4HQQH

Crystal structure of rv144-elicited antibody ch58
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
215
Chain Sequence
b'EVQLVQSGAEVKKPGESLKISCKGSGYRFTSYWIVWVRQMPGKGLEWMGIIYPGDFDTKYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGGYYYLDYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 215
sequence length 227
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqH01
3PHSA 2Q7YA 4WV1B 5CP3A 1YEDA 3I6KB 4OIAA 4EEEA 1QLFA 1U2HA 2Q20A 3PL6C 2Z4QA 3PQYD 4JRXB 3CVIH 3O6ML 5A16A 1OAQL 1JCKA 4G6ML 3QHTC 3S34L 4ONFL 4AYFA 4XNYL 5FYJL 3VMPA 3FOMB 4OZHE 3RL1B 1I8IB 1PKQA 2E9WA 1QO3B 1KEMH 1JRHH 4LCYB 2HFTA 4OV5B 1MCBA 1TCRB 3LKSB 4OM1L 3RQ3A 1KXTB 3K8LA 4U6HB 3THMH 3B9KB 3MQIA 3T3MF 3B2VH 5D70H 4JO2H 12E8H 1D6VL 5GRJH 3QUZC 4LSDA 1FL6B 1U95B 4KRPB 3EO0A 2W9DH 5L2KA 3RUGF 3VWJD 1UXWB 1KBGL 2ITDA 1ZA3A 2NW2A 4Q2ZA 4OKVB 4G5ZH 4LSSH 1HHKA 4CVXA 5F1IA 3PIQA 3EO1A 3HNVH 3QPQD 4MVBC 5IEKB 2A6KA 2IPKA 4N8VG 5E00A 1FFNB 1KLFA 3IJSA 1NCAL 5LAXA 1MCDA 4OCMC 1YEFL 1EAPA 1P7KA 3WNKA 1CXIA 2VQUA 3DI3B 4NO5B 4PJGF 4RIRA 4NUJB 4X7SL 5HYJB 4FOMA 1U3YA 3MV9B 2F5BL 2DM3A 1DQJB 3TO2A 4RMRA 3B6SA 4NQDD 3C5ZA 4RMWA 5I8KH 2VXQH 1ZLSL 3TBTB 1H15B 2P43B 1MCWM 3GI8H 1NAML 3E8UH 3LDBC 4U6TA 3U83A 4DKEH 4R97C 4MA8H 4PGDA 3HMXH 1EMTL 4L8DB 4W70A 3WFCL 5I17B 1EEZA 2J2ZA 5BVJB 2R8SH 1PFCA 1VGKA 5B3JE 5BRZB 1I8MB 3PQYA 1C08B 4JY6B 4KKLC 3V5HA 1R3IH 2P8MA 3ZTJG 3HI6L 3ZDYE 2R15A 3LAFA 3SE4A 3SKOA 2OR8A 3L5HA 1ZGLM 5F71A 3RHWK 1CGSL 5E1HB 4HZLB 2IAMB 4KZDL 1YJDC 3HG1B 5KVMC 1EEYA 5BJTB 3P77A 3MJ7A 5GJSH 3VXUD 1UKSA 4F7PA 4M03A 1CL7L 3BN9D 2DQJH 3PWPE 3TWCH 3DO7B 4I8DA 5CBEB 4QHMA 4WNQB 3R0MA 5DK2B 3VWJA 1K2DB 2VLKD 4ODTL 1MCPL 3D85B 4JM4L 4UBDC 3I75B 4BYHA 4PTUA 1MRDH 2CMRH 3ILQD 3GSRB 2DQDL 4FXGB 3BISA 1S7UB 3EYVA 5FUOH 2NY5C 3VXNB 2OJEA 1P1ZA 1X5YA 4I0PB 1DBMH 2LQRA 4NJAL 1TPXB 5HGGS 3VFNB 2EYTA 1JFQH 5DEFA 3RA7L 4YHLL 2X4RA 3WBDA 5FV1L 3GHBL 4RGNE 1XZ0A 2JIXB 3RTQB 5E8PB 4BKLB 1NGPH 4OF0A 1KTLA 3TFKC 3WV0A 2EDRA 5TQ0H 2OTUA 4HUXA 4M4PA 3T3ME 5EOTB 4M61A 4Z7WA 1G7LB 1I9JH 5HDQH 2BOBA 1AGCB 3FB8B 3NCJH 1NCNA 4HXAL 3O3BB 5J9PA 4WTZG 3PL6A 4KKLD 1CGVA 4F33B 1A3QA 4ODHL 4WFGD 43C9A 5IBLD 4X7TB 3P30H 5DJZA 4PJGE 1R3LB 1GOFA 3FO9B 4Q9RH 5F89A 3U4BL 1UENA 4Y2DC 3CFDA 3BP6B 4NRXA 4ORGB 5L7XL 2D0GA 2W65B 1KCUH 4NKDA 4PJIA 2EKSB 3QUZA 1R5VA 2Z8WC 3TT3H 1W72H 2CIKB 3IFOB 2D4FA 3HFML 4UQ3B 3HTLX 1I1AC 3RL2B 1FFQA 1MCEA 3CSGA 2H8PA 3QYCA 4K55A 2X2YA 1OP9A 5LWYH 4JKLA 1CL7I 1GL4B 2VN7A 1QBBA 5JA8B 1IGCL 4K3DH 4NN6B 1HQRA 2FNBA 4OZFH 2GJ6A 4LP4A 4D0CA 5ALBH 1AGEA 2ADFH 1A4JB 1A7QH 1S7TA 4BZ1L 2E7MA 2IALB 1MAKA 2AEQL 2ZCLL 3SE8L 3FQTB 1RUML 4U6VL 2DYPD 4PLJC 4OD1L 4OZHB 3D69B 5IQ9A 1U3HB 3KWWA 5I6XC 4I2XE 4XAWL 4PS4L 4ZPTA 4ZS7L 4HT1L 3TN0D 4ELKB 1KCRH 1CLZH 5AAMA 4YWGL 3FQXA 4YPGB 4G9FA 3O0RL 3C6LC 5ESQB 3OG4B 1J1OL 1Z9SA 3SO5A 1U8HA 2YXMA 4PJXE 1KXQE 3GBML 2ORBH 3K2MC 4LCUB 4OUOA 1Z3GL 2JB5L 4E0RA 1CD1B 3RNQA 4FRWA 5AYUL 4XPBL 3BKML 4ZODA 5T5FL 3VGGA 3FCTB 3V0VB 3QIWB 2X9XA 3OPZH 4PD4J 1S7VB 3VGDA 3ARVA 4AL8H 5SX4I 4Y2DD 5I0ZA 2LU3A 3QA3B 2HRPL 3KLSA 4LQFH 4UT7L 2VUYA 5DWUH 1ADQL 1N6VA 3H0TA 3R06A 3ESVF 1CLYH 3T65A 2F8OA 4XWGH 2YPKA 3K4ZA 3AS0A 5IBUB 4G7YH 4U31A 3UYRL 1A1OA 3FOLA 1QPXA 3BP7A 4JN2B 4M93B 32C2B 3CUPA 3QNXB 4JG1H 5I8CB 3FRUB 4G7VH 2YN3A 3BDBA 4YGVA 3T4YB 5HGDB 5EZIL 1JYXA 4UINL 2YBRB 3QSKB 5C0RH 5JHDB 5EUOF 3KJ6H 4KRLB 5TE7L 2P8PA 5C0GB 1E6JH 3AUVA 3S6CA 1JGUL 3RWJB 5B38A 4JY4A 1JPST 3O11A 4OFPA 3NFPB 2YC1A 1A9BB 2A1WH 4M5ZH 5DD5L 5IB2B 3ARPA 2BRQA 3D3VE 4JCMA 4KU1A 4P9HH 3OF6D 1BIIA 3NZ8A 3PWPB 3ARUA 3U0PB 5IFHH 2R2EA 4U1GB 3SGKC 4X5WB 1Q72H 1EUUA 4FQJH 2LAGB 4LLQA 4QTIL 1NJ9B 4ZNCD 3LKNB 1LQSR 3GSNB 5T1KB 1YDPA 3IDXH 4LF3A 4X4YA 5F97E 4LLVB 5KSBA 4F80A 4LCCB 1HINH 4YR6B 5C07A 3EFFB 4R0LB 4Y5VB 1JMXA 1HXMB 2NX5B 3S36X 5HYQA 3N9GL 4RGNB 4Y2DA 4DKFH 4EQ2A 4HIHB 1M1SA 1LP9E 3ZE0F 2GJJA 3MRJB 5E08L 3W0WE 5CEZH 1T0PB 2OLDA 4Q58C 4YDVB 1H3VA 1GGUA 3QQ3A 3I6LD 4P0DA 2WLZA 1DQLL 5KVDL 1I1AA 1UZ8B 3HRZA 2BSED 4U4BA 2I9LA 3LKOA 3QFDB 3P9LA 3BE1L 3RIFF 4F7TA 1IM3A 1YEHL 1IC4L 3W11D 5L0QC 4XNZC 4Z8FH 2WK2A 3LPFA 3EYFA 5EU6D 4EVNA 4PJ7F 3W2DH 4PY8J 3DMMD 3TBYA 1I1CA 1T5XA 4XP5H 3G5XB 3V52L 2UY7A 1UM4L 2G60H 3QQ9C 3H7BB 4K3JL 4GSDH 2NW3A 2YZ8A 4JCLA 1OT2A 1F11A 1MJJB 3GIVA 3DECA 3DPBA 5IFAH 1PJ9A 4QF1A 2CK0H 2NPLX 3MRNA 3DV4A 3X14A 3MRQA 3C6LA 1UJTA 4KKBD 1PQZB 1HYSC 5F8QC 5ENWB 5SWZD 1IGTA 3OZ9H 2QSTA 5JW3H 1YC8A 4XP1H 3PDGA 4YO0B 5BW7C 3GKZA 2EZ0D 5C70A 3L3IA 4E41D 1AH1A 1TENA 1EHXA 4I48A 3NFNB 1INQB 4M48L 1VA9A 1DJSA 3NZHH 3UPRB 5EUOE 2BVYA 3IT8D 4NZRL 2VR9A 1F58L 4QRRD 4NO3A 