4HQ1A

Crystal structure of an lrr protein with two solenoids
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
424
structure length
424
Chain Sequence
b'DSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLSPDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQSVEIDNNPFKSWEIPESLRNASALQNFSANSANVSGSLPGFLGPDEFPGLSILHLAFNNLEGELPMSLAGSQVQSLWLNGQKLTGDITVLQNMTGLKEVWLHSNKFSGPLPDFSGLKELESLSLRDNSFTGPVPASLLSLESLKVVNLTNNHLQGPVPVFKSSVSVDLDKDSNSFCLSSPGECDPRVKSLLLIASSFDYPPRLAESWKGNDPCTNWIGIACSNGNITVISLEKMELTGTISPEFGAIKSLQRIILGINNLTGMIPQELTTLPNLKTLDVSSNKLFGKVPGFRSNVVVNTNGNPDIGKDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable receptor protein kinase TMK1
publication title Crystal structure of an LRR protein with two solenoids
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 141
structure length 424
sequence length 424
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4hq1A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4hq1A02
4YEBB 2Z7XB 2ELLA 4LSXA 2O6QA 2Z63A 4NKGA 1O6SA 3VQ1A 3CIYA 5IJBA 3ULUA 3RGXA 3RFEA 2BNHA 4ECNA 2OMZA 1H6TA 3DZEA 2ASSB 3FXIA 4FCGA 5GS0A 4P8SA 3OJAB 4ECOA 1DCEA 4BSRA 4U06A 3UL7A 3ZYIA 4Q3GA 1K5GC 4R6AA 3E3ZA 5IJCA 3C6NB 3WPGA 5A5CA 4NKHA 1FT8A 2XWTC 4PSJA 3WN4A 4B8CD 4QC0A 1JL5A 3G04C 5AWBA 3PMHG 1A9NA 3BZ5A 3UN9A 5AWAA 4QBZA 4ARRA 4XSQA 3UL8A 5HDHA 4MQWX 2XOTA 4XOSA 3KJ4A 4QXEA 4U09A 4LSAA 3O6NA 5B4PA 3TSRE 1FO1A 4LXSA 3REZA 1OTNA 3P72A 3CIGA 3W3JA 4LI2A 2UZYA 2Z65A 1DS9A 2OMXA 2JE1A 4R08A 2V9TB 4BV4R 1M0ZA 4J4LA 2O6SA 4R07A 1KOOA 4UFRA 4CNCA 4L3AA 4Z64C 4XGOA 1M9LA 3SB4A 2WQVA 3W3NA 1M10B 2V70A 2Z62A 2IFGA 2UZXA 4FMZA 2Q4GW 4PERA 3WPFA 3M19A 4GT6A 2CA6A 4M7EA 4R09A 1XKUA 5HZLB 2V9SA 1K5DC 4BSUA 1QYYA 4CP6A 3A79B 2P1NB 1OTMA 5IYXC 1H6UA 1DFJI 4OQTA 1OOKG 3G39A 1GWBA 1M9SA 4C2AB 3WPIA 3WPHA 1P8VA 2P1QB 3RW6A 5AWCA 4ARNA 4KXFB 4CC4A 4L3FA 2P1MB 1XECA 5B0TA 4RWTC 4V2EA 3W3LA 4FS7A 1OGQA 3E4GA 4R5DA 3C6OB 4FD0A 2Z64A 5GQRK 