4HPOL

Crystal structure of rv144-elicited antibody ch58 in complex with v2 peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
b'NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
molecule keywords CH58 Fab heavy chain
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoL01
1EEZB 1N2RA 5GHWH 4OZ4A 3HUJA 1CTNA 4ZFGH 2VDOL 2NMSA 4ZS6D 2PYEE 1P7QA 2YR3A 4NRYB 4HKZB 3RL1B 2XFXA 2YUZA 5E2UH 4IRJC 1XZ0B 4CVUA 1JGVH 1X9QA 3K0WA 3TJEH 4PJAE 4DZ8B 4OZHB 2C3WA 5BW7A 3H42H 4N90D 5DRWA 3O8XD 4XC1H 3WS3B 4ZTOL 5LBSL 1DVFC 2R1YB 2B5IB 2HT3D 5C07D 1KBGL 4RISL 3QA3B 3KXFE 3RTQC 5F96L 3OAUH 4N8VG 4N1HB 1KFAL 4TSAH 1I1AA 4LCIH 1UZ8A 4NNXA 1VFAB 2WANA 2AI0L 1A14L 1FFOB 4GBXC 4NO3A 1IMHC 4ZAKD 3ZDXF 4KGJA 2V7NA 4OM1L 1S7QB 4PRNB 2RFXA 3NCJL 4XPAH 5SWQA 4MDJB 3T2NH 4TRPH 4UQ2A 2VLRE 1KENL 3TA3C 4RWHA 2CDFB 3ARQA 1SJXA 1RIUL 1IKNA 3QCUL 1FHGA 4S2SA 5C09B 4OGYH 1FL5A 3AFLA 1AGCB 3QAZB 4QHKJ 2W65A 1A4JB 1OPGH 2B0SL 2XNAB 3DX6B 3IAGC 2WZPD 4JN1L 3VXOB 4AG4L 2IJ0C 2YBRB 5DRNA 5GPRA 3B6SB 4XVJH 1T7WA 5T1KD 4X7TB 5EU5A 3DMMC 1F00I 4WHDA 5EC1B 1XGUB 3VE0A 3PV6A 1CFVL 4PTUB 5CILL 3RKPA 1HKLL 4P4RB 5BRZD 1P53A 4PGZA 1JL8A 1QBMH 2EDQA 1DQMH 5KN5A 2J1KA 2BOCA 4BQCA 1JPFA 3BWUC 1Q8MA 4DK6A 4CGTA 4DGYH 2HFGH 2K7QA 4NKIH 4MJIE 1QFWH 1BQLH 5HYSB 1PY4A 4PGBA 4R26L 4HCRA 2QSVA 3ARVA 4JFOB 3ZYJA 1ND0A 4DAGL 5IEKB 2FYYA 3LS4L 3GJFA 4HBQA 1UZ6E 1VACB 2PNDA 1MLBA 4Z7UB 2BSRB 5TE4H 2A6IB 3KDMB 2EDBA 4OCRH 3BMVA 3Q6FB 5DHYA 2AEQL 2P8PA 2I9LB 4G80B 4LSVL 1YQVL 3RGVC 4B7LA 1AD0B 3G5ZA 5L8LB 2HVJA 4YDKL 5J6GA 1CG9B 4OQTA 4HUUB 5I8OL 3S4SB 2X4UB 4YHZL 3I3DA 2V17H 1IQWH 4ZFOL 3LDBC 1E28A 3U0WL 5I8EB 4OZIE 2HJFA 1Q38A 3QHFH 3AXLB 3WFDH 1YPZB 4NDMB 1UKSA 2VL4A 3K4DA 4ZXBC 3JUYA 3KYOA 4OCNC 2OL3H 4ZO7A 2ITDA 2R0KH 4XBPB 4JM2F 3ROOB 2RAMA 2DJSA 4MNQA 4J3XA 5JQ6L 4BK4A 3C2AH 1URLA 2WBWB 4EI5B 4JANB 4QKXB 1OSZA 2P24B 1JPSL 5T1LD 3OX8B 1NCAL 2J8OA 3GIVA 3HZKA 4KI5F 4OLZL 1AP2A 3MA7A 2FX7L 2Q8AH 1SMAA 2XRAH 4JFXA 3H3PH 1AXSA 4NKDA 3OR7B 1RZFH 2PCPA 3ALPA 3O2DL 1QFWM 1A7PH 4OUOA 4NC2B 1F6AA 3OPZL 1SY6A 2ZJSH 4N8CH 3W5NA 3TNNB 5KG9B 3VWKB 3LSOA 5IEHB 1MHHB 2PN5A 1T3FB 3WFEL 2WK2A 3KXFA 2BHZA 1S9XA 3RP1A 5CP3H 5D6DA 5IGXL 3L7EB 3WHXB 5ITFA 1NBVH 2AS5M 4O2EA 1IQDB 1SYSA 2IADA 4UDUA 5LXGH 5I1EH 2C1PA 3TBWA 4O5LL 1OHQA 2NY2C 4JJ5B 1NCWL 5DVMA 5LCVL 1L7IH 2EYTB 2ZSVB 4L9LA 5IQ9A 1DN0B 4QHUA 4WUUA 1TZHB 2VLRA 3VRLF 2BVQA 5C0EB 4I48A 4FTVD 2CLRA 3KLAA 5D7LD 2QADC 4J8RB 1DEEA 3DXAB 1I75A 4J7RA 4LPXA 2Y1VA 1PG7L 3E2HC 1ZAGA 4Y16A 3OKOB 2R4SH 4NZRH 4OZGE 2ZPKH 4UOW1 3VRIB 1A1MA 3NZHH 2JB5H 2Z35B 4HPOH 4C83B 5D7IF 3KJ6H 5JZ7C 1JVKA 2VERN 2AEWA 4TQEH 2E6QA 3MGTB 2DQDH 1N0XL 5F6HI 3DI3B 1BFVH 3MRGB 1C5BH 4Y5VC 2GITB 5JUEH 3SDDA 1RK0A 4G3YH 5GJTH 5IJKC 4MJIA 3H6JA 5FUOL 5EWIH 5I1LB 2AJVH 4UT9H 4LSTH 5HY9A 3TH3T 3BXNB 4AYFA 3GMPA 5F6IC 4R0LC 3QIBC 3TZVB 1J11A 2V2WB 4ORGB 2EDWA 5CFHA 3PWNB 2DLEA 1RK1A 3T8XA 3L5WA 5J56B 2JCCB 2EKSB 4EVNB 3LEXB 4NUGL 2NY6C 2GCYB 3FB8B 5TE6L 5TQ2H 1LEGB 4OLWH 5A2JH 3PGDA 3TPKA 4P23B 3DURB 1OP3K 3FQRB 3RY5A 5ALBH 4KQ3H 4P9ML 4Z7QE 1U8KA 5I1IL 2BMKB 3RAJL 2VQTA 3KYKH 5DGQA 1YY8A 4L3EE 5CP7B 3Q5YA 1ORQB 1BZ9B 4OZIA 2R2BA 1V7ML 5DC4B 1NANH 3CDFA 3D3VE 5IHUL 1QSZA 5FYJE 1CFQA 4O4YH 3IFPB 4X6CE 5GRXG 3OJMB 3GGWB 3KYAA 1DANU 2QV2A 2VISA 3EFFA 3GMOB 4JRYB 5I1HL 5I6XB 4LSRL 3JWOH 3FHQA 4ZYKA 1E6OL 2VITB 2CDEA 4Y4HA 5IHBA 3B5TA 3F6LA 5GRUH 5TFSH 5EOQL 3BKJH 4OGXL 1UYWL 3DIFA 4JRXD 1UWXK 3L95B 3TFKC 1MCWW 4NYLA 5MHSD 1YN6A 2AABL 2VZTA 2VWEE 4JZNA 1U3HC 2DQJL 4I77H 1RFDL 5DUMH 2CXKA 3OAYK 4OD2B 2XKNB 1L6ZA 4DOHE 3P9WB 3QUXC 4ZUUA 2P43B 1AXTL 1G7MB 3PGFH 4D9LL 3IDGB 5C0DB 3UTTD 4YHIA 1L7TL 1CZ8L 2DQUL 4KUZL 4MMXC 4F9LC 1VHPA 2XIDA 3O81A 3HCVA 4OLVH 3VXUE 5A2FA 1DP0A 4PRHE 3RU8L 3DUUB 2WP3O 1NSNH 1EFQA 3R1GH 1XF2A 4RGND 4WNQB 5GGVH 4YUEL 3WO3B 3VDBA 3CCHA 2C3XA 3IETA 1JMZA 1PSKL 2JF1A 4NNXB 3WE6B 3UTSD 1IM3A 3HZYB 4PG9A 3IFLH 1ZLSH 4Y88A 5CGYD 1ZS8A 4IDLA 5GGRB 4OZFA 1S5IH 3A6CL 5ICZB 5KSAB 4OB5H 5DD0H 1BVLB 5BS0D 4M5ZH 1UCBH 3RGHA 3VFNB 1W0VB 1ZLUK 4Z78B 2OBGA 2V2XA 4OZGA 1CL7L 1REIA 3MLYL 2D31B 4G8FA 4EUPH 2DWEA 1AIFB 5DRNB 4DK3A 1K3IA 1T7VA 2D7PA 3P0GB 4HQQL 3MLRL 2D7MA 1HHGB 2Y07H 1R5VA 5BMFH 3S35H 3NVQA 3JV6A 3LQZB 4R2GC 1CICC 1W0WA 5A3ID 1LO4L 3D2UA 2XA3A 1TQBB 2JJVA 4XCCL 3BEVB 2X1PA 5HGBB 1A7RL 1T2XA 1YMME 3U9PL 5HGDA 4FXGB 2LU7A 3TO2A 2VQUA 2XZAL 4KGLA 5EUKA 1MFEH 5EZJB 3ILQC 1PKQB 2XN9A 4FQCH 1Q0YH 4WO4D 5IR1A 3LKRB 3JZ7A 2WLZA 3C5ZD 3CVIH 3L3OA 4JE4B 1Y6MR 3SJVD 5J3HD 5T3ZL 3V0VB 2YD5A 2EXYC 1UEYA 5KVDH 1Z0MA 5SWSB 1OY3B 4UI2A 3VH8G 3PP3H 2X70B 1NFKA 5I1KH 1IGML 3FQWB 1GOFA 5JW4R 4X4ZA 3ALXA 3N1QC 4JN2A 2ZUUA 3TVMA 5KSVA 5JXAL 2P8PB 3G5ZB 2HTKD 3E3QE 2AJXH 3GMLA 1UQSA 4KK9C 2KH2B 2XTJB 4NUJB 5E8PB 3T77B 1NGXA 4G8EB 4L3EA 2A73A 4RAUB 1F4YL 2COQA 4CRPA 2BNQE 1A6TA 4KHTH 2FBJH 4GG8B 2IPUG 2GTWA 2XY1A 3FRUB 4P3DA 3EYOA 1C1EL 3D3VA 5DEFB 1SVCP 1RUPH 3SDCD 2GJZB 1WCBB 2BZDA 4X6CA 4ZUSA 3S5LB 1A6UL 5GGSA 2DQFA 1I9RH 4KJPC 2UUDH 2O5YL 