4HPYL

Crystal structure of rv144-elicited antibody ch59 in complex with v2 peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
DSYELTQPPSVSVSPGQTARITCSGDALPKNYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNHRVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH59 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpyL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpyL01
2J88L 1J8KA 5GS0H 5AYUH 3IXTB 1RUPH 4J7RA 5GSRA 4NNYA 4WO4A 3SDCD 1FO0L 2C3VB 2VDNL 3L5HA 4PJBA 4G8GA 4PJ9D 1MJUL 2YEZA 2FO1A 1S7UB 2Z31D 1FVEA 2ENYA 2D4DA 4S1SH 1KB9J 3JWDL 2AKRA 5DHXB 1NSNL 5ELIA 1CLCA 1AKJB 2A73B 1IC1A 4H5SA 4RGOH 1GJIA 1J1OH 2I5YL 2IQ9H 1UCBL 3EDJA 4FQIH 5EU6A 1QBMH 3IFNL 4Z0XB 1MHEA 1BQHA 3OJDA 5JDJA 1FNSL 1GHFH 4I0PD 5IESL 4AEIL 2HJFB 2FO4B 1SY6L 3E2HC 3QZWB 5TFSL 1HCFX 1QTYT 3GMNA 4LSPL 3WNMA 2DL9A 3QT2A 3X3FH 3LKNA 1FYTA 1BMGA 2IQAA 3S97C 3IS0X 1SQ2N 1OAYL 5GIRA 1T1WA 4ZODA 4U7KA 3IDXH 2Y9RT 4NQSB 3HRZA 5KOVC 3HPLA 4OCWL 4GRLD 3CFKB 4PLJD 3U7YL 2AJVL 4YFLI 5IB1A 2XTJD 4XPAH 2F8VA 4K23H 4AL8L 4LLYA 3PABA 1WBYB 4PY8J 4F7MB 2QV2A 4U7MA 4EI5C 4I18B 1GPOL 4FZ8L 1GOHA 1I4FA 4JFPB 4L4VE 4NNPH 5AG8A 1I8IB 2ZG2A 4XWGL 4P46D 2E6JA 4IMLB 4WHYG 5C0RL 1ZA3B 5KSAA 3M1BB 1Y6NR 1NC2D 3TIEB 5JPMA 3KJ4B 3VFWA 3MA9H 3U30C 4RMSA 1T21A 2DJUA 3IDIB 4CVZB 1DEDA 3P0GB 5FM5M 5FYJL 1CLYL 3K1KC 1ZWIB 5H37H 4LSQL 5ACLA 1IAIM 1K8IB 4GRWH 3WHXB 2MPAH 3L3HB 4GAGL 5E6IC 4RGMC 2OTUB 4KRMB 1U2HA 5GS0L 3GSQB 3LN5A 5AYUL 5KZCD 4R2GB 1CE6A 3D3VD 1RUPL 4M61A 4P4RB 5KAQG 3STLB 1HSBB 3WIHH 2F54D 1FLRH 4Y5YC 5IM7A 1P4BH 3AM8C 3V4VH 4S1SL 1T1YB 4I3RH 3WUWG 1EGJA 1U8NA 4OAWA 3EDDA 4RGOL 4N1CA 2YHGA 2VZ3A 4HUWB 5BMFL 4CJ0A 1FFPB 1MJJB 4S1DC 1KCKA 3OAUH 4FQIL 3BVNB 2J5LB 5I1JH 5EU3B 3RKDD 1WAAF 1OSPL 3MV9B 4YBQD 4RNRB 2BY3A 4HMCA 2DIBA 4OZ4A 3DUSB 3VG9C 3K80A 1QO3A 4HULB 5IB3A 5JHDB 3ULUE 1BVKA 3ARYA 4MZ3A 4D8PB 4N90D 5BZDA 1AXTH 1W0WA 3EYVA 5DO2D 4IJ3C 2BNQB 3S4SB 3O2DA 2X1OA 5GGSY 1IKNA 1D3CA 3TYFB 5C2BH 5HHOE 4IRJD 5IEKA 1IM3B 1Z9LA 3S36L 2HVKA 3ALWA 4Z18A 1AXSA 4K23L 1YPZE 3QEUA 4DEPC 1CFNB 4PP1D 4UBDC 3BGFC 1QBBA 5BXFB 2AVGA 1PX3A 5CEZD 3JWNC 3L6FA 4NNPL 5GRZA 2W65B 3BZ4B 4HJGB 3TT1L 4N0FA 1ES0A 5GGUA 5FO7A 3LVEA 4HKZB 5EBWB 5E00B 2NX5A 4EI6A 5ITBH 4WFGE 2PYEE 1W0VB 5IHLB 3HR5A 2BC4A 4FXLA 1FCGA 1U58A 2AQ3A 4ZQKA 1WISA 1AGEB 1F11B 4OZHB 2ICWJ 1CGSH 3ZHLA 4HH9B 4X8JA 3ILPB 4PRPB 1IZJA 1ZT7B 1I85A 2CMRH 2HVJB 5IMKA 1A22B 2MPAL 1M71B 4PJHB 5KAQF 1JWMA 1S9YB 3DOSA 4OQTH 4MAYB 5B8CB 4LLQB 4NYLA 3VMOA 2IH3A 3P40A 2EYTA 2XNAB 3BWUC 4HFWA 2A6DB 1ND0A 2ADFH 3T77A 1N2RB 3VH8A 4AEHH 3V8CA 3WIHL 2IAMB 3EZJB 1WT5C 5F7KC 1FLRL 1P4BL 2WWMD 4AM0B 3MRRA 5TDNA 3V4VL 4K7FA 2NZ9D 4I3RL 1DDHA 4LLMB 4AT6B 1KIQB 3W11D 5DEGB 1I8KA 1D5XA 5J11B 1JF6A 1BOGA 5D7LD 5E8DH 2FIRT 2AJ3B 3OAUL 3LEXA 4NZRH 3FJTA 3LEYH 4YZFE 3ARVA 4L3CB 1P53A 3BHBA 3HMXH 5D7IA 1ORQB 5EO1A 1RFDH 3V6FA 1KB5L 5ICZA 5JORB 1HDMA 2R1XB 3JWDC 2NY5H 4M7KH 4OZFA 3ZDYE 4QLRA 4Z7UA 4KKLC 3D39D 1IARB 1AXTL 1NAKH 4OZGA 1MY7A 1B9ZA 4O51A 3FKUS 4HWBH 2QQQA 2HJLB 4LLVB 1DANT 5C2BL 4F9LC 4U1LA 2YPLA 1ED3B 3S7GA 1AGDB 3ARGC 3MNVA 1SMOA 1DBAH 4IRSD 1XF5B 2FD6H 2R23A 3HE7A 3O4LB 2MSPA 4LCWD 1FQ9C 2ZUQB 1XGRA 2XXCB 5DJXA 1YUHB 5C0AA 4AQOA 5BJTB 2XKSA 3QUZD 2P46B 1YEGH 5E7BA 5D7KE 5C09B 2ZG1A 5C1MB 5IMMB 5ITBL 4S11A 4NQDD 2BSTB 3CSPA 1CLOL 2C1PB 4GT7A 4DWHA 1T7YA 1GC1H 1LO0H 2CMRL 3RZWA 1RJLB 4KH2A 4HLJA 2Y6SD 4OQTL 3W9EA 5DZLA 3FHAA 1T6VN 3QZWG 5F3BB 1RJZA 2R4RH 15C8H 4G3YL 5E94A 2ADFL 1FLTX 3SO5A 4AEHL 2A0LC 1RZGB 3JUYA 4XNMA 2PO6B 2HMID 4HS3B 5HI5C 2H3NA 1CFVH 3MRLA 1YPZF 5J12B 4KHXH 2XFXA 1OGTB 3QXAA 5E8DL 4BELD 5DMKA 3VI3E 4DOHB 5LWYH 3L5XH 4NZRL 3MV9E 1UFUA 3LEYL 4H26A 2EDDA 4IDJH 5BO1H 3HMXL 1ZHNB 3LDBC 2GSGB 4L8BB 4PJFA 4JM2F 5A2KH 4HAGA 3BPLC 1RFDL 5JHDE 1HHKA 1TCRA 4C56A 2QEJA 2W9LA 3WV0A 2NY5L 4P2RD 4M7KL 5KSVB 3EAKA 3W0WB 4HDIA 3RDTD 1NAKL 1FL6A 32C2B 2BNQE 4OQ1A 3BGMA 5EIQA 5BS0A 4D9RD 4MJ5B 4ZDHB 2HA1A 4ZO6A 5T5NG 3RWFB 4HWBL 4RWYH 3QDMD 1KELH 1CD1B 2X70B 5J6HB 2R0ZH 5IBLC 1DLHB 4LSSH 1TQBB 5C0BB 3MOQA 5FECB 5SV3A 4EXKA 3FQUA 4JFQA 3MPCA 4BH8A 1DBAL 3TCXA 2WLYA 4D0CB 3VD4A 2FD6L 4H1LB 3BAEH 2EKSA 3ECBA 1EO8H 3VWKA 3JBG7 3OV6A 3PGDB 1H3GA 3KVQA 1T4KA 1A8JH 2AV1B 1WCBA 3MUGA 1J88A 1RK1B 4Q0XH 3CH1B 1YEGL 4M3KB 1BBDH 1EEZB 4YLQT 3GMQA 1KIPA 2CDFA 4OZHE 3UTSE 2YSSA 4ZAKC 3QQ4B 3TP4A 4RIRB 4P23D 3QUYA 3IDYC 4XC1H 3L1OH 3KWWA 3O8XB 4PRPE 4YZFF 5BRZB 4XPTL 1GC1L 4NGHL 1V3KA 1LO0L 4J6RL 4PJHE 4HPOL 1XGQB 5I8CB 2YD7A 4K3DH 4X6BA 4G8EB 4LHUA 2Y23A 3EJYD 4GQ9L 2R1WB 3VMNA 3PIQB 2R4RL 5ESVB 15C8L 4JZJB 3GBLA 4HUXA 4LMQE 1CFBA 3ZT6A 3IAPA 1UWGH 2JIXB 5E0QA 5HD8D 3VGDA 3S4SG 1B90A 2QR0B 1XGTB 3VGGA 3A6BH 4YHPA 1FZMB 1XF4A 1CFVL 3GHBH 3T2NL 3BIKA 4KHXL 4LPCA 1YEIL 3JXAA 4RMQA 1KNOB 3RWIB 2EYSA 3TCLB 4X99A 3QBTB 5D1ZA 4XCNA 5F9WB 4JQIL 3L5XL 4YDLB 1ZA6B 3J8F7 3U7AA 2OBGA 4ZPVA 2C26A 4IDJL 1LEGB 1L9NA 1TXKA 4C83A 3P0YL 1I8MA 3MBEB 2H6PB 2W0FB 1BBJB 3I6KA 4U1JB 1HI6B 5A16B 2G2RB 3EOBB 4QRRD 2DQJL 1ZHKB 4F7CB 