4QRQA 1WBYB 1UA6L 1OOAA 3BP4A 2C4FU 2N4IA 4JDVA 3TBWB 1OY3B 4I2XB 1YMMA 4NQCD 4Y4HD 1RJZB 4M3JA 4Y19E 5JQ6H 1DQQA 1V7MH 4KVNL 4NWTL 5T3XH 2GK0B 3O2VL 3O6LL 3MJ8A 3SE3C 1FO0H 3PWNB 1OTUD 3BXNB 3B5GA 5DK0A 5AZ2H 4OBSA 2C1PB 3HNTH 3O4OB 5T3ZE 2FECL 4PJXB 3GSWA 2CDGA 4S2SA 4OZGE 5C0CD 5CD3A 7CGTA 1YUHB 2V2WA 2NY2D 1MFEL 3W9DB 4DZBB 5I1LB 1BJMA 2CXGA 3F12B 3CZFA 4IDJL 4OLYH 2BSRA 3OG6B 1ONQA 4O02L 2PTTA 2E9BA 3S97C 5GRXG 4NM4L 4LLYB 4IHOB 2YPLE 1JHTB 3SGKA 2AXHA 1GHFH 2O26U 2LAAA 2ZUQC 5EFIB 4X9BA 8CGTA 4UMGA 1FAIH 1OGAE 5EU4B 1G84A 1SEQH 4GG6A 1LK2B 1H3GA 4E41A 4GAJH 5E6IC 2IMNA 2AP2A 3D2UD 3PWVB 5FHAL 4OD2B 4U6XA 5HHQB 4PJ7E 4CUCA 5DUMH 1OAQH 1ZE3C 5IMOA 1A2YB 4ONFH 1XCTB 1HI6B 2RIKA 3BH8B 3LIZL 3QDGE 3GUTA 3ZE2F 5JPNA 4RAUA 4LFHD 1BAFH 1FG2B 2W59A 4Q0XL 1MWAL 3ARBD 4OM1H 3LN5B 5GS2H 3RY4A 1PYWA 5CMAB 2AEPH 5I9QB 1A7BA 4K8RL 1JPTH 3VFWA 2RBLA 1UYWL 3QUML 4YZFE 3EYSL 1UVQB 4NQXB 4Y5XB 5GZOD 2EIZA 1Q9LA 1ZT4A 4G6KL 4MNQD 4K9EC 3WUWG 5AZEL 4JFQA 1NCAH 5IM7A 4QNPF 1Y6KR 4HQQH 4LMQE 5GJTH 3KPMA 4KQ3L 5J57B 4X5XA 5JPMB 5JNYB 2V7NA 2CRZA 2K7PA 2DWDB 3T2NH 1LP9B 3MLZL 4YIQB 2HVKB 2FECI 4FQPA 3T04D 1MIEH 3EKCA 5FEBA 3U79A 5C0IB 3MA7A 5IW6B 5IVZB 2XZAH 1W8OA 4X98A 1ZLSH 2DIAA 3VXPA 4HHAB 3ZE1F 4W4OC 1OGTB 1XGPB 5C0NC 2MHAB 2XKSA 1NEZB 4Q74A 5MEOB 1G6RH 1M71A 1AXSA 1AO7D 2D3VA 3WFCH 2DLGA 1WIOA 2ZJSH 5BW7A 5F1KC 1UWXH 3MLRL 3PGDB 4WUKL 4HMEA 1EVUA 1I8KA 1CE6B 1OSZB 2VXUH 5HDBF 1NCWH 4YHIB 4Z0XB 3UJTH 4RBPK 1I4FB 1NAMB 1NH6A 2HFFA 3QCVL 4NKMB 4RWHA 1F45A 3ULVE 2V2TA 1H3PH 4H0GA 4UU9A 1QSFD 5EC1B 5HGHA 4LEXH 1OARL 1QG3A 3MFFB 4XMPH 1N6UA 5DHVH 1J1XH 2CKBH 4R4NC 4XC3L 3SE3A 5E9DE 4DW2H 5CAYB 2EDJA 1B9ZA 2X41A 4LU5L 1L9MA 2NY0C 2FIKA 4JLRB 1S9WA 1MCPH 4KFZC 4I4WA 4MCZA 4OFIA 3TIDB 2VYRE 4MNQA 1WC7A 3E3QE 2P5WA 4RZCB 4X8JB 4P2OD 4ODVH 1CR9H 4NOFA 2VXVL 1YNLH 2AJ3A 2Q87A 3AU1A 4P3DB 5EIIB 2R1YA 4XZUB 2DWEA 1XEDA 3RA7H 1NGZB 4EBQH 1KFAH 3T4AA 1IFHL 4WGVB 1UB6B 5JIPA 3L3OA 4MDIB 1RZFL 1JTTA 1MHPH 1K5NA 2NYYC 3EOYG 1KIPA 5DTFB 2JJUA 3TGXA 3B8SA 3H42L 4TQEL 5DJDA 5LXGH 1I1YA 1AJ7L 1FNFA 1WBXA 2GQHA 1MHHB 2BNRB 5C0ND 4MX7B 1JZ8A 2N7BA 4JFPB 1MFCL 1X7QB 5E6IA 2Q76A 4HG4J 1GC1C 5KSAC 4HC1H 3T0EE 5GS0D 3UJJL 4ZFOL 4MNHB 5C09A 4Z78A 5FECA 4OZGB 4ODHH 5I1CL 2ZPKL 4FS0A 2AXFA 4DTGL 1BJ8A 4Z76A 2J8UA 4OLXL 1EJOH 4RQQB 3RNKB 2VL5B 5EN2A 3P9MA 2LU4A 4PY7A 3GFUA 2X1PA 4HWBH 3HZVA 4PJ5A 3QFJA 4I3SH 5E8EB 5T1LD 3SQBA 2F58H 2YD1A 4NJ9H 2YPLB 2ZKHH 2NY0D 1GIGH 4ERSL 5I30L 3SKNB 1UWGL 1OGAB 1JNHB 3TNMB 2H1PL 4PV9B 4RISH 2VLLB 3LVEA 3SPVA 4PG9A 3FB6A 4R2GC 3P0YH 4WEMB 4DQOH 3BD5A 4RGOL 3C6SB 1SMAA 1IGCH 5HDBE 1A7RL 1LVEA 1RFDH 5AYQA 4F8TA 4RRPG 4R7DB 4TPRL 1JPFB 2R69L 4GKOA 1JK8B 2X70B 1HK6A 3MRHB 4J4PD 3VFTA 4YC2B 4MQXD 2WIMA 2ZCLH 4U2ZA 3C5SA 3C87A 4PGZA 4OD1H 5A3ID 3QDGB 2F53B 3BHBA 4W4OA 1HXYB 1RZKL 4WDIA 3KNBA 2F54D 2XTJC 3MLYH 1S5IH 3WO3B 3PNWA 4NQVB 4P3WA 1U2CA 4IRZL 4ONGL 1CFSA 3TZVB 3RUGA 5TJWK 3UTZB 4R4FL 3O0RH 3LQZA 5F3HA 3ROOB 1JWUB 5TH2B 2QSCH 2YRLA 4PJEF 2H3NA 1KB5L 5J11B 3MMEA 3UDWC 1F8TH 4CVZB 1ZLWK 1XR8B 2AABH 4PJGA 4JZOA 3PV6B 5AYUH 3BKMH 3ULUL 3LMJL 4FN0A 4DGYH 1I3RA 5T1LA 2A77H 4H26B 3E6FB 2HRPH 2Y25A 5CUSL 2V5SA 4P2QD 2X7LB 4XVJH 1MSPA 3C2AH 2OZ4H 2M1KA 2BOCA 4JFFD 2APVA 1IILE 3UYRH 2MPAL 1HOCA 1K8IB 3EYQD 1DDHA 3MUGB 3GMPA 2PCPB 5BO1H 1A6AB 3ARFD 2NXZD 2YD2A 2NY1C 1BF8A 4ZTOH 4LLUB 4MD0A 4UINH 3RWGB 4D94A 5TE7H 2JJSC 4PJ8D 4TNVF 5JZ7D 3DYOA 2HKFL 4TRPL 3MV8A 2D7OA 3TT1L 4UIKL 5I76B 3MRKB 1CLOH 4LVHC 3TVMC 2QQNH 4QHLB 4N0UE 4LLDA 2AQ1A 2ZUVA 3MRDA 4OGYL 2FATL 2IBZY 2R2CA 3VRIB 4HS8L 4G8FA 4LIQE 5MENA 5KSAA 4IJ3B 2IH1B 2P24A 2KKQA 3O6KL 2QQKH 3MJGX 3QZWA 1FAKT 2Q8AH 3KYOB 4N9OB 1UEMA 2BCKB 4PYGA 1K6QL 5DHYA 5FOBA 3SKJH 5C08D 2KUTA 4JPWH 4LHUA 1FN4A 2IJ0C 4LPXA 5TE4H 3F7QA 1FVDA 1EXUB 2BRRL 2VLME 3BZFB 3CC5A 5E08H 3H9SE 3M1BB 4MAUH 4Z7VE 1U93B 2W0LA 4Y1AE 3T77A 1ES0A 4KROD 4J3UA 4D0BB 3SDYH 1T2QH 1QBAA 2SEBB 2ADIB 1YN6A 4GRWF 3BE1H 4LRIC 5CKAA 3SCMD 4C83B 3T0EB 4J2XA 1OVZA 2LTQB 3JXAA 4D9LH 1ZVYA 4BELD 2VISB 4PJEE 2NY1D 3RWCB 1S8DA 1JGLH 4EUPA 3NPSC 3BEVA 3U6RB 2FDBP 4LNVA 3IETB 4IRJB 5JOFA 1U8PB 4KWUA 4R4BA 4X8XA 5AUMA 3V52H 4WUUA 1JHKL 4ZOBA 3UTQB 2EC8A 4GQ9L 5IB1A 3TCLA 3WL9B 4CJ1A 2OYPA 4D3CL 2MQCA 2O5XL 2EEBA 3DO3A 4C4KT 1XF3A 2VAAA 4XBPB 4XTRC 5DMGD 3VWKC 1QHPA 4Y5YC 2VLRE 2XN9E 1RJCA 3D0VB 4NGHL 5IMMB 3NH7L 2XZQH 5TDOA 3WFDL 3UDWA 2YHGA 1JZ2A 4CDHA 4HJ0C 2X4OA 3FQNA 2GJZA 1N4XL 3E0GA 2QTEA 1G1CA 4OIIH 5I8EB 3V7AG 4KV5F 1BQHA 2VZ1A 5D7KD 2C3HA 1S7WB 3MODH 4FABH 1F58H 3DX9B 3HPJA 2H6PA 3LRSA 5IV2A 5HVFB 1UA6H 3VFGL 1ZHLA 1BOYA 1MCHA 2VNCA 3TH2T 1YPZF 3HRPA 4U7MA 3WIHH 