5AZ5A 3W3GA 4PEQB 3E2JA 4WP6A 1KOHA 2Z66A 4R5CA 2WQWA 3WPEA 3G3AA 3M18A 3WPCA 2ASTB 3ZYNA 2OMVA 3OGMB 4LSCA 4K17A 2Y5QA 1U0ND 2OMYA 5B0NA 1IO0A 4KNGA 1P8TA 5GMHA 2O6RA 2WFHA 2BEXA 1XWDC 4V2DA 3ULAA 3G3BA 3RGZA 4U08A 2RR6A 4AY9X 4J0MA 1Z7XW 5AWDA 4Y61B 3RIZA 4PQ8A 3GOZA 4R6GA 1G9UA 4Z61C 2Z81A 4BSSA 3UL9A 1OTOA 4I6JB 5IJDA 4FDWA 4V2CA 4FHOA 3CVRA 3ULVA 3RFSA 2OMWA 5CMPA 5D3IA 3RFJA 1W8AA 1SQ0B 4Z94G 3ZYJA 4Q3IA 4GLPA 5GMFA 2ID5A 2JE0A 3G06A 2OMUA 4RCAB 4Q62A 4AW4A 4P91A 4H09A 4R0AA 1YRGA 4KT1A 4RCWA 2Z82A 2A0ZA 1XCDA 4M7EC 4WYKA 1O6VA 3W3KA 3OGKB 4MN8B 4LSXC 4PKIG 3ZYOA 2Z7XA 1OZNA 1A4YA 2P1PB 3RJ0A 3WPBA 4G8AA 5CMNA 4EZGA 1LTXA 3O53A 1FQVA 3W3MA 2WQXA 1D0BA 2JQDA 4R6FA 5FTTB 1WWLA 2FT3A 2RA8A 1FS2A 4HQ1A 1O6TA 4CNMA 4CC4C 3OJAA 4Z8GA 3JB9j 4C2BB 2WQUA 2P1OB 1XEUA 4TZHA 3WPDA 4LXRA 2R9UA 4U7LA 4R58A 4R6JA 5GS2B 4Z79A 1PGVA 5LFNA 1ZIWA 5GMGA 2OMTA 3E6JA 3C6PB 3RW7A 1P9AG 4LI1A 3VQ2A 4CILA 4IM6A 3OGLB
chains in the Genus database with same CATH superfamily
4YEBB 2Z7XB 2ELLA 4LSXA 2O6QA 2Z63A 4NKGA 1O6SA 4NZRM 3VQ1A 3CIYA 5IJBA 3ULUA 3RGXA 3RFEA 2BNHA 4ECNA 2OMZA 1H6TA 3DZEA 2ASSB 3FXIA 4FCGA 5GS0A 4P8SA 3OJAB 4ECOA 1DCEA 4BSRA 4U06A 3UL7A 3ZYIA 4Q3GA 1K5GC 4R6AA 3E3ZA 5IJCA 3C6NB 3WPGA 5A5CA 4NKHA 1FT8A 2XWTC 4PSJA 3WN4A 4B8CD 4QC0A 1JL5A 3G04C 5AWBA 3PMHG 1A9NA 3BZ5A 3UN9A 5AWAA 4QBZA 4ARRA 4XSQA 3UL8A 5HDHA 4MQWX 2XOTA 4XOSA 3KJ4A 4QXEA 4U09A 4LSAA 3O6NA 5B4PA 3TSRE 1FO1A 4LXSA 3REZA 1OTNA 3P72A 3CIGA 3W3JA 4LI2A 2UZYA 2Z65A 1DS9A 2OMXA 2JE1A 4R08A 2V9TB 4BV4R 1M0ZA 4J4LA 2O6SA 4R07A 1KOOA 4UFRA 4CNCA 4L3AA 4Z64C 4XGOA 1M9LA 3SB4A 2WQVA 3W3NA 1M10B 2V70A 2Z62A 2IFGA 2UZXA 4FMZA 2Q4GW 4PERA 3WPFA 3M19A 4GT6A 2CA6A 4M7EA 4R09A 1XKUA 5HZLB 2V9SA 1K5DC 4BSUA 1QYYA 4CP6A 3A79B 2P1NB 1OTMA 5IYXC 1H6UA 1DFJI 4OQTA 1OOKG 3G39A 1GWBA 1M9SA 4C2AB 3WPIA 3WPHA 1P8VA 2P1QB 3RW6A 5AWCA 4ARNA 4KXFB 4CC4A 4L3FA 2P1MB 1XECA 5B0TA 4RWTC 4V2EA 3W3LA 4FS7A 1OGQA 3E4GA 4R5DA 3C6OB 4FD0A 