3MFFB 5T1KA 4UOW1 4J12A 5FGBC 1IQWH 1KELL 4EN3A 7FABH 3KNBB 5IGXH 4LSSL 5E4EC 2A6IB 5GRVK 3C08H 3W5NA 3O4LE 3QIBB 4N0CC 5E8OB 1MQKH 1EO8L 3WCYA 4IHOB 2VZUA 4DGIH 1QFWH 1Z2KA 4X4ME 2WBKA 1B4JL 3VGEA 4F3FA 3NPSC 5GGVY 5C09E 4Q0XL 3O9WA 2O61A 3MGTB 1X5FA 1BBDL 1RZFH 5J9PB 3FT4A 1OGAD 3CDCA 5BQ7A 1U8LA 4XC1L 2Q76B 5GZNC 5KW9H 3QUMA 1ACZA 2BNRA 3BQUC 2J12B 3I02B 4UDTB 4WUUB 1CD0A 1CXIA 4NKMB 4JJ5A 1IILE 3RL2B 2FEDC 3B9AA 1QSVA 5H35B 3BO8B 1SJVA 3BIBX 5EC2A 4K3DL 4EI5D 2BCKB 3B6SB 4V1DA 1FRGH 3V9FA 5DA0B 3I6LD 3SDCB 1D7FA 4UDUB 5T3XL 5TGBB 3T65A 5IHZA 4PJ9B 2Z31B 2B4CC 2APXA 4PRIB 5DVLA 1UWGL 2V6HA 1CZ8H 4OF6A 2PXYA 3ZE0E 3MOBH 4DOHE 3GHBL 2BNUA 5FYKL 1G7QB 3V5HB 4I0PB 1F58H 2WP3T 5AD0A 1TMCB 1T1XA 1A3RH 2WANA 1ZGLB 2FL5A 2NY1B 3PF2A 4E42B 5JLZA 3KDMB 3HPJA 2CUMA 4QYOA 4YO0A 4YHIA 3W0WE 1BLNB 5M94B 1EHXA 4X0KB 5KVGH 2GK2A 4OD2B 3UJIH 4OZHF 2ICCA 4GS7C 5IR1A 2VN7A 1X7QB 2GUOA 4ESKA 2YN5A 1IGTA 1JV5A 2DI8A 1E4JA 1Q9WB 4L8SB 4PTUA 3G5XA 1ADQA 1F4AA 4UZGA 4G6JH 1HHIA 2XTJB 5C0BE 3UCRA 1T6WA 1MHHB 4PJHF 2WLZA 7FABL 1JNNH 2OLDA 4RAUB 5IGXL 2FH6A 3LZFH 4P49A 3BI9X 4CW1A 4HIJA 1OAZH 1WAAA 4CN6A 4Y1AA 3I84A 5HHNA 3G6AA 2NY5C 1G1YA 1QR1A 2BY2A 1U8IB 1MQKL 4IIQB 4P46B 4PJ8B 1M4KA 4OFPA 1EGJH 4DGIL 1QFWL 1M7DA 2AXFB 2FWOB 3KPRB 3Q6GL 1MPAL 4CN4A 5INDB 4MZ2A 1NC2B 4TQEH 3QPQD 3O3EB 3SOBH 3BH9B 1OTTC 5DMGC 3O3DA 3BESR 1RZFL 3L7FA 3ARTA 3KLAB 1QEWA 5TH2B 2VDQH 2K9UA 3O3UN 4TOYH 5KW9L 5F6HI 5DUPH 5D6DA 1TITA 4RZCB 4AG4H 5BV7B 2XWBB 3DX7A 3L3GB 1RVFL 4HKJB 2X6MA 1QLRB 4BSWA 5IMOA 1X44A 5KZCB 5CILH 3D3VB 5BCAA 3V5DA 4XP5H 1KSRA 3DYMA 3O2DH 4OLWH 4XTRC 1FRGL 2BDNH 3K2UH 4PJGB 5JXED 1MCLA 2LU7A 5TQ2H 5D7JC 5EUKA 3CVIH 3DTXB 3QNXB 3MRQA 3VXPB 3FN9A 3HI1B 3EO1A 2V2TB 2RR3A 3L5JA 1KACB 3FQRB 3MTRA 1CZ8L 4ONHB 1FCCA 4L3ED 1AH1A 3HE6A 5EIVA 3MOBL 1D5MA 1QSEA 1MFBH 1HXYB 4C57C 1PD6A 2ICWA 5IJKC 4MDJB 1F58L 4A6YB 1CI5A 3NCJH 4H1LG 2NY6D 4MLIA 3U4AA 3OAZH 3CFBA 3TNMB 3BPCB 2ATKB 2BY1A 2CJUH 4LQFH 2XN9A 3F5WB 4I9WD 4XB8A 3NA9H 1JP5A 4RA0C 3WUWA 1JTTA 4X5LA 4ETQA 3UJIL 2GSIA 4JRXD 3JV4B 4NQVB 1S5IH 1MVUA 2ARJA 1WBXB 3LQZA 1IAOB 3TYGH 1ZT1B 3OKEB 4G6JL 4IRJB 4UMGA 3GFUA 3ULSA 5LVEA 2G5BB 1BX2A 1A6PA 1JNNL 3G9AB 3MNZA 3VD3A 3W2DH 3BEVB 3LZFL 3LPGA 3D2UA 4L4VA 4C59B 3KR3L 3IT8D 3SJVD 2AEQL 3L5WA 2JJUA 2OJEB 4OT1H 3L95B 4MA7H 3IJSB 1AD0B 3FQWA 1EGJL 3C2AH 2BJMH 3CH8A 3SE9H 5DEFB 3BKMH 3KLDA 3RNQB 3U46B 3VJ6A 1Y0LB 4TQEL 2EIEA 3Q1SL 3ARFB 4HMDA 2B1AH 3SOBL 3VFNA 4HCRA 2I07A 4X4YA 1DL7H 3WUZA 4FXGA 2VDQL 4WI7A 4WUUE 4TOYL 1S7RA 3IU4H 4ODUA 4U6YB 4UOJA 5DUPL 1YEKH 1UB5A 4OZFH 2DL2A 2R2HA 3PP3H 4QEGA 3ARGD 1VDGA 1JGVH 3AAZB 2IGFH 3QCTH 3SE4C 2GCYB 5CILL 4MJ2A 3VFRB 5FA3A 3SKUD 4XP5L 3O2DL 1CGYA 4OLWL 1MI5B 3UPAA 3K2UL 5EB9A 5TQ2L 1YEDB 4PPTA 4PRIE 3CVIL 4GKZB 3MLVH 4PIRF 3HUJB 3BEWB 3VD5A 2LAAA 1MFAH 5FUCE 2V17H 5DJ8A 2P43B 4Y89A 5LGKA 1NDMB 4UOW0 3MLSH 3IFPB 1BFOB 3DXAA 1MFBL 5LBSL 3LS5H 1YEJH 3H0TA 3SGDI 4HBCH 4PY7B 3SO3B 4U6XB 3NCJL 2FX9L 2YPKB 3RPIB 4JGJA 3CFEA 1F4HA 5CEYA 4LQFL 1HHJB 3L7EA 1I1AA 3NA9L 1JPTH 1SJHB 1QYGH 4UNVA 4OKVA 4JVWA 6FABH 3RY6C 4NZTH 1MHCB 2A0LD 1BFSA 1WEJH 2WUCL 3ARBC 4ZUSA 3UPRB 1S5IL 2BVPA 4MA3A 2XTJE 3TYGL 5HHOA 5HI5D 2H26A 3WS6A 4U3HA 1YPZA 1GRWA 5FKPA 1JYNA 3C6LB 4ENEC 4IRSB 4JAMA 1DQJA 1H5BC 3DRTA 4LCWB 1F6LL 5IF0B 2X4UA 3MLXH 5C3TA 4F2MB 3NFNB 3IGAB 3B5GA 2BHYA 2EDXA 1BVLA 4OT1L 2FZ3B 4JM2A 3KPRE 4MA7L 4G42A 2QBWA 4DK3A 2P47B 3C2AL 3TF7C 5HPMB 2BJML 1DUYB 4R97C 2G75B 4XVUC 3RWGA 1V5JA 2NY0D 3P4OA 2PYEA 5B3JE 2IPUG 3BDYL 1KCLA 2B1AL 3MV7D 4NQDB 2DIAA 4WO4C 1EFXD 5ETUA 5CD3B 1DL7L 2W59A 5IBLD 1T22B 3IXTA 3IU4L 4HH8A 3F8UB 2VZTA 1Q9KB 3D3VE 3DV4A 1J0YA 1YMME 1JGVL 1SM3H 2C3VA 1WTLA 4PJGE 1S7UA 3B9DA 1G9NH 2BSSB 1AKJA 2A73A 4UQ2A 2HFGH 5FA4B 3MLVL 3NBNA 4IM8A 1ZSDA 4M7ZC 3MR9B 1BZ9A 3VXRA 4DK6A 1I7ZB 1MFAL 4Z0XA 3ES6B 4WY7H 1A1OB 4ZAKD 4MLSA 2HJFA 4JVPA 3MLSL 5A40E 1C5BH 3T2PA 3QZWA 1JF1B 3LS5L 3TFKC 1YEJL 2AABH 2N1KA 4XBEH 4HBCL 2CDGB 3WO4B 3O0RH 5ADOH 1DP0A 1H0DA 2JCCF 5E2VH 1JPTL 3UTTD 4NCDA 1QYGL 1HE7A 5I76A 3IETB 4PLOB 5GS3A 3H3BC 6FABL 3CFKA 1OP5K 1VHPA 2GY7B 1HOCB 1WEJL 5F1OB 1N6QH 3QDMB 3TJEH 5C70A 5KSAC 3B2UD 3BZEB 4F7MA 3O41B 2YC1B 4I18A 3OKLB 1NFKA 2VDOH 1I8IA 1C12B 4IMLA 5CEZE 4M48L 3FQXB 1ZA3A 5E24E 5EBMB 3M07A 4NFDA 1QA9B 4OM0H 4GJTB 1A6TB 2Z92B 1CFTB 5CZKA 1W0YT 3KPMB 3V6OA 3IDIA 1TVDA 4CVZA 5I6XC 1B2WH 3OSKA 4HUKB 3RTQD 5I0ZA 1HH9B 1QLEH 2ZKHH 1ZWIA 2FHBA 4NBZB 3WHXA 4JQVA 1L0YA 3FMGH 1ZMYA 3IRZA 4WWKC 1IC5H 2OS7A 1LVEA 4P4RA 5DHYB 3STLA 4H25B 1K4DB 5E6YA 1HSBA 3VXQB 2J4WL 3ZZ1A 4MNHB 1NEZA 3HG1E 1MI5E 4N5EC 3RVXD 5JZ7C 4XGZA 3ZE1E 1T1YA 1G9NL 3M45A 4W68A 3EOAB 3B9KC 3LKRA 2HFGL 3HUJE 1JJUA 4HUWA 5J1AA 1C08B 1FFPA 3DETC 2YRPA 4YFDB 1C16B 5D9SA 5EU3A 2WWKO 3DGGB 1JPFB 4E41D 4ZS6D 2VZ1A 1K85A 3LPFA 5GZND 1EJOH 3BQUD 3DUSA 2A77H 2EE3A 2DMKA 3PGFH 3TH3T 2O5ZH 2AABL 4GUPA 5JHDA 4XBEL 3F7QA 2FEDD 4D8PA 1TCMA 3O0RL 5ADOL 1EHAA 1YNLH 2X09A 5LG1A 3MRHA 1F3JB 4PLKC 1WIPA 4QRRB 3WNNA 2BNQA 3S4SA 3QUMH 4ZUWB 