3WEXB 3AGVA 4IRSD 4L9DA 2VDMH 4NWTH 3S88H 2OX5A 3O6LH 5FCSH 1YECH 5DXWA 1LE5B 4KI5D 1XGQB 4I18B 4PRID 4LKXA 3EHBD 5J6GB 5DHXB 3BIBX 1S7SA 3MBEB 2GEEA 4K7PH 5A43C 4MD4B 4RNRB 1UJ3C 2DTML 5K9OB 3RKDC 4D0DA 2C5DC 2JJSA 3QO1A 3LHPH 2ED9A 4Z7QF 1E28A 2YWYA 1ZV5A 5T1MB 4S1SL 2APWA 4IDJH 4GAFB 4OI8A 4YK4B 4KZEH 1XIWB 3TVMA 1EX0A 4POZC 3BWAB 1ORQA 2MNUA 4ZXBB 5C0BE 3IGAA 1VEMA 1J12A 3CFJA 1JI2A 3WN5C 5IROC 3BJLA 4BQ6A 4OQTL 3E6HB 3VWKD 4BQ9A 1FZJA 1D5ZA 1S3KL 1CFVH 4HIJA 1BFOB 1QSED 2QKIA 3HZKB 4R9HA 4FTVD 2G5BA 5DD6A 3T0VA 5IFJA 5FHAH 3MX0A 2NY3D 5EUOA 5LGHL 2BMKA 4WI7A 1AGBB 4PREA 2DBLH 1X9QA 3TA3C 2HRLA 5F93C 2L7UA 4RA0C 5IK3B 5KAQG 4JHZA 3OKOB 4PRPD 1T0MB 5D7LD 4ZS6D 2BK8A 2L0DA 3DSNA 4Y19A 3WYRA 1AXTH 3CCHA 1DVFB 1MWAH 4N0UB 3SQOL 1NANI 4HS3A 5JOPE 5I15L 3IDIA 1SJHB 4LSPH 4OCWL 1OTTD 4LRIA 1NAKH 5D1ZD 2GAZB 2OL3H 2XQBL 4Z7UB 4QXTB 2AJXL 1RV6X 3RZWA 4TULL 3QWOB 3CZJA 4G6KH 1F4WL 1T1XB 1TZIA 4GLRI 2P8LB 4M1CD 1CICC 5ECJE 1N6QH 2AV7A 1QVOB 4NKOA 3V2AR 4L3AA 4KV5E 4ZUVA 1F3JB 2VXTH 3FQWA 4Y16D 1OWRM 2A9MH 1VFBB 5GRVK 4FZEL 2ICWI 4UNVA 1KV3A 5K9JL 3H9SB 1Q9OA 4KJPC 3N1PC 4Z7VB 4NT6B 5L9DH 2IGFL 4RAHA 2KPNA 3MLTB 3SOBH 3VWKA 4H1LB 4PRAB 4MQ7A 4WJ5B 4Y5YA 1G7IB 2VDPL 2FJFA 3T3PE 1EH9A 4YXKH 3QBTB 3BZEA 3UBXA 1QSEA 3G5ZB 5IHUL 1IKFL 2PW2A 5H35B 2HLAB 3MLRH 2OJZH 4GUPB 3G6JA 2F9BT 3U30B 1T22A 4AQ1B 4PJ7A 3WMSA 4FFWD 3UPCA 2QQLL 3FQRB 1J8KA 3LRHA 2VB5A 3WKML 4YBHA 4Z7QE 5FF6B 3QCVH 4HPYL 3FRPA 4YHPB 4UI2A 1H3WM 2XWTB 4PRDA 2ARJB 3PWUA 1RZJC 1NMBL 3CFBA 3BZ4A 1HHGA 3TO4C 5EBWA 3U1SL 1UT9A 2XPGB 4QY8A 5DJYA 2EDYA 5C6TL 2L4OA 2A0LD 2K3TA 5J56B 1CGTA 3OJ2C 3VXOB 1PZ5B 1MUJA 4N0RA 4ZUTA 1QFWH 2WP3O 4PD4K 4WWKB 2VLRB 2XN9B 2XXCB 4B41A 1F4XL 1A6TB 3OGCB 4MHHI 1UJ3A 4GMTL 3MO1B 1T03L 2H9GB 2BVOA 4ZDHB 1U0QA 1I7TB 5EOQL 4G6JH 2V5TA 1EEQA 1YYLH 1D9KC 3WD5L 3GNMH 5EBMA 1J8HD 1T4KA 2VZVA 4NQUA 3T08A 2R29H 5IB3A 4HK0B 2DI7A 3VXMA 4NSKB 1ODAA 3GMQA 1WTGT 2OK0L 4M4RA 3VA6A 1NC2B 3V8OA 3WN5A 4O2FB 5IROA 1PY4A 3P4LA 1FSKC 3DROB 1SY6H 3OX8B 1SHMA 2EDDA 4P46C 4LPCA 1NUNB 1MFCH 5J12C 1NFDE 4YHOL 4JB9L 1TTGA 4HCRL 4KGLA 3CXHJ 2GT9A 1MRCL 4GBXB 1ZA6B 3TA3A 3RDTB 1I9IL 3D0LA 3BKCL 3ILPB 1B2WH 3RVUD 1NUGA 1X5XA 3ARDC 3U0TB 2Z91A 2FR4B 4R8WH 4L8CB 3O9WD 4K7FB 4XNMA 4ZO6A 5KVEH 1ZVHA 3GJFA 1FC2D 2QHRH 5E9DA 5C0BB 1D7FA 4ZFFB 2R4RH 5E24E 1KTRL 3AREC 4C56D 2NLJA 5I75B 3K2UL 5IBTH 1AD9B 2J8OA 1UWGH 2CK2A 5DVNA 1T1WA 2AK4D 5EPMA 3MLXH 4MLSA 3QIBC 1N3NA 3LRGA 1QR1A 4YNYA 1CICA 2FHBA 1KLUB 2B39A 3JV4B 3TBSA 4LLWB 4Q97A 1KB9J 3ELAT 4KHXL 1BOGA 2NY4D 1FFOB 1ZK9A 2Z8RA 3EOAB 4OCXH 1A0QL 2K9UA 5L8LB 2YKLL 4JFDE 5IW3A 4CMMB 5L2JA 5KVFH 5CHNB 1X3DA 1ZT1B 4G8EB 4QRPE 4OCNC 3BQUB 4JKWA 4MDJA 1MCCA 3O2DA 4KK9C 3Q5OA 4MYWB 1BP3B 1IEHA 3CDGB 15C8H 3KPQA 5IW1B 4S1RL 4P2RE 3QDME 3K8KA 3F7PC 3STZB 5IB5B 1MH5B 4N9GB 5FCUH 5FYLH 4U0RC 3HI1A 4WCYL 4EI6B 3RX8A 1UKQA 4U1KB 2B4CC 1A3RH 3MLPA 1SQ2N 3Q48A 1KYOK 2GFBA 3ULUH 3K3QA 5CEZE 5KBNC 1QOKA 1U8IB 3TO4A 3ARDD 3MC0A 5HHOD 4O51A 1BM3H 2J4WL 3MRCA 1T04B 1FZMA 1A7PH 2BHUA 2X9WA 4RWYL 4PRHD 1KB5B 4GRLB 1Q1JL 1HH9A 3P73A 4KK6C 2EDWA 3BDXA 4F37F 5FK9A 5MEPB 5ESAB 3QIBD 1KNOA 4WFEE 4WW2F 1O5DT 5CP3H 3OKEA 1D9KA 1P4BL 1YNTB 4I0KA 1BWMA 4WW1B 2ZUWA 5DEGA 3KDMA 2E8YA 4Z5RA 1BBDL 4HKXB 4X4XB 4OM0H 3TT1H 4UIKH 4JJ5B 3BPLB 4EKXA 1IAOA 1ZAGA 1YEEL 2PR4L 3M45A 1W72B 1CGXA 4ODXA 2VE6A 5DC4B 4XBGB 4P46A 1A1NA 1BBJB 3K1DA 4HGWB 2FATH 3BYYA 3LKPB 1BJ1H 2BHZA 2WZPD 4HS8H 2H2PD 4PJHF 4MAYB 4K3GA 1DBBL 3TIEB 2J5LB 3WFHB 3ZMRA 4OZFB 2IPTH 3N06B 4L4VE 4OGXH 4JKKA 4DEPC 5DLML 3B2UD 3R1GL 4H25B 4TNWK 5TFSL 2LU7A 2ADJB 3G6AA 1A6UL 3ARDA 3NIDE 2HT3C 1K6QH 1N8ZA 2R0ZL 3QG6A 4U0QB 5I1HL 2BC4A 1RZGA 2CPCA 1EFXD 2BNQD 3IJHB 2BRRH 2Z31D 4O9HL 3M8OL 5T3XE 3LEYL 4PRHA 1T1ZA 5KS9A 3AREA 4M62L 3I6GB 3GMRB 4HJGB 3NTCH 1BX2B 1CD0A 1AR1C 5F7LB 1J11A 3CK0H 3GHEL 4KK6D 1QA9B 3DETD 3QIBA 4XPHL 5E2UL 5HHPB 3L6FA 1NFDB 2E7CA 3F58H 4YLQT 2XA8L 5IEHB 2EIBA 1WZ1H 2GSIA 4FXLA 2OQJB 5AWNH 2AJUL 3DYPA 3K80A 4CNIA 3L3KA 1DEEA 1UB5B 3KXFB 5LCVH 2VIRB 2OP4L 4KDWA 4KUZL 2J88L 1DBJH 1PX3A 4ISVA 3O3DA 4XCEA 4KUCD 1DANT 4UDUA 4APQB 5IMKA 4JRYA 4D9QD 3QXWA 4PB9L 4JRXD 4HF5L 1BFTA 2IQAB 3QHZL 3O6FB 4NUGL 2AJYH 5EU7C 1N5AB 4D3CH 3SDCC 4DN4L 4PIRF 1E4WH 5GRWA 2ENYA 4QHNB 3UJIL 4YQXL 3JTTA 1IQDA 5E2TH 5F7DA 4CMHC 2ICES 5FUCC 3KPRE 4HEME 4NGHH 3RVTD 3H3PL 4NNPL 3B9KD 3TYGH 2VXSH 4JDTL 2PYFA 2BZDA 1KG0B 4LBEA 4ZTPH 2WINA 1AQDB 3G6DL 1INDH 4KRPD 5JW4Q 2P44B 4Z7OF 3CLEH 2YD9A 3RPIB 4K23L 4DAGL 2CD0A 4YXLL 1GZQA 2XG4A 4WTWA 3VFGH 2E9JA 4H20L 1U8OA 4Y1AA 5GIRB 1D6EB 4FXKA 3QO0B 5HYJD 4FG6D 4QRPB 3MV9D 1T5WB 2DQFB 3HE7B 4MMXC 