2Z64A 5GQRK 5AZ5A 3W3GA 4PEQB 3E2JA 4WP6A 1KOHA 2Z66A 4R5CA 2WQWA 3WPEA 3G3AA 3M18A 3WPCA 2ASTB 3ZYNA 2OMVA 3OGMB 4LSCA 4K17A 4NZTM 2Y5QA 1U0ND 2OMYA 5B0NA 1IO0A 4KNGA 1P8TA 5GMHA 2O6RA 2WFHA 2BEXA 1XWDC 4V2DA 3ULAA 3G3BA 3RGZA 4U08A 2RR6A 4AY9X 4J0MA 1Z7XW 5AWDA 4Y61B 3RIZA 4PQ8A 3GOZA 4R6GA 1G9UA 4Z61C 2Z81A 4BSSA 3UL9A 1OTOA 4I6JB 5IJDA 4FDWA 4V2CA 4FHOA 3CVRA 3ULVA 3RFSA 2OMWA 5CMPA 5D3IA 3RFJA 1W8AA 1SQ0B 4Z94G 3ZYJA 4Q3IA 4GLPA 5GMFA 2ID5A 2JE0A 3G06A 2OMUA 4RCAB 4Q62A 4AW4A 4P91A 4H09A 4R0AA 1YRGA 4KT1A 4RCWA 2Z82A 2A0ZA 1XCDA 4M7EC 4WYKA 1O6VA 3W3KA 3OGKB 4MN8B 4LSXC 4PKIG 3ZYOA 2Z7XA 1OZNA 1A4YA 2P1PB 3RJ0A 3WPBA 4G8AA 5CMNA 4EZGA 1LTXA 3O53A 1FQVA 3W3MA 2WQXA 1D0BA 2JQDA 4R6FA 5FTTB 1WWLA 2FT3A 2RA8A 1FS2A 4HQ1A 1O6TA 4CNMA 4CC4C 3OJAA 4Z8GA 3JB9j 4C2BB 2WQUA 2P1OB 1XEUA 4TZHA 3WPDA 4LXRA 2R9UA 4U7LA 4R58A 4R6JA 5GS2B 4Z79A 1PGVA 5LFNA 1ZIWA 5GMGA 2OMTA 3E6JA 3C6PB 3RW7A 1P9AG 4LI1A 3VQ2A 4CILA 4IM6A 3OGLB
chains in the Genus database with same CATH topology
4YEBB 2Z7XB 2ELLA 4LSXA 2O6QA 2Z63A 4NKGA 1O6SA 3VQ1A 3CIYA 5IJBA 3ULUA 3RGXA 3RFEA 2BNHA 4ECNA 2OMZA 1H6TA 3DZEA 2ASSB 3FXIA 4FCGA 5GS0A 4P8SA 3OJAB 4ECOA 1DCEA 4BSRA 4U06A 3UL7A 3ZYIA 4Q3GA 1K5GC 4R6AA 3E3ZA 5IJCA 3C6NB 3WPGA 5A5CA 4NKHA 1FT8A 2XWTC 4PSJA 3WN4A 4B8CD 4QC0A 1JL5A 3G04C 5AWBA 3PMHG 1A9NA 3BZ5A 3UN9A 5AWAA 4QBZA 4ARRA 4XSQA 3UL8A 5HDHA 4MQWX 2XOTA 4XOSA 3KJ4A 4QXEA 4U09A 4LSAA 3O6NA 5B4PA 3TSRE 1FO1A 4LXSA 3REZA 1OTNA 3P72A 3CIGA 3W3JA 4LI2A 2UZYA 2Z65A 1DS9A 2OMXA 2JE1A 4R08A 2V9TB 4BV4R 1M0ZA 4J4LA 2O6SA 4R07A 1KOOA 4UFRA 4CNCA 4L3AA 4Z64C 4XGOA 1M9LA 3SB4A 2WQVA 3W3NA 1M10B 2V70A 2Z62A 2IFGA 2UZXA 4FMZA 2Q4GW 4PERA 3WPFA 3M19A 4GT6A 2CA6A 4M7EA 4R09A 1XKUA 5HZLB 2V9SA 1K5DC 4BSUA 1QYYA 4CP6A 3A79B 2P1NB 1OTMA 5IYXC 1H6UA 1DFJI 4OQTA 1OOKG 3G39A 1GWBA 1M9SA 4C2AB 3WPIA 3WPHA 1P8VA 2P1QB 3RW6A 5AWCA 4ARNA 4KXFB 4CC4A 4L3FA 2P1MB 1XECA 5B0TA 4RWTC 4V2EA 3W3LA 4FS7A 1OGQA 3E4GA 4R5DA 