3R0MA 3ILPA 3E8UL 3VFOB 1E27A 3ZKSD 1NAKL 1XGTA 1Y0LA 5IIEA 2XKUA 3ZTNL 2JE8A 3OQ3B 3U0PA 3NMEA 4Z18A 3T08A 4JFYA 4KMTH 1FV1A 3GEWB 4JQIL 1EV2E 3BYYA 3CMGA 4LVHC 5IW1B 2PYEB 3KJ4C 2DQGL 4JFXB 4WTZA 2FIKA 32C2B 3SBWC 1BF2A 3P9LA 4LCUB 4YPJA 3IS1X 4PY7A 2ZOKA 1MCKA 4PJAB 3MLTA 2Y36L 1F6AB 4R97C 3RVTD 1BP3B 2CLVB 5D7IE 2Q7YA 3EJZD 3KLDA 5D7SH 4HIIA 3MRHA 1FLRL 3LKOB 3MJGX 5T3XH 4Z8FL 3MUHL 5E2VL 4TSBH 3BQUD 1BAFL 3GUTB 1S7VA 5EIQA 1PLGH 3BZFA 4PRHA 4XNZB 3VFRB 1G7PA 1K4DA 3QB7C 4POZD 3NCEB 2UYLB 2HVKA 4XMLH 3GB7B 3G5XA 4GFTB 1MFDL 2H45A 4OLYH 4OSUL 4DGIL 3MLVH 3TBWB 3GSOA 2HJLB 5ECJE 2F58H 4I0PD 4M5YL 3REWA 2QHRL 3BWAB 3FB5B 2C7UB 5DQDH 2BVEA 4MLIA 4GMSL 12E8L 1YYML 4JPVH 3ARGB 3O4LE 2Z8WC 3RWEB 5CKAA 2O26U 1FJ1B 4MX7A 1MUJB 2A74B 2LAGB 4GRWH 5GS0L 3IDYB 2PXYC 4LSDA 2YPLD 1AGBB 3KPSE 4YO0B 3U30C 3V4PL 3S37L 4CJ1A 4H20H 3VXRE 4GRLA 2X9WA 4RBPK 4Y7MA 3PL6A 4J12A 2IPTH 4NBYB 3QXVA 1NCDH 3LQAL 1XGPA 1KPRA 1W72L 1N8ZB 1R3JA 1YMMA 8FABA 2I26N 2VXUH 2VLKB 4WI9A 2AQ3A 1U8QA 3QUZD 4WCYH 2YMXL 2R56H 1HHHB 4I13B 4EXKA 4O00A 2NXZB 2PETA 4BUGA 1FN4A 4HWZA 5EBMA 4XGZB 5GGTH 1D5XA 4NM8H 2YD9A 4WEBL 3UPRB 1NBZB 4UT6L 5CAYB 4WFFE 4XRCB 1KB5A 4YDVB 3TWCL 3GSQA 3LPFA 4KZEL 5L2KB 4G5ZL 4ODHL 1MIEH 2H8PB 3C60B 4M7KH 2VMFA 2X2YA 4RGMC 3UJIH 3JV4A 1OT2A 2AK4D 1RK1B 1KTDB 3L5WB 3HB3C 2F8OA 4YBQD 2OJEB 1I1RA 3O6FA 2RJMA 1FFPB 3QIWD 3VW3H 1GSMA 1NFDF 5D2NB 4P2OA 1LK2A 3SCMC 4AEEA 3SQBA 3K46A 1DBKH 3LKPB 4Y1AE 4GS7C 5JW5B 4KK8C 2BNQA 1T83A 3CSPA 2I60L 1EO7A 4Y4FA 5CZVH 4KZDH 4UAOC 2V2TA 4OZIB 1IC7H 1JYVA 4HKXB 1WWAX 4MYWB 3P4OB 4R4FH 3QDJE 3T3PE 4QNPF 3VCLB 3OKDB 5L7XL 5AUMB 2Q6WB 4K9EL 3TYFB 1U36A 3OB8A 5D70L 3LN5A 5CJ5A 4OLXH 5D9SA 1Q0XH 4JO4L 2EO9A 1DQDL 4PS4H 1RHFA 4LCYA 1Z0NA 1IGYA 1RMFL 3HC3H 5DDHB 5E5RB 2FB4L 5C0CE 3UAJD 3BYTA 4FABH 2I5YL 1N7MH 3QXWA 1SM3H 3M1BB 2OR8A 3MLZL 5CEYA 1X3DA 5D6CA 5BQ7A 4QRQB 5I1DB 5ILTH 4IBLT 4UOJA 4JVUA 2VXTL 2AJUH 3MX0A 1G0DA 1NQBA 3ZSTA 2UVFA 2KL6A 3CPLB 1BEYL 4OLUH 1CFTA 1T4KA 1FRGH 4PRPD 2AJZB 1JK8B 3KPMA 4YLQT 1EUTA 2VR5A 5E5UB 5BXFB 4GUPA 5FK9B 2YD2A 5IVXE 4B53A 3IETB 3GJEA 5JR1L 4AIZB 1KJVA 4NCDA 4A6YA 5E2WL 5HJ3B 4X5WA 2EIDA 4L29B 4WWKC 3WDHA 4Y4KC 1Z2KA 3BDBA 5ID0B 3O4LA 2XY2A 4JO1H 1CCZA 1WT5C 1ZHLB 3Q6GH 3UBXA 1FZOB 4YH6A 4OGAD 4LMQI 5K93A 4CADA 3KPSA 3CFIC 1TTUA 5I19L 2X4RB 4RRPG 3A6BH 2FJFA 1RJCA 3VXRA 4PBVC 5H2BA 3M8OL 4GG6B 4IIQB 2IGFH 1CDHA 3D39A 4ZS7H 1KIQA 2B1HH 1U8PA 4PY8J 3EOTH 1W0WB 4BZ2L 1FAIH 3MRQB 1ZV5A 3VFPA 1F5WA 2DMCA 3BI9X 2WBJA 3MR9B 4HGKC 4UB0L 4WI6A 4G7VH 1QA9B 1CR9L 1JHKH 4FQJL 4XTRD 2AXGA 2VRAA 4IS6A 3TO2B 5FGSA 4M6AA 4WW2A 5TGBB 3IU4H 5GGSY 3ZE0F 3UEZA 4PBWD 1PG7W 1DDHA 5D93C 5IJVA 3PWPE 2ZCHH 4KH2A 4XWOC 1PFCA 1KG0A 1QQDA 2W1NA 3VXMB 3PHOA 4C56B 1GYAA 5FYLE 1L0XA 5T33H 1NDGB 1LO0H 5GS1A 1I1CA 3GSNL 1I3GH 5T5FH 3TIEA 3WUZA 5LAXA 3QIUB 4U6XA 5KSVB 2Z9TA 3HC4H 2JELH 2PO6A 4YDLC 5I8KH 5JA8B 1FP5A 3G08B 1HIML 4X6EA 2F53E 2HKFL 3OG4B 5MENE 1LK3H 4R7DB 2APFA 4YGAB 3IU3A 3MV7E 1Q72L 3D18A 3L3IB 4Q6IA 4Y1AA 1CWVA 1VDGA 2HWZH 4EIGB 5C0AD 1A6TB 3PWLA 1OAXL 2GTWB 3HG1B 2ZSWB 1PAMA 1RJYA 2DTSA 3CFEB 3QDJA 5HHVH 1ZA6A 2CK2A 3D3VB 3PHQB 3WUWA 4P2RE 4XZUA 4H5SA 4X6CB 2X9YA 3KPPA 4ZUSB 5HHOD 2HTLD 1BJMA 3GNMH 1N26A 5C0BD 3BPOC 2P5WD 5JOFB 3HE6C 5J12B 2ZUYA 5F7DA 4RMVA 2XZQH 1RZ7H 1ZKAA 1VADA 4ZOBA 2H3NB 5EORH 3RWFB 4ELKA 4ERSL 3QH3A 1FV1B 2BCKB 2F54B 3GSXA 3HMWH 2A83A 3C2SA 2VL5A 4PJ8B 4PV9A 4F15B 2FIKB 5CCKL 4OUUA 3NFNB 5KVGH 4CVZB 4EN3A 3KNBA 2ESVE 1AGDA 3MLTB 5SX4I 3I75A 5DZOA 2YD1A 5GS2D 4L5FH 4MAYD 3ZYIA 3EDKA 3PIQB 2P5EE 3MYJA 4D0DB 1ZOXA 3L3DA 3MODL 1G7HA 1S7VB 1OAQL 1VFMA 4ONGH 3BZFB 3V0WL 3S8WA 1JGDA 3VXUB 1AR1C 3CAFA 4GKSB 5I76B 5AG8A 1GJIA 3TVMC 4U1SB 2ICCA 5DJAB 5IVXA 1XEDA 4QRRD 5BZWB 3NCYP 5ERWA 4PJEF 3IDMA 3KPNA 3U1SL 5EN2B 3ROLA 4MQ7B 3ESUF 5I1AA 1A7QL 3QUYA 1LE5A 5DJ6A 3VWJC 2FGZA 1IVLA 3MJ9A 2G75A 1QKZH 1TJHL 4HUNB 3MRDA 1XF4A 4TTDC 2P1YA 3QDGB 2UZXB 5FHBL 5JW3H 3CDGB 3LKSB 5SWZB 1YEDB 4JR9H 3TV3L 2HT4D 2Y72A 3LV3A 3Q5TA 4Y0GA 3P4LA 3OKLA 1OM3H 1MY7A 5F7HA 2YSSA 4I5BA 2BNRA 5TJWK 1B88A 3MRLA 3D9AH 2LE9A 2Z31B 1N3NA 2CKNA 2FWOA 3UBXI 2EO1A 1RQ5A 3CH1B 1KLUA 5EU3A 2IAMD 1AKJB 4NO0D 3QO0B 4HCRH 1I8IA 2W38A 4U0RC 5EBLB 4Y5XA 4HFUL 8FABB 5I74B 3PABB 1BGXH 5I9QC 4QNPE 1X5IA 1A0QL 4X7DC 3MBEB 1FBIH 4JM2B 1JZ8A 2Y9RT 1D5XB 4JKKA 2CKBB 4GH7B 3BP5B 4M6ML 3PWPA 1FE8H 1NJ9A 2CIIA 2H2SD 4QXUH 2AEPH 2W59A 5FUZL 1CE6B 5D2LF 4MCYA 4NQCD 1INQA 5A40E 3CXDL 3JV4B 1JNLH 2ATPA 3H3KA 4OQTH 1BM3L 2AVGA 3BE1L 4N9GA 5I1CH 4H25A 5TE7H 4NIKB 1WJ3A 3BT2L 3HI5H 2EDYA 3PWJA 1MAJA 2WAHA 5AYQA 2R23A 4H8WL 4X4XA 5C9JA 2VDKH 1UM6L 2LABA 2IALB 4WW1B 4EQ3A 2IC2A 2F53A 3LRGA 4P46B 4YZFE 5MENA 1WCQA 3DUSA 3MV7A 4HZLA 5TF0A 1WQVT 3CC5B 4M62H 1JUFB 3ZDYE 2L7JA 4Q2ZA 1E4XH 3MNZA 2IG2L 3I50L 4ZO6A 3ARFC 3ULVE 4JQXC 2HLFC 2AKRA 3DV4B 1MREH 3EO0B 3QUMA 4WVRA 4PV8B 3O9WD 4L4VB 4P2RA 1IM9B 3PXHA 1S7WA 3JTSB 3AU1A 3VA2C 1UWGL 4O2CB 4UILL 4UU9A 4NM4H 4YHYC 3LN5B 3ARBC 1GZQA 4GQ9L 3T4AA 5HI5C 1M7IA 