3TPUB 2GK2A 4KKCC 4I5BB 3T2OA 4PJHE 4RGMB 5DSCB 1N5YL 2NZIA 3QDMB 1XGUA 3DVGA 4XNQB 5MP6L 2O5YH 2WWMC 1VCAA 2RQ8A 1JN6B 4L8SC 3STLA 2YD4A 4IS6B 2AI0L 4M7JL 4TUKL 5BRZD 1RQ5A 1UQSA 3NOIA 3I85A 1MHCA 5GGSY 4S1SH 5DJ6A 3S5LB 1IC1A 3FFCB 2UYLB 1NDGB 2X4UB 4Y4FB 3BGFB 5JDJA 3WDIA 4JZJC 2ICWB 3RL1A 2IAMD 1JUFB 2KZ1B 2Z93A 3HG1D 5FDWA 4OV5A 4RA3A 3S37X 1PG7X 4XHQA 1NGQL 1TETH 4LPUA 3MZTA 1I7UB 1L7TH 1V3MA 4U33A 4WU7B 5C0EA 3GJEB 5KW9L 1NC4B 4KAQL 3TC9A 4OJFH 4QO1A 1LO4L 4R7NB 5LGHH 3D85D 4X9HA 4OKVA 3J7HA 2HKHH 1X5FA 4RAVA 5LKNA 2DB8A 1IAIH 1RJLA 4KGJA 3OGOE 4G6FB 2LVEA 5H94B 4HG4K 3B5HA 4MHHG 4I0PD 5I66B 4Q9QL 1J05B 3UTSE 4NUJA 5HPMA 3MRGA 5FM5O 2AAVA 1A5FH 1CDHA 2JIXD 4ZOAA 3RTQD 4HFUH 2JE8A 4ODSH 5BV7C 3TBTA 4GT7A 2MKLC 3RIFK 5HHNA 4UUJB 2X1QA 3OB0K 4YDKH 4TOYL 5DVMA 5GS0L 9CGTA 4L4VB 4N8VA 1U8LB 2WWMD 1WZLA 1IKNC 4NO2A 4QWWC 4Z7OE 1SJEA 2B20A 4OZIE 1YJDH 2QADC 3EDFA 4U1SA 3CMOH 3HUJF 1TZHA 3U36B 4GMSH 4JPKL 1YN7A 1HILA 1YQ2A 4PLKD 4PJAE 3T1FB 5EO0B 3IU3B 4FZEH 1X5KA 3SDCA 5K9JH 3OKDB 3SJVE 3PP3K 1CK0H 4Y7MA 5BCAA 4JG0H 4X6EB 3REVA 3V4UH 2ZOKB 1QRNB 3RZCC 1TNNA 2F19H 2QBWA 3IDGB 3NIGF 3DO7A 5D2NC 4PJCB 5IHUH 4LVNC 1TQBB 3VDCA 3DVFA 4XX1E 4L29B 3CH1A 5DK2A 2NY5H 4LNRA 4MQSB 3GSUA 1SEBA 4ZO9A 3VFVA 3MUY1 4MQTB 2EICA 3W81A 3MRBB 5KG9B 1WFTA 5GGRB 2GITB 3LQAC 4G9DB 5C8JA 1D5XB 3U7AA 2J6EL 3UZEA 4HPYH 5C9JB 4LGRB 4LAQH 3LN9A 1MVUB 5E8DL 4I77L 5INCB 4L3CB 4ELMF 4W6WB 3U1SH 2JIXA 1CT8A 1AGDA 5HGBB 3SY0B 1H0DB 1K4DB 2Y6SD 3PHOB 4G8IA 4P4KC 1ZHKA 4N1CA 4CW1B 2IF7A 4YE4H 5SWSA 5JDSA 4IOIA 1NCDH 5EOTA 1F4XH 1LE9A 4YH6A 4AMKL 4LPWA 3KPRB 4Y88A 1G7LA 2FYYA 5C2BH 1IL1B 5ITFB 4L8SA 4U1JB 5H8DA 4N90D 4M3KB 5D71H 1QSZA 5LQBL 1GJIA 1ND0B 4PLNC 2BVUA 5J13C 2E6JA 5DUPL 4NP4H 1QR4A 3PGCB 3M17B 2VZSA 3NGBC 4GXVL 4EXKA 4J7RA 1ETZB 2IANE 2R0KL 1FBIH 1Q0XL 5D2LB 1YPZA 5CEYA 1OM3L 1AFVL 1CDCA 4KJWD 4U1MA 3BO8B 1KJ2A 3PHQA 3QIWD 4M43H 2NZ9D 5H37G 1X5JA 2V9TA 3BP6A 4ORGA 5GGSA 3ZKXC 1BVZA 4LCIL 4PGBA 1J5OH 1GGCL 3HLAA 3IFOA 1JYVA 4DGIL 3T09A 2Z0BA 4FFZL 3DRTA 4WO4B 5EZOH 1MRCH 3PWJB 1OLZA 4HX1A 4EDXA 5IB4B 4LSVL 5DMJB 1HH6B 2P49B 3E2HC 2XKNB 2FEEL 3BKCH 3OR7A 2Y06H 1FQ9C 1M7IA 3HUJE 3X3FL 2PTUA 2VC2L 4BSVA 4HXBH 5D1QC 4DZ8B 4JANB 5JHDD 4QRTB 1G6RB 3FQTA 1YNKH 5HBBA 4M02A 1AP2A 3D69A 3DUUA 3MRFA 5KSUB 4XHJD 3P0VL 1WZKA 4JDZA 1KJVB 3K2UH 3BX7C 3CVHA 4QXWA 3NIGE 1LEKB 4EI5C 3GSVA 2CJUL 3GRWA 4P57A 1S7XA 2FCBA 1IKNA 3RVVC 2O5ZH 4UOW1 4X7DC 6FABH 2EYSA 4NCC2 1X4ZA 2R23A 2ZCHH 5IVOA 2UWEF 1LO2L 3DXAA 5I1EH 4G42A 2YRZA 4FQQB 1XR9B 1CVRA 4XCYB 3GM0A 5T1KD 3QUXC 5EORH 1A0QH 1I85C 3NCEB 2XWBB 3DV6B 3UTSB 3RPKA 4OLUH 3L5JA 4WTXA 2NX5D 35C8L 4NBZB 1OQOA 3SE9H 3VXSA 1MREL 1KXVC 4EN3C 1SJVA 4OF8A 4RGND 4LSQH 3RZCA 4L9LC 4YBQC 5L6YL 2HTLC 5D2NA 3ZKND 1LEGB 1A64A 4NO0B 4HWNA 4Z0BL 1KEGH 2H41A 1C5BL 5DD1L 1KIUA 3Q6FB 5F7EH 3JV6B 3R0NA 4WCYH 5HY9A 3O3EB 5HGAB 1MFAL 3QNXA 2MCG1 4HW6A 5HGDA 2JK5B 2DQIL 4OZIB 4WEBL 3OXSA 4TUJA 1JJUA 3S36H 5C0DB 1BQUA 2X89D 4PJAB 4RFNC 5C0GA 2ATPB 1KELL 3R8BB 1TQCC 3PV7A 4RWYH 1I1FB 3VG9C 3KYNB 4P4KA 3NFPA 4KK5D 4KJQC 2AEIT 4KMLB 2BJML 2DMBA 1Q1JH 2GY7B 3LY6A 3BPCA 1CFQA 1KLGA 2B1AL 5D1XB 1CQKA 1P9MC 3CSYA 3VFUA 4BK4A 4AM0B 5DRWA 1WCBB 3IVKB 1NCBL 1MOEA 2R1WB 1IJ9A 1JV5A 1WEJH 3Q5TA 3GBNL 1RUQH 2VDLL 4FQIL 1ZGLP 1ACYH 4LRNL 4DCQA 3SO3B 3DX6B 2PW1A 4O2CB 3L7FB 3EFFA 1OPGL 4JFDA 4ZUWB 4A6YL 3VXTB 3U4EB 2NX5A 4ODUB 4RFEA 5ETUA 5EU5A 2GW5A 4YHYC 3BPOC 3PGFH 5IIEB 1R24B 3B8YA 3HHRB 1XFPA 1FVEB 5D96C 1CTNA 4GS7C 4UILL 5H2BB 4L8BA 2DQHL 2C3VB 1KN2H 4JM2F 4MCYB 5M95B 4JPVH 2F15A 4OAWB 3C5JA 5HJ3B 4IBLT 4X6CF 5D7JB 4WW2C 4CU7A 2B1HL 1G0YR 5TFSH 1XGYH 5EZLA 5FM4A 4MJ5B 1KIQB 4L1HA 3HNSL 3G04B 5D1QA 4QRUA 1WAAE 3MLWL 2IANB 3HB3C 5D93B 1S5HA 3LEYH 1WSST 1WICA 5FV2A 4S1DC 3D9AL 1R3HA 1F02I 2VL4A 3QNZA 3QEGH 3C09C 4EI5A 4XRCA 3MNVB 3GHEH 5ANME 5F6IB 2EDQA 4MZ3A 1Z5LA 3OHXB 4M7ZB 3QCUH 4XXDB 2ZCKH 1IGML 1U9KA 1KSRA 1W0VB 1EO8H 2OP4H 4YO0A 2G2RA 5ADPL 1NMCC 4KUZH 2J88H 2XNAB 4P3CL 4LFHG 3QUXA 1XAUA 1DBAL 4HIIA 3IDJB 1I85A 2BVQA 3MRMB 1OSPL 4PB9H 4NKIH 2A74B 5ESVA 2DQGL 1FZOA 4EN3A 4CADA 3O41A 1TJIL 1QBLH 1WBYA 4NUGH 4L9LA 4NWUH 3IJYA 1F5WA 2HJFA 3U9UB 3MUHL 3IU4H 4YFLI 4XCNB 1BZ9B 2I9TB 2Y72A 2IWGA 4YAQA 4M1GL 3H3PH 4PJ9C 2VERN 3IB4A 2NTFA 2EXYC 5EUKA 1TTUA 3G6DH 5CZVL 3QCTL 4F9PC 5C6PB 2X1WL 3GMMB 2HT4C 4DAGH 4YXLH 4UT6H 3IAQA 3MBXL 3SDAB 1OP3K 3A67H 4HIXH 1MNUL 4RX4D 4OCYH 1YUHA 4CKVX 5AAWA 3FFDB 3QEUA 1HHIB 1L7IL 2XOTA 5M7QA 3QUKB 5CZXC 2CDEB 4LVOB 5EH1A 2WIIB 2B8OT 5E4EC 1XGTA 4JHWH 4PRBA 1R3JB 2Q6WB 1BD2E 3GIZL 3VCLB 1P9MA 4IHOA 3DNKA 2HFEA 1AHWB 3MV7E 1OP5H 2H2SC 5C0FA 2HTKD 