3C6OB 4FD0A 2Z64A 5GQRK 5AZ5A 3W3GA 4PEQB 3E2JA 4WP6A 1KOHA 2Z66A 4R5CA 2WQWA 3WPEA 3G3AA 3M18A 3WPCA 2ASTB 3ZYNA 2OMVA 3OGMB 4LSCA 4K17A 2Y5QA 1U0ND 2OMYA 5B0NA 1IO0A 4KNGA 1P8TA 5GMHA 2O6RA 2WFHA 2BEXA 1XWDC 4V2DA 3ULAA 3G3BA 3RGZA 4U08A 2RR6A 4AY9X 4J0MA 1Z7XW 5AWDA 4Y61B 3RIZA 4PQ8A 3GOZA 4R6GA 1G9UA 4Z61C 2Z81A 4BSSA 3UL9A 1OTOA 4I6JB 5IJDA 4FDWA 4V2CA 4FHOA 3CVRA 3ULVA 3RFSA 2OMWA 5CMPA 5D3IA 3RFJA 1W8AA 1SQ0B 4Z94G 3ZYJA 4Q3IA 4GLPA 5GMFA 2ID5A 2JE0A 3G06A 2OMUA 4RCAB 4Q62A 4AW4A 4P91A 4H09A 4R0AA 1YRGA 4KT1A 4RCWA 2Z82A 2A0ZA 1XCDA 4M7EC 4WYKA 1O6VA 3W3KA 3OGKB 4MN8B 4LSXC 4PKIG 3ZYOA 2Z7XA 1OZNA 1A4YA 2P1PB 3RJ0A 3WPBA 4G8AA 5CMNA 4EZGA 1LTXA 3O53A 1FQVA 3W3MA 2WQXA 1D0BA 2JQDA 4R6FA 5FTTB 1WWLA 2FT3A 2RA8A 1FS2A 4HQ1A 1O6TA 4CNMA 4CC4C 3OJAA 4Z8GA 3JB9j 4C2BB 2WQUA 2P1OB 1XEUA 4TZHA 3WPDA 4LXRA 2R9UA 4U7LA 4R58A 4R6JA 5GS2B 4Z79A 1PGVA 5LFNA 1ZIWA 5GMGA 2OMTA 3E6JA 3C6PB 3RW7A 1P9AG 4LI1A 3VQ2A 4CILA 4IM6A 3OGLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEB B;  2Z7X B;  2ELL A;  4LSX A;  2O6Q A;  2Z63 A;  4NKG A;  1O6S A;  3VQ1 A;  3CIY A;  5IJB A;  3ULU A;  3RGX A;  3RFE A;  2BNH A;  4ECN A;  2OMZ A;  1H6T A;  3DZE A;  2ASS B;  3FXI A;  4FCG A;  5GS0 A;  4P8S A;  3OJA B;  4ECO A;  1DCE A;  4BSR A;  4U06 A;  3UL7 A;  3ZYI A;  4Q3G A;  1K5G C;  4R6A A;  3E3Z A;  5IJC A;  3C6N B;  3WPG A;  5A5C A;  4NKH A;  1FT8 A;  2XWT C;  4PSJ A;  3WN4 A;  4B8C D;  4QC0 A;  1JL5 A;  3G04 C;  5AWB A;  3PMH G;  1A9N A;  3BZ5 A;  3UN9 A;  5AWA A;  4QBZ A;  4ARR A;  4XSQ A;  3UL8 A;  5HDH A;  4MQW X;  2XOT A;  4XOS A;  3KJ4 A;  4QXE A;  4U09 A;  4LSA A;  3O6N A;  5B4P A;  3TSR E;  1FO1 A;  4LXS A;  3REZ A;  1OTN A;  3P72 A;  3CIG A;  3W3J A;  4LI2 A;  2UZY A;  2Z65 A;  1DS9 A;  2OMX A;  2JE1 A;  4R08 A;  2V9T B;  4BV4 R;  1M0Z A;  4J4L A;  2O6S A;  4R07 A;  1KOO A;  4UFR A;  4CNC A;  4L3A A;  4Z64 C;  4XGO A;  1M9L A;  3SB4 A;  2WQV A;  3W3N A;  1M10 B;  2V70 A;  2Z62 