2BVQB 1IM3A 5JW4M 3TJEL 4XNQB 3B5TA 1CFNA 2ERJC 3BMWA 2EO1A 5BXFA 3PWJA 2EE2A 2VDOL 4LCWE 2H45A 2W65A 3BZ4A 3X12B 1LNUB 4HJGA 1NUGA 4LP4A 3HNSL 4HKZA 5EBWA 5E00A 3NIGE 4OM0L 4LIQE 1W0VA 3LV3B 5IEHB 1F11A 4OZHA 1B2WL 3MUZ1 4OI9A 3FT3B 4HH9A 1OGAB 1TQCC 3ILPA 4PRPA 1ZT7A 5CINH 2X10A 2HVJA 1CG9B 1M71A 4PJHA 3T3ME 4MAYA 3FMGL 2J8UB 3DUUB 4XMPH 3TA3D 3TBTA 1NCBH 2VAJA 4RFEB 1IC5L 2XNAA 1UADC 1WZKA 2A6DA 4DGVH 1A6UH 1N2RA 4KTEH 3K2MC 4N8VB 5F7FA 1F6AB 1P69B 4AM0A 1ADQH 5E03A 4B7LA 3C8DA 4MD5B 3GMLB 4YUEH 1KIQA 5CSZB 3RQ3A 3UJTH 3GM0A 3C5ZD 1BWMA 3B9EA 1CGUA 4IOFC 2AJ3A 1OTTD 1RJYB 2RFXB 4U1NA 5SWQA 5IHBA 5EOCH 5DMGD 5ACMA 2XPGA 5TE7H 5J57B 1LEKA 5E95B 4NM8H 2RB8A 1WV7T 3RWCB 2Z93B 4GAFB 1IAII 4QWWD 1ORQA 1U8OB 3D69B 5JORA 3FRUA 3PGFL 2O5ZL 2R1XA 1UACH 4RGMB 5GGSB 1U93B 5HYIA 3JTSB 3IDUA 1Z9SA 1YNLL 2NXZC 3DMMC 4XTRD 1OB1B 4Z7QF 3QUML 4XXCC 5D7JD 3RAJH 2HJLA 5CUSH 4MAUL 2P1YA 2F5BH 1QQDB 3QDME 1OW0A 4WHYH 1ED3A 2JB5H 3OKOB 2P5EA 1AGDA 3X11B 3S88H 1ONQB 3F7YB 1XF5A 5E5RB 3N06B 1RZKC 3O4LA 3LB6C 5IW1B 5L0QB 1KPUB 1U3YA 3BN9C 1YUHA 2BRQA 1IAKB 3C8KB 5BJTA 4Y4FC 2P4AB 3UTQA 4JPVH 5C09A 5ALCH 2X9WA 5IMMA 4AIZB 3VG9B 2YUVA 3HUJF 1KENH 2BSTA 4K8RH 5DS8B 3R8QA 4KJYB 4PRAB 4U1SB 4PD4J 3D87B 4QNPE 2C5DC 5CINL 5IWLA 1RJLA 4FG6D 4OLVH 2CQVA 5F7YC 1MFDH 4XMPL 1LD9B 2YD8A 2HT4D 5F70A 5F3BA 5TPWH 4L9LC 4Y19B 4DGVL 4FQCH 4TSAL 5HXMA 1A6UL 3TPKA 5JIIA 3BDBA 4KTEL 3FQTB 1RZGA 4HIHB 1AC0A 2PO6A 4WNQB 1ADQL 3CZJA 2OSLB 8CGTA 3DGCR 2ESVA 4YUEL 3UJTL 1JHKH 2DQEH 3PNWA 3RBSA 1CCZA 2GTZA 4H0GA 5EOCL 3WFEH 5HTSA 1AI1L 4IEFB 3MLRH 5TE7L 4R7DB 1AIFB 2A9MH 4NM8L 12E8L 5C9KA 3DV6A 1N5AA 2GSGA 4L8BA 2DQGH 4LSUH 3AXLA 2NY6B 5HHMD 4KMTH 2OJZH 1G9NC 1UACL 4G8IB 5JOPD 4HKBB 4HCRH 2C3GA 3W0WA 5KSVA 4RQQB 4ZUTB 2ATPB 2G9HB 1PY9A 2PTUA 5CBEB 2AW2A 3G6JB 4MJ5A 4TSBH 5D70H 5EZIL 1D5BA 3H8NA 4GH7B 4APQD 3GMPB 1NGWB 4K71C 3RWFA 5KBNC 2X70A 1MLBB 3RAJL 5J6HA 1K8DB 3VW3H 1IAMA 4KRPD 5C0BA 2B20A 2HG5B 5I66A 3LAFA 4JFHD 3SKNA 3T3MF 2Y5TB 1G7JB 2JB5L 3VA6A 5C86A 3FO0H 3S88L 1U8QA 4S0TD 4H1LA 3DRQB 2XT1B 1EMTH 3MV11 3D25B 3K0WA 1NFDB 3SJVB 2AV1A 1CFSA 4LAQH 4V2CB 3CH1A 1FNGB 2IF7A 3CDYA 4ODSH 4JFDD 3F7VA 2HJKB 4JPVL 2OK0H 1EEZA 1A7PH 5DQ9B 2HTKD 1KENL 4RIRA 4K8RL 2I26N 2WAHA 3GSUB 1FVCB 3K74B 1IMHC 3DVFA 5EZJB 4PJ5B 4WV1C 4X5WB 4EUPB 2DJSA 5BRZA 4LCCC 2FLBT 3VD9A 1DBBH 2QKIB 2UWEB 1QP1A 4BK4A 3TWCH 4XWOC 2J8UE 4G7YH 3ULUH 1XGQA 1F2QA 2H2PD 4MCZB 5I8CA 1KTRL 1KJMB 4G8EA 1MFDL 4FTVD 4ODTH 3ARGB 2R1WA 3PIQA 1CN4A 5ESVA 5TPWL 4JZJA 1WLHA 5LGJB 2E7LC 3I6LE 4FQCL 2FNBA 1KJ2B 4ZTOL 3GI9H 4QF1B 3QULB 4DN3H 3GBNL 2JIXA 1YN7B 2QR0A 3U83A 5K59E 1XGTA 4XVUD 5DRNB 5CIPA 2AXJA 1TJIH 2DQEL 3SGJA 3DPBA 5BVPH 3TCLA 3RWIA 4UV7H 2ZJSH 1F8TH 2AQ2A 4PUBH 3F7PC 2A9ML 1LEGA 1D9KA 1QLFB 4P2OA 3RWEB 3VCLB 2DQGL 2UZXB 3P77B 3MBEA 3TT3H 2H6PA 1RUMH 1RK0A 1KLUB 2W0FA 1BBJA 4KMTL 4M6MH 1HI6A 4EN3C 3AUVA 2G2RA 5A16A 3EOBA 3NIFF 4HCRL 3RZCA 1ZHKA 4F7CA 2DN7A 3MFFA 1U8MB 1EIBA 4U33A 3S35X 1CD8A 5HSFA 4DAGH 1KG0B 4TSBL 5D70L 4ZMAT 3N9GH 5KN5B 4QNPF 3BE1H 3KNBA 3T0EA 2K1MA 3F62A 1AFVH 4XNZB 3FO0L 3QIBA 3UC0H 5E8OA 2EDYA 2X41A 4IHOA 1EMTL 4DVBB 5F9JB 3H42H 5IHUH 5CLTA 1MF2H 4MJID 4N8VG 5L8JB 4ODSL 3MGTA 4R3SA 3FFDA 2OK0L 2MTPA 3BPLB 1A7PL 2XWJA 1JHTB 2NY0B 2X4PB 5J9PA 1EJ6A 1ITCA 3MV7B 5CBAB 2Q76A 2X1WL 3BP7B 3VDBA 1EFXB 2IMMA 3CAFA 4UDTA 1DBBL 4NKMA 1J18A 3RL2A 3O2WH 2EDBA 3TWCL 3PG2A 4G7YL 3ULUL 1YEFL 4S1RL 1AGCB 5EA0H 1CDJA 2BCKA 3B6SA 4Y19E 1IM9D 2PXYC 4GXVH 3SDCA 4WI3A 5DD0H 4HEPG 5ESQA 4MXVE 5SWSD 4UDUA 3MV8D 4PJ9A 1A14H 2Z31A 4DN3L 4GAYA 3GMRB 3ZYOA 1G7MB 5FHAH 1FP5A 2QQKH 4PYGA 4J3WA 5TE6L 1TJIL 3T2QA 3HCVB 3QIUA 1G7QA 5I8EB 3V5HA 5BVPL 4NCC1 4UV7L 5H94B 4ZAKB 3T0AA 4I0PA 4PUBL 4FFVD 3B9VA 3V0WH 3G5ZB 3AC0A 3K8MA 2JJSC 2VZSA 2DAVA 5E6ZA 4E42A 3KDMA 1OD7A 3Q3GA 2J3SA 3HLAA 4MYWB 4WWKD 5J4MA 1X6LA 2ICEB 1RUML 1BLNA 1VFOA 4I9WE 4X0KA 4M6ML 4Z7WB 5C6PB 5EC1A 4OD2A 1MCJA 4Y2DD 1X7QA 3G6JE 3UTTB 1ULVA 2ED7A 5I8KH 4BZ2H 1EUUA 1J0JA 3KYNB 1Q9WA 4DAGL 5JZ7D 4GRLA 1TVHA 3U79A 4L8SA 3V0AC 3N9GL 1C7TA 2PW1B 4AJ0A 4OGAC 3B9KD 3BE1L 5I8OH 3B8SA 2J8UF 1G6RB 4RAUA 2OX5A 4R4ND 3DETD 1AFVL 4N8PA 3T08A 3UC0L 4YQXH 2JK5B 1P9MC 4JG0H 4TNWF 1NFDE 4FFWC 1U8IA 4P46A 3SJVE 3A67H 3MOAH 2VL5B 4JY4A 2FWOA 3H42L 3MRBB 3OB0H 3O4OB 2FBJH 4OIBA 5FCSH 5IHUL 3AGVA 1MF2L 1NAMB 5INDA 1FH5H 1NC2A 3O3EA 4G6MH 3ROLB 3WDHA 5I73B 5D6DC 1KFAH 2NXYD 3ZYIA 43C9B 2VWEE 4LSDA 1NEUA 5EULV 4XI5D 3WO3B 4PJ5E 3RTQB 5D2NB 5TH2A 1AR1C 2Z8VC 4G9FD 3QYCA 1FAKT 1M7IA 1MCOL 2UWEE 2AI0H 1DN0A 1P5VA 5FO8A 5FK9B 4RZCA 3MA7B 1DVFC 3L3GA 5CMAB 3O2WL 4HKJA 2AJUH 5HDOA 3D3VA 4YIQB 4G7VH 5E4EB 4DZ8B 3AU1B 5DGRA 2UUDH 1T83C 1B0RB 4GXVL 5DD0L 3MYJB 2F54A 3DVGB 1BIIA 2X4NB 3DTXA 3QNXA 1A14L 3VXPA 3HI1A 4KHTH 2V2TA 2F8XC 3FQRA 3NPSB 1NMCC 2NY3C 3VRJB 4ONHA 4WI2A 5FHAL 4N1HB 1UZ6E 2QQKL 4MGXA 1Q9LA 2A9NH 1UG9A 3QP3A 3TJHC 1HXYA 3MCKB 4E41B 3MRDB 2WIMA 4LSRH 1NGQH 4A6YA 3V0WL 3TNMA 1ZS8A 2ATKA 4CDGC 3F5WA 2WBJD 1EAPB 5CS7A 2VERN 3UBXB 4GAJH 5A3IC 4TSCH 