4WI2A 5EU4A 2VH5L 4R6UA 4HS6A 4X6CE 3RGVC 3P9WB 4HKJB 4Z18A 1RULH 4TNVK 1J0HA 3DSFH 4YXHL 2VABA 3N0PB 3EDJA 4K71B 3W39A 5GRUL 3INUL 3ZDZF 3BSZL 1YEIL 5CEXB 1JGEB 2FEDD 5FYKH 5TGBB 1T66C 4J3OC 1BQSA 1GGTA 1BVLA 4OGAD 3WIFB 4NN7B 2D03L 4QHUB 2NY6C 2R0WH 2CGRH 4Y2OA 5D7IB 1NGYA 3MLUH 1UFUA 4WHYG 3LS5L 2DDQL 1E6OH 3OKKB 4WW2A 5F7YC 5KW9H 2XXMB 4K9EH 4KAQH 2HN7A 2YUXA 4XPGH 3MRRB 5DI8A 1LO4H 1B6DA 2BXZA 5F9AC 4RX4A 5JHLL 1U8JA 1KIRA 2EDNA 4P4RB 3LN4B 4GW1B 3P40A 3UX9B 4BH8A 3HC0B 1KCSL 3CXHK 2YR3A 2IPUK 4Q9QH 2VJXA 3IKCA 3P11L 4YC2C 3JUYA 3S35X 3QG7H 1GGBL 1TJHL 3UXFA 2XWJB 2Q8BH 2HFGL 5F70A 3UTTA 2LE9A 4U05A 1NGXB 1BLNB 1XCQB 5IW6A 3LKRB 1OAZH 1XGPA 4HWZB 5DUBB 2JCCF 5GS0H 1LHZA 1QHOA 2EO9A 2G9HA 2WUCL 3UAJC 4DVBA 1RU9L 3WUWA 1W2KT 3SKMA 2BNRD 3W9EB 3ULUF 1S9YB 4F2MB 4KKAC 3I02A 2JJVA 5DD0H 5E99H 3DUSA 2R2HB 3B3IB 1NAMA 5T3ZD 4JO3L 4NKMA 1T7ZA 5DQ9B 4LGSB 5K9KA 2A9NL 1T66D 1NKOA 3KLAB 3EFDH 1KB9K 1NBVL 4L4TB 3TPKA 5HYSB 5GGUB 2VMFA 3LH2L 4E5XA 4N0CD 4P5TC 1AR2A 2W1NA 4PJ9A 4ZOCA 3VXRB 4KQ4H 4NC1E 2ZUYA 5ANMB 4JFOB 1ZT7B 4Y8DC 1VADB 2YPLD 1AI1L 3RX7A 2ICEB 4F9PA 1C1EH 2GSGB 1FYTE 2BSTA 3TIDA 1OGAD 2X4TA 3IDYB 1FNLA 2J6EH 1XF5B 3ZDZE 4P3DA 5E8DH 2OSLB 3RU8H 4HDIB 1U92B 3JZ7A 1B0RB 3OAZH 1MCOL 1A7OL 3LEXB 3RVWC 1NL0H 4HJJH 5TF1H 3MACH 4PGCA 4R96A 3SHSA 2XI9A 1MCRA 3UO1H 1OB1B 3WFEL 3VD5A 1HSAA 2UVEA 3QHFH 3QDGD 5DZNA 2F53D 1GC1H 4WU5A 1QEWA 3LB6D 5C0AA 2YK1L 3RGVA 5I1IL 1BVKB 1FE8L 2A6JA 1ZSDA 2XFXB 3FO2A 3TZVD 1SVZA 4TUOB 1CGUA 5LQBH 2FO4B 5D9SA 5JO5B 3VW3L 1KT2B 4MMZC 1XMWA 3N1MC 5DUPH 4HMDA 4KTEL 4I9WE 2D2OA 2YSSB 2FX7H 5GGVH 2R0KH 4F7CB 1Q0XH 1X6LA 4RQQA 3RNKA 5EZJB 3SJVA 1AFVH 3WFZA 1VACB 4FZ8H 2Y36L 4LOUC 4DOHE 4YX2L 5KOVC 3IFLL 1MI5E 3ARYA 2OL3B 1BD2B 1QQDB 1Q9WB 5F96H 3QUYC 1UM6H 4P5TD 5FYLE 1GGCH 3VFPB 2MWCA 5DR5L 4XVTH 3MV7B 4TTDD 4GW4A 4TVPL 4QHKI 2DLFL 3EOBB 5DJ2B 1M7DA 1CFNB 2DKUA 4PV9A 3ULUE 2X5PA 4EUPH 3FT3B 5FB8A 3C08L 3C6SA 5F7FA 1OCWL 3Q3GA 4HKZA 3SEPA 4CU6A 1KCVL 5J1AB 3HS0A 4ACPA 3QWQB 1JPFA 4BSWB 2HT2C 4M6NH 5KVGL 4PP2B 2G75B 2XV6B 1N0XH 4MNGA 3X3GH 2EE2A 4IRJC 1WFNA 5DRNB 3ULVD 4OLVL 5ABDE 2RFXA 2F53A 1Q94B 4JFEE 5I1KL 1HXYA 2YOCA 4QXUH 1KTDB 2QHLA 3L3DB 4OGZA 4U3CA 3PWLA 4HLZG 4JREB 4ZUUB 3S98A 1PBYA 4F15B 4RRPA 1B90A 1NLBL 2VLJB 1B4RA 3N1FC 5FGBC 4PUBL 4F3FB 2VZOA 2A6IB 2Y7QA 1PKQE 1FORH 3NACL 3UTPE 3RP1A 1IM9B 3UYPA 1BEYL 4NQEE 1LDPL 4KHTL 4H0IA 1CXKA 4NNYA 4QT5B 4LLMB 1FVCB 4MSWB 3KVQA 3G08B 1VFAB 4U1IB 3REWB 4U6YB 4P5TA 5L2KE 3MCKB 5L6YH 4XAKE 3KYKL 1FLRL 1P7QB 5B39G 5BVPH 4QLRA 3LOWA 2DMCA 4RMVA 1A6VL 3UC0L 1JPGB 3BGAA 1CGYA 1NPUA 1C5BH 1ORSA 4M9OA 1A7NH 3U7YH 1ERNA 3QJFB 3SDDB 1KPVB 4KJYA 2WV3A 2FL5A 3O8XC 1QYGH 5MHSE 2R1XA 3HUJA 5I16B 5JQHC 2DQIH 1A4KA 4LLUA 3RWGA 3T0ED 1ADQA 3B9DA 1AD0A 1ZEAL 5F88A 1KELH 4P5MB 5J3HC 3IAGC 4HPOH 4IRJD 3GMNA 5EA0L 2DI8A 2J1KA 4NZJA 5GSVA 4Y4KC 2BJMH 1M6OA 5I74B 3PQYE 3WXVL 5CGYC 5D7SL 3NAAH 4ZXBC 1NBZB 3MROB 1NCBH 2AXGA 2VDKL 3HI5L 1RUAH 5M94B 1P5VA 1HYRC 1S7RA 2AEWA 1P2CB 4E42B 3O45B 3OXRB 3F7VA 3G5VB 3VG0H 1W8NA 4UT9H 2DQEL 1R3KB 4ELMA 3BPNB 5TDNA 4FFVC 1OPGH 3CFIC 1U8MA 1VEOA 3VFOB 4A6YH 1WIPA 1NMAH 1GGIL 1RHFA 3P4NB 1UM5L 5FA4B 1P4LA 4OBRA 5GGTL 5T5NG 1K4CA 2DOCA 3QUYA 3VFRA 2W0FB 3J8F7 2FB4H 2W9EL 4M6OH 5ID0A 4D0BA 4I3RH 1DANU 3UROR 1P53A 1U8QA 3QP3A 1GVIA 4XVSH 3V6OE 2AJVL 2BY1A 3KJ4B 1TVHB 3VD7A 1OAYL 3WS6C 1WWBX 2APFA 1FIGL 3OB8A 3PJSB 4L3EB 1T2JA 1LK3L 1DSFH 1GPOL 5HHME 5FO8B 4HD9A 1DL7H 1DBKH 3V5DA 1AGFA 3T0WA 4KTYA 3NBNA 3RWDA 3MNZA 1LMKA 5DVLA 3KPNB 3MBED 3N85L 1A9EB 2LABA 4O5LL 3EUUA 3MGOA 4IRJA 1U8PA 1MCFA 4MXWH 2CO7B 1E4XI 4Z7WE 5EULV 3IFPB 2JF1A 4K8RC 4U1LA 2EC9T 4HKBA 1EHAA 3VGAC 4DOHB 2I25N 2PXYB 3I2CH 3S4SG 3QIUC 1T6VN 3FT4A 3L7EB 3FO0L 3MNWB 3B4NA 4JM2C 2XT1B 4XBEL 5TE6H 4ZXBD 5FO7A 4NCDA 2A38A 3A6BH 3QDJA 2IQ9L 3DOSA 1UACL 5FGBA 3F5WB 3VXQA 3FB7A 3GKWL 3C60B 2J12B 4N5ED 1V3JA 3EJJX 3VXUE 4WGWB 4ZD3L 2BSSB 1AXIB 4C55A 1NUFA 3U30C 1HDMB 3HE6C 4LASL 1ZLVK 4GO6B 2DQGH 1S7WA 4J3SA 5MEQB 1F13A 3LEVH 4PJBF 4ALAL 1UH3A 3L9RA 3OSKA 3FHQA 5I1DB 4F57L 5FKPA 1D5BA 1LO3H 2Q7YB 3QXAA 1SYVA 2ESVA 3S37L 1YEDB 5F7HA 1DVFD 4M1GH 1QLFB 4GW5A 1PG7L 2DQUH 1AE6L 2GJ6E 2Z4QB 5A16B 3HA0A 4P59H 1BJ1J 3FQUB 1G7PA 3O8XA 2YD8A 5J6GA 3RWEA 2UWEA 4WWKC 3T1WA 3QCTH 4NN5B 2F74A 4PV8A 4AH2A 4AIOA 4XPAL 2BNUA 2X9YA 4S1QL 1IGIL 1PKQB 3SGEH 4JFZH 1B88A 3U0WL 4ZYKA 4D8PA 5DJCA 3VA2C 1Z0MA 4XCFL 4OCRL 1KULA 1YQVL 3BW9A 3CXDL 4Y4KA 2NXYC 4G9FE 4UQ2A 1B0WA 3EO0B 2ZOLA 5L2KB 2CIIA 3GIZH 2VLMD 2ITDB 1ZA3B 2NW2B 3NA9H 4ZXBA 3H9SD 1I8LC 1HHKB 2JJWA 4CVXB 4JM2D 2GKIA 5F1IB 3PIQB 3EO1B 3S96A 5DJXA 1GSMA 5E00B 2IPKB 