3CH8A 1EO5A 1SY6H 1CLOH 1FSKC 4XNUH 1JF6A 1QLRB 3FFCB 3MNWA 1NC4B 2OSLA 1R0AH 1DQJB 1HWGB 3OMZA 5FEBA 1CXHA 3MRJB 3DNKA 3GRWL 4LGSB 2ESVA 2NX5D 2NY1B 3EOBA 3C5JB 1MIMH 5D7IB 4JB9L 1OP5H 3T0EE 3IXAA 2P5EA 1A6VL 3ZDZF 5IB1A 3ETBF 2V5RA 4MQTB 3KPRE 3MRFA 4KHXL 3F7QA 5I71C 1S9KC 2VABB 4GSDL 3ECBB 2R0ZL 5MEQB 1U8HB 3E6HA 5F8QC 3V4VL 3ZKND 1HZHL 1LD9A 1OQOA 4M1DL 3SE9L 5ESAA 3O3BB 2VQ1A 3QUKA 4MNGB 5JLZB 5D8JH 2IFFL 3RWIB 4OCXH 4DEPC 4ENEC 3QHZH 1YNKH 1NLDL 4G8GE 4JFQA 3VI3F 3WIHH 3GO1H 4DN4H 1MHCA 4B5EA 4X0KA 4G9FE 1T83C 2J7LA 2XKSA 4P4KB 3OXRA 3QI9C 5C8JB 5I0ZA 2IPUK 4NO5B 1R3IL 5I2IA 2VN4A 4P57A 1U8IA 3W5MA 1F4AA 1K9TA 5E8DH 1D5ZB 2C26A 2Z4QB 3CFDA 3QFJB 1MVFA 1T80A 1Z6JT 4AENA 3HAEA 1I4FB 1G9MH 4XP9L 3FOMA 4QRSA 5FKPB 4BFIA 2EDJA 4PRDA 5IHLB 1U8PB 5EU4B 4YHKH 4R96B 4XHJC 2R0WH 2UY6A 1A02N 3QCVL 4U1NB 2EZ0C 2WBJB 5E5MA 3V6OE 1J0JA 4LLUB 4S10A 5E70A 2B4CC 3EHBD 2ILLA 3EOYG 4G7YH 4NC1E 3RDTB 1HYRC 5IFHL 2HH0L 3QXAA 1J8HE 1F4XH 1U9KA 1DDHB 4JPWL 3FN9A 1AE6L 2UZYB 3CUPB 3KPTA 2ERJB 4W4OA 1AD9B 4S1SH 4C4KT 3BDYL 1M71A 3FT2A 3WNMA 2FX8H 5CSGA 1MELA 3EGSB 5GS1B 4L8SA 1JZ2A 2YXMA 3RWCB 4AY0A 2Q76A 3V5HA 1A8JH 1KC5H 3OGCA 4WEMB 3T2PA 4GW4A 1G6RB 4NN6B 4LHUD 1GGIL 2XTLA 4HSQA 5EH1A 1T66D 5DJCB 4F33A 4BZ1L 4K94C 4OF6A 1WTGT 2DQEH 2D7TL 5HHPB 1BREA 3WL9B 4AQOA 4ODTH 4OIAA 5DT1H 3QDJB 3WUWB 3E0GA 4XZUB 5F8RC 5C6TH 1R3LB 2APBA 2WINB 2KZWA 3DV6B 4N0FA 3MRKA 4F58L 4PJEE 3VD7A 5B3JF 4XP1H 3ULUC 2FCBA 4M4PA 4LLYA 4X9BA 1U0QA 3O41A 4Y19E 1CGTA 1U8MB 5FXCH 2WV3A 4N5UA 2YK1L 1MCSA 1C5DB 1YDPB 1HXMA 2H9GA 3BPCB 2GSIB 3DX8A 5C0CB 2XQYK 4QRUA 2BY1A 1IJ9A 3UTQA 5IMMA 1F97A 3TCXA 5IMLA 2W0FB 5DMIL 1RY7B 4XXDA 4DTGH 5ADOH 6CGTA 4WHTA 5LGHL 1BFTA 4P9HH 1AGDB 1RD6A 3MYJB 5D1QA 1I3RA 3KPRA 2DLFL 3W0WB 2XT1B 3MGOB 5SX5K 5F7KC 1VFBA 4NWTH 4JKPH 4JFFA 4OZFH 1YC8A 3Q48A 3QAZC 2PW2B 4I9WE 5T5NF 3V2AR 5IESL 4LHUG 2PO6C 5J9PA 1KJ3H 1RULH 5JXED 5ERWB 1MOEA 3OJVC 1LO5B 1H3TA 3IDMB 1FNSL 4G8GA 3ROLB 1N5AA 4P5TA 1HSBB 5C0RL 5EOCJ 4U3XA 2YOCA 3QJFA 3QNYA 1S78D 3IFNL 1JNNL 2EEAA 4QHNA 4N5EC 4PREB 2YKLL 1K85A 2Z8RA 2NY4B 3FT4B 4S11A 1IGCH 4D9QE 5IMOA 2VDRH 3Q2CA 3ZT7A 1NGZB 3V7AG 1XCTA 3GSVB 3KHOA 3CVHL 4I18A 5GSRA 4XBGB 5ID1A 1OAUH 3O2WH 1KOAA 5DK2B 3U7AA 2VDNH 3V6OA 3SGDH 2GAZB 5C70A 5ICXA 5E99L 3R06A 4JZOA 2D0HA 2VH5H 1ZT7A 1MFBH 5J1AB 1A21A 4K3EL 4NJ9H 4P48A 1IAIL 4FNLL 1NJ9B 4O02H 3QQ9C 3WFBL 1DQQA 1OSPL 2JK5B 1T0PB 2DM3A 2DD8L 2MPAH 4BSVA 3P73A 5AZEL 4CVXA 1RUQL 4RWYL 5HYQA 2FO4A 2AV1B 4JFED 5C0GB 4WI5A 2G2RB 1A1NB 1OW0A 2AQ1A 3IDJB 3GMRB 3L5JA 2JJSC 2QHLA 1XR8B 1H15B 2Z91A 1DQLH 4NRXB 4OI9A 1HEZA 1IT9H 1JJUA 4P2QD 3BKYH 1EO8L 5FUCC 5MENB 4N8VB 3DUSB 4EI5C 1OGAB 5EO1B 1XR9B 3QUYC 3ZDZE 2Q1EA 4OCWH 3T0XA 4K3JH 4S1QL 3MNZB 3GMNB 3VFVA 5ENWB 1QRNB 5D1XA 2YS4A 3SY0B 5CLTA 2IBZX 4KVCH 4HUWA 3MRRB 3MA9L 4PD4K 3TA3D 4ALAL 4P59L 1QSEE 5HDBF 5IBTL 2J8HA 4NZTL 2RQ8A 1IAOA 3L3KB 1QG3A 3FB7B 5EZIH 5L6YL 4KKCC 4U6TA 5EDXA 2DDQL 5HHMB 2DOCA 4Y19A 4OJFH 3VWKC 3EYFB 1MCOH 2NY0D 5DJ0A 2BFVL 2ZG2A 1FORH 4LAQL 3VXSA 5DYOB 5C0JA 1D6EB 1IAMA 4NCC2 1EH9A 4HUVB 4Y5XC 1U2CA 3EOAB 3SOBL 4EUPG 2E5EA 1RZKC 3SDAA 4O58H 2NY5H 2AW2A 3UTZA 1VA9A 4ZG1A 3EO1A 4BELD 2R2HB 5IQ7L 4ZFOA 1Z3GH 3VXNB 1GAFL 3KPOA 5ISZE 2X4NB 1FVCA 5JMOC 2P5EB 2VE6A 1ES0B 2BC4B 4NN5B 3RRQA 5C07B 2DBJA 2BDNL 4V2BA 1MJ8L 4RAVB 1CFSB 4L4TD 4LK4A 3HA0A 5KVFH 5BJTB 3MBXL 1KIRA 2NY7H 2OLDA 4FMKA 4PLJD 2HAZA 3MUGB 5T3XD 1TVHA 1NC2A 4YHML 4TSCL 3UYRH 3LB6D 4ZAKB 1ZVSB 4NQTA 4F37F 5F3BA 2J4WH 1E4XI 3O2DA 4HUMB 2Q3AA 3TP4A 3V95A 4HWBA 5HD8C 4KKAD 1F58H 2PW1A 3Q3GB 2H2PD 2VDQH 1T22A 2ZUTA 1FDLH 3GI9H 1XF3B 4MA7H 4XP5L 2FDBP 4QGYA 1NFDB 3RIAK 3OKNA 3UDWC 4XVTL 4DGVH 3SQOL 3H7LA 5E2TH 4CN1A 1GHFL 1RI8A 3JSSA 1B0WA 3QCTL 3MZGB 3TZVC 1CGSH 4GAJL 1B6UA 4MHHG 3VGHA 1LNUB 1UENA 5E00B 1K8IB 4IOIA 5DD1H 3BRGC 4MAUL 4XPGH 2OM5A 5CMAA 4K23H 2D2OA 5BRZB 1WISA 4ZD3L 2M1KA 4GXVL 4K8RH 1J1OH 3DETD 1ZT4A 5I30H 4DQOL 1KCSL 4ZPVA 4MNHA 4FQXA 3SN6N 4ELME 1QFUH 4YAQA 3MZTA 1G9NL 2H1PH 5D7KE 4NZUL 5B3JE 1MRFH 2EH7H 3R8BB 1MHEB 5I75B 1X5AA 1J0HA 2GJJA 2VUYA 4NQEE 5DUPH 3TO4B 1X5YA 1Q94B 5HI4C 3OAZK 1M71B 1OP3H 2EDKA 3WN5B 1IGFL 5IK3A 4CU8A 4AQ1B 4FQ1H 1I7UA 4KU1A 3VXPA 1CU4L 1VESA 4Q6YA 3MV11 4I0KA 4LSPH 1E4JA 5I6XC 3U6RA 4YWGL 2X40A 4G42A 2ORBH 4OFKA 1AJ7L 4YC2B 4ODSH 1M7DA 1FVDA 4RNRA 5CEXA 5EBWA 2CLZA 3MXVL 5GRWA 3C09B 1BF8A 4GAFB 2WM0A 4LGRB 5INDB 4ZUWA 1I7TA 4APQB 3ZHLA 3INUL 1MCCA 2A6JA 3GMMB 3BGFB 3P77B 4WEUD 1Q9LB 2N7AA 4HWNA 2ADGA 1QSEA 5FA3A 1S3KL 4IDJL 5JO5B 1FFQA 3RKDD 2E6JA 1WZKA 4L8BB 4ODBD 4QXTA 3I6LE 5E9DE 2YEZB 1V7NL 2AQ2A 2BRQA 2FJGB 1M6OA 1WSST 4ZFZA 3OAYH 4GQPH 4NHUB 1FL6A 3QPQC 3BFOA 3HR5B 4YHNB 3B43A 5T1LB 4QRUB 1KJ2L 5FECA 1INEL 1IRAY 1DJSA 4NO2B 4ONFH 4HH9A 4OKVB 4J23A 5ISZA 4YHLL 3ZMRA 2XXMB 3W11C 1T1WB 1AQKH 3P9MA 4Z0XB 1X4XA 3T0EB 3ZHKA 3TN0C 2GJ6D 4WGVB 1JMXA 4JFHE 1HYSD 4HV8A 2WUBH 1F45A 1MAKA 4H26B 1SEQH 1OD7A 4L8SC 1R3KA 1JHTA 2MCG1 1BFOA 1J87A 1MQKL 2QLVB 3G04A 5DR5L 5KSUA 4KKBD 1UM5H 2FGWH 3T0DA 