5ESAA 1MRFH 1JUFB 3JV4A 4NQVA 3RJQB 1WBXA 5HVGB 3TGXA 1IAOA 3UMTA 1AHWB 4BZ2L 1U3ZA 1ZT1A 4N0RA 3RWHB 1P1ZB 2G5BA 3IJHA 3MACL 4X80H 4EUPG 5HVFB 5I8OL 2DM2A 1EUTA 2GJZB 3BEVA 1QFWM 1SEQL 4LF3B 4QHNB 1A9BA 3EGSB 3LRHA 3QSKB 2O26U 1UJ3A 1TTUA 4YQXL 2OJEA 1BREA 5FKAB 3ME0A 3L95A 4JG0L 4MXVF 3A67L 3IJSA 3MOAL 1AD0A 1OAKL 4XPBH 4U1MB 3I50H 2KQNA 1QSZA 5DJYB 5DEFA 2FBJL 3S37H 3U46A 1FH5L 2I25N 2L4OA 5MI0B 1KFAL 4TNVF 1KIUA 4MX7B 2GT9B 2NXZD 3RPKA 3DMMD 4X9HA 5IBUB 4CVXB 2AI0L 3DSNA 4U6YA 1E4WH 3MGAA 3HFMH 2XZAH 3AAZA 3TA3B 1I3VA 2AJUL 2FGZA 1DCLA 5C0IB 2GCYA 3LB6D 2DLIA 4G7VL 3VFRA 2LU3A 1KN2H 4F9PC 4QY8B 3G6JF 1YEDA 1ZGLP 4Y4FD 3C09C 4GKZA 3WS3B 4KHTL 3REWB 2B7DT 3HUJA 3BEWA 2R2BB 3C5ZB 5DA4A 5D7LA 3HAEB 1NDMA 2LVEA 5ID1B 3ULUC 3FFCB 5DGQA 3HKFA 3IFPA 1BFOA 3IYLW 1I1AC 5DHVB 4OLYH 5C0NC 3K8LA 1CQKA 3QI9D 1FZJA 4LSRL 4PY7A 4K7PH 4LVNC 3VFTB 2YPKA 2R2EB 4POZD 3PWVB 3PXHA 1HHJA 4Z7WE 1SJHA 1A1NB 5EOQL 2Q7YB 4GAJL 3D39A 3ZT7A 4F37K 1BHGA 1WWCA 5JW4R 5HHVH 3MO1B 4TSCL 1MCSA 1MRFL 3KLSA 2WIIB 3AREA 1MHCA 4K94C 4JB9H 4GBXD 3BT2H 4EOWH 3UXFA 2UWEF 2AEPH 3OMZA 2R1YB 4JM2C 4DVRH 1QVOB 4X80L 3HC0B 1OP3K 1KTDB 2NY7L 2X42A 2P44B 4IRSA 1X4ZA 3IDMA 4W4OC 4LCWA 2QHRH 5IF0A 3IGAA 5SX4I 2FZ3A 4RA3A 4UI2A 2H32B 3ZT5A 4XPBL 3ZTJH 3U82B 3QUZA 1DUYA 1YA5A 3I50L 4PGZA 5L2KB 3S37L 5I0DA 3VXSD 5A1AA 5J7CC 2E9JA 2OQJB 4CKVX 4NQDA 3GBMH 1HKFA 4UU9B 5D2NE 3SDAD 3MCG1 5CD3A 5DUMH 1A1MB 5CJQH 3FCTB 1ZE3C 2V5YA 4TN9A 4G5ZH 1F4XH 3P9WB 5ICYA 1T22A 2O5XH 2Q3AA 4TRPH 4JR9L 5K9QI 1Q9KA 3INUH 3HFML 1F45A 2J8OA 2XZAL 5E1HB 1F90H 1X5YA 1UWEH 3WJJA 1VKXB 4P2CG 2LTQB 4KZEH 3BRGC 1KN2L 5DVKA 2H8PB 4X9IA 3REVA 5CZXD 1GZPB 2C1OB 5GHWH 1YEEH 2BSSA 2ZCLH 1FG2B 4TUJA 2OCFD 5FA4A 4JDZB 1T1ZB 3DO3A 1LO3H 3X14B 2NR6C 4H1LH 4NIKB 3FO9B 3PHSA 3IU3B 3WL9A 1FYHB 3DECA 4E41E 4HLZG 4OLYL 4L5FH 5DC4B 5T1LD 4LPYA 2CDGA 5ICXA 2P8LB 4AENA 5HHMB 4XVSH 3MUY1 4P2RA 1FJ1B 1T20B 3RDTA 3IETA 4BSVB 3DX6B 1M05A 3OAZK 2FRGP 4LKXB 4BUGA 1HOCA 2P8MA 2P42B 1X5ZA 4APQB 4JB9L 1WBZB 1DJSA 3BT2L 3QDMA 5D5MB 4EOWL 1S3KL 3GSOB 4NBXB 4NRZA 4NHCH 3BZEA 4KRPB 3O41A 1JPST 4KGJA 4YHNB 1I9IH 3KJ4C 3OKLA 4RWHA 2GY5A 1JN6B 2NLJA 4PRDA 4P0DA 1C12A 4AIOA 1ZOXA 3CMOL 3B3IB 1GXEA 3FQXA 2QHRL 5DF0A 3P4LA 5EBMA 2J6EL 1QA9A 4G6FB 1PG7X 1A6TA 2Z92A 1CFTA 2VE6B 5CIPH 3P9LB 4JFDB 3KPMA 3TBWB 2C4XA 4R2GC 1N6VA 2FECL 4HUUB 1Q94B 4JANB 3GBML 3TH4T 2VXUH 4P23A 3EZ8A 5DUML 5CJQL 1UKSA 4G5ZL 5D72H 1F4XL 4XCYA 4ZD3H 2C4FT 1S9VA 1NPUA 3INUL 5DHYA 4H25A 1IVLA 1K4DA 5C0CD 4FTVB 1F90L 4XNYH 3VXQA 4MNHA 2NTSP 1UWEL 4MHHG 4KZEL 3UBXG 3PP3K 4K55A 1YEEL 4MJ6B 2ZCLL 2E8ZA 4WJ5A 4DKAA 3CCHB 3EUUA 5FFLA 3H2WA 1C08A 1J87A 1MCIA 1LO3L 1UXWB 1MCCA 5GGRY 5DFVC 1C16A 3MREB 3VGAB 3FFCE 1U8KB 1JPFA 1VSCA 2MQCA 4GRWF 5DTFA 2CLRB 4U6TA 2L7UA 3OJ2C 4CU7A 1AXIB 4YEFA 1ZV5A 1BP3B 2VDPL 4WU5B 1J10A 1P7QD 2CUIA 2HKFH 4K7PX 3O6MH 4XVSL 3HNTH 1AGBB 1F3JA 3QDHA 4QRRA 5FXCH 1GGIH 1DQDH 2BVQA 3RWJA 2UYLA 3BN3B 3CMGA 3V4UH 4XNQA 1YNKL 4OCNC 1I7UB 4NHCL 4DCQB 3IFLH 5FDYA 5IBUG 2Y7QB 1I9IL 2LVCA 1T7XA 3MLUH 4RMVA 3X12A 5C2UB 3MRKB 1LNUA 5MP6L 3CC5B 4YGVA 4Q97A 1XGPB 5L2KE 3RFZC 5T1MB 4MJIB 1Q38A 3U9UA 3LV3A 5FUOH 2LQRA 5IEHA 4MAYC 5B8CC 3K3QA 4J8RB 2XZZA 3FT3A 3TBYB 1OGAA 2AQ1A 2VXUL 1X5AA 1CG9A 3D5OF 3HAEG 2IAMC 5GQBA 5EWIH 2J8UA 3DUUA 5D72L 2FX8H 4ZD3L 4BQ8A 3B4NA 3MLTB 4EI5A 1VEPA 4M03A 4KROC 5J11C 4N8VA 1IM9B 4XNYL 1F6AA 5DJ6A 4ETYA 1EO5A 4P4KD 2VNCA 1JGUH 3SCMB 3F6LA 3MV8B 4MD5A 2KL6A 3GMLA 2PNDA 4J3OC 1IJ9A 5CSZA 3IAQA 2XA3A 3WKNA 1I3RB 2RFXA 1EEQA 1H15B 3EKCA 3HZVB 1MSPA 2CR3A 2FHFA 4NRYB 1J1PH 2Z93A 4JLRB 3RWCA 4MXQD 4S1QL 3GJFK 1AR1D 1U8OA 5CHNB 1WUNT 3LKPB 4XHQA 5GGSA 1U93A 3VGHA 4Z5RB 4O9HH 3QO0A 4O2EB 5BOPA 1L7TH 1NMBH 5HHME 5D7SH 4QGYA 5JOPE 3JTSA 4WWKB 5ITFB 1NBQA 3O6ML 3OKMB 1YN6B 4XH2B 4LPWA 4BYHA 4F7PA 1OB1A 4Y2DB 4X6EB 3WFBH 4M8QB 1GGIL 2ZUQC 5I1KH 4LBEB 1VADB 1DQDL 1QQDA 1XGUA 3R0MA 4MNQB 1LK2B 1NGPH 4PJXF 4WTZG 3V4UL 3X11A 1QRKA 4FRWA 3L3KB 1DN2A 2NY3D 1ONQA 3B9KB 2GQHA 3F7YA 3BP6B 5IW1A 3RGHA 1KPUA 5J13C 4MWFB 1N0XH 3ZDXE 4OZIE 3MLUL 4PRBB 4C55A 3C8KA 1Q1JH 1W72B 3LY6A 3BP4B 4AIZA 4JFDE 5IWLC 4KK6C 5FUOL 4UTAL 4KJYA 1AJ7L 2NXYB 4PRAA 5A3ID 4U1SA 3PL6B 3ARPA 4XZUB 1RJCA 4A6YH 1JI2A 3S6CA 4YBHA 3C5JB 4OCLC 3DVNA 1EO7A 4G9FB 1H3TA 4ZFFA 2QSTA 5C08B 1UH3A 3MRIB 1EFQA 3EYUH 5EWIL 1BWWA 2FX8L 4OLUH 1LD9A 4JO4H 3V7AE 1CDIA 5FM4A 1JZ4A 2CKBA 2A38A 4FTVE 3NA4A 1MIMH 1HK6A 3HZMB 3OKNA 4NJ9L 4HIHA 4Z76B 5JXEA 1QBAA 1JGUL 2OSLA 4BKLB 2E27H 1MCRA 3CSGA 1NLDH 4L3EA 1HILB 2WW8A 1GGBH 1A7RH 1K2DB 4JPIB 1U41A 5CEZH 2VABB 1PKQB 4GG6B 4R26H 4R7DA 4WW1B 5C71A 1CVRA 1JIBA 1J1PL 3PWLB 4JN2B 3VGBA 2YUXA 1B3JA 1J0HA 1TQCB 1XMWA 4NQCB 1CD9B 3GEWB 4XRCB 4F15C 5HDQH 1K4CA 1V3MA 2B39A 4G8IA 4P99A 4O9HL 2ARJQ 1NMBL 1TQBC 5BZWB 2WBJB 5D7SL 3KYKL 4RQQA 4ZUTA 2ATPA 1Q72H 2B5IB 2G9HA 3G6JA 3JWOH 3GMPA 1NGWA 4QRSB 3WFBL 2W0LA 4JRXA 2WINB 5I1KL 3D9AH 5BV7L 3DYOA 3UYOD 2ZSVA 4ZNEA 2HG5A 1NGPL 2Y5TA 1G7JA 1FZKB 1RPQA 4QTHB 1CGWA 1IEHA 4U1HB 1N0XL 4O02H 