4RDQG 3IJSB 5LAXB 1EAPB 1P7KB 2E6QA 5F1SA 1J0KA 1MLCA 5MERB 3P4MB 5DO2D 4EZMA 4WENB 4MJ2A 2C3XA 4JQIL 3TO2B 2RCSH 5IF0A 3B6SB 5GRUH 1QUNA 3N1GC 4QXGH 1HN1A 4MA3B 1SM3H 2YA2A 3GJFH 2YEZA 4PGDB 5DJAA 3DARA 3OV6A 5T33H 3ECBA 3EAKA 1EEZB 2D03H 4XNXH 3V4VL 4B5EA 4XC1L 1VGKB 5GRVL 2CUMA 4BFIB 1U6AL 3V5HB 2P8MB 5F1OB 5HVHC 3WS6A 2DDQH 4DJMA 3HAEG 1U91A 2JB6B 5DFVC 2YD5A 3SKOB 1YEJL 4MGXA 4WWKD 2VLRD 2XN9D 5HTSA 5FO9A 4DK6A 3QWOA 4KMQA 3T0BA 5GRZA 1EEYB 1I1RA 3U46B 1GOHA 3F7YA 1MWAA 3P77B 2C1OA 1QVOA 3MJ7B 3OKYA 1UGNA 4IOFC 4F7PB 1KCSH 2AQ2A 3BOVA 3QQ4A 1T7XA 4QHMB 3QUMA 1JBJA 2P5EA 3QIUA 3VWJB 3OJVC 1UWXK 4KPHH 3QULB 3EJZC 4GAGL 3D18A 2YD7A 4JM2A 4PTUB 1HIML 1MY5A 4NT6A 4JQVC 1OAXL 5BZWB 1NC2D 2UUDH 5D5MF 4PRAA 5KSBE 3R8QA 3EYVB 1G7IA 4JQXC 4X7EC 2OJEB 1P1ZB 2R2BA 4X6CA 4OTXH 2EYTB 4WWID 4XP6L 4JVPA 4OLZL 5DEFB 4Q6YA 2X4RB 2CSPA 1KN4H 4UV7H 1XZ0B 3EGSA 1S78C 2APTA 5HHMB 4AEFA 1RZJH 1ZTXL 4FQXC 3HE6A 3KPSA 4BA8A 4F7EA 2DL9A 1RZKC 4GBXD 3LCYA 3H7LA 2OTUB 1MQ8A 4HUXB 4OLWH 1EO5A 2XWTA 4M61B 3BN3B 3LPWA 4M7KL 4XP4L 2GTZA 5HHVL 4IMLA 4Z7WB 1WFUA 4OB5L 3OAUL 1JWSA 3RWIA 1NBVH 5K59F 5ALCH 2XPGA 4M5YL 5F9DC 1FDLH 2B0SH 3PL6B 3OJMB 3L5WB 3VXOA 5C0BD 3BD4A 1GXEA 1AI1H 4GRLC 4WWKA 4GKNA 2EDKA 4JY5H 4JKPH 3U2SA 3ULUC 5DT1L 1IGFL 3MO1A 1FV1A 2H9GA 3GSNL 5F89B 1T1YA 4FP8H 4R90L 1BPVA 3CGTA 3CFDB 1XF1A 4NRXB 2QL1A 5BZDA 4NM8L 4CVUA 1A6WL 4NKDB 4PJIB 5ISZA 4F9LC 3QUZB 1SYSA 1R5VB 2A6DB 2Q3ZA 2W38A 1LEIA 3MOAL 5INDB 2AGJH 4NSKA 1GZPA 5LJYH 1BQLL 3NMEA 2H8PB 1I8LA 2XQYK 1A3LL 1FNEB 4LCWA 1V7NL 5AD0B 1HQRB 5HI5C 2GJ6B 3BQUD 4D0CB 5I1IH 1AGEB 1S7TB 1G9ML 3I50L 3BT2H 2ED8A 4HUUA 1OQXA 3VDAA 5JXAL 4NHCH 5IQ9B 3I6LE 3KWWB 1YMME 1Q9KA 4BM7A 3LDBB 1VHPA 2B5IC 3L5IA 4R97B 5D6CA 4AEHH 3DGGA 2BY3A 3FKUS 3BFOA 1WGOA 3MJ9L 3FJTA 3U0TA 5E70A 1W0WA 2FR4A 3ZHDA 3H8NA 4L8CA 4M8QA 3FQXB 4G9FB 1NQBA 4YX2H 1RIHH 4UOJA 5CP7A 4P23C 1O7SA 4ZFOA 2VKXA 4PP1C 2UY6A 1U8HB 3TH4T 1OTSC 1KENH 2ATKA 4LAJH 5ICZA 1GAFH 3RNQB 1FGNL 4E0RB 4GRLD 3WXWH 4QKXB 4V1DA 3QEQD 2HMID 4JHAL 3MSPA 3C08H 3L3JB 5I2IA 4BFEA 4OSUL 5HD8C 4P48A 1C5DA 1MJ7H 4ETQA 3H0TB 3R06B 2IBGA 4PYHA 4G8GD 3T65B 2YPKB 4L1DA 5FUZH 2OR9L 4OLVH 1A1OB 5K59E 3CD4A 4GG6E 5IQ7L 4AG4H 3FOLB 5JR1L 4JQVA 4YHNA 3BP7B 4NBXB 4E41E 4JQXA 3CUPB 4G8EA 4YGVB 4XMLH 5IJVA 2C26A 4HWEL 4H5SB 4FMFA 3RVXD 1IGYB 1NLBH 4X6DB 5IW1A 2B4CH 2P8PB 4X6BA 4MAYD 4FQXA 3JBG7 4NQCE 3RJQB 3FTGA 5B38B 4EI6A 4JY4B 4ZG1A 3O11B 5I1AA 3IFNH 2YC1B 4FQ2L 3U7WL 2EDFA 3EBAA 5F7UA 1LDPH 1BIIB 3NZ8B 4WRLA 4ENED 1IBGL 3FN0L 3NVQA 5FM8A 4LLQB 1LO0L 1FLRH 1T89C 3QPQC 2JCCA 3ZT7A 4LSUL 4MA7L 1YDPB 1KB5A 1VEPA 4GRLA 1T83C 4LF3B 4X4YB 5KSBB 1F3DH 3T8XB 3V6OC 2FSEA 5C07B 3HE7C 3QEQA 4R26H 2FBJH 5DRXB 3H9ZA 4W68A 5HYQB 4RGMC 1G7HA 1A6ZA 5GPRA 1XH3A 1TNMA 2I60L 3SKUD 3KLDA 4F9LA 4G8GA 4WW1A 1U58A 3VFMA 3W5MA 4PJDF 1JP5A 5I8OL 3QQ3B 1DQDL 2W0PA 3KXFD 3NABL 3DX7A 1MLBA 1I1AB 5IG7A 4KVCH 1RUPL 2FX8L 2VO5A 3HC3L 2D7QA 4IMKC 4JFEA 4J1UA 2HJKA 2I9LB 3LKOB 3P9LB 4APQD 5B22A 3TBVA 4F7TB 1IM3B 4LDLB 2Y5TA 1JPSH 2GCYA 3WXVH 3O6FD 1MF2L 2V17L 3VFSB 1J88A 4EVNB 5DD3L 2PYEA 2ARWA 3MRLA 4DKAA 2CUHA 4HFWA 5I6XB 5IHZB 4O4YL 2NW3B 2GTWA 3QRGH 5EBGA 4QOKB 1F11B 4NQEA 1B4JL 4NRZA 4UB0H 3GIVB 1QKZL 2ILLA 3BN9C 4XPFH 5LGJA 5EO9A 3UP1A 5EG6C 1H5BC 1CF8L 4QF1B 1GGIH 3MRNB 3DV4B 1QFUL 3MRQB 3C6LB 2YPVL 4P23A 5TPWL 4YPJA 1IGTB 5ID1A 3ILQC 4KXZH 2VKWA 3I6GA 4MNQE 4OFKA 1QFHA 4YFEA 2P5WE 4N5UA 4PJFF 1G7MA 2A73A 4QRPD 1JWMB 4M7LL 4E9LA 3HE7D 1OAYH 4WI8A 1EBPA 4NO3B 1I7RA 1EEUA 1RIUH 3QDMD 1X44A 2IG2L 3N85H 1M7XA 1YMMB 3ORJA 1QP1A 1DQQB 1ZVSB 1AO7E 2JKXA 4MXVF 2VDQH 5DRZA 3BEWA 3MJ8B 3V9FA 2R56H 1JE6A 1A6PA 2M2DA 5DK0B 1ED3B 3FFCD 5KN5A 2DI9A 5I1GH 4GRWH 2W9LA 5F7NC 3HZYA 4Y4FD 2D0HA 1TTFA 3JWDL 5C09E 3RBGA 3GSWB 2CDGB 5IBLC 4S2SB 1QACA 2EDLA 3ZTJH 4QHNA 5CD3B 1NGWA 2XIDA 4H8WL 2V2WB 5I1JH 1QSFE 2DQCL 2DLTA 2J8UE 5C2UB 3ZDXF 3GKWH 2WM0A 3CZFB 1KG0A 2BSRB 4WI5A 1ONQB 2PTTB 4J8RA 4ZD3H 3V7MA 1NC4D 5FYKE 3KYAA 1EERB 3V6BR 4PJ5E 4N0FA 1D5IL 3QFJE 4Q9CA 3KPPA 3RPIA 3BGMB 3BVNA 4GKZB 4POUB 2AJSL 3MRPB 1JGVL 4LGPB 1FRGL 1RVFL 4OZ4B 1T89A 4NHUB 4GG6B 4G6FD 1ZHBA 1HCVA 1K8DA 4JKMA 3NIFF 4MD5A 3QWRD 1MJ8H 1T83A 4E41B 2DQTL 5CJOH 5DJ8B 3V6OA 3S37H 4FQ1L 3HE7A 1PG7H 5E5MA 4I5BA 4K94L 5T1DL 4NQDA 3D39B 5IMOB 3P0GB 4XPAH 3UTOA 2X40A 5T3ZL 4JFXA 4L4VD 5E6YA 1IGIH 5BXFB 5JPNB 4RAUB 4AENA 3TN0C 3U0WH 4WHDA 3O2WL 4XCFH 1YQVH 2EYRB 1PYWB 4IMKA 5J89A 1L6ZA 3CXDH 43CAA 1EHLL 3BDYH 4KDVA 3RUGE 3MPCA 1KJ2H 3S35L 2D4DA 4NRYA 2UZYB 2E27H 5HVGB 5HI3C 4Q7DA 5T3XD 5DJ0A 2OI9B 2EIZB 1R0AL 1Q9LB 1ZT4B 2XTLA 4NOBA 4OT1H 4JFQB 4LSRL 3UZQA 2IADA 5EU3A 1QRND 