A;  2IFG A;  2UZX A;  4FMZ A;  2Q4G W;  4PER A;  3WPF A;  3M19 A;  4GT6 A;  2CA6 A;  4M7E A;  4R09 A;  1XKU A;  5HZL B;  2V9S A;  1K5D C;  4BSU A;  1QYY A;  4CP6 A;  3A79 B;  2P1N B;  1OTM A;  5IYX C;  1H6U A;  1DFJ I;  4OQT A;  1OOK G;  3G39 A;  1GWB A;  1M9S A;  4C2A B;  3WPI A;  3WPH A;  1P8V A;  2P1Q B;  3RW6 A;  5AWC A;  4ARN A;  4KXF B;  4CC4 A;  4L3F A;  2P1M B;  1XEC A;  5B0T A;  4RWT C;  4V2E A;  3W3L A;  4FS7 A;  1OGQ A;  3E4G A;  4R5D A;  3C6O B;  4FD0 A;  2Z64 A;  5GQR K;  5AZ5 A;  3W3G A;  4PEQ B;  3E2J A;  4WP6 A;  1KOH A;  2Z66 A;  4R5C A;  2WQW A;  3WPE A;  3G3A A;  3M18 A;  3WPC A;  2AST B;  3ZYN A;  2OMV A;  3OGM B;  4LSC A;  4K17 A;  2Y5Q A;  1U0N D;  2OMY A;  5B0N A;  1IO0 A;  4KNG A;  1P8T A;  5GMH A;  2O6R A;  2WFH A;  2BEX A;  1XWD C;  4V2D A;  3ULA A;  3G3B A;  3RGZ A;  4U08 A;  2RR6 A;  4AY9 X;  4J0M A;  1Z7X W;  5AWD A;  4Y61 B;  3RIZ A;  4PQ8 A;  3GOZ A;  4R6G A;  1G9U A;  4Z61 C;  2Z81 A;  4BSS A;  3UL9 A;  1OTO A;  4I6J B;  5IJD A;  4FDW A;  4V2C A;  4FHO A;  3CVR A;  3ULV A;  3RFS A;  2OMW A;  5CMP A;  5D3I A;  3RFJ A;  1W8A A;  1SQ0 B;  4Z94 G;  3ZYJ A;  4Q3I A;  4GLP A;  5GMF A;  2ID5 A;  2JE0 A;  3G06 A;  2OMU A;  4RCA B;  4Q62 A;  4AW4 A;  4P91 A;  4H09 A;  4R0A A;  1YRG A;  4KT1 A;  4RCW A;  2Z82 A;  2A0Z A;  1XCD A;  4M7E C;  4WYK A;  1O6V A;  3W3K A;  3OGK B;  4MN8 B;  4LSX C;  4PKI G;  3ZYO A;  2Z7X A;  1OZN A;  1A4Y A;  2P1P B;  3RJ0 A;  3WPB A;  4G8A A;  5CMN A;  4EZG A;  1LTX A;  3O53 A;  1FQV A;  3W3M A;  2WQX A;  1D0B A;  2JQD A;  4R6F A;  5FTT B;  1WWL A;  2FT3 A;  2RA8 A;  1FS2 A;  4HQ1 A;  1O6T A;  4CNM A;  4CC4 C;  3OJA A;  4Z8G A;  3JB9 j;  4C2B B;  2WQU A;  2P1O B;  1XEU A;  4TZH A;  3WPD A;  4LXR A;  2R9U A;  4U7L A;  4R58 A;  4R6J A;  5GS2 B;  4Z79 A;  1PGV A;  5LFN A;  1ZIW A;  5GMG A;  2OMT A;  3E6J A;  3C6P B;  3RW7 A;  1P9A G;  4LI1 A;  3VQ2 A;  4CIL A;  4IM6 A;  3OGL B; 
#chains in the Genus database with same CATH topology