4WI5A 1NFDA 3SJVA 4DGYH 5K9JH 4ERSH 3V7AG 1J9CT 1Q1JL 1FNGA 3O8XC 2HJKA 1MCDA 3B43A 3NCBB 1F5WA 5I15H 1JFQH 3GKWH 3GSUA 1MCPH 1FVCA 4Y16B 4X5WA 5JIHA 4EUPA 5IVXB 4A6YL 4JZJC 3DMMB 2UWEA 2QSVA 3FTGB 3HN3A 4X9BA 4F9LA 3Q6FB 3FB5A 3RVWC 4OLUL 3ARGA 5ERWB 2QQNH 5LGJA 1KJ2A 2OR7A 4PD4K 4U6HA 3GM8A 3GSWB 3QUXD 4QF1A 4CJ1A 3QULA 1LE9B 3O6FB 1YN7A 4Y4FB 5HGHB 5D5MF 2VDRH 2D9CA 5DRNA 3T3PF 2E27L 5D6CB 4JHAH 2EZ0C 3I3BA 3F6IA 1NLDL 1U8HB 1F02I 1GGBL 1CTNA 5CEZL 1U8JA 1I7TB 4R26L 5GRXG 2W9DH 3HC3H 1QLFA 4J3UA 3RWEA 5DQJB 3VCLA 3QI9B 1R3IL 4LIQH 1WQVT 1KLUA 5HDQL 2KZWA 3S9DB 1EAJA 1QSFD 1YQ2A 1Q72L 4JO3H 3ULVD 4R96B 3RRQA 1KG0A 3JWOL 3O3BA 1I1YA 1SEBB 2VIRB 4FZEL 1CICB 4MNQE 4RSVA 2XZQH 1J5OH 4PJCB 4GBXB 3D9AL 1IBGH 4TULH 5GRJH 3SQOH 1AO7D 4FQ2L 2NR6D 3P30H 2EDFA 3BKJL 5A2LH 4WHTB 5TDOB 2EE6A 4DVBA 4JKKA 4O02L 4DGYL 5I71B 3ARXA 2CXGA 5JQ6H 1BJ1H 3QFDB 3S3JA 4FQPA 1GVIA 4WIQA 2VKWA 4X4ZA 3BUTA 4UT9H 1JHTA 2X4PA 5I15L 1VCAA 1JFQL 2NTFB 3M17A 3QEGL 3QRGH 4WTWA 3VXSB 3SKOB 1F6FB 3GKWL 3MV7A 1MCPL 3FOMB 4HS8H 2D2OA 3BP7A 1G7HB 4G9FE 1WTGT 1EFXA 3SDAB 5C08E 3VXMD 5SX5H 4K71B 2Z31C 1INQB 4DKEH 5GGQH 1G9MH 1AGCA 4X83A 1VB9A 2CRZA 4X9FA 2QQNL 3UROR 5FUCC 2YXFA 3ZKNC 4JZOB 4U1IB 4O00A 4I0PC 3KLHC 3GMRA 4YNYB 1G7MA 3UJJH 3ESVF 2VDRL 3VMPA 2JE8A 2D31B 4L4TB 4LLDB 1CXFA 3HTLX 4JHAL 2NY1C 1BZQK 1PKQE 3C5SB 4R2GD 4GG6E 2WWKT 5H94A 4ZAKA 5FGRA 4E0RB 1PG7W 4WV1B 2W9DL 3HC3L 3VD7A 3G5ZA 4NQCE 5DJDB 5T1LB 4LIQL 1A3LL 4L8SC 1E27B 2X4RA 2ICEA 2XTJC 4X7TB 4Z7WA 2APVA 2IG2H 3OPZH 4L4JA 5FAAA 3UTTA 5IFJB 2BMKB 2XQYK 5LQBH 4JO3L 2HN7B 5IB5A 1CL7L 3MV9D 2B1HH 2PW1A 3P73B 4IIQC 4PJ8C 4FABH 2XZQL 1J5OL 4JJHA 1IBGL 4ZUUA 4CL7A 4TULL 4FHBD 5GRJL 3SQOL 3C60C 2BOCB 2XKNA 3P30L 4I0KA 5JW3L 2E9BA 5T3ZE 2FHCA 5SX4H 2VL5A 1HEZB 2GK0A 3MRBA 5B38B 1NAMA 4KK5D 4RAVB 5DMYA 3ROLA 5JW5B 1L9MA 1XF1A 1F97A 1QD0A 3QWOB 5BV7C 4UT9L 43C9A 1INDH 4ZFGL 3OG6B 4QXWA 5K93A 3RTQA 4PV8A 5IVXE 4F58H 4HS8L 1OCWH 1JL8A 1JI1A 3MA7A 4XPGH 4KPHH 5L7XH 5FGBA 3R0NA 3W81A 4X98A 4DKEL 2WV3A 5GGQL 1G9ML 4YIQA 4DZ8A 3AU1A 5I9QB 1B0RA 1KB5A 3LCYA 3VI4F 5C0CB 4HIEB 3QFJD 2O93L 3MYJA 1UGNA 3WJLC 1S7WB 3UTSD 3DVGA 2RCSH 2VQTA 2X4NA 4LU5H 4Y4HC 1A4KB 3D0VA 2CO6B 4O2CB 1OLZA 3RKDC 4UAOB 2BVTA 1SBSH 2ADIB 4YBQC 5DK0B 3VRJA 3UJJL 1MFEH 2ADGB 1UKQA 2EC9T 2X1PA 2VSCA 1OTSC 5C0JB 3T0WA 2R29L 4EZMA 4E41A 3MRDA 1EEYB 2DQHH 5E99H 4P5MB 4U1KA 5MENB 5DO2C 2HFTA 2DMCA 4XCEA 1I3GH 4E5XB 5ISZB 2CDEB 3BQUA 2ZCHH 5D1QD 3BD4A 1L4IA 1MQ8A 3E8UL 1P7QB 2DWEB 1MELA 3DLQR 3H6JA 4IRJC 2VC2H 2IBZX 4TUKH 5F9OH 1JUFA 4KROD 2IG2L 3HZKA 2YPVH 4OJFH 3SDXB 1AHWA 5LQBL 3QEHA 5E5MB 3RWHA 4F33B 4KU1A 4PJCE 2B1HL 1ZK9A 4FS0A 3P0VH 4FABL 1P1ZA 3MJ8B 2W1NA 2GJZA 4CMHB 1T5XB 4G80B 4WEUD 4ZFOB 4LF3A 4QHNA 1G9EA 4RBPH 3EGSA 4HG4J 1PLGH 3ARFC 3PJSB 5FKAA 1A4JB 4U1MA 1FV1B 3LHPH 5DJYA 2BSRB 1H9VA 4N9GB 2WUBH 3VXSE 1E6OL 4XP6H 1MHPH 1JGEB 1INDL 4MX7A 2GT9A 3RP1A 4F58L 2GI7A 3PHOB 1EBAA 2G5RA 1QFHA 4PJXA 4CVXA 3OHXB 4HMEA 1OCWL 5HYSB 2J1KA 4XPGL 4KPHL 5L7XL 3ARDC 3WHE1 2GIYA 1C5CH 5JDSB 2WWMC 3TA3A 3MNWB 1ZHBB 2DLHA 1QPPA 4QY8A 2APFA 3VE0B 1XF2B 4C54A 4P4KB 2RCSL 4LU5L 3WS3A 5J06A 1JK8B 3REWA 5EBGA 1SBSL 1TZHB 4L4TE 3SO3C 2OR9L 2R2BA 4B50A 3C5ZA 1Y6KR 4JFED 1CF8H 2A2QT 2VQ1B 3AS2A 3HAEA 5ID1A 1YZZA 2XYCA 2IPKA 2ZOLA 5DHVA 2AAVA 4XMLH 2Q8BH 1TJHH 3UAJC 3TBSB 2VO5A 2BSED 5AZ2H 1P5UA 2EDHA 3VFTA 1MRCL 1CDUA 2R2EA 3OGCB 5SWZA 4BFIB 3PWVA 2QADB 1WWWX 2ZCHL 3QNZA 5KVEH 4WCYH 4EXPX 1BIHA 3SY0A 2Q7NA 2Y25A 2X4OB 3C6LC 5FF6A 4U3CA 2VC2L 3MO1A 5F9OL 5DVOA 4IRSC 2WIIA 4NO0D 2B2XL 4OJFL 1NGXB 5CP7B 4OFYD 5D7JA 4J1UB 4UILH 1ZTXH 1KPVA 1QZ1A 2R1YA 1BJ8A 2I9LA 4HFUH 3P0VL 1DBMH 1QVOA 3DVIA 3BUYB 3HC0A 1KTDA 2CKBH 4HV8B 3MMEB 3QXVA 5FOBB 1NL0H 1PLGL 3B2VH 5TQ0H 3MRPB 4M02A 3DBXA 5F97E 2H32A 1I7RB 2CIKB 3O11B 5IJKA 1WSST 4KMQA 3LHPL 3R4DA 1KT2B 5CSGA 1FNHA 1T66C 3MRMB 1DR9A 3DROB 1U92B 3ZO0A 5IG7B 3AS0A 4NT6B 2WUBL 4RRPG 4XP6L 1HYRC 2C7UB 1IC4H 4WTZA 2Y6SC 1KGCD 3WEXB 3TN0B 3QQ9C 5CGYD 1A1MA 3FCTA 1ZLSH 1A5FH 3DWTA 4YHZH 3WFZA 2BOBB 2FJGB 2ZNWA 1RZ8A 5HBBA 3AVEA 2CIIB 4OIAA 4OGZA 1QFWI 3QCUH 1C5CL 1R5WB 4UT7H 4F57L 2H1PH 3EYQD 1RHHA 3U36B 1IQDB 4XP4L 5C0CE 1VKXA 1WZLA 1JMZA 4NSKA 3S98A 2H8PA 2E7CA 2VZOA 4KZDH 1FPTH 1GZPA 2C1OA 5J0BA 1IZKA 1FIGH 1Z5LA 3ARZA 1JNLL 3O8XD 3A0OA 2DQDH 1T1ZA 4PJCF 2AGJH 2P8PB 3ZHKA 3X14A 1DLFL 3C9NA 3MSPA 2J88H 3NFSL 3WO4C 3IU3A 3QQNA 4FFZL 1CF8L 4HPYL 4PJFF 3GSRB 4NZJA 2VLKE 4JCLA 1G9MC 5MHSE 2ORBH 2IC2A 3V5KB 5MENE 4D0BB 2WBWB 1TJHL 5ISZE 3BD5A 2XQBH 4FOMA 3MRJB 5AZ2L 3CX2A 1T0MB 2EDWA 3WNOA 4Q9CA 4OI7A 4PGDA 2P8LA 2YA2A 3GB7B 1ZLUK 4JY6B 5KVEL 1YDPA 4WCYL 5B38G 1T20A 4BSVA 1WF5A 3DX6A 2DM3A 4EUPH 3QXWA 1R3KA 3SDXE 1W8OA 4LKXA 4BQCA 5IROA 5HY9B 4APQA 2ZUUA 4EJ1C 1WBZA 3VDAA 5IESH 5D5MA 3GSOA 1ZTXL 4UILL 3ZHDA 1S7VB 4MQTB 4YDKL 4HFUL 2GTWB 3WNLA 1DBML 3DJ9A 2CKBL 2EZ0D 4UINL 1JN6A 4LSPH 5F96H 1KJ2H 4TVSa 5EBLA 3HI5H 3B3IA 1PDKA 1A7BA 1NL0L 3B2VL 5TQ0L 1OAYH 2ZUTA 1QFOA 3LKSB 5FM5O 1GOFA 1MY5A 2X4TB 4WVRA 2VE6A 5HGBB 