5B3NA 3C8DA 5BV7B 2NY6D 2R2EB 3CLEL 2BSED 2ICES 3JUZA 1MRCL 4YPGA 1A22B 3ES6A 3B9EA 1MCDA 4G9FB 1F6FB 1ZLUH 2CPCA 5K9QI 2V9RA 4HC1A 1TQBC 5FO9A 1MFAL 2P7TA 4FTVB 1P1ZB 5D7LB 1NCBH 3VG9B 1KJMB 4XCEA 1DBJH 4QTIL 1TFHA 1U58B 3AB0B 2IQAB 3N9GH 3SDXF 5IFAL 3FO2A 3O3EB 3V6ZA 4NSKA 5BVPH 1MRDH 4RDQG 1PG7X 3I6KA 3GBMH 4WU5B 1NAML 1AC6A 2GHWB 5ID1B 2X09A 3NAAH 1YEFH 1YUHA 5L9DH 3MJ8A 5AZ2H 4K07A 4WFHD 4UNTA 1NBYA 4XMPH 3TH2T 2EKJA 3BPNB 2FECL 1T7XA 5DJZA 4ELMA 1U3HD 4TUKL 2VLLB 1J8HB 3MPCA 2CH8A 3DRQB 4P0DA 1NUGA 2XTJC 1XIWA 4NQEA 2FH6A 5D1QC 5CINL 1DQQB 3KLHD 1F6LL 3S97C 3HE7B 3D85D 4MJ5A 3MLWH 3WDIA 5HYQB 2BXZA 2FO4B 4HIJA 3WV0A 2ICEB 5SV4A 2KQMA 3GM8A 3HRZB 4XI5C 1KIUA 1JGEB 3NCCB 1HH6B 1U91A 1WBZA 2GFBA 4QHLA 4ZUVB 4X7FC 4IRSA 4P23D 4E5XB 1EMTL 5EO0A 3DO3A 3RVWD 2G9HA 3TPUB 1G84A 3C08L 2R4RH 5CSBA 5BO1H 3C6LD 4QHKI 5KS9F 3TBTA 3GBLA 3LMJL 1S5HB 1SJEB 1QVOA 2OP4H 1J0ZA 1PQZB 4NN7B 3LRSA 3FQXB 1B0GA 3G6AA 1BHGA 4HMEA 5B39G 1OAKH 2QSQA 4R4NC 4UIKH 4PJEB 1I85C 4KJYB 3TT3L 2X7LB 5E9DA 2P4AB 3RIFF 1DLHA 1HHKB 2MSPA 1P7HL 1MF2L 3MFFB 4K71B 4PR5A 4JRXB 4OCYL 4R6UA 2M8XA 3QRGL 4XNZC 3OKKB 4DVRL 1JV5A 4OFVA 5FDWA 4FZ8L 5IOPA 2FEDC 1VPOH 5FYKE 1KXQE 2AJ3A 4HFWA 1P7QD 5DJ8B 3UTTB 1JRHL 2VE6B 1U93B 4Z5RA 2R69L 2ZWLT 2CRYA 3WHE1 1SMOA 1DUYA 4PGCB 3ARGC 3NPSB 4XMKL 5E0QA 4TVPL 3CFCL 1P4IL 1HKFA 1DE4B 5E8OB 1EHNA 1UVQB 4N68A 5INCA 1ZTXH 2VZVA 5GXBB 3OHXA 3FTGA 1I7RB 1RZJC 3VH8B 4MXQD 5I15L 4RGNB 4H1LA 4NNYB 3FQTB 5GHWL 3X14B 4ZFGL 1WIUA 3UTSB 2CD0A 1TVHB 1I1AD 5D2LB 1R5WA 1GCFA 2B39A 5E2UL 2WUCH 3TJEL 3HR6A 2X4OA 3FCTB 1SYVA 4U7SA 3K74B 3RA7H 1KTLB 1TVBA 3H42L 4BH8A 3CVHB 2OJZH 1QLEH 4XC1L 4RBPH 5I66B 2NXZC 3RNKA 1ADQL 1IC5H 3LOWA 4KV5F 5F3HA 3O3DB 3U4EB 2D0FA 5FO7A 5KVEL 5JDSB 3DVNA 2YC1B 5CJQH 3OAUL 3STBA 3C60C 1FZKB 1WWBX 4NKMA 4O51B 5DJDB 4LCIL 1ZHNB 3DX9B 3IRPX 4AMKL 3MXWH 5K9OB 5B8CA 2CMRH 1P7KB 4NOFA 3JWDH 4X6BA 1LEIA 1U3YA 5FYLH 5D2NC 4YBHA 5F7MC 4TVSa 1NGWA 4TRPL 4N8PA 1OTTC 4Z7WF 4WO4B 3BOVA 2HA1A 3C5ZB 2VDML 5C0NC 1T7ZA 3BHBB 4Y2DA 3QEUB 2O61B 4OGYL 4LVNB 1A3RH 3SJVB 3MUZ1 1OPGL 3ARRA 1GC1H 2DKMA 4XVJL 3QPXH 1U8OB 4Z7VF 4PJ9A 3MRCA 2IH1B 4PJHE 1QLFA 1U3ZA 2AGJH 3BO8B 3MJ7A 1AQDB 5DS8A 1DBML 2VIRA 1XGQB 1HILA 2QQLH 4XPFH 5IF0B 1RJZA 1JE6A 1ZT1A 1W72A 1MVUB 4NQDE 5GSVB 4JFZH 1DQML 4U6VH 1FVDB 1D6VL 1NGQL 4XVSH 2BVYA 3N06B 2EE9A 4TOYH 4NKIL 4U7KA 2CK0H 1QFWL 3QG6B 1BQLL 5JPMA 2V7HA 1EBPA 3FOLA 5ICYA 5F88B 2A6JB 1A3LH 4HW6A 4YX2H 4NQVB 4ZSOE 4R90H 4IOFD 4QHMA 3SDCB 5C6WH 2M26A 5DD3H 2VLMD 3E6FA 4X99A 2X4PA 4J1UB 1X5JA 4YFEA 2VZUA 3QISA 3DLQR 4X8JA 5TE4L 2IFGA 4JQVC 4LCCB 2XWJB 5KJRH 4MNQD 3NN8A 4OCRL 4MB5A 3GHEH 1N4XL 4G8IB 4N0RA 2Z93A 5DQJA 4ZOAA 1P4LB 4BKLB 3MRIB 4HDIA 5HGAB 3BESR 5F1OB 1WK0A 2F74B 3BIKB 3SDXE 4U6HB 1FFRA 3FAXA 3S3PA 3AMKA 2V17L 4GMTH 1IQWL 2PYED 4PJXF 1SJHA 3P9MB 1KGCE 4PJIE 2IANE 3QHFL 3WFDL 3V79C 1ZA3A 1UKQA 3RPKA 2OL3L 3THMH 1MWAB 1PYWA 4JKWA 3WFHB 5DFVC 4B7IA 5D7JB 3C2AL 4LLWB 1HQRB 3BEWB 3REVA 4JDZA 5F1IA 3S96A 4X98A 5DZLA 4KK5D 3KXFD 5M94B 3CMOH 4IIQC 2Q8AL 3BUYA 4QF1A 2XRAL 1CBVH 1SBBA 1XH3A 3H3PL 3S88H 4KFZC 1RZFL 2X1WL 1ZHBB 1A7PL 2R1XB 1KCUH 4D9RE 4N8CL 3ZKXC 2VLRD 1JYNA 1EK3A 3V52H 4Z76B 3MTRA 5AAMA 3N1MC 1RAMA 1MCWM 4Y16D 3ARDA 4HT1L 5GZND 3SGKA 4X7CC 1FGVH 4UIMB 5C2BH 1NLBH 1CVSC 3BN3B 1CXLA 5DLMH 3D25B 3VFGL 4NT6A 3I02A 4PUBH 1YUHB 5LXGL 5I1EL 4QRTA 2DF3A 1IC1A 4HF5H 2ADIA 4ODXB 1QTYT 2NY3B 1L7IL 3DHMA 3QUZB 5KSBE 1MQ8A 3KPQA 5E6IA 3F62A 2HLAA 3MRBB 4CAGA 2CJUH 5IB4A 4FXKA 3SDDD 3CSBA 1UA6H 4KKLC 5L88H 4MJID 3MRMA 1J1PH 5CLWA 5DEZA 5B4MC 1G7LB 3FZUD 4F7CB 4NOBA 2R4SL 4LEXH 4NZRL 2D03H 1BBJB 3BGMB 4MS8C 3NZHL 2AK4B 2JB5L 1S7RA 4HPOL 4PJHA 2IF7A 3KJ6L 4DKFH 4JG1H 3ULVH 4TQEL 5EFIA 3QIWB 3VXTA 1KLGA 2DQDL 3LQMA 3F58L 3ET9F 5AD0B 1BBDH 1U91B 1BFVL 4UDTA 1WBZB 4NQDA 4WFGE 5J12C 4IMKA 5FO8A 4BZYA 4IRSB 4PB9H 2VZSA 4RX4A 5DD5H 5JUEL 2I9TB 4G3YL 5GJTL 1GOHA 2X4QA 4UTAH 2AJVL 1KNOB 4UT9L 3TBTB 4E41A 2H26A 4LCWE 4LSTL 3VRJA 4JY4A 5E1AB 1RZGA 1JBJA 1B0GB 1A3QA 2ARWA 3MRPA 3L3HB 1TZIB 4GRWF 1IBGH 3F8UB 4RFNB 3GSNA 4HK0B 43C9B 5M7QA 1DBAH 3T3MF 3IJSA 4WIQA 3OTTA 5TQ2L 4OLWL 5DRZA 4YQXH 2RBLA 2V5SA 5CBEA 4Y4HD 1BVKB 1YYLH 2X9XA 2F5BH 5ALBL 3UYOD 4KQ3L 1TTGA 2FSEB 3UJTH 3WFCL 2W0LA 5FDWB 4QOKE 5C0FA 4HXBH 3SDXA 5A43C 2FATH 4FXLA 5IM7A 4Z7UF 4PJIA 1QSFE 2IANA 5AWNL 4NQXB 5JIIA 3FONA 1UCTA 3IDNB 3SKOA 3IGAA 2Y6SC 1UWEL 5JORB 4PRPB 3PJSA 5DJ2A 5BV7H 3RZCB 1U8JB 1QUNA 4LGPB 3IAQA 1LP9F 4XWOD 1WFOA 5GRUL 5GRYA 1YEKH 1NGYB 4P3CH 4KTYA 4PLKC 4WHCA 2JJTA 3KPLA 3QHTC 2Z31C 4JHWH 1BIIB 3NPZB 1RIVH 4HUXA 4M6OH 4I77L 2XWTB 5DUML 3F7PC 5ELIA 4DCQA 5FV1L 4F7MB 4NJAH 2NXYB 3B9KA 3IDIB 4LLDA 3VI4F 4RDQF 1AY1H 5IROA 3RVXC 5AYUL 2ICWA 3PGFL 3AS3A 5F96H 5C08E 5HYIA 3K1KC 3TT1H 1KFAH 5H35A 1UH2A 4L8CA 1NAMB 3MBEC 5A16B 1H5BA 3FN0H 4KROB 3RNQA 2CO6B 4YIQB 3PF2A 5F71A 4R3SA 3EYVA 4OLVL 2CQVA 3HMXH 3BZ4B 3K81A 1HI6B 4Z77B 3R1GL 3MO1A 1K3ZA 3SE4A 2NW2A 1MLCA 2EICA 3BAEH 3WKML 3C8KA 3U36A 5HVHB 4UV7H 2Q87A 3W9EA 