B 2BHUA 4Y19D 4U6XB 5HDQL 1K3IA 1S7RA 5IJKC 2Z4QB 4Y7MA 4MJIA 3WD5H 2H2SD 2XN9D 32C2B 5FHAL 2DB8A 4NWUH 3MLXH 4M1GL 4DVRH 3JV4B 2V5MA 1HKFA 1XH3B 3UAJD 3O0RL 4G7VL 1PZUB 5JHDD 3GUTB 5IIEA 1QFWI 3SE3C 1NCDL 1T5XB 5E2VL 4CVXA 3QFJA 5HYJD 2Y07L 4YGVB 3BN9D 1EXUB 3T77A 4FQ1L 4BUHA 4AQOA 1U58B 1J0KA 1QOKA 2CH8A 3GMMB 5EZOH 3PWVB 3TZVA 2AQ1A 3SGDH 1FH5H 1WV7T 4M7KH 1U8QB 3GGWB 1O7SA 5BV7H 4LHQB 4MVBC 4XVSH 4PR5A 4BA8A 3SO3B 2ZCKH 4RGOL 4UOJA 1ZK9A 1D5MB 2NR6C 5T1MB 4EOWH 2CDGA 4P5TC 1WTGT 4YGAB 5LCVL 3NCCB 2QL1A 5EU4B 2A0LC 4QRPD 3RPKA 4F3FB 2QJDA 1JPFA 2WBKA 4Z7QF 1FL5A 1MLCA 3BH8B 1FYTB 3CXDH 2BFVL 2D31B 2IPKA 3DETD 3EYUH 1M7XA 4I8DA 1RAMA 2NLJB 4RMSA 1QLFA 4E41E 4GXVL 4XHJC 2AJYH 4IRJD 1XF2B 5JW3H 1T5WB 4HJ0C 1QTYT 1FSKB 1CBVH 3ULUH 4G5ZL 4LAQL 1UJTA 3FB7A 1A0QL 1G7QB 3BGFB 4DAGL 4P2QD 4Q9RL 4DW2L 3RDTD 4YXLH 3TIDB 4TQEL 3AMKA 1CWVA 1HCVA 4GG8B 1BIIA 2VQ1B 2F54D 4O9HL 2YXMA 4LCUB 5C07A 1NKRA 2MNUA 1XCQB 3EHBD 1QR1B 1RFDH 4JQVC 4WI4A 1MEXH 4XAWH 4Y19E 1N6UA 2A77L 2XN9E 4K7PL 1ADQH 2VLJD 3U7YH 3NCEB 3WEXA 5C0CA 5I71C 2YD2A 1J18A 5HHXH 1QPXA 1E6OL 1WEJL 3EDKA 2X7LB 4XNQA 2YKLL 4AK1A 2VC2L 4PTTB 5FGBA 5JHDE 5B8CA 1A6ZA 3VFWA 2D03L 5LWYL 2EDJA 3QNYA 2F58L 5HYJE 4KRPB 4NHCH 3KR3L 1JWMB 1NAMB 3V0WH 2CR6A 3QR2A 5F44A 3WFEL 1KJ2H 2BC4A 3P3YA 4PYHA 4WCYL 2VDQL 4EI6B 1A8JH 3EO9L 1MQ8A 3E6HB 3IFPA 1NGPL 5JA9A 3UBXA 3O41A 3HC3H 1D5ZB 4DUXA 3QSKB 1XGRB 4LRNH 2QADB 1NBZB 3C08H 3I6GB 1FFOA 1YEEH 4H0IA 4Q58C 5CINH 3HG1A 4DVBA 3SO3C 1BZQK 4QWWD 1P7QA 4WJ5A 4QRPE 4KZEH 4NFDA 4F7TA 4S10A 1YNLL 2FIKA 3S4SG 3ARXA 4NKOB 1OGAD 2DQFA 3X14A 3VFVA 4D3CH 5J06A 5E8NB 1BZ9B 3BP7B 3NIGF 4I2XE 1ZLSH 4AMKH 4QNPE 5FYJH 1LE9A 3SKOA 5JDSA 3D0VA 1J11A 5I75B 4P99A 4DK6A 2EZ0C 4H0HB 1ETZB 1U8JB 5IW1B 1A3QA 4OD3H 3AROA 4PJAF 2R23A 4TTDC 1KUMA 5C08B 4OV5A 1RY7B 2VLRD 5GZOD 1G7HB 1IC5L 1HDMB 3GSXA 1FSKC 2VLKD 3C5JB 2F5BH 5F9AC 3V8CA 2ENYA 1R5IB 1MCOH 2J88L 2F54E 3IDNA 4JO3H 1MCIA 4FHBD 