3P9LA 1JGLH 3LMJH 2AJVH 4JFDA 4LVNB 4QXGH 1TETL 1OL0A 3QJHB 5IB2A 4HUUA 1Q94A 1IC4L 1S78D 3VG0H 2VN4A 4XPFH 3EJYC 4QOKD 1ZLSL 1A5FL 1AD9B 1EZVX 4YHZL 1YC8A 1X5LA 3ARBA 2E9IA 4XAKD 4BFBD 2OL3B 4JHBA 3KHQA 3MRCA 4Z8FH 4RMWA 1HH6B 3QCUL 4I1NB 2H1PL 2YD9A 4FTVA 3HI6H 2F19H 3GK8L 2R69H 1F3DJ 3QO1A 1HQRA 4JEGB 1F2XK 5MEOB 1UH4A 1O0VA 1H3UA 1H5BA 2MWCA 4KZDL 1FPTL 1ZHLA 3QUXB 4MJ6A 4QO1A 3CCHA 1JZ7A 3QNYB 4ODXA 2L0DA 1MLCB 2DQDL 2AGJL 4J3XA 4ODVH 2ICES 2V5MA 4GAGH 4WUUD 5AUMB 2R8SH 1DBKH 3MREA 1U8KA 3V6BR 4PJ7B 2CLRA 4QHMB 4YXKL 3GDBA 3A6OA 5GGTA 2ORBL 1R0AH 2G60H 1WK0A 1Q0YH 2XQBL 3NFPB 4A2LA 3L3DB 5HI4D 3FT2B 4PRID 4YK4B 4LLUB 4Y5XB 2FJFB 4OGXH 5HJ3B 4PRHB 5BMFH 4NDMB 1HIMH 4F7EA 3MC0A 1QSFB 4X7DC 1BVZA 3ZKND 4NZUH 8FABB 1KLGA 1OSPH 4PG9B 3TV3H 3KLHD 3O6LH 1I7UA 1ROWA 4DCQA 3DIFB 3PQYE 4C56D 2Y7QA 1AO7B 5HYSG 2NY1D 5F96L 1KJ2L 3MRKA 4M9PA 3HI5L 3CC5A 4UTBH 1O7SA 5IMLA 1UVQB 1XGPA 3WHE0 4AH2B 5T1MA 4MJIA 5DDHB 2Y07L 4G43B 5DRWB 1JGLL 3LMJL 4QXGL 3S36H 4YWGH 1BF8A 4U7SA 2FSEB 1IGCH 4J8RA 2QSCH 3SDDD 2X89D 3TBYA 4OCXH 3HS0B 1UYWH 3VG0L 3VWKD 3FHQA 4XPFL 2A74B 2NYYD 2VAAB 3JV5A 4PJ8D 3TT1H 3VXMB 4Z8FL 3KPRD 2SEBB 1OWRM 5GJSL 3QG7H 3UDWA 3C60D 5FCUH 3HI6L 1JYXA 2F19L 1R3LB 2EDJA 2R69L 5HYJD 1Q9OB 4RGNE 5GGRB 5SWSA 4NCC2 4M43H 3MV8A 2YD2A 2GW5A 1YNTB 3G04B 5FHBH 4HLZH 1XZ0B 1IL1A 1DBJH 5GGVH 3MZTA 4ODVL 7CGTA 5KVFH 2R8SL 1DBKL 4OTXL 4QHUB 4NRYA 2BZDA 5KANI 1YMMD 1GSMA 2ZG3A 1NAMH 1S7TB 3TO2B 1R0AL 5CHNA 3VFUB 2G60L 5D93C 3LKPA 4KRLB 1Q0YL 1G7PB 4YBLC 4O2EA 1TDQA 1DZBA 4LCYA 4ODWB 1TZIA 4WWKA 1KEMH 5ITFA 1PBYA 1YN6A 4XH2A 4OGXL 2IWGA 1J0IA 1HIML 2FDBP 2NW3B 4M8QA 4X6EA 4Y8AA 5L0QC 5MEQA 9CGTA 4LBEA 1VADA 2DJ4A 4NZUL 4Y4HD 3T8XB 1LK2A 4MMXC 3TV3L 3B9KA 3O6LL 1CXHA 1U95A 3IJYA 3BP6A 1KB5H 2EDEA 3KPOB 4I5BB 3TIDB 1OTSD 1OAUH 3QPQC 2I9TA 4PRBA 4DKDC 4HZLB 5EUOB 2NW2B 4QXUH 1A9EB 4UTBL 3OKDB 4MDIA 1W72A 2IADB 3BP4A 4PJEB 2JLLA 3RUGF 1RU9H 1U3JA 5F8RC 5C0FB 4KC3B 5EN2B 4YWGL 1IGCL 1YJDH 4XZUA 2QSCL 3G5YA 1KCSH 4OCXL 1S9XB 4EVNB 1UYWL 4G9FA 3T2OA 2FH8A 3NCMA 5C0GB 2FJHB 5JXEC 3Q5OA 3U2SB 5E8PB 1P7HL 1C8PA 3O9WD 5JNYA 2ENSA 2F9BT 2Z8SA 3QG7L 3O81A 3HZMA 1E28B 3ARFD 5FCUL 1CLOH 3QFJB 2VDLH 1OQXA 4M43L 3UTSB 2B4CH 2CRMA 2FIKB 4H20H 5HHQA 1WZ1H 1RZJH 1G6RL 5FHBL 3ILQC 4WTXA 1DBJL 2NY6C 5GGVL 1HILA 5KVFL 4PJ7E 4JPIA 3CXDH 4MMZC 2VABA 4GG6A 4O2FA 4WW1A 3PWLA 3QDGA 4G3YH 1CS6A 2YEZB 1NAML 3HG1D 1MI5D 4XRCA 1IGJB 3ARDD 5D1QB 4B41A 2WBJA 4DUWA 5JOFB 3OAYH 4PRHE 1KEML 5IKCB 1QSFE 1HZHH 1UA6H 4KROB 3ULVE 2DLFH 5L2JB 4W4NA 2WINA 5E9DD 4N0UB 2DD8H 1KJ3H 2VLJD 1FZKA 2Z91B 4QTHA 3ZYJA 3KYMB 1AO7E 4GXUN 2ITCB 1CT8B 4JPWH 3LKNB 4U1HA 3WMSA 2IQAB 3GJEB 1BFVL 1OAUL 1VENA 5GIRB 3VXUD 3T1WA 2VWEC 2V9TA 4LSVH 4DN4H 3UAJD 4QXUL 2NNAA 3D85D 5IB1B 3FOLB 1RU9L 3HAEH 4ZPTB 2IH1B 3QWRD 5DHVH 3P2TA 1P7KA 3C6LD 1YJDL 5IVXA 1KCSL 1X9QA 3S36X 3DMMA 5A2IH 3FTGA 4XXCA 3VXME 5E2TH 4G8FB 5LAXA 3BKCL 4M1DH 3DI2B 5JPMB 4HF5H 4GLRI 5ERWA 3WFHB 3OGOE 1D6EA 2C9AA 1UWXH 3V0VB 2E6PA 1T7WA 5J13B 3GSWA 5ADPH 4KV5E 4JDVB 2VDLL 4KQ3H 2B4CL 4Y4FA 4H20L 1CBVH 1V3JA 3F65A 1SVCP 4XPTH 1EHLH 1WZ1L 1RZJL 4NGHH 5D6CA 1T66D 4J6RH 1DQQB 2ADJA 4HPOH 3LN5B 2VSDA 4K2UH 1U8HA 4JFEB 3CXDL 5M7QA 3T0DA 1HNFA 2H32H 3QQ9D 3ULUF 4ZO9A 1A21A 1GGTA 1MCFA 1TLKA 1XAUA 4GQ9H 1MCKA 1G7LB 5DQJA 3QI9A 1KJVA 3ARWA 1T7VA 3HMWL 3QHZH 2XTLA 3BWAA 5CJBA 2HAZA 4U1GB 2FBOJ 4QRPD 3RJDA 4XNZC 2PUQT 4XVJH 4L9LA 4R96A 1J05B 1FFQA 1SEBA 3T2NH 1HZHL 1UA6L 4ZOEA 1YEIH 2DLFL 1MOEA 4NO0B 4LSTH 1Z6JT 2V7NB 4JQIH 2M2DA 5DXWA 4PJCA 1D6VH 4GBXA 1A02N 2DD8L 2WP3O 3CX5K 1KJ3L 1N26A 3LRGA 4WUKH 4LDLB 4OZ4B 1JMXA 1U8PA 3P0YH 2Q87A 2C3WA 1W0WB 2NY0C 4JPWL 4U4BA 4WHTA 5TDOA 1QRNE 4WU7A 5EUOE 4EBQH 2N7AA 1FDLH 1OF2B 4L8CB 4JDTH 4POUB 2DQJH 4LSVL 4DN4L 4PJAB 4PJEE 1OAXL 1LE5B 3QFDA 3ABZA 5EU7E 3WLBB 4UT6H 5I18H 3VXSA 4F15B 3SKOA 5KVMC 5DD1L 1HYSD 2R0KH 4W6WB 1JHLL 1G7HA 4NO5B 5INCA 3SDAA 1A6AA 1L0XA 2YD5A 1CE1H 3KHOA 3NACL 4M6OH 4HUMB 5GS2H 1ES0B 3OQ3B 5GGUB 4I13B 5KOMC 5E2TL 3GNMH 1Y18B 4LNVA 1B4JH 2GITB 5F7MC 4M1DL 1CTOA 1SJEB 5ALBH 4HF5L 3TZVD 4FQHB 2DKMA 1TZGH 3HR5B 2BC4B 3UO1L 2W60A 1ZLVH 3QFJE 3R8BB 1A7NL 3CDGA 5ADPL 3UTZB 4LGRB 4RRPA 4G9DB 4K7PY 4CRPA 4KQ3L 1UM6H 4X8JB 4YNYA 1CBVL 5D2LB 3D18A 4KUCD 2D31A 1EHLL 4LLDA 2VLLB 1JWMB 2HTLD 3C5SA 5CGTA 4K2UL 5L6YH 2CRIA 1BD2D 4LHQB 2WSKA 4NZDA 4XAWH 4P2QD 4WV1A 5FYLD 3ZDYF 3VH8B 3C6SA 5DJDA 3CFJB 4LCCA 5T1LA 3MRRB 5T3XH 2D7MA 1E27A 4CUCA 3QHZL 1XR9B 2ZOKB 1TENA 3QIWD 3U9PL 5JPNB 5F1NB 5DJ2B 3RHWK 1FBIH 3B2UC 3ZKMC 1BOGB 2NY4D 5IFJA 2BMKA 1GGUA 4XVJL 2OMBA 1H3PH 2E7LA 4LKCB 5JA8B 1WWBX 4N0UE 5FYKH 3P73A 3JTTA 4LSTL 1H3XA 5D7IB 4P3WA 1D6VL 2X40A 5DMJB 3O4OC 4WUKL 2EIZA 2BOCA 2DKSA 4KVCH 1T5WA 2WQRA 2K7PA 4Q6IC 5I73C 4AMKH 4P2YA 4Z7UB 3VFVA 1Q8MA 2DQUH 1HEZA 4EBQL 1FDLL 5T5NF 3RTQC 4PREB 4JDTL 5D2NC 1LK3H 5B38A 1KEGH 4RAVA 4O51B 5GRYA 3BRDA 5JW5A 5F72S 3BOVA 3PDDA 4NC1E 4HKXB 3QWOA 3Q5YA 5I2IA 4UT6L 5I18L 1WIUA 3IF1B 1CDCA 1BGXH 5GGTH 3HE7B 2R0KL 4B0MM 2JJVA 1CXLA 4QOKB 