1INDL 3RWGB 1WAAE 3IFLL 4HX1B 1J9CT 4WWID 1ZLSL 4NFDA 4HJ0D 3D2UD 4JN1H 4QT5A 5KSBA 5TDNA 1NBQA 4U1MB 4AT6A 4KTEH 2EDNA 2ENYA 4OB5L 5DD0L 4M5ZL 1UCBL 1MI5E 3GHBH 4K7PX 3WJJC 3GKWH 3W9DB 1N59B 4LF3A 4XHQA 3HI6H 2Y07L 5EIIA 1A9BA 1QLFB 3U9UA 3S35L 4M1CC 4RSVA 3QZWA 3MMEB 1GGBH 1JCKA 4HJJH 2VB5A 1F4HA 3QIUD 5T1KA 4ODUA 3TVMD 4DAGH 1L0QA 5GIRA 1ED3B 2X42A 4GJTB 4OZFG 3IJYB 5CD5C 1IEAB 5IHZB 4JPKL 4OLEA 1Q0YL 3TEUA 3KWWA 4LCWA 5C0AB 3UTPE 4F2MB 1KXVC 1MCLA 3VXQA 2XPGA 3RVUD 4E42A 4L3ED 1EVUA 1K2DA 3BZEA 2AEQH 5FM5M 1PGRB 1YQVH 4PJGE 5J0BA 4PRIE 3QNZA 1UB5B 5KVDL 3BKML 4J4PA 5HHOB 1K4CB 2NY1C 5I1JH 4Z7NE 3U2SB 3D6GA 3D3VD 4UBDC 5C0BB 4OAWA 3BVNA 4PJFE 3RWDB 5I1KL 2P5WB 4JHAH 5FYJD 3MCLH 4KAQH 1A7NL 1UJ3B 1JTPA 4YHZH 4S1DD 1XGYH 1IL1B 5F7EH 3F5WA 2FRGP 3MROA 4HULB 2Z93B 5IB2A 4U2YA 4YGVA 1UB6B 5B8CC 2AJXL 3L3JA 5DSCB 3QEGH 1AO7E 4RMRA 4WGWB 1A4KB 3BH9A 4QOKA 3WJLA 4I3SH 2V6HA 3FKUS 1QPPA 5E6YA 2D7NA 4X4YB 3V8CA 4KHTL 2FBJL 1QSFA 1AXIB 4FQ2L 4PJ8D 4QXGH 1S8DB 4Y2DC 1T1XB 5ACMA 2WBKA 4EBQH 1OAYL 4QYOA 4MAYB 2BOBA 2X4SB 4Z95H 1NCAH 1IEBB 3QXTA 3H0TB 1I9RL 4K2UH 4P4KC 4DKDC 5FKAB 2EYRA 5F1IB 4MA3A 4XNYH 4HLZG 3VXUD 2NTFA 4PRHD 1QZ1A 3OKEA 1J18A 4LRNH 4LBEA 3OPZH 2Q86B 4HWBH 1GZPA 1V3LA 4QRRB 5DTFB 5DI8A 1NFIA 3BW9A 2GY7B 4KMTL 4U1HA 3GSRB 3WEXA 1F3DH 4CBPA 1WBYB 1KT2A 3HZMA 1KYOJ 4U33A 3PP4H 3CGTA 5C08A 4BQBA 2VLJE 5K59E 2LU3A 1OVZA 5IGXH 5IV2B 3RDTC 3RZWA 5D7SL 5T3XL 1B4JH 4HKJA 4JREC 2DIBA 4TSBL 1T5XB 3HUJF 1AFVH 2Y4SA 4JRWA 5EO9A 1NCWH 4OFYD 1TCMA 4XCYB 4HBCH 1XAUA 1CXEA 1H8SA 1KIPA 1VEOA 2B2XL 2CIKB 3PGCA 2W60A 2PR4L 5F97E 1XGRB 4XMLL 4QLRA 4K7PY 1WICA 4FFWD 2IAMB 3TYGL 4OLYL 1QHPA 4GRLD 4JGJA 3MLVL 4NO0B 1MCPL 1PG7H 4ZNCD 3PL6D 1F11A 4K7FA 1WAAA 2NLJA 2F58L 3QJHB 5DRXA 4FHBD 4WTZG 5DQDL 3ZE1E 4CDHA 1SHMA 4ZUTB 1G1CA 1YJDC 1YMMD 4LLVB 1ZWIA 3KPQB 4JPVL 3O3UN 2YUXA 1DSFH 2EDHA 2ITCB 1MI5A 3NFPA 3CFBA 1CD1A 3OXSA 1IGJA 1TIUA 1N0XH 1W2KT 3T3ME 1VEMA 1MEXH 1T20A 3WNPA 4IRJA 4FFYH 4NQCB 2W07A 1Z5LB 4OFPA 4Y5YB 2XZCL 1C16B 4LLAA 4H20L 3C6SA 4K8RD 5GZOD 2BK8A 4WU7A 5HPMA 1EA9C 1S7SA 2R9HC 1A9EA 1DVFA 2IPTL 3UX9B 5EFIB 2PUQT 4PP1D 1NCDL 2EDDA 1QOKA 3O6FD 3OKYA 5ESQB 4MJ2A 4RZCB 3RTQA 4MQXC 1JZ5A 4LNRA 2VXUL 5IP4A 1IKFH 3D0VA 4L8DB 3BMWA 4JM4L 4WCYL 2R56L 4XVUC 2BVPB 4V1DE 4P2OD 3NIFE 1C08B 4ENED 4P46D 1CK0L 5GGTL 4GBXA 4NM8L 3UZQA 5TE6H 4FQIH 5FDYA 1JTTA 4ZSOB 5C1MB 4PJGA 2BNQD 4PRIA 3O9WB 2QKIA 1DFBH 4Y4FD 3P4NA 4X8XA 1MIEL 5I17B 3UJIL 4PY8I 4EDXA 2FX9L 2Q3ZA 3RAJH 4PJFA 43CAB 1T6VN 2CR3A 3VW3L 3T65B 5F72S 5CBAA 4NWUH 3NIDF 2ZG1A 3PNWA 3VD3A 1HSAB 3V8OA 5J11C 3DMMA 2PYFA 1OF2A 1WZMA 1UXSB 5DK0A 1U95B 3BISA 3VFMB 4M61A 4WY7H 3TIDA 4XHJD 3WXWH 3WYRA 1NCCH 4AEHH 1TETL 3SDXB 1BZQK 1MWAH 3MV9E 1T2QH 5BVJA 1LEKB 4DVBB 5CZVL 4KZDL 1IC7L 4PJIB 4ZOCA 4OGXH 3CU7A 1UYWH 2NX5B 5SX5H 3KG5A 1TDQA 4KJWD 4AJ0A 3IGAB 2DQJH 3L3GB 3QULA 4HIEA 3HI1B 1SEBA 1EAPB 2FEEL 3RPIA 5F7LB 4OLXL 1TCRB 1Q0XL 1JWMA 4PS4L 1FZMA 4HC1H 2HJKB 3HC3L 4ETQA 5DA4A 2ZUVA 4RA0C 1YC7A 2OMBA 1H3VA 4GT7A 3RI5K 4HUXB 2EDTA 1N7ML 1SM3L 4AM0B 1YN7A 3RGVA 5CEZE 4HJGB 4OV5A 3DROA 2X1QA 4ETYA 2VLJA 5LGJA 2WWKO 1RZKL 2AJUL 4NBXB 4FFVD 5DMKA 5MI0B 2Y5EA 1PZUB 4JO2H 1YA5A 3O4LD 4D94A 1FRGL 1KPUB 4R3SB 4MWFB 3T2OA 3U7WH 5LJYH 3MNVA 1RUML 1P6AB 1NEZA 2JB6B 1GOGA 3A6CH 1NUDA 3KPSD 4ZXBA 3MO1B 2BJMH 3FO9B 2RCSH 2BVOB 3G5YA 4OT1H 3VXRD 5KS9B 2WW8A 1X44A 4ACPA 4J3TA 1T04A 3ZSSA 4WTXA 1CL7H 3MCKA 5HHQA 5KSBB 2WBJD 4MCZB 5KANG 4NCC1 5EUOE 3K8MA 3Q6GL 4MD5B 2YWYA 5D1ZA 4JJHA 4LLQB 5J13C 5EOTA 3EO9H 3EFDL 3TJHC 5ANMB 3AS1A 2C3VB 3KYNA 3T0BA 3MV8E 1CXFA 4H0GA 1AGFA 3X11A 3BP4B 5EIIB 5MEPB 1QFOA 2IGFL 3L7FB 3T4YB 4ZS7L 2GT9B 4PFEA 3F7YB 4X83A 2B1HL 4IJ3B 3V5DB 3EOTL 1FAIL 2X89A 1E4WH 4G7VL 4LSUH 4QTHA 5GIRB 1JHKL 2V5MA 1M05A 3G6DH 4LHUB 3ZLQC 4V1DA 4POUB 2FR4B 1TJIL 1HHIA 4Y1AD 1QO3B 4RFEA 3LN4B 4MJ6A 4ZS6C 3BZEB 3UBXG 3DTXA 2P48B 2ZCHL 2FZ3B 3F7VA 1FNLA 3IJHA 1ZGLB 3U7YH 2R15A 1ZANL 1WBXA 2LVEA 2VZ3A 5T33L 3QDJD 4WENB 3BVNB 5LG1A 1CGYA 1LO0L 1ORSB 1I3GL 2DYPA 3EJYD 3O8XC 4N0UE 4N5ED 1FGNH 5FF6B 5E4EB 3EDJA 2BNUA 3BPLB 3UC0H 2HT3C 4JKLA 1UH4A 4RMWA 1LK3L 3LN9A 4IRZH 3STZB 1A6UH 2GKIA 4LSQL 2Y06L 1UZ6F 3MV9A 5B21A 3EZJB 4PJ5E 2HWZL 1QYGH 3E8UH 3HFMH 1T21A 3OJ2C 4Y5VA 5T1MA 4XPBH 3AM8A 3DX7B 5HHVL 5MERA 1ZHKB 4ZAKC 4H1LH 5IJKA 4FP8H 2BOBB 3ZL4H 4EN3D 3GNML 2XA8H 3NCMA 1TPXC 5HGHA 1JFQL 4D2NA 2EYRB 4R0LA 3QIBA 5BZDB 1RUAH 4MA3B 1I9EA 2DBLH 5ETUB 4OZIF 4Z7WB 3JVGC 4WI2A 5EORL 5T1DH 1FLRH 1G0XA 3GSUB 1BOGB 2YZ1A 4X6FA 4BSWA 3HMWL 4HHAB 1CFNA 3RWJB 4JEGB 4G6ML 4NFBA 5KVGL 4F7EA 4Z7VB 4BUHA 3SPVB 2P46B 2MMXA 5HYJE 3DGGB 4L5FL 1FYTE 4OSUH 4OM0H 4HIHA 4DGIH 4ZQKB 4DUVA 2QJDA 4ONGL 4Q9RH 5I75C 2PTVA 1JWSB 2QHRH 1KIPB 3V5KA 1AI1H 3NH7H 2V5TA 4GMSH 1LWRA 2NY4D 2BNRD 1X5XA 4H8WC 2MQ3A 3WN5C 3MLUH 1RJLB 5GS0H 4PTTB 2DMBA 1H3WM 5DRXB 3NBNA 3DBXB 5GRJL 1HNGA 2VC2L 4EUPB 5EUOA 1QKZL 3GSWB 3MV01 5CZKA 3L6FB 4YC2C 3OAZH 3QSKB 4D0BB 2A77H 5JW3L 5CD3B 1IGJB 3LQAH 5FIEA 1HQ4A 3QUXA 4JO3L 4I1NB 