 4YEB B;  2Z7X B;  2ELL A;  4LSX A;  2O6Q A;  2Z63 A;  4NKG A;  1O6S A;  4NZR M;  3VQ1 A;  3CIY A;  5IJB A;  3ULU A;  3RGX A;  3RFE A;  2BNH A;  4ECN A;  2OMZ A;  1H6T A;  3DZE A;  2ASS B;  3FXI A;  4FCG A;  5GS0 A;  4P8S A;  3OJA B;  4ECO A;  1DCE A;  4BSR A;  4U06 A;  3UL7 A;  3ZYI A;  4Q3G A;  1K5G C;  4R6A A;  3E3Z A;  5IJC A;  3C6N B;  3WPG A;  5A5C A;  4NKH A;  1FT8 A;  2XWT C;  4PSJ A;  3WN4 A;  4B8C D;  4QC0 A;  1JL5 A;  3G04 C;  5AWB A;  3PMH G;  1A9N A;  3BZ5 A;  3UN9 A;  5AWA A;  4QBZ A;  4ARR A;  4XSQ A;  3UL8 A;  5HDH A;  4MQW X;  2XOT A;  4XOS A;  3KJ4 A;  4QXE A;  4U09 A;  4LSA A;  3O6N A;  5B4P A;  3TSR E;  1FO1 A;  4LXS A;  3REZ A;  1OTN A;  3P72 A;  3CIG A;  3W3J A;  4LI2 A;  2UZY A;  2Z65 A;  1DS9 A;  2OMX A;  2JE1 A;  4R08 A;  2V9T B;  4BV4 R;  1M0Z A;  4J4L A;  2O6S A;  4R07 A;  1KOO A;  4UFR A;  4CNC A;  4L3A A;  4Z64 C;  4XGO A;  1M9L A;  3SB4 A;  2WQV A;  3W3N A;  1M10 B;  2V70 A;  2Z62 A;  2IFG A;  2UZX A;  4FMZ A;  2Q4G W;  4PER A;  3WPF A;  3M19 A;  4GT6 A;  2CA6 A;  4M7E A;  4R09 A;  1XKU A;  5HZL B;  2V9S A;  1K5D C;  4BSU A;  1QYY A;  4CP6 A;  3A79 B;  2P1N B;  1OTM A;  5IYX C;  1H6U A;  1DFJ I;  4OQT A;  1OOK G;  3G39 A;  1GWB A;  1M9S A;  4C2A B;  3WPI A;  3WPH A;  1P8V A;  2P1Q B;  3RW6 A;  5AWC A;  4ARN A;  4KXF B;  4CC4 A;  4L3F A;  2P1M B;  1XEC A;  5B0T A;  4RWT C;  4V2E A;  3W3L A;  4FS7 A;  1OGQ A;  3E4G A;  4R5D A;  3C6O B;  4FD0 A;  2Z64 A;  5GQR K;  5AZ5 A;  3W3G A;  4PEQ B;  3E2J A;  4WP6 A;  1KOH A;  2Z66 A;  4R5C A;  2WQW A;  3WPE A;  3G3A A;  3M18 A;  3WPC A;  2AST B;  3ZYN A;  2OMV A;  3OGM B;  4LSC A;  4K17 A;  4NZT M;  2Y5Q A;  1U0N D;  2OMY A;  5B0N A;  1IO0 A;  4KNG A;  1P8T A;  5GMH A;  2O6R A;  2WFH A;  2BEX A;  1XWD C;  4V2D A;  3ULA A;  3G3B A;  3RGZ A;  4U08 A;  2RR6 A;  4AY9 X;  4J0M A;  1Z7X W;  5AWD A;  4Y61 B;  3RIZ A;  4PQ8 A;  3GOZ A;  4R6G A;  1G9U A;  4Z61 C;  2Z81 A;  4BSS A;  3UL9 