3VXPA 3BGFC 1BVKA 1ZVSA 1JGLH 4PJHF 3OKDB 4QRSA 4OFKA 1S78C 3JTTA 4B5EA 4YFLI 4NQDD 3TVMD 3B6SA 3CK0H 4KK8C 2ICEA 1FJ1B 2HFGL 4TSCL 2GUOB 2VLJE 4OUUA 5HHNB 4DTGH 5HSFA 1NGWA 2EH7L 3SGDI 5DRZA 3CFCH 3CVIH 3HNSL 1H3PL 3QXAB 1MNUL 3CZFB 1YEHL 3VRIB 2OS7A 5CILH 2HMID 3BYYA 3K4ZA 4K71B 3DV4B 3OL2A 2AV7B 4OQTL 3PL6D 4NUJA 2I9TA 1YEKL 5SWZA 1IEAA 2LQRA 4NRYA 4LSPH 3SJVB 3BDBA 5ADOH 1WGOA 3MLVH 3LKSA 3QULA 4WEBL 1EMTH 2D7TH 4A2LA 1TZIB 4X7DC 4P4KD 1VESA 1CU4L 2O5XL 2MTPA 4KRPC 3C8KB 4MNQB 3WLBA 1AIFA 4KKAC 1F3DH 1G9ML 5DZNA 1WAAF 3WJJC 5EG6C 4WFFE 1JRHL 4PJFF 2IGFL 4KK9D 3QJFA 1MJJA 1E4WL 1BBDH 4F57L 3ZE0E 2B4CC 2Q8AH 5IT2L 1B0RA 1UQSA 4RMQA 5L9DH 1I1AB 4M7ZB 4MJ5A 2BRRH 2WWMC 4HUKB 2QADC 3ZDYF 4HF5L 4LBEB 2NTFB 1OGAE 4XP6H 4LCIL 4QLRA 2XNAB 2UV3A 4K9EL 1OM3H 4XRCA 3MGOA 2GKIA 3F7VB 2Y7QB 4RNRA 5T3ZD 3DHJA 2G2RA 5ALBH 3NA4A 5DRWB 3UTPD 2X9YA 3TN0A 5F3BA 4OZIB 2YD5A 4TVPD 5F9JA 4L3CB 4KWUA 1D5IL 4ODXA 4S1QL 1N8ZB 2BNQD 3HMWL 2VLRE 5FO8A 5I75C 2EDRA 4RWYL 2VLKE 1UEMA 2MMXA 5A2FA 2GJ6D 3PWUB 3S6CA 3JV5A 3IU3B 4L5FH 1S9WA 2GYSA 5CHNA 2ITCB 1I9RL 5AAMA 1UZ8A 3IDMA 5DUBB 2C3XA 5T1DH 4XC1H 4PJBA 4XPHL 2CUHA 1U3HA 4H26B 1HKLH 2DQCH 2ZKHH 4NQDE 4GQ9L 3X12B 4GO6B 3L5IA 5B39A 5D72H 3PP3H 1T1YA 3RNQB 2WUCL 1AGBB 5HI4D 3MRGB 2X4PA 4GRWF 4OBRA 4NQED 3KXFD 4WHTA 5K9KA 4QRUA 5B4MC 2ATKA 2BNRA 4WI7A 3KYNB 2W60B 2A74B 3B9DA 3VXTA 2Y5EA 1FZJB 5F7WC 2HH0L 4K71C 1S9VB 4RMUA 3G6AA 5D5MA 4Y2DD 4KQ3L 4X8JB 1NFDF 1EX0A 5LQBL 2X4QB 5GGUB 3FQTB 3UZVB 5IF0A 5CJOH 2A6DB 4LCYA 1U8PB 3BH9B 4HZAA 5D7SH 4D0BB 4YDKH 3DIFB 4JFPB 1L6XA 4NN5B 1ACYH 4PJXA 5BMFH 2Q8BL 5IWLC 4GW5A 4J7RA 5GS2H 1A7PL 4GJTB 1OAZL 5EA0L 4QHLB 5CIPB 1SYVB 1I1AC 1QFPA 2YD6A 1CQYA 4P46A 4M7ZC 3GHBL 4NKIL 3HZMB 1IC7L 5T3ZE 4LKCA 4NHUA 1P84J 3L7EB 3B9AA 2BMKB 5IK3B 5I15H 4YO0A 5IOPB 4TVPE 2X4RB 1S7XB 2H45A 1TJIH 3V4VH 3EDFA 4JANA 3DX7A 4WIQA 2BNQE 3JWOH 4S2SA 2QBWA 4G6KH 4W6XB 1NLBL 3VG0H 5I0DA 1MFBL 3G04B 3UJTL 