5JOEA 2Z92A 1T20B 1W72H 3HZVA 1OM3L 4S1RH 3B2VH 3PDOB 3MV8A 3PWPD 1CI5A 3HNVH 4Q0XH 3D9AL 4JFEB 2D0GA 4ODWA 3CZFA 1V5JA 3P11L 3MQIA 5DMGD 5TDOA 5FYLD 4F9LA 5CHNA 2EIZB 4PG2C 2HT2D 4HCRL 3VFUB 1D9KA 4PJXB 1ITCA 4P2QB 4F8TA 1TVDA 4PLOB 2CGRL 3TWCH 4KZEH 2YA2A 5HGGS 1BGXL 1I8LA 4OZGF 4JPIA 5H8DA 2DWDA 5ADPH 1MH5A 1ONQB 1FBIL 4NRZA 2F53D 5MEND 2QQNH 2ATKB 2QQKH 3MV7D 2HN7A 3IKCB 2IBGA 3QNXA 2KKQA 3HC0A 1FE8L 1MHPH 4QXUL 5DQ9A 2AEPL 4GO6B 3N0PB 5FB8A 5JIPA 1DUZB 3O45B 2BSTB 1HOCB 4G9DB 1A6AA 3TA3B 1EFXA 3W39A 3LIZH 4P2RD 4OQTL 4YHOH 4N0UA 3DYMA 2I60H 5TE7L 5FYKH 5HSFA 3B9AA 3RY6C 2XWBB 2APXA 2HFEB 3BP6B 3LEYH 4FQQB 1T1ZA 2CDGA 1Z9SA 3PNWB 1BQSA 4WJ5B 2VDKL 2H6PA 4R4BA 3MGAA 2PYFB 3I84A 1AO7B 3AAZA 5GS2H 1X5GA 4K9EH 4OTXH 3IVKB 4KTDL 2KQNA 1CICA 3GIZH 4PJ5A 5E8EA 1T5WA 1E4XL 4I4WB 4P5MA 1DN2A 1U42A 5DEGA 4JO4H 4JVWA 1MREL 3O11B 4CMMA 1X7QA 2R2CA 1T1YA 2FB4H 2ESVD 2VDLL 4XC3H 4Z7QF 5EZLB 3AC0A 5DJYB 1F3JA 2P5ED 4CW1A 1D5MB 1GXEA 3VG9C 3V4UH 4UOW0 1KPVA 2APTA 3WMSA 1OGTB 5IG7A 2HG5B 5D4QA 2NNAB 1AHWA 5JPNB 4BFGA 4L4TB 3ZTJG 3NGBB 1GH7A 1BEYH 1SY6L 1KJ2A 4RCAA 4PP2A 1JPTL 1SJVA 4YK4B 5HDLA 4N1EA 4UT7H 4JAMA 4X6CF 4F3FA 1R0AL 4M3KB 3HS0A 4MXVE 2IMMA 4HGWB 1H0DA 4LKXA 1FG9C 3I6GA 1FO0B 4MZ2A 4IM8A 1U6AH 1MIML 5HYJA 5ESVB 3QDME 1FYTA 3K3QA 4WUUE 4GKOA 4KRNA 3LDBB 4TVPE 3WBDA 4OIBA 3HPLA 5E2WH 5HPOA 4PJ7E 3DRTA 1U8NA 2G5RA 3R4DA 2YD8A 4KXZI 5IKCB 2A9NH 1XFPA 2LFGA 3OR6A 4OCXL 4GLRI 4EZMA 3GBNH 3QHZL 4JFPB 3AMLA 1YNKL 3QO1A 3VA6A 1XCQB 3WIHL 3GO1L 3MCKB 4I3RL 1RZJL 1EAJA 4DN4L 4GRWB 2XYCA 2PTTB 4U1KA 1ZSDA 3QG7H 3M8OH 4PB0H 4YNYB 4DZBB 4WV1B 2LV4A 4L3CB 3DO7B 3SBWA 5KW9L 2ARJA 4YR6A 5E8DL 1MJJA 4UB0H 1GPOH 1TQCB 1CR9H 5TH2A 3TO4D 2YPKB 2G5BA 5ACZA 5HHNA 4NN7C 1CYGA 1EXUB 1G9ML 2SEBB 4K7PH 3GMQB 4KPHL 3ZYOA 4YHKL 1EGJA 25C8H 2R0WL 3WO4B 3G9VA 1K5NB 2A0LD 3LEVH 4KWUA 4M1GH 5FGCB 4LDEB 3C5SA 4HEME 1KCRH 1M05B 4G7YL 5DO2D 1JZ6A 2XACC 4TNVF 4PRAA 4JY6B 4PRBA 1YY9D 4DJMA 2NY2B 1F4XL 4XAKE 4F7PB 2AP2A 4JDVB 4MJ6B 1LP9B 3O6KH 2CSPA 3ULVD 4X7SL 1I8KB 1DL7H 2J8UA 5GGUA 4APQD 2C1OB 2BRRH 1HIMH 1OAZL 1WBXB 1IZJA 2QADB 1X5HA 4XAWH 3HAEG 4XP6L 5J8OA 2PXYA 4NQSB 2CRIA 3NPSC 5F1KC 1OAXH 3SKNA 1JPST 3QQ3B 4X7EC 2R1WB 4R8WH 4Z9KB 2AV7B 4ESKA 5FCUH 3CSGA 2X6MA 2FIRT 3IFOB 3VJ6B 4L1HA 4RGNC 3TCLB 3RUGE 1WC7B 1AC0A 3MV9B 3OJDA 3T1WA 2GSGA 4N0CD 3OB0K 1ETZA 4FQHA 2DQEL 3CFKB 2F8XC 4GKZA 4NPYB 3S36X 5CGYC 5DT1L 2NW3B 3HPJA 4Z0BH 5D1ZC 1RZ8B 2GJ6B 1I1FB 1G7IA 4CVWA 4CUCA 3T0ED 3CIQA 4LPWA 4LPYA 5HGHB 1HHJA 5D1QD 4XP1L 4XB7A 3KPRD 5CCKH 4PJDE 2P8MA 2NYYC 1R3HB 3FO1A 4CNIA 4H0IA 3EYUL 3F65A 4DKAA 1BLNA 5EPMA 3EYSH 5DHVB 4EDWH 2UZIH 4YHPB 5FOBA 5MEOB 5EU6E 4X6FB 2NY6B 1BPVA 3V0WH 3C9NA 2DKSA 1PW3A 2E6PA 3GDBA 3SE8L 3U46A 4G8GD 1A5FH 5F89B 4P5TD 4BYHA 1A1OA 4H88H 3SCMA 4P9HL 2G60H 2XICA 3QDMA 4G9FD 2ZOLB 1T0MB 5CSZB 3HLAA 3ABZA 1KF9B 1P84K 3BGAA 5HDOA 4WO4C 1BZ7A 5B38A 5C7XL 1S9YA 4PJ7A 3C5ZC 4TNVK 3QFDA 5DD6B 3V5KB 1FIEA 4NWTL 4JKPL 4LVNC 5J3HC 5B39B 4AIXA 4GAYA 3B8SA 2Q7NA 2BSSA 1KJ3L 3CFJA 4QXWA 1P2CB 1JNJA 3GI8H 1FFNA 2GUOB 3L5XH 1OWWA 1I1YB 4QCIA 5K9JH 2GK2A 3JV0A 2E9JA 1BD2E 1S9WB 2HTKC 3IDXH 1U3HB 5EUOB 3X3FL 1JPGA 1HH9B 1QEWB 3CSYB 1Q9WB 3AM8C 1A6ZB 3QUXB 1J8HD 2O93L 2XN9E 5DUBB 2BHYA 1ADQA 3HZVB 5J6HB 1WF5A 3D85B 5C9KA 3RHWK 3ZKMC 1N6QL 3MV8B 2OR7A 1IGCL 4KQ4H 1U92A 4O2FB 2VDRL 3FQUB 5J06A 3HE7D 2FJHB 5DJXB 4HS6B 2Z8SA 3SDCC 1JHLH 5CHNB 4HMCA 4M8QB 1WITA 2OX5A 1OAUL 4W6YB 1NCUA 5IW6A 1JNHB 3MJ6A 4LCCC 3FO0L 4MD4B 1A7BA 3NFSH 1OCWH 2QBWA 4ZTPH 3VFTA 4YDJA 3CXDH 1YNLH 3K8LA 5K9KA 3O6MH 1V3KA 3DSFH 4QEGA 2VH5L 3BE1H 1MFBL 4JLRB 3C6LB 4C55A 4G6AC 4NJ9L 2FHCA 2OTUA 3BT2H 4E0RB 4WWKA 2FECI 1FVEA 1LE9B 4TUJB 2HKHH 3F12B 4Y4KA 1UM4H 5D1XD 2VXQL 4M6NH 5I8CA 4TUOA 2MPAL 1II4E 3GFUA 3QXDB 1WT5A 4AH2A 5I0DA 3FN3A 2VKWA 1NUFA 4WW2F 1VGEH 4JFDE 3BQUC 3PWVB 5JHDE 3P4MB 1DQLL 4PJCE 4MDIA 4RIRA 2UY7A 3BKYL 4Y19D 1CDIA 4GKNA 4GRMA 3EYQD 3O4OB 4POZC 3VFWA 5JNYA 1EEYB 3VXSD 4L1DA 3U0TA 4G43B 4R2GB 1UWGH 1S9VA 2I24N 3RUGA 1N2RB 5E8EB 4OCWL 3O6LH 1F90H 1EDQA 3HUJB 3NZ8A 4K3JL 4OZ4B 2O5ZH 3SDAD 5IFJA 4ZPTA 6FABL 4I0PC 5I18H 1P7QB 4KVCL 1FNHA 1NPUA 2XFXB 5DC0A 3HNTH 2DLGA 4W6XB 3FMGL 3NCBB 5TPWL 5C6PB 5F7UA 4RMQA 5EZIL 1R5IA 5DRWB 2NZ9D 4XP4L 4PJDA 4OJFL 1MCOL 1FNGA 2GTZA 2C4FT 2CRMA 5CZXD 4JB9H 1D9KC 1CT8A 4JY5L 5I73B 3X12A 3ZT6A 3T0VA 3H3BC 4I9WD 4R7NA 4O58L 3T3PF 5EU6A 5KVMC 1I8LC 4PGDA 3SO5A 1TJGH 1I1AB 1ZGLM 4PLNC 1UZ8B 3OKMA 5IB5A 2R0ZH 2QSCH 5JW4M 1G9NC 1Z3GL 4NHCH 2ZKHH 2I07A 3G6JA 4NO3B 4M1DH 3SE9H 1IGTA 1NC2D 1C12A 5F9WB 2V7NB 3NABH 3QUZC 2IFFH 2RFXB 4LMQE 3U48A 5ALCL 5SWQB 4UQ2B 1UGNA 2A9MH 2OL3A 1I7ZA 3SGEI 3GK8L 4BQ9A 1NLDH 3CX5K 4LQ1A 2WQRA 1T7YA 3ZKQD 4S2SB 4LEOA 1FL5B 1JRHI 2W65B 5CWSA 2ZZUT 1QBLH 4D9QD 1B4RA 4BH7A 4U1IA 1MFNA 3HE6A 5F7FA 2Y7QA 5EU5B 2WQ8A 2EC9T 2FD6H 4WDIA 4ODVH 3VE0B 3PV6B 3QIWC 1K6QH 1G6VK 3UYRL 1BD2A 4F57H 1WZLA 4XP9H 5KN5B 4CU7A 2BOCB 1JPFB 5IUSA 4LVHB 1F58L 1U2HA 4FQXD 5IVXF 2VDQL 2DM4A 3GI9L 3QCVH 2DIJA 1CE1L 