A;  1OTO A;  4I6J B;  5IJD A;  4FDW A;  4V2C A;  4FHO A;  3CVR A;  3ULV A;  3RFS A;  2OMW A;  5CMP A;  5D3I A;  3RFJ A;  1W8A A;  1SQ0 B;  4Z94 G;  3ZYJ A;  4Q3I A;  4GLP A;  5GMF A;  2ID5 A;  2JE0 A;  3G06 A;  2OMU A;  4RCA B;  4Q62 A;  4AW4 A;  4P91 A;  4H09 A;  4R0A A;  1YRG A;  4KT1 A;  4RCW A;  2Z82 A;  2A0Z A;  1XCD A;  4M7E C;  4WYK A;  1O6V A;  3W3K A;  3OGK B;  4MN8 B;  4LSX C;  4PKI G;  3ZYO A;  2Z7X A;  1OZN A;  1A4Y A;  2P1P B;  3RJ0 A;  3WPB A;  4G8A A;  5CMN A;  4EZG A;  1LTX A;  3O53 A;  1FQV A;  3W3M A;  2WQX A;  1D0B A;  2JQD A;  4R6F A;  5FTT B;  1WWL A;  2FT3 A;  2RA8 A;  1FS2 A;  4HQ1 A;  1O6T A;  4CNM A;  4CC4 C;  3OJA A;  4Z8G A;  3JB9 j;  4C2B B;  2WQU A;  2P1O B;  1XEU A;  4TZH A;  3WPD A;  4LXR A;  2R9U A;  4U7L A;  4R58 A;  4R6J A;  5GS2 B;  4Z79 A;  1PGV A;  5LFN A;  1ZIW A;  5GMG A;  2OMT A;  3E6J A;  3C6P B;  3RW7 A;  1P9A G;  4LI1 A;  3VQ2 A;  4CIL A;  4IM6 A;  3OGL B; 
#chains in the Genus database with same CATH homology
 4YEB B;  2Z7X B;  2ELL A;  4LSX A;  2O6Q A;  2Z63 A;  4NKG A;  1O6S A;  3VQ1 A;  3CIY A;  5IJB A;  3ULU A;  3RGX A;  3RFE A;  2BNH A;  4ECN A;  2OMZ A;  1H6T A;  3DZE A;  2ASS B;  3FXI A;  4FCG A;  5GS0 A;  4P8S A;  3OJA B;  4ECO A;  1DCE A;  4BSR A;  4U06 A;  3UL7 A;  3ZYI A;  4Q3G A;  1K5G C;  4R6A A;  3E3Z A;  5IJC A;  3C6N B;  3WPG A;  5A5C A;  4NKH A;  1FT8 A;  2XWT C;  4PSJ A;  3WN4 A;  4B8C D;  4QC0 A;  1JL5 A;  3G04 C;  5AWB A;  3PMH G;  1A9N A;  3BZ5 A;  3UN9 A;  5AWA A;  4QBZ A;  4ARR A;  4XSQ A;  3UL8 A;  5HDH A;  4MQW X;  2XOT A;  4XOS A;  3KJ4 A;  4QXE A;  4U09 A;  4LSA A;  3O6N A;  5B4P A;  3TSR E;  1FO1 A;  4LXS A;  3REZ A;  1OTN A;  3P72 A;  3CIG A;  3W3J A;  4LI2 A;  2UZY A;  2Z65 A;  1DS9 A;  2OMX A;  2JE1 A;  4R08 A;  2V9T B;  4BV4 R;  1M0Z A;  4J4L A;  2O6S A;  4R07 A;  1KOO A;  4UFR A;  4CNC A;  4L3A A;  4Z64 C;  4XGO A;  1M9L A;  3SB4 A;  2WQV A;  3W3N A;  1M10 B;  2V70 A;  2Z62 A;  2IFG A;  