3EYUL 4MB3A 1YMHA 3KPMB 1CG9B 3ALWA 4X5XB 3VXUA 5ICXB 2V7NB 3D25A 3PG2A 4JQIH 1L9NA 1H5BA 4TVSa 2VLKA 4X98B 3VXPB 2B7DT 3CH8A 3E1F1 4OFYD 4OQTA 4HUMB 1C7TA 4WY7H 3BUYA 3QXTA 1AXSB 5BV7H 5BMFH 5FGSA 1J05A 1U36A 4XC1H 1HZHL 2D0FA 3CVHH 1J10A 3WJLC 2MFNA 1T3FA 3GRWH 1H3UA 2FD6L 1MRFL 2HFFB 2QR0A 2VDOH 5CBAA 1VGEL 2V2TB 4YUEL 1I75A 3MREB 5C7XH 3ZHKA 3MV8E 5HGHB 4UU9B 1U8LA 1DLFL 3KPRD 4H88L 2F54E 4NQSA 2FGWL 3EJYD 1I3GL 3PF2A 1CFTA 3EDDA 1QTYT 1VKXA 1QLEL 3U36A 4HV8A 2W91A 3T1FA 1S9WB 5MENE 4I4WB 3JVGC 2AVGA 3NIFE 2OTWA 1HIMH 5HI3D 5GS2D 3ZTNH 2JELL 1WC7B 4LSTL 5IBUG 2P5WB 3VMOA 2Y1VA 4JAMA 3MYJB 1RIVL 2AJ3B 3OKNB 3AU1B 1IMHC 2KZWA 1OW0C 4OLZH 3LS4H 5FKAA 1C5CL 4J3XA 1SBSL 2DWEB 3LQAH 2I26N 1P4IL 5FXCH 3T4AB 4OD3L 3TYFB 4DUVA 3L3OB 4ZQKA 1ZTXH 4AT6A 4UTBH 3MRBA 3CLFH 4JGMA 1AQKH 1K5NB 4WO4D 2ZUQB 3AB0C 1KIPB 3FO1B 4U7SA 4JFFE 3ULVL 3DI2B 1EBAA 1EZVX 1VFOA 2ZG2A 5DJDB 1ZGLA 1OAKL 1WBXB 1IGJB 4I13B 4PB0L 3W11C 2HWZL 4AEIH 5D72L 3DHJA 5EWIL 5E6IB 2AKRA 4RMTA 3SY0A 1KC5H 2Q76B 4OUUA 4M5YH 2CLVA 1VPOH 1HKLL 3TV3H 3DMMC 5C09B 4Z78B 1WVZA 5FECB 2DYPA 2AXFB 1QLRA 3U9PL 5J1TC 2J8UB 4M8VA 5D1XC 5F9WC 2O93L 4WUUE 4YFLF 5GGQL 3P9MB 3GSNH 4PY7B 2PKDA 3HZVB 3TN0A 2XTJE 3DBXB 2OMNA 4PJ5B 3QFJB 5CIPA 1YEGL 4PJBA 4KI5F 4KKBC 4MJID 2EE6A 5F44A 3RAJL 3TNNA 5HYEA 3GI9H 1Y18A 3CPLA 5CILL 3EDEA 5JIIA 2CLZA 1B0GA 3AMKA 5I71C 2EZ0C 1KJ3L 4PG9B 1A3LH 3FB6B 1S9VA 3UTSD 4ZSOA 4LMQI 3FMGH 3GSXA 4W6YB 3DURA 2PO6B 3WHXA 2VZ3A 5C08E 1IC5H 4URTB 2EXWC 1H8SA 2DS4A 5FA3A 5IVXF 3VFTB 1E27A 1MEXH 4CN1A 4NO0D 25C8H 2BVTA 2NY7L 5F1NA 5JXAH 3C5SB 4JR9H 1R5WA 5HHXL 1DUYA 4Y4HC 5E8OA 3MTRA 3BHBB 1N7ML 5A2KH 3KNBB 3B43A 3KG5A 1CE1L 1NSNH 1YY8A 2WUBL 2WQ8A 3MJ9H 4X6FB 1OTUC 2X4QA 1CFSB 4HCRA 3RUGB 4BZ2L 1RY7B 3LQZB 3WJLA 1IT9L 2X10A 5F3HB 4NPYB 2PUQT 3CJJA 5L88L 3TP4A 3G6JF 4AIZA 3F7RA 5KTEL 4D2NA 3EYOA 2NY2C 2H3NB 3LKQA 5E8NA 4A2MA 1KJVA 3MMEB 3BKYH 2EEAA 2EH7H 1U8NB 4JZOB 3DRQA 4PJGB 4W6XB 4N1HB 4TSBL 2Q86A 4YDIH 5C1MB 5J4MA 1ZANH 2GUOA 5D1XD 1I3RB 2YS4A 3OF6A 4JHAH 4PBWD 1EJ6A 1HHJA 4XNUL 2F5AH 5CLTA 4MJIA 4S0TD 1P84K 1N64L 1QNZL 3JVGA 1DQML 2BOCB 4G6AD 2OR9H 1EDQA 1RI8A 3DV6A 3C9NA 3EZ8A 5IQ7H 3OKMA 3M07A 5EIVA 5JXED 1HOCB 1DDHB 3IDMA 3L1OL 4WFFD 3GMPB 1VSCA 1OW0A 4WI3A 4O2EA 4MD0B 2EH8H 4HWEH 3KGRA 2EXWD 2EE3A 4LL9A 4U1NA 2MCPL 2B2XH 3AAZA 3V4PH 3WO4C 1J9CT 3MV8B 4FQHA 1L6XA 1U42A 3IAPA 3O3EA 5JUEH 3ARBC 3MXVH 3TJEL 2LV4A 1T0NA 3U7WH 5D7JD 1DZBA 1R5IA 2JK5A 3MLSL 1ZLVH 4LLDB 4GH7B 1BZ7A 3KR3L 1NDMA 3MRDB 4PRIE 1IBGH 2CLRA 4G8FB 1Z2KA 3HC4H 5MENB 5GZOC 5KSAB 5EU6A 2P24B 2IAND 5D5MA 3VI3F 3DMMA 4LVOC 1BFVL 1LWRA 4LSUH 4RDQF 4R3SA 1IAKB 1WJ3A 4JO4L 1WLHA 5D1XA 3O4LD 5DHYB 1JHLH 2X6MA 4LHUB 4JEGB 3QXDA 1FN4B 5SX5H 1FGVH 1AY1L 3ZE0E 2V7HA 1TVBA 1FVDB 2HH0L 4X99A 5HYFA 2X4SB 5CCKH 3CC5B 4FQCL 5A40E 2IH3A 1JNLH 1OD9A 1AKJB 4YBLC 1ES0B 5SWZA 3BI9X 3DX6A 4O2CA 1FL3A 1FH5L 2FX8H 5GS1B 1QSEE 1LGVA 3NCYP 1YN6B 4FTVE 1A22B 5IT2H 4R2GB 2HJLA 5GZNC 3WSQL 3G6JE 1KPRA 4WI4A 4NYLA 3O6MH 1S7QA 1F6AA 4QRRA 5H2BA 5DD3H 5E94A 4G6MH 2EDTA 3BEVB 4LIQL 4S0SD 3S34H 4XNYH 2RHEA 5JOFB 1HHHA 5FYJH 2EC9U 4R4BB 4YHML 4Y4HA 4NQCA 5AUMB 3WIIL 3PDOA 4WUUB 4YEFA 4ONHB 4UIMA 1OD7A 5IB1B 2W0KA 2XTJB 3D3VB 3PUCA 1B4JH 5I18L 1QKZH 5DMKA 3HCVB 3NN8A 5DQDL 3UMTA 4DFHA 1XT5A 1D6VH 2AXJA 1XF3B 2VAAB 3GO1L 3SDAD 4NZTL 4V2CB 1KBGH 3DVIA 5C71A 2P7TA 5C0CA 1NEZG 1YC7A 3BP5B 3CFEA 4P2OC 4X4ZA 3HR6A 4UTAL 3MJ6A 5TDOB 5BQ7A 4G3YL 2H32A 3O4LA 2XRAL 1YEFH 2X4OB 3FQNB 2GJZB 3ULSA 4ZAKB 4DUXA 4X7SH 1UWEL 1BQHB 2V5YA 2F5BH 3HPLA 1AC6A 3H9HB 2H6PB 3HPJB 3LRSB 5DS8B 5E2VL 5IV2B 1MFBL 3V6ZA 3W0WB 1ZHLB 3VXME 4P9ML 3X12B 4GXUM 2UZIL 4JVUA 5IGXL 1W0VA 1LD9A 1NAMH 1A1MA 4CRPA 1EMTH 3ARGB 1RUKL 4HK3N 3AS2A 3D2UA 4LKXB 3IDNA 5GS0C 1PSKL 5GZND 1J0YA 2NY1B 3U9UA 2EDXA 3HI6H 1S7SB 4G80A 1YYML 3EO9L 1FP5A 4YHKL 1CDYA 1BZ9A 5IJKC 3QO1B 4F58L 1E28B 1CGSH 2DQCH 4KZDH 4PRNA 4WHTB 7FABL 3ARBA 5TDPB 4LVHB 1TDQA 3TVMB 3X11A 3DTXA 5EDXA 1D5IH 3GMOA 1ORQB 1CL7H 5F9OL 3IGAB 3CFJB 3SGDI 3GB7A 1JGVH 3IDYC 4ODTH 4XGZA 1RVFH 4G43A 1J7VR 4JM4H 3D5OF 3THML 1FZJB 4MWFA 1KUMA 4POYA 3B2VL 12E8L 4HIJB 2DQDH 2QKIB 2G5BB 2DQTH 5DD6B 1OAUL 5IFJB 4NJAH 4XVUD 4J4PC 5EUOB 4YHLH 4MQXC 2BMKB 4G5ZL 4LSSL 4PREB 3SDXF 3F8UB 3GHBH 3IF1A 3HNVL 4ORZC 4X80L 5A3IC 2BHYA 3ZE2E 5T3ZH 5KSVA 4Y19B 5IKCA 3RBSA 5K9QI 5KS9F 3IS1X 3CCHB 1AO7A 1UCTA 2X4NA 3VD9A 2O61B 4HS3B 5I8KL 1JGDA 4Q6IC 2VXQL 3IDIB 1CFBA 3OMZA 3ES6A 1JGEA 3FT2A 4HXAH 3ARZA 3S35H 3V5KA 5GGVY 4N8CL 3HMXL 1C12A 1T80A 5SX4H 1G7JA 4QHUA 2R8SL 1TZIB 3NPSB 5IOPB 3UEZA 4L4TD 4ODWA 3BRDA 4QNPE 1QSFA 2AV7B 3S7GA 1MCKA 1R3IL 4NKOB 3VRJA 