4PGBB 3ZT5A 4DGVL 2X1OA 3LPWA 4R97B 3VD5A 5E2TL 1ND0B 1S7TA 4N0YL 4ZDHA 5CP3A 4PJBE 3QP3A 2FYYB 3GJFB 3H9HA 1R24A 1AHWC 1UJTA 4I3GA 4RFNC 1WV7T 5DD1L 4XPGL 2CKBL 1MLBB 4P2CG 2X05A 4K23L 3C5SB 2DB8A 2VXVH 2J2ZA 4K8RL 1J1OL 5DHYB 3BDYH 5I30L 4U1JA 1FIGH 2HVJB 1FCCA 1GGCH 1QFUL 5J6GB 2H1PL 3UAJC 3BUTA 1G7QA 1RHHA 4KK6D 1LVEA 4XBEH 5DUPL 2YN3A 3VWJA 1GGTA 5GGUB 1E28B 3S34H 3ME0A 2HJFB 3HTLX 5J57B 4YEEA 3O0RL 4XXCC 3JTTA 1BQHA 1QSED 4JFDA 3KYOB 5ACLA 1J05A 4U1LA 2ITDB 5FFLA 5JHDA 4MNQB 4PJCA 2FNBA 3QEHA 1XF5A 4LSPL 4GW5A 4ISVA 2ORBL 5HDQH 4IHOA 3RWHA 3VGAB 3I3BA 3D5OF 4XWGH 2D3VA 1OSZB 4UQ3A 2H41A 3GIVB 3HZKB 1AP2B 2YUVA 3MA7B 2GK0A 1JN6A 4P5KA 1I8MA 1LDSA 1AXSB 1N64H 2YK1H 4NKDB 5ISZD 3X17A 4EXPX 1YEEH 4KJQC 2A6DA 2PCPB 1M7XA 1QFWI 4TNWK 3VMNA 1HHJB 2LAAA 3KYMA 4HS3A 5FA4A 5CS7A 1QNZH 2OZ4A 3ISWA 1KB9K 3LSOB 4OGAC 4PGJA 2WIIA 1HDMA 3LKNA 5D7JD 1FO0H 3L1OL 3LAFA 3KXFB 3VFSA 1S9XB 3TNMA 3FQNA 4UV4H 5ITFB 4S0TD 4OI7A 2C9AA 5GGQL 4O2EB 2IADB 1SYSB 3PQYE 4UDUB 4XPTL 3U46B 2C1PB 5L2JA 4LLMA 1AQKL 1RZIA 3QDMB 4MB3A 4XTRC 1KN4H 5DWUL 5IESH 4L9LB 5L0QB 5F9OH 3F7RA 4GS7B 4QHUB 4MVBD 4WUUB 5IQ9B 4F7TA 2VLRB 2BVQB 3ARFA 4I48B 4JQXA 1FNSH 3RL2A 2BX5A 2CLRB 1OTUD 3KLAB 2IPKA 3WS6C 1DEEB 3SKJL 2ADJA 2HRPH 5DVOA 5H94A 4AL8H 1ACYH 1SEQL 3B3IA 4Y16B 2IQ9H 3IF1A 4LPTA 1Y18A 4AEIL 1A1MB 1QFPA 3G5VA 4OZHE 1UM5L 3BKCH 3ARBA 3IFNH 3ULUE 3D39E 1JNNH 2K9UA 2YKLH 1FFNB 3UJJH 1Q9KA 2XQYG 1TMCB 4Q7DA 1EHXA 2ADFH 1B0RA 4PYHA 5F1NA 2NY3D 3SDDB 1RK0B 1NCBL 4MJIB 1DBJL 5D7KD 3U82B 2VYRE 1XIWD 1CTOA 2H32A 5HY9B 5BVPL 1MRDL 4NQED 3GBML 4IMLA 1WEJH 1BECA 3GMPB 5TDPA 4IOSD 2N1KA 4PJBA 2A38A 3DVGA 3U4BH 4K3EH 2HTLC 2JIXA 3WLBA 7CGTA 3T8XB 1IAIH 1YEFL 1C7TA 1VFUA 5L9DL 1C5CL 1NH6A 5AZ2L 1UJ3C 1Y6KR 5E95B 5C09E 1I9JL 4URTB 4XMPL 2DD8H 1K8DA 1KCVH 3PGDB 3BN9D 2DIAA 1CF8H 1U8KB 4KDVA 1NMAH 4IRSD 4XNQA 1YY8B 2UWEA 3M17A 4WWKB 3K1DA 1QR1A 3L9RA 5IBUG 1G6RL 1YJDL 2D7OA 2R2BB 2FHFA 3ULSA 3MLWL 1MAMH 5C0IA 3QI9A 4OF8A 4U2ZA 4ONHA 4MAYC 1IAKA 1CGUA 1CFQB 2DI9A 5JW4N 4M02A 3S3SA 4M7ZB 1FZJA 1NDMA 3I6LD 5E9DD 5GJSH 2VISB 3EFFB 4RIRB 4XPHL 4MMZC 4ZYKB 3UMTA 2CDEB 4Y4HB 4GRMB 2EYSA 4UUJA 1JF5A 3DIFB 4P59H 3I9GL 1EJOH 1X6LA 3RUGB 4NYLB 1YN6B 1OWRM 3WNNA 1H3GA 4JZNB 3EAKA 5BO1L 2R4RL 1P5VA 3SO3C 1WZ1H 2BFVH 3AREA 2OP4L 2VXSL 1S7UA 5E94A 4ZUUB 4LU5H 1G0YR 5DHVH 4NZJA 4LVOB 1UEMA 4YZFF 4UIKL 4YHIB 5IMKA 4X5XA 4JFHD 3ZDYF 5CEZH 1GAFH 2HT4C 3RQ3A 2J88L 3RZCD 3ULVF 3HCVB 2MHAA 2OTWA 4JCMA 2WSKA 5DF0A 1J7VR 3FB6A 5JW4Q 1IAIM 1YPZE 5EU6B 1XF2B 2AJYH 4FZEL 2X4TA 2IAMC 3PQYA 4TTGA 2E7BA 3CCHB 1VKXA 7FABH 3STLA 1VPOL 1IM3B 2AERT 4PG9B 5FUCE 1MJ8H 2VZOA 2NXYD 3D0LA 3PDDA 1ZS8B 4OZFB 3MBXH 1NKOA 1MFCH 4MQSB 3B5GA 4KROD 4TSCH 1JF1A 4NRYA 1NANI 1J5OL 2H2SC 2V2XB 4OZGB 3RL1A 1ZTXL 1XZ0A 4G8FB 2DWEB 4KVNL 2BNRE 4DZ8A 4OZHA 3BPOB 4U1IB 4Y5YC 2Y7QB 4OIIH 3PHSA 3S3JA 1R5VB 3WS3A 4DN3H 1P9MC 3JV6B 2R1YA 3EZ8A 3PE9A 3D2UB 3QA3A 1BD2B 3ZE2E 2VDPL 2DJ4A 1ZK9A 4LOUD 4Z7OE 5HGDB 5EUKB 2BERA 4LIQH 4MAUH 2OJZL 2XN9B 5IR1B 4XX1E 4YXLH 1IC5L 3AY4C 5FGBC 1H8NA 1FFOA 3A67L 3L3OB 5D5MF 5BOZG 5GS0D 5FYKU 4PRNA 3O9WC 1S7QA 4CMHC 1BQUA 2K7PA 2AK1H 4MDJA 1WLHA 5D96B 2BHUA 1R24B 4N1CA 2YRZA 3QWQB 4H1LG 4PJ9D 3S35X 3DXAE 1IGIL 3MXWL 1WIPA 5C09A 3RFZC 2CMRL 4JN2B 3DX6A 1A4JA 3TVMB 2XNAA 3JWDL 3VXOA 4KRPD 2YBRA 1RV6X 5FYLL 3B6SA 3PUCA 2ED7A 3GMLB 4X7TA 4QRPE 1YZZA 1UQSB 4FFZH 1HXYA 5EC1A 4M00A 1NGXB 4L3EB 4PTUA 2A73B 3WCYA 1RHHB 5D71H 4P4RA 3P0VL 1GC1L 4LRIC 4P3DB 3EYOB 3QPXL 3RVVC 2AGJL 5E08L 3KR3L 5HYSA 5GGSB 2DQFB 4RMTA 4XPFL 4NQUA 5IVNA 1EHLH 3ILPB 4JFOA 3ZKNC 1E27B 5IEKA 4JFZL 1XGTB 1Y0LB 3V7MA 5IIEB 3ARTA 2BVUA 3SE3A 4TOYL 3U0PB 1VACA 2XOTA 1MCHA 5IT2H 2CK0L 4JFYB 4U0RB 2BSRA 2A6IA 1V7NH 3KDMA 5LKNA 5I9QB 4DOHB 3Q6FA 4YX2L 4G80A 3P9LB 2I9LA 5FYKD 2MCPH 4PY7B 2ZOKB 1CIUA 5MI0C 1CG9A 4HUUA 2Q7YB 2W9EH 4HIIB 3MRHB 3S4SA 1V8HA 2X4UA 1LDPH 3S36H 1HDMB 4YHLH 1F4WH 5KJRL 3BX7C 4Q9CA 4GAGH 5I8EA 3GHEL 4PRHB 4BQ6A 3AXLA 5ITBH 1G7PB 1K4DB 1YPZA 4NDMA 4TULL 3TNMB 1Q1JH 2R9HD 4C4KO 2HVKB 3G5XB 3EUUA 2JJSA 2ZUQB 4XBPA 1R6VA 3ROOA 4FMFA 3W81A 4OCSH 5DXWA 3GSOB 4JRYE 2W92A 3H8NA 1EHAA 2J5LB 3REWB 4EI5A 4JANA 2WWMD 4XVUD 1MQKH 3EHBC 4EI6A 2N56A 2P24A 3OX8A 2HP4A 2P49B 2X5PA 1N0LA 2OR9L 3THML 1HN1A 1NCTA 2HMID 4MX7B 5H94B 4M7LH 3WNKA 3OR7A 3WIIL 1MFAH 3ARDD 4GRLB 3TNNA 4GXUN 4QTIH 5KG9A 3PL6B 3VWKA 4HWEH 4HPYL 5CJBA 1MHHA 1XGPB 1CBVL 1KPRB 1T3FA 4EEEA 1EBAA 3S88L 2EE2A 1R3JB 1FSKB 1YMMB 4YDIH 5F7WC 1U8QB 3GJFH 3L7EA 3WHXA 1KCUL 3LHPL 1KSRA 4MD0A 1EGJH 2F5AH 1GRWA 1IQDA 5E6ID 1T66C 1FN4B 3I3EA 4HWZB 5EBMB 1T89C 3IYLW 3V52L 4BK5A 4JJ5A 1ZMYA 2JKXA 2EYTA 2ZSVA 5I1GH 1MJ7H 1KB5B 1X6NA 3GSQB 1FGVL 1DN0A 5C2BL 1TZHA 1CDJA 1NLBL 4TUKH 5C0EA 5DLML 3WLBB 5BOPA 4D3CL 4PUBL 4J8RA 4MA8H 3DXAA 3O6FB 4U31A 4C57C 1FNFA 2L7UA 3OKOA 5E4EC 3BPLC 3VRIA 4FQLH 3N1FC 4NQDD 4P2OB 2Z35A 1RU9H 4QRPA 1LK2B 3MYZA 4C83A 4PYGA 4JGMA 2CJUL 4KKNA 1EVTC 4RX4D 4DUWA 1UA6L 4JDTH 1J1PL 3CLFL 3MGTA 3L9RB 1KEGH 2BNQB 3RY4A 5HI3D 4UTBL 