2VQTA 4PG9B 4XCYB 1AGFA 2GJ6E 1P1ZA 1Q1JL 2APBA 3WSQH 4D0CA 4HIXH 4ETQB 3DVNB 4PP1D 2AK1H 4OCRH 2A9NL 1RZ8A 4D9QD 1C08B 1H15B 1F2XK 1A2YB 3T04D 4AL8H 4BKLA 2FB4L 4NSKA 4OLUH 1E27B 3LOWA 3FB6B 4ZUTA 4ZUWA 4DGIL 4MQXD 3O11A 1MFDL 2RCSL 1S78D 3TT1L 1H3VA 4FNLH 5LGJA 1U3ZA 3HZVA 4F9LC 3ARYA 4XP1H 5F6IB 4NQEE 3ECBA 3KXFE 1T2QL 2DBJA 5IMKB 2BNUA 2VUOA 5IVOA 1XCTA 5KVEH 1K5NA 4N0YL 4UV7L 1ERNA 2L7UA 3I6KA 3RGVD 1RJLA 2Z0BA 5E8OA 1OPGH 4UUJA 5C0EB 5D4QA 1MIML 1BFVL 5CSZA 3HS0A 3NZHL 4MHHI 2DQUH 3I9GH 3K8MA 4RAVA 3DX9B 1F5WA 1WIPA 3D5OF 5DJAB 2HG5A 3DGGA 3HAEA 1FIGH 4ZSOB 4F2MB 4OI9A 1RUAL 4NBZB 4DCQB 3QDMA 1FFNA 3RU8L 3SKJH 3TNNB 1U6AH 1C12A 1FORH 2CIKA 4OIIL 5CJQH 1QFWL 3FQRB 2HN7B 1LGVA 3UPCA 5HGHA 3HRZB 4LOUC 4HAFA 4NN5C 1UJ3B 5MEND 1L0QA 2UWEA 1FNSH 1CDJA 4AENA 5IGXH 5LAXA 2YUVA 4EQ2A 1QO3A 2QEJA 5KAQG 4E0RB 3C5SB 2ID5A 3AS3A 4LPYA 4WGWB 3OAYK 2Q86A 1GC1H 3QUXA 3EJYC 1D7FA 4EDXA 4GG6F 2GTWA 4I0KA 3WDHA 1HHGA 3GO1H 5JHDA 3U9PH 3N1FC 5J8OA 1GGCL 3BRFA 4Y89A 1LD9A 1SJXA 1A6AA 3BFOA 3QPXL 1I7RA 1TTGA 3FO0L 2ED7A 4FXKB 5M7QA 3OG4B 3KPRA 3ULVL 1YN7A 3L3IA 2NY0B 4JFFD 2CMRH 2I9LA 2AEQH 3LEXA 4D9QE 3SGJA 5C0AD 3UZEA 1A5FL 5TDNA 1AR2A 4F7MA 1RPQA 4JN1H 4G6AD 3MODH 4MAYB 3W9DB 4HJJL 1YEIL 3L5WB 2HKFL 1CK0L 4JJHA 3SDXE 2WBJA 3MOBH 1IZKA 5F1IA 4POZC 2OSLB 4X6BA 3RVUD 2V7NA 3CXHK 4ONHA 5F6IC 3MOAH 3UCRA 4KKCD 1NGZA 4RMRA 4D9RD 4PJDA 5L2KD 4I2XA 1TVHB 2J12B 4IRJA 4D9LH 3E6FA 5DC4B 2XXMB 3B9KB 2ZG3A 3LKPB 5E2UL 1B2WL 5JO5A 1VFBA 3MNZB 2OJZL 2FL5B 1OAKL 4DN3L 1R0AH 5GJTL 3D39B 3EOAB 1HSBB 1LDPH 5ISZA 4YE4L 1W0YT 5CZXD 3MCKA 5MENE 1DBAL 2AEWA 3BKMH 2DQIL 4UNVA 1DFBH 1JF1A 5INDA 4KHTL 4LFHD 1UJ3C 3SOBH 5DJCB 3TFKC 5E6YA 1I85A 3IKCB 4YHKL 5KVDH 5GJSH 2DS4A 1I7TA 1QSFD 4PJIE 2YMXL 3UYRH 1DQJA 2WLZA 5JW4N 4ZUVA 1JHTA 5C0FB 1JCKA 1IGIH 1INQB 3TV3L 5ACZB 5ENWB 4NJAH 5ICYA 4YEEA 5MP6H 2BSTB 2HJLB 5TF1H 4I18B 1YPZF 2JK5A 2NY6D 2Y36H 3RKDD 2HT4C 2P8MB 4L4TA 4U1LB 1EFXA 