1A6WH 1CE1L 4M6OL 4M7JL 2AK1H 5KSUB 2HT2C 3RVXC 4X7EC 5EZOH 1JNJA 3GNML 3Q6GH 5F1SA 1MPAH 4P9MH 5ALBL 5C0CA 1TZGL 4HIEA 2Y36H 5IT2H 1S7WA 4FQXD 4M1GH 1A4KA 3VDCA 5CCKH 1R24B 3IRPX 1YJDC 4ZS6C 2ADIA 5I1GH 3VI3F 5DK0A 3GIVB 2ICWI 1UM6L 1VFMA 2P7TB 2MHAB 1X5GA 4KK9D 2ADGA 3VGFA 4JFEE 1BEYH 1DTUA 1NKRA 5C0JA 5I16B 2X4SA 3N85L 3BXNA 1RVFH 4G6KH 5L6YL 4OBRA 5FO9A 3TO4D 1EEYA 4P5MA 1RJZB 4JZNA 1T89A 2IAND 5EUOF 1QFUH 1WIOA 4XAWL 3ZTNH 3OR7B 2CDEA 1AHWC 3U0WH 2D0GA 4PJEF 3MGOB 2HFEB 2DQCH 3BW9B 1P7QA 2DWEA 4YX2H 3N1MC 4M7LH 3VXRD 5I1HH 1RZJC 3EDFA 3SE3A 1FBIL 1N3NB 5DMKB 3SDXA 3OJVC 1H3PL 5E5MA 4F33A 2COQA 3H9HB 5L9DH 1T5XA 4ZFOA 1FVDB 4KVCL 4C56B 4AMKL 5MI0C 1MH5A 4MA1B 2PW2B 2DQUL 4JFOB 4LVOB 5DEZA 1A4JA 2Z8RA 5GRVL 4PJAE 1FV1A 3EOTL 3RL1B 1LK3L 3AS1A 3DO7B 1KEGL 2HT3C 3SEPA 1OP9A 4EQ3A 2JJSA 3ZKXB 3MLPA 4DW2H 3QR2A 5I19L 1JGEA 3GJFB 4GQPH 3TA3C 4JFQB 5T33H 1KGCE 3SDDB 4M4RA 1BGXL 5GGTL 1OTUD 3EJZC 4X6CB 2EKSB 3VWKB 3KR3H 3OHXA 2AEQH 1A6WL 2AK1L 3MUGB 5JDSA 5EZOL 2CLZA 1ITBB 3MNWA 2HFFB 2DDQH 3C5ZC 3C60B 4P9ML 2QHLA 3GMQB 2VXQH 3Q1SH 4XCFH 3VE0A 3ZSTA 1XF2A 5SX5K 2Y36L 5IT2L 3IVKB 4P4KA 1P9MA 2RHEA 5HYJB 4IBLT 4M1GL 3KWWB 1JK8A 3MODH 5CCKL 3RUGA 4CADB 1OPGH 4PGEA 1UB6B 5D2LE 1TZHA 1JGDB 2L7JA 5I1GL 4QWWC 1YC7A 2RBLA 2F5AL 4FXKA 1GAFH 5CJ8A 4BJLA 1BEYL 1NBZB 4G6KL 4KXZI 4OUUB 4X7FC 3TVMD 2PCPA 4Y19D 3TBSA 1W72H 1YMMB 1QFUL 2KDGA 4Z0BL 3ZTNL 4JKLA 1S9WB 1A2YB 1VA9A 2CXKA 3U0WL 3EOYG 1ZKAA 2X1XR 4X4XB 1A7QH 1DVFA 2DQCL 3ARRA 4QT5A 4FQLH 3MX0A 1PEZA 4YX2L 3UPCA 2X4OA 4M7LL 5I1HL 1CR9H 2A1WH 1T83A 4X99B 5CP7A 4LGPB 4J1UA 1GGYA 5D7IE 4Y4HB 4Z7NE 4FN0A 5LBSH 5DI8A 3FZUC 4KTYA 3EFFB 5L9DL 4X7SH 4HV8A 3ILQD 2FX9H 1I8MB 3NZHH 1MCHA 4Z7UE 2DTMH 4OZGE 3I75B 4RMTA 3MRPA 1VFBB 3JVGC 4IS6B 1QHOA 1I7RA 2CIKA 3O11A 3ARQA 3VU2A 3RVVC 2MQ0A 1KT2A 2WUCH 4N9OB 4LFHD 3MRMA 3DROA 1U92A 4NKOB 5IG7A 4NT6A 2YWYA 4KQ4H 4OF0A 3FB8B 2C7UA 4FG6C 4DW2L 4PR5A 3WN5B 3OKKA 4HG4K 2HT4C 5T33L 2DS4A 2LTQC 4GKNB 4HHAB 4HK0B 4QOKE 2KH2B 2FJGA 4XAKE 3ISWA 1QKZH 2CIIA 3UYRH 4R0LC 4F3FB 1J7VR 1R5WA 1AQKH 3GKZA 1XGYH 3VH8G 2VDMH 3U36A 3O9WB 4QHKI 1IQDA 1NGYB 5HGAB 1S7QA 2DDQL 4JPKH 2OZ4L 3BDYH 2VXQL 4XCFL 1S8DB 3FT4B 5HPOA 1JWUB 1EERB 3ZE0F 3UTOA 1FIEA 4PJ5D 1LQSR 4ZTPH 3NOIA 3MODL 2P8PA 1OPGL 1FZOB 4ZXBD 5JR1H 2H2SD 4XCCH 1LGVA 1GAFL 2EIDA 3GSRA 3U6RA 5EIIB 3S96A 2P45B 4DUVA 3UEZA 1F3RB 1A3QA 3V5KA 4JKPH 4D0BA 2ZUVA 1UZ8A 4PBVC 1OT1A 1D5ZA 1W72L 5DQDH 3L3OB 1PAMA 3T65B 4N68A 3QDAA 5IROC 4DKFL 4APQC 3HG1B 3I2CH 1LWRA 3GB7A 3ARDB 1A7QL 4KRPC 4FQLL 4JN1L 1YMHB 2VDKL 3IDJB 1CR9L 2YZ1A 1JVKA 4HIIB 2A1WL 2BNUB 4ODBD 5HY9A 4F9PA 1RAMA 4XX1E 3LD8B 1X5KA 1M7XA 1P2CB 3VFSA 2YWZA 3WIFB 1S7VA 5E9DB 1F4YH 2AK4D 5A43C 3NN8B 4ONFH 2YR3A 5CJOH 3V95A 2VLJB 4KMLB 4C56E 4X7SL 1RD6A 1RZKH 2KKQA 5JIPA 5L8LB 5IOPB 3NZHL 4J3TA 2DTML 2HTKC 3LKSA 3K7UA 3VXUB 5BS0E 2X4TA 4TNWK 5E56A 3H9SD 3G5XB 3D85B 1L6ZA 5D2LF 4YFLF 3QJHA 4KQ4L 1MCBA 2H2PC 1N6UA 1PQZB 1KTKE 4Q9RH 2V9RA 3FB6A 1RIUH 2XKUA 4X6CE 2DTSA 1I8LC 4S0SD 5HHNB 3BRFA 4M48H 2OL3A 2NMSA 5GISH 1M7DB 2WM0A 3GMOB 1QKZL 4WGWB 5ENWB 3UYRL 1HH6A 1AQKL 4CN1A 1XGYL 2ED8A 2VDML 4S2SB 5D71H 1H8SA 4WW2C 4ONOA 2APWA 3VGAC 3O3DB 1KLFA 4FQQB 5FOJA 4JPKL 4W4OA 5HYJE 5IFHH 3QUXA 4C58B 4ZTPL 1BQUA 5AUMA 1RIHH 3BPOB 4XX1G 5JR1L 3DX7B 1NJ9B 3IXAB 4XCCL 4RDQG 5JW4Q 3QDJD 1E0OB 1ODAA 2DRUA 4JKPL 1O5DT 2J4WH 5J1SC 3NFPA 3LKQB 3OWEA 5DQDL 5EUKB 5CLWA 1WITA 5KSBB 3FT2A 3I2CL 4LLUA 2F53D 4NDMA 4QRPB 5IK3B 2XY1A 1QSFA 1GYAA 4LLAA 1AGFB 8FABA 1QSEB 2VL4A 2W9EH 1UEMA 2EC8A 4O4YH 1RIVL 2FO4A 2M26A 2X4QB 3JZ7A 4C4KT 1NGZB 1F4YL 4EIGB 4ONFL 3DIFA 4G6AC 5CJOL 1AO7A 1LP9B 4YDVB 2XN9B 1R6VA 4KVNL 1RZKL 3EDEA 3KJ6H 5F6IC 5IBTH 2IJ0C 4P48A 2R0LH 2GSIB 4NQSA 4AH2A 4ZUVB 3LQZB 3QISA 5DDHA 3T1FB 4MQXD 5DRWA 4G43A 1I1RA 4YFEA 3TH2T 4JFXB 2ILLA 2FSEA 1IGYB 3MQIA 1WBYA 3MNZB 3ZKMD 3HS0A 3UDWC 4Q9RL 1RIUL 3D2UB 4PTTB 4NO2B 3QG6B 4JFPA 3LSOB 2A74A 2VAAA 2E7MA 1I3UA 4OF8A 4LMQI 5EORH 5GISL 3SCMC 1XR8B 3HNSH 4MSWB 2EICA 3M1BA 4GLRH 4PJDB 3TIEA 4HEME 3CD4A 3TZVB 5D71L 2QL1A 1R3LA 1Q9OA 4WI8A 5GGRA 43CAB 1PGRB 3RGVC 1YNTA 3AB0C 1FFOB 2BVOB 2IBZY 4HZAA 2NPLX 5IFHL 5KS9B 4RDQF 2IEPA 5F71A 4NKIH 4HW6A 1RUQH 4FFVC 1K8IA 3L3HA 4ZO8A 1G0XA 4HK3J 1KBGH 2OTUA 1RIHL 1F00I 4QHUA 3GSQA 4R9HA 5E4IA 4V1DE 4NOBA 1BD2B 1I9EA 5C6TL 3VFUA 4P2QB 4Y2DC 2D4FA 3E3QE 1JWSB 1G7PA 1GCFA 4N5UA 1ETZB 1L7IH 2HT2D 5J8OA 4ODWA 4BQBA 2LABA 5F1IB 4LRNH 4ORZC 3QIWB 5KVDH 4R4NC 1MJJA 2NW3A 2NY4B 3NGBB 3BVNA 4X6CF 3T8XA 1XIWC 2W9EL 5E9DE 1SMAA 3MV9A 4NUGL 4O4YL 4P2OD 5I75B 5GPRA 2VLJE 4RNRA 5DD6B 1DUZB 2J2ZA 3TNNB 1JZ6A 2QQLH 3QA3B 3KPOA 3CFEB 4I5BA 4M6NH 3TIDA 1YY9D 1SYVB 3CXHJ 4M9OA 3KJ6L 5EUOA 5IBTL 2NXYC 5GS1B 2NW2A 3PL6C 1A9EA 3VXUE 4OKVB 5B3JF 3DX8B 3OKDA 4XI5C 2R0LL 2IADA 4PJEA 3MYZA 5D1XD 1P84K 4ONGH 2LE9A 4MAUH 3T0ED 3TYFA 5C0FA 3EO0B 5EN2A 5J3HD 4JRYD 2CRYA 1S9XA 2ITDB 4N8CH 2VXVH 4KY1L 1DQJB 5IQ9B 2FJHA 3U2SA 5E8PA 4KKBD 1Z9MA 4PJGF 1JTOA 5EORL 1EA9C 1REIA 5F8QC 5DJ0B 5L8KB 4PG2C 1NLBL 