4Y4FB 2V2TB 4JZJC 2D03L 3MRGA 4QWWD 2GITA 3JWOC 1JGUH 5HHXL 3PXJA 2N7BA 3C08H 1PKQE 5I1LA 3LMJH 3WLWD 3UDWA 3DGCR 2E8ZA 4NNPH 5D9SB 1BBDL 4DKEL 3TZVA 2WLYA 2V2WA 4LCYB 4ORGA 3FT3A 4PB9L 1IGYB 5SWSE 3PWNA 2YXFA 3TT3H 4UTAL 1OT1A 5JIHA 5JXEC 2EKSA 4EVNA 3LEXA 2GCYA 3FB8A 1N5YL 5CEYB 2YZ8A 1LEGA 5D6CB 3SGJA 5BQ7B 1W8NA 1FNEA 3DURA 3FQRA 5HVGB 2EECA 1KGCD 2IAND 4TPRL 2EEDA 1BJ1H 3LZFH 2XTJE 2BMKA 1XMWA 4FZ8H 4G6FD 4RGOL 1S78C 2QL1A 3TGXA 5CP7A 1CFTB 1T4KB 3N85H 1DBAL 2UVEA 3KPMB 4M7JL 4YQXL 3NTCH 1YYLL 2F5BL 4JFFE 2R69H 2V9QA 1PX4A 4GUPB 3IFPA 1RURH 1YEIH 4AZ8A 4TVPH 3CFCH 4YXKH 4HXBL 1VKXB 1J1XL 3STLB 2FATL 3DYPA 4BQ8A 3GMOA 3GJEB 5EBGA 4JRYA 1KJVB 2VITA 4IEFB 4KC3B 4A6YB 4X5WB 5D5ME 3B9KD 3QR2A 5E7BA 3L95A 3O4LB 4QO1A 4D9RD 2ZCKH 5BV7L 3UBXB 1F3DJ 4OD2A 4LL9A 1JF1B 2XKNA 3SDYH 4LNVA 4CADB 3KPSB 1OTSD 1G7MA 1YEKL 4P3CL 35C8H 4NGHH 2J6EA 3IDGA 2FJFB 5C0DA 3VXRB 5H2BB 2FEEI 5EU7C 3D39B 4JHWL 1RIVL 4M6OL 1KIQB 5J1SC 1ADQH 2Q8BH 4HZAA 4NJAL 3VFPB 2DN7A 1AY1L 5JMRA 3DUUA 4X80H 5KVEH 2AXGB 4IS6B 3AREC 4WNQA 3TT1L 1KV3A 4WW2B 3W2DH 3FN0L 5F7YC 3WE6A 4AMKH 1ERNA 3HZYA 4M43H 4XCFL 5IJVB 3TN0A 3TH4T 4U3HA 3HMXL 5GGRA 4HS8L 5ICZA 5KSAA 1KG0B 1QQDB 1WVZA 3PHOB 4MA1B 1VENA 1BVLA 3RX8A 3BAEL 1GGYA 2VDMH 4UV7L 1TZGH 3ELAT 3VFNA 4Q9QH 2JJUA 3TIEB 1W0VA 1WFUA 5LAXB 4Z78A 3RX7A 4U6XB 2D31A 2NY0C 2PO6B 3DJ9A 1AIFA 4WFGD 3HRPA 4P49A 3OWEA 4KTEL 1HHGA 1QSVA 4X6EB 1HXYB 3IU3B 1DBMH 1H3PH 3D18B 3LQZA 4Q6IB 4Y1AB 3GHBL 2YUWA 1T0NA 3PV7A 2RR3A 2XG4A 3GKWL 4LCWD 3PWLB 4O9HH 3BEVA 5HGBA 1RJYB 1D6VH 2VLKE 1NGQH 4FXGA 4QY8A 1ZA6B 3HI6L 4HK3J 5EZJA 4H5SB 4J4PD 1PKQA 5CJOL 3KPPB 4ELMF 1GIGL 3NCYS 3LKRA 4X9GA 4YEFA 3LH2H 4HJJL 1GGBL 2ZUXA 2IMNA 3V0VA 5F7DB 2R8SH 4K3HA 5L2KE 2B5IC 5SWSA 1VADB 3VXSE 2X70A 5F44A 3PWUA 3NGBC 3N1PC 4ELKB 3FQWA 3QH3B 3MOAH 4OF7A 3T04D 4QOKD 4YK4C 2FHBA 3GSXB 2A83B 4PLJC 2VL5B 4PV9B 1N4XH 2OK0H 1XF1A 5D2NE 4OUUB 3LB6C 4KRLB 1QSFD 2EXWC 4EN3B 4M03A 3KNBB 4NUJA 1X4ZA 5E8PA 3I75B 5I1JL 3RJQB 3T77A 4KKAC 4XNMA 4G8EA 4RAUA 4JHAL 3MCLL 3H9SE 4KAQL 2H2PC 1IEHA 3LRHA 3L3DB 4HXAH 1G7HB 1XGYL 3LD8B 5F7EL 1T6WA 2P47B 4GG8A 1JGDB 4BFBD 3QZWG 5IBLD 3FRUA 3OBAA 5F9JA 1YEGH 5DEFA 2E3VA 4K55A 2GJZA 3DARA 4WUKH 2B7DT 3QEGL 1WCBA 3UCRA 4EOWH 5IVXB 3S5LA 5HXMA 5EG6C 4I3SL 5C2UB 1NCNA 3Q5OA 1QP1A 3KPNB 5D5MA 4PIRF 3VFOA 2P44B 1TLKA 5I1AB 3P3YA 4QXGL 5BCAA 2DRUA 4OCMC 3QUYB 1LE5B 3DETC 5DJ6B 4EI6B 4EBQL 5C08D 2G75B 4Z95L 3MRDB 1XF4B 4WV1C 5IW1A 2PYEA 4K2UL 1DANT 2E8YA 3IKKA 3NA9H 32C2A 3ARZA 5FHAH 4LCUA 3LV3B 3OKLB 4XNYL 1TQCC 4DFIA 2YSSB 4I5BB 2BNRB 4PJAA 4LRNL 4U49A 5C86A 3MRLB 2CLVA 4HWBL 1I85A 2YWZA 4M93B 1OOAA 1N3NB 2FWOB 3GKZA 3LKOA 4ZODA 4M4RA 5HYEA 1KLUB 5EU3B 3GUTA 3SE3C 2CRZA 3WO4C 4F9PC 3VFRA 1B2WH 3PP4L 1I8IB 4HT1H 4NFCA 1NMBL 4Y5XB 2UYLA 5F93C 1RUKL 3GB7A 4LVEA 3VFGH 3I2CH 4MD0B 1B4JL 3SKMA 2HJLA 1MI5D 1AFVL 5J4MA 3PWPB 4HLZH 1L4IA 2CIIB 3BWAA 4HBCL 3FB5A 1JZ3A 2C7UA 3VG0H 3MACL 4IRJD 4MCYB 1INQB 1UACH 5FOJA 1ZLWK 3ARGA 2ATPB 3RKDC 3RWEA 2R0LL 1FPTH 1FJ1A 5IWLC 1MUJA 4N9GB 2W91A 2A74A 1DVFD 3WIHA 4H25B 2DQTH 2D4FA 1AGBA 4YO0A 4HAFA 3PWJB 2R23B 2DKUA 4X4XB 5C9JB 4U6YA 2KBGA 3RTQD 4QRPB 5CUSH 2F53B 1DLFH 4GG6E 3RIAF 1DSFL 3MV7B 4HZLB 5FYJH 5H37H 4WI8A 1JYXA 4Q2ZB 2C3GA 3UTPD 3F58H 3O2VH 1MEXL 2ZNXA 2YPVH 4GBXD 1N8ZA 2AKRB 4FFYL 3UO1H 2DQHH 1JGLL 3CNKA 3QUMB 2VLKA 4PRID 3WSQH 4P2RB 1HHHA 1S7WB 4WFEE 4OD3H 3MLPA 1A2YA 3AU1B 3JWNC 4FRWA 4PD4J 3W82A 4XGZA 4UU9B 1HYSC 3UPRA 1NBZA 2BY3A 2ARJQ 1GZQB 15C8L 3OB0H 4XRCA 4YDVA 4BM7A 3T4AB 5L2KA 3ZYZA 2FH8A 1IKFL 3FT3B 3VXME 2H8PA 3ARUA 3C60A 1M7IB 2DLHA 1LO3H 4C56E 1KTDA 1ACZA 3DMMD 2OJEA 1AO7D 4KKBC 3K2UH 4JG0L 4K3DL 1FFPA 3MNWB 2OZ4H 3EBAA 2OSLB 4FQIL 1FNEB 1DFBL 5D2NA 3VMOA 2ENSA 5GRZA 3WD5H 2ESVB 3EOBB 5JOPE 2Z0BA 3WFCH 3IXAB 5JDJA 3LKPA 3H9SA 1BIHA 5JW5A 5IB1B 2DQIH 2EDRA 3MRFB 3HG1E 3H2WA 4HKXA 5AWNH 3FHAA 4NWUL 3E6HB 3P4OA 5LQBL 3VCLA 1LD9B 3OKDA 5ESAB 3FRPA 1MCIA 2ZNWA 1UWEH 5AUMA 4WY7L 2Q6WA 2VQ1B 3QUKB 3TYFA 3WXWL 1NCCL 4AEHL 4FA8A 4NP4H 1MWAL 1T2QL 1MSPA 3MCG1 4JFQB 5FCSH 5GGRY 3BRFA 2VAJA 5A2KH 3ZDXE 3IRZA 1MHCB 3RGVD 4X0KB 5DDHA 2VLJD 5MP6L 1SVZA 4CN6A 4CDGC 3M1BA 3OXRB 2F54E 5I2IB 1EX0A 3V6BR 4P57B 4QRQA 1U8IB 5I1DA 4NC0B 3CFDB 3KLHC 5AYUH 1M1SA 5DVKA 4HC1L 4MZ3A 3ALWA 5EOCL 3VD9A 1DTUA 3CPLA 4AENB 3HAEB 4ZXBD 3FOMB 4QRSB 4BFIB 4JQVA 4PRDB 4B41A 2AJZA 1JK8A 5C92A 1F2QA 5CIPA 2H32H 4M3JA 4OBRA 5E5MB 4UINL 1KB5H 1F8TH 2ZCLH 5BXFA 3SGJC 5FK9A 4M48H 4P23C 3WKMH 4YE4H 4KMQA 3QXAB 4JO2L 4LARH 1INDH 3RVWC 4AIZA 5IVZA 3C6LC 3U7WL 5HJ3A 4L29A 2MJWA 3EDDA 3TN0B 5D1ZD 1RIHH 2A1WH 3LKQA 5ID0A 2BJML 4XT1C 4YBLB 2RCSL 3FT2B 4OT1L 1ZHLA 3QDGE 1WUNT 3AVEA 4WRLA 1FZOA 3AUVA 1OARH 4L8SB 5SWZE 3SEPA 5I16A 2NYYD 2Q76B 3V5HB 3OGCB 2XQBH 2NR6C 4GW4B 2X89D 2X4RA 1AR2A 1NMCB 4LPUA 4GG6A 4IIQA 3O4OC 4G6KH 4V1DD 2EDXA 3MRQA 1T0NB 1IC4L 2NY2D 4F33B 3EO9L 3MR9A 5CJ8A 2YD3A 4OD1H 5EULV 1QA9A 3BZDA 1NEZG 4QY8B 5T3ZE 5A2LH 3X3GH 3WHE0 5TGBA 2GIYA 4JPKH 2O5XH 1UWXH 2AXFA 2QADD 5SX4H 4N0FB