2XZAL 2C5DC 5J89A 1BJ1H 1T3FA 4JFFE 3FFCA 2ZG1A 1A7NH 4Y5YB 5C0AE 3P2TA 4XCEB 5T3XD 4IIQB 5JXED 1OAUL 2NY0C 3QI9D 5K59E 4PJGE 4LEXL 1G7LA 4KUZH 4G3YL 1J1PH 1AP2B 2R1YB 2ZOLA 5KVFL 1TVDA 3MLXL 4DVRL 1AD0B 5IESL 3QRFM 1RUPH 4LVNB 3ARTA 2JCCB 4MAYC 5F7DA 5D7LB 3K4DA 3BRGC 2JIXD 2BOBA 4D9RE 1I3RB 2C1OA 1FO0H 2C7UA 1JIBA 5EIQA 3OKOB 2AP2A 1A7BA 2HAZA 2DI9A 4N0CD 1JZ2A 2QKIB 3TT3L 3ZKSD 2VZSA 1DN0B 4IMKA 5BV7L 2Y06L 3U0WH 4XVSL 2VLKA 4HS3B 2HVJB 1VGKB 3AB0B 2ZCKL 3B9KC 4EI5A 5DJXB 4JM2A 4R0LA 3VXSA 4P2RB 1BEYH 4EOWL 1FV1B 3LKNB 1RZGA 4QTIH 4YBHA 2FECI 4ODSH 2CDFA 4XNMB 1EBAA 4Z78B 1SY6H 2X1QA 3CXDL 4O2EB 2ERJB 2R56H 2VNCA 3EYUL 3DWTA 4J3VA 4PUBH 4MDJA 3HMXA 1EZVX 1QSFE 2AJYL 4Q6IB 5A3ID 3U48A 4WU5A 4AIXA 2VB5A 1CBVL 3BMVA 1CF8L 4I3SH 3ULUL 5AZEH 5BJTB 1KCUL 4X6FA 1RV6X 4WY7H 1TIUA 4X5XB 3RWJA 3ARGA 3QXDB 1JGUH 1XIWB 2Z9TA 1EEYB 5MERB 1CD8A 3PGFL 5IKCB 1BOGA 4NQCD 4TUKH 4I18C 5JHLH 2HTKC 4M3JA 4ZFOA 2UY6A 3GB7B 5T3XE 1RFDL 1MEXL 1X5LA 4XAWL 3X13B 3BP4B 3KPSA 3OXSA 1E0OB 3FMGL 4AIZA 3QG6B 4Y5YC 4G8EB 2EDDA 1ZA3B 1ADQL 4IIQC 3U7YL 4XMKH 5EIIB 2XACC 1IM3B 4HW6A 1KCRH 5HHXL 4XGZB 4BH7B 4OF0A 2I24N 1B4JH 3MV8A 1IGYA 1NFIA 3BP6B 1KCVH 3O8XD 4EDWL 5D93B 4LVNC 3C60D 1B6DA 4X99B 5I66B 3PWPB 1AXSB 1JTOA 5JPNA 3LZFH 4Y4FB 4I9WD 1NJ9B 2E7CA 5KOMC 1KJ2L 5ESQB 4POZD 25C8H 5EO0B 4GUPB 2HYMA 5DHYB 1G7PA 3QDGA 3DMMD 1CGYA 3ES6A 4JRXE 3RTQA 5JZ7D 1YC7A 1ZLVH 3RWDA 1GGBH 4W4OC 3WHE1 3HC3L 4OZGA 3ZTNH 4LRNL 3C08L 1YEEL 3PGDA 4QHMB 2OL3L 5I19H 3C87A 3AB0C 2LFGA 1N2RA 3OJ2C 3FRPG 4BQ9A 5IR1A 3PUCA 4X4MA 5F7HA 4N9GA 1BVZA 4HUVB 3BPCB 2DLIA 5A16B 1X5AA 4MB5A 1OGTB 2M1KA 2P49B 5F1SA 5C86A 1QLEH 3N85H 4MX7B 4D3CL 4K55A 1G7IB 1SJHA 4MA3A 5DC0A 5FYJL 3HPJB 3RI5F 3MACL 3ARBD 4HIHB 5SWSB 2ERJC 1X5ZA 1YN6A 3OKEB 3QZWG 4KKLD 4HK3J 2APWA 3FOMB 3QWRD 4Q6IC 1A14L 3V0AC 4M8QA 4PRAB 2R2HB 1HI6A 4Y2DA 1FZOB 2F5BL 1KC5L 2DBLH 5D2LF 4NQCE 5GSRA 2JF1A 4JO3L 4R90H 4PGBB 4ONOA 2FSEA 1XGPB </