2UZX A;  4FMZ A;  2Q4G W;  4PER A;  3WPF A;  3M19 A;  4GT6 A;  2CA6 A;  4M7E A;  4R09 A;  1XKU A;  5HZL B;  2V9S A;  1K5D C;  4BSU A;  1QYY A;  4CP6 A;  3A79 B;  2P1N B;  1OTM A;  5IYX C;  1H6U A;  1DFJ I;  4OQT A;  1OOK G;  3G39 A;  1GWB A;  1M9S A;  4C2A B;  3WPI A;  3WPH A;  1P8V A;  2P1Q B;  3RW6 A;  5AWC A;  4ARN A;  4KXF B;  4CC4 A;  4L3F A;  2P1M B;  1XEC A;  5B0T A;  4RWT C;  4V2E A;  3W3L A;  4FS7 A;  1OGQ A;  3E4G A;  4R5D A;  3C6O B;  4FD0 A;  2Z64 A;  5GQR K;  5AZ5 A;  3W3G A;  4PEQ B;  3E2J A;  4WP6 A;  1KOH A;  2Z66 A;  4R5C A;  2WQW A;  3WPE A;  3G3A A;  3M18 A;  3WPC A;  2AST B;  3ZYN A;  2OMV A;  3OGM B;  4LSC A;  4K17 A;  2Y5Q A;  1U0N D;  2OMY A;  5B0N A;  1IO0 A;  4KNG A;  1P8T A;  5GMH A;  2O6R A;  2WFH A;  2BEX A;  1XWD C;  4V2D A;  3ULA A;  3G3B A;  3RGZ A;  4U08 A;  2RR6 A;  4AY9 X;  4J0M A;  1Z7X W;  5AWD A;  4Y61 B;  3RIZ A;  4PQ8 A;  3GOZ A;  4R6G A;  1G9U A;  4Z61 C;  2Z81 A;  4BSS A;  3UL9 A;  1OTO A;  4I6J B;  5IJD A;  4FDW A;  4V2C A;  4FHO A;  3CVR A;  3ULV A;  3RFS A;  2OMW A;  5CMP A;  5D3I A;  3RFJ A;  1W8A A;  1SQ0 B;  4Z94 G;  3ZYJ A;  4Q3I A;  4GLP A;  5GMF A;  2ID5 A;  2JE0 A;  3G06 A;  2OMU A;  4RCA B;  4Q62 A;  4AW4 A;  4P91 A;  4H09 A;  4R0A A;  1YRG A;  4KT1 A;  4RCW A;  2Z82 A;  2A0Z A;  1XCD A;  4M7E C;  4WYK A;  1O6V A;  3W3K A;  3OGK B;  4MN8 B;  4LSX C;  4PKI G;  3ZYO A;  2Z7X A;  1OZN A;  1A4Y A;  2P1P B;  3RJ0 A;  3WPB A;  4G8A A;  5CMN A;  4EZG A;  1LTX A;  3O53 A;  1FQV A;  3W3M A;  2WQX A;  1D0B A;  2JQD A;  4R6F A;  5FTT B;  1WWL A;  2FT3 A;  2RA8 A;  1FS2 A;  4HQ1 A;  1O6T A;  4CNM A;  4CC4 C;  3OJA A;  4Z8G A;  3JB9 j;  4C2B B;  2WQU A;  2P1O B;  1XEU A;  4TZH A;  3WPD A;  4LXR A;  2R9U A;  4U7L A;  4R58 A;  4R6J A;  5GS2 B;  4Z79 A;  1PGV A;  5LFN A;  1ZIW A;  5GMG A;  2OMT A;  3E6J A;  3C6P B;  3RW7 A;  1P9A G;  4LI1 A;  3VQ2 A;  4CIL A;  4IM6 A;  3OGL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...