5B4MC 1NBVH 3QFJA 4RX4D 1AGEA 1XCTB 3CUPB 3UTSA 1VEMA 2VUYA 2FECI 4FQXB 2FIKA 5LKNA 4QRUB 3D48R 2EH7H 2HT3D 4P5TC 4NKIL 2FB4H 2BVYA 1RUQL 3WIIH 3CLEH 1ZLWK 1KBGL 1S9YA 4U3XA 5B8CA 4LLQA 3UTPD 3DV4B 2WBJC 2B5IC 1HHGB 2EC9U 3TO4B 4OUOA 3EJZD 3G6DH 2IANB 4TSAH 5KSBE 3VXTB 2IAMA 3MXWH 1IGJA 4UQ2B 2OTWB 5D1QA 5DZOA 1L7IL 4DUXA 5JOFA 4UV4H 4LLMA 1ZSDB 4LRNL 4AT6A 4QRPE 5IKCA 1BZ9B 3VXRB 5DEGA 1AY1L 3QIUD 5KVDL 1QSEE 2V2XB 5L2JA 2MQ3A 1Z0MA 3FFCD 4M4PA 1AI1H 4N0UA 2Q8AH 3RIAK 3EYOB 4XP1H 4MS8C 5HYFA 1G7IB 4ZOCA 4L3CA 12E8H 2UVEA 2Z91A 1RURH 3KYMA 4W70A 1LP9E 2GAZB 4Q6YA 2XN9E 2ITCA 2QQLL 1CT8A 1MFCH 2XZCH 3GJEA 4IDLA 1H0DB 4M6NL 5F7WC 1MCEA 2CK0H 1K6QH 4W6YB 1L6XA 4Y16C 2D7TH 3CZFB 5I76B 1LMKA 4NPYB 2ZPKH 3E6FB 5EZIH 1NBYB 5SV4A 3QUKB 2VXTH 3MRFB 5D93B 3FOLA 5D96B 3H3KA 4ZNCD 4ZPTA 4ONGL 4LLVA 1F4WH 4YBLB 3ARSA 2IH1A 1HCVA 1ZANH 2KBGA 1HKLH 1VGEH 5ABDE 4N8CL 2VXVL 3PE9A 3RU8H 4O5LH 3U1SH 1AQDB 2AJYH 3S3SA 2Q1EA 2EE9A 4G8FA 4HC1L 4TTDC 3O6FC 3FZUD 2AEIT 4PJDE 4X4MA 3WFHA 3IS1X 5L2KD 3ZE1F 5HI3D 3V0VA 1OAQH 5M95B 2DM7A 5F7DB 5DC0A 2E9WA 4JO1H 3SKMB 1NBVL 2C1PA 4JDVA 3PGCB 3V4PH 5KS9E 3RVVD 3EFDH 2EH7L 4NRXB 3QI9C 5FEBA 1DQQA 4ZFOL 2FB4L 5DC9B 3WIIL 4JFEA 3CLEL 3RI5K 4KKAD 4FQ1H 4POZC 1BD2E 2OI9B 1R3JB 1CDHA 4P2QE 1NEZB 1G7LA 5DFWH 5FYLE 3TVMB 2VRAA 3G6DL 1NANH 1CICC 4XGZB 4ZTOH 1EXUB 1II4E 2DQTH 3MXWL 4GBXC 3GBNH 4LPUA 2J6EA 3LKRB 4YPGB 1NDGB 4HS3A 1J1OL 2XY2A 5J1AB 4UV4L 2IQ9L 5EOCJ 3H7BB 1QBML 5EFIB 1J05A 2HRPH 5F7LB 4D2NA 4XXDB 5D9SB 1P6FA 2X5PA 1OGTA 4LNRB 4NO0A 1GHFL 2V7NA 3DXAE 2Q8AL 3FAWA 4OFYA 2FEEL 5I71C 4XP1L 3LOWA 2R4SH 3MLZH 2X2YA 1NCCH 1ZHNA 4GUPB 1RURL 1FGNH 1X4YA 1EZVY 1JRHH 3BMVA 4WFHD 3X3FL 1MFCL 2XZCL 3NIGF 5F1KC 1CGVA 5AYQA 1OF2A 4KDTC 2CK0L 1K6QL 3MRHB 4L8CA 3IDXL 2XQYG 4WI4A 2D7TL 4PJAA 4R7NB 32C2A 1LE5A 4AEFA 4WGVB 3SDAC 2VTFA 2ZPKL 3WLBA 4ZDHA 3I3DA 4XPAL 2VXTL 4YPJA 1CD1A 1DLHA 1F4WL 1WZMA 5CGMA 1JZ2A 2J8HA 5FECA 4Y5VC 4GFTB 4PGCB 4Y4KC 2UV3A 4NO5A 1ZANL 3PWJB 4D0CA 1HKLL 1VGEL 4RMUA 3RU8L 4O5LL 3U1SL 3PGDA 1S5HB 4LDEB 2GJ6D 2AJYL 5CZXC 2YUWA 5KSBF 1RQ5A 1Y18A 2GITA 3L3IB 4G6FD 1RK1A 4NKQB 1SJEA 4BA8A 2BRRH 4FQHA 4XHJC 2JB6B 3MA9L 3B8YA 2XWTB 1OAQL 3KPNB 3V6ZB 4JO1L 3UTZA 3FAXA 4G9DA 3QQ4A 2PYFB 3V4PL 2AERT 4HK3N 3O8XA 5D2LA 3EFDL 1MIEH 2VLLA 5JA9A 1BFTA 4ZXBB 3TBTB 2E7BA 1LP9F 4WFFD 1YEFH 4S1RH 4FQ1L 4KXZH 2IANE 4YHYB 4Q58C 3CFJA 4A2MA 4YC2B 4BQ6A 3F7RA 3PXJA 3EHBD 1VFUA 4LHJB 3BJ91 5CEXB 1XR9A 2DQTL 2ZOKA 3HC4H 1UC6A 2KUTA 5JPNA 4OFVA 5F1NA 5DJ2A 3BPNB 3X13B 3VXRE 4NN6C 2RIKA 4U1NB 3PDOB 4CBPA 5SWQB 1FZMA 2HRPL 5TE6H 2XPGB 5I1JL 4LKCA 1LEKB 4K94H 4NQXB 4R8WH 2OL3H 1KNOA 1ZA6A 1UH2A 2K3TA 3OAYK 2AK4B 2XV6B 2R4SL 3MLZL 1QACA 1B4RA 3FRUB 1NCCL 4HJ0C 4GG8B 1FGNL 4KI5D 4PJDF 5IP4A 1JRHL 3VRLE 4U1JA 1FNEB 3ARED 4PREA 4UIMB 4YXLH 4PGJA 3STBA 3ZLQC 5KS9F 3H3PH 4HKXA 2IBBA 5E7FA 3H9SB 2KPNA 2P5EB 1MCNA 3IF1A 4KUCF 3RA7H 3QAZB 3OX8B 5F21B 2A6IA 3FQNB 5DURB 1KOAA 5I9QC 4QOKA 2DYPD 4I0CC 5FV2A 5KSUA 4OM1H 1EPFA 3UTQB 5HHPB 4UAOC 3SGKA 1IGFH 2D0HA 4G6AD 1T0NB 1OSZB 3RNKB 2BRRL 3V6OE 4PRNB 3BZDA 3ULVH 2JJTA 4MB5A 4CDHA 1CGSL 1R24A 3PDGA 4NJAH 5F6HJ 5C8JB 1T89C 3GIVA 2P7TA 5C7XH 2MHAA 1MCOH 1IFHH 1UWXK 2OM5A 2VR9A 1MIEL 1NH6A 3I02A 4WUUA 2HLAB 5FDWB 5I16A 4ZS7H 3PWUB 2AV7B 5H35A 4BM7A 3BO8A 2XA8H 3WSQH 5CSBA 3QDJB 4J4PC 2ZCKH 3SE3C 3OR7A 3J7HA 3ROOB 3MGOA 2HFEA 5TGBA 3BW9A 3SCMD 4NQTA 3NZ8B 2ESVB 4HUNB 4PRIA 3HC4L 4CMHC 3PNWB 1HNGA 2F53B 5BVJB 1KULA 5GS0C 1N3NA 1PYWB 2GTZB 2VB5A 5BW7A 5DK3A 3RGVD 4K94L 4R8WL 3VRIB 2OL3L 3H9HA 3UP1A 3TBVB 3DV6B 1CXKA 1N5AB 1KCRH 1TIUA 3IKCB 3PUCA 3AXLB 1FVDA 5EOTB 1KF9B 1ZGLA 1NUDA 3HR6A 3D6GA 3DI3B 1QG3A 2PW2A 4JFOA 1M1SA 4HXAH 3VFPB 3RL1A 4YXLL 1D5BB 3DO7A 1ZXQA 4ZYKB 4MA8H 3H3PL 4MNQD 2AS5M 1KPRB 4UIKH 1XCQB 4JY5H 5I66B 3SKNB 1QNZH 3GJFA 1MHHA 3MACH 3RA7L 1U8QB 5TDPB 3SDDA 2X89A 3KS0J 4X6CA 2AP2A 1SEQH 3NAAH 1V8HA 1U0QA 4QHKJ 1XIWD 2DOCA 1CFSB 4NWUH 4P4KC 1DQMH 4IIQA 4PJ8A 3QXDB 2Q6WB 1OAKH 4OM1L 4K3EH 2AXFA 4RFNB 1IGFL 1NEZG 3KPRA 3F7VB 4D9QE 2HFFA 3C60A 5AZEH 4ACPA 4Q6IB 3BH9A 5E8NB 1CQYA 3IVKA 3ULVL 5K59F 5HYJA 5I30H 4MB4A 3PL6D 3N1FC 4W6XB 4KJWD 4TVPD 1YEHH 4CADA 1F42A 4NJAL 1UB6A 3E0GA 3KLAA 4MXQC 1JGDA 5CKAA 3ELAT 2UY6A 5C08D 5C7XL 1ZLVK 1IFHL 5K9KB 5KG9B 2QADC 5AG9A 1LDPH 3MJ9A 3VWJC 4ZS7L 2XWBA 1NBZA 1KCVH 4OUUA 1QLRA 3VRLF 2P24B 1A7OH 2XA8L 1YMMA 3WSQL 2ZCKL 1S9WA 1MCWW 2WK2A 5HYEA 5LCVH 1A2YA 1HN1A 4PJGA 3ZSSA 4X4XA 2DLGA 4LEXH 4WFED 4EDXB 5CIPB 2FR4B 3DHJA 1UKTA 4BH7B 5B4MD 1U3HD 1Z3GH 4LFHG 1FSKB 5LWYL 5HGDB 3WJLA 2YBRB 2B8OT 4Y4HA 1MVFA 5BO1L 2YKLH 1HXMB 1PFCA 1D9KB 2AK4E 1NUFA 4P2OB 4MDJA 3EFFA 1KCRL 4OFIA 4P5TD 4NQCD 4HSQA 5CJXA 4BK5A 4J3VA 3BPCA 1XH3B 1RK0B 4HBQA 1OWWA 3I75A 1VFBA 4IS6A 3RZCB 5EOQH 1B0WA 4HXAL 3TN0C 2E8YA 1HWHB 2FCBA 2E7HA 4RWYL 3RKPA 1CL7I 4NKOA 3H9SE 4MA8L 2E5EA 2R0ZL 5D1XB 2P5EE 3OKEA 3FB8A 3LEVH 2CLVB 3T0EB 3WN5A 4UIKL 4JY5L 4KRNA 1QNZL 4IRJA 2BXYA 2W92A 2NY7H 4YR6B 3JV0A 4JRYB 3BAEL 1GH7A 4GKNA 4HHAA 4HK0A 3NAAL 2OYPA 3KPQB 2YRZA