4ZUVB 3U4BH 5CD5D 3VXRD 3BIKA 1PDKA 3FQWB 5DDHA 1Y0LA 5L7XH 2X09A 2JLLA 1FZKA 1Q9OB 2J3SA 4PJDA 3ZE1E 2AQ3A 4TSCL 1UEYA 3RY6C 3FL7A 3FRPG 1F4YL 3VWKB 4GW1A 3HFMH 1G9NL 4MQ7B 4Y5YB 2VSCA 2FJFB 2VRAA 3HC0A 2AK4E 1QSEB 2DQJL 4P2OA 3EYQC 2HYMA 3D1MC 2HAZA 4HSQA 2F8VA 2PW2B 3ARFC 1X5HA 2NXZC 3WHE0 1T22B 4PJ7B 3S9DB 1J1PL 1HE7A 1MRDL 2CMRL 4OFDA 3LV3A 4BZ1H 4PJ8C 5JZ7C 2AEQH 3SE8H 1VGEH 1RUMH 3ALPA 4PRDB 4JREC 4U6VH 1DBML 3PWUB 3CFBB 1FPTL 1HHGB 1JFQL 1DLFH 2ZSVA 3BZ4B 1H8OA 4XAWH 3W9EA 4PS4H 4ZS7H 5EBWB 4DKDC 4HT1H 4QY8B 5DJYB 4JFYA 1PW3A 4BUHA 3B3IA 4YWGH 5TQ0L 1MUJB 1RHHA 1ITBB 4ZUTB 2AJZA 1WBZA 4JGUA 3NCBB 1IEBA 1J1OH 4GKSA 5E1AA 1JF6A 1I9JL 2VQ1A 1UJ3B 2JELH 3GBMH 4L4TA 1JNNL 4PJFA 2BVOB 1Z3GH 3NCJL 2JB5H 5IJKA 1PVHA 1RIVH 4ZUSB 5A2JH 4XPBH 4KUCF 1BD2D 5T5FH 3VJ6B 3BD3A 5EBMB 1P4IH 4PG2C 2ICEA 5IB3B 2GSGA 3MV7D 3VXMB 1OF2A 3GMQB 3QR2A 4UT7H 3LQMA 4KROC 4PRHE 1ADQH 2FJGA 5KS9E 4Q9RL 2ERJC 5CSGA 3WN5B 1F2XK 2YUZA 1DUZA 4F7MA 5LGKA 4KK8D 1KCUL 5ADOL 4ZFZA 3SCMC 3TT3L 1W72L 5D72H 4AIXA 2CQVA 1NFKA 5EZIH 2GT9B 1S9KC 4J4PA 2MQ3A 1ZWIA 1K85A 4EXPX 3TA3B 2J6EA 4NBYB 5C9KA 3D0LB 5E95B 4K3DL 1JGUH 3DVNA 3NFSL 2F54A 2ADFL 2Z91B 4JRYE 5DMIL 5DD5H 4TN9A 4XNMB 1EV2E 2VLJD 4MJ6A 3GJFB 4JRWA 3ARWA 5EBLB 3T0XA 5E9DB 4EJ1C 4Q6IA 3QAZC 5DMGC 2NLJB 3A6CL 5DEZA 2QJDA 1IM9D 4QTIH 1AC0A 1O0VA 1KCRL 1N3NB 1QR1B 4YNYB 1CICB 2NR6D 4PGEA 2XY1A 1FFPA 4HUVA 3TBSB 2QEJA 3WNMA 3OJDA 4X9GA 2VR5A 3N9GH 1P7QD 2BNQE 4YDLC 3VFPA 2ORBL 2VDNL 3C8KA 3EOBA 4JZNA 5HHXH 3MV11 4P2QA 3RY6A 2ZWLT 1N2RA 3MCLL 1RK0A 4UDTA 5L2JB 3OPZL 4IRSC 4JFFA 4M7LT 1URLA 3SDDD 2MSPA 1DQLH 4A2LA 5KVDH 1CE1H 4MDJB 4KI5C 5I73C 1A8JH 1WWCA 4OF3A 1JZ3A 3EHBC 1YEHH 3ARFA 1IC4H 5CWSA 5J6HB 2YUWA 3KPQB 2HG5B 4XWGL 4X83A 1WITA 2FBOJ 4G7YL 4QHKJ 4PJ8A 3L3DA 3SBWC 1PG7W 4JG1L 4G7VL 3WJJC 1RZIA 3PP4L 1UM4H 4K3JH 2GFBB 3EW3B 4D9QE 2EDOA 1KOAA 3ABZA 3TO4B 5FGCE 5IMLA 3TCXA 2VLJA 3KJ6L 4O51B 2DLEA 4S11A 3MRCB 1E6JL 1FZMB 5JW4N 3MCG1 3L95A 4CU8A 3RGHA 4C4KO 2A1WL 4M5ZL 2V2XA 3GGWB 3H2WA 1F97A 4P9HL 1HH9B 3P73B 4QYOB 1ZHNA 4LLMA 5IFHL 1XF4A 1NFIA 5FK9B 1CU4L 1DE4A 1KNOB 1Q0YL 2NY3C 4FQJL 5C08A 4M48H 3OKEB 1D9KB 1LNUA 4NZRH 2YD6A 4PG2A 3KDMB 2VITA 4ZS6C 4C54A 2ZSWA 3QJFA 3F6LA 1IAOB 2ADGA 1ZLUH 1D5MA 2CRIA 3IRPX 1FSKB 4ODXB 2VE6B 4KVNH 4L3ED 4DUWA 4UAOC 3QI9C 5C0JA 3L3GA 4P46B 3MLSH 3O2VH 1BIHA 5CEZL 3KR3H 1OTTC 3SCMA 5J12B 5D1ZC 4XT1C 3RWFB 1KPUA 5B39A 1PEWA 2R0LL 2CDFA 4I9WD 5F7KC 1FL5B 4M1CC 2FWOA 1PX4A 1VB9A 1I7ZA 4NFBA 2CRMA 1DN0A 2VTFA 1HWGB 4UNTA 1MFEH 4JO4H 2PXYD 3V6FA 3G6AB 5E4IA 4Z8FL 3ARDB 1N8ZB 5IR1A 4Y16C 2BC4B 3W2DL 1RZGB 4O02H 1P6FA 1UC6A 2HH0H 4HUKB 3ZKQD 3KS0J 5EU7E 4NM4H 4PR5A 4E42A 1T1ZB 2G60L 3AREB 3OXRA 4GSDL 1FJ1B 4OZHF 3C60D 5BOPA 3KLHD 4NC2B 3QEHA 5F6HI 1FH5H 4PTTA 5FUCE 3VFOA 4GRWE 3HZMB 3IKKA 2CK0L 3QIBB 5FHBL 3MGTA 3G5YA 3L6FB 5HDLA 2MMXA 4FFWC 4MA1C 3OZ9L 2GSIB 5JW3L 3GMLA 1CZ8L 4P99A 4XP1L 4CNIB 3L3KB 1DEEB 3F6IA 4WI9A 4LIQH 5ICYA 1L0YA 4Z77A 4ISVB 1MPAL 5JMOC 3KPLB 4A6YA 4XCEB 3LIZH 3NZHL 4UDUB 5IMKB 4JRYB 4XWOC 3LD8C 4IRSA 4L3EA 4IOSD 4Q0XH 5I18H 2A0LC 2WBKA 5DQDH 3QI9D 4PRIA 5B8CC 4K8RH 1UYWH 1CXHA 3QUMH 5JQ6L 3EYSH 5SWSE 1V7ML 1IQDB 3JTTB 5F7DB 5T3XL 1HKFA 5DC9B 4H1LG 4U0RB 1FO0L 2PYFB 5K9QG 2E3VA 3SBWA 1UH4A 4LBEB 3FZUD 2WINB 4H1LH 4G3YH 5AZEH 3WJJA 4BUGA 5B3JF 2UV3A 3HNTL 1CDGA 5IVXA 2ITCA 5L2KD 3MNWA 4KQ3H 5DA4A 1UWEH 1GZQB 4GAYA 1IEAA 4FNLL 1UXSA 2I07A 1F3DJ 3ZDYF 4EDWL 5I19L 3MLZH 4N8PA 5HYIA 2W60A 5HI4D 1YPZE 4Y1AB 1U8OB 1T7VA 3BESR 4OLYL 3IXTA 4FXKB 1XF2A 5MHSD 4LKCA 3S4SA 4FTVA 3L3HB 1RUKH 1GHFL 2H45A 2K7QA 2BY0A 4WUKH 2R39A 1FAIL 1XGUB 3DVGB 5I0DA 1SEQL 4PJEB 2PTVA 3Q0HA 2EDBA 3HR5A 4YHKH 3STLB 4GAJL 5DK3A 3RVUC 2XYCA 2DLIA 4PRPA 5D7LA 1WTLA 4F58H 1REIA 1UQSB 1MHCB 3O9WC 5DJ6B 4XH2A 1BECA 5FGCB 3FQUA 1OARH 7FABH 5DUML 1MCQA 2HLFC 3CDFA 4XWOD 3QI9A 4ODBD 1G7QA 2Y4SA 2Q3AA 4XC3H 5MI0C 5F9OH 4LU5H 5D1ZA 1WWWX 2X1OA 2Z93B 1BAFL 4HH9A 5FDWB 3K7UA 2ENSA 4GG8A 1OP5K 4DEPB 5J8OA 2AEPL 4BH7A 1NUDA 1IAIM 4N90E 1JPTL 2RJMA 5C0EB 4JPIB 2VXVH 4HBQA 4GJTB 3QB7C 1OAUH 1DQTA 3V0WL 2NY4C 3ZT6A 3T0DA 4Y16A 5JLZA 5ELIA 2AV1A 3DXAE 5AG9A 3OR6A 1IFHH 1TFHA 4RAVB 1RJLB 3U4AA 1RZFH 4X80H 3O3UN 4XI5D 1FNGA 5ITBL 4HQQL 2XZZA 5GJTL 5MERA 3P4MA 5HPMB 3MRGB 3VXSE 3ET9F 3T2NL 4J3WA 3H42H 4TQEH 1AJ7H 1R6VA 5HHMD 1MIEL 5D2NE 3QNYA 2XZAL 2MKWA 5HHNB 4OFVA 4MA3A 2IPUG 1G6RL 1LDSA 4N8CH 3UJJH 2E6PA 1HWHB 4N8VB 5DF0A 4QEGA 5DYOA 5I1CH 2ZJSL 2ZPKH 4DTGH 1EPFA 4NO2B 4BFIA 4OLXH 1SJEB 2VXUL 3CX5J 1NCWL 4U1SB 1TZHB 3PL6D 1J0JA 3UJTL 2JB6A 3K4AA 5JHDE 1RURL 1UZ6F 1M05B 1YN7B 1HILB 1JMZA 2HLFD 1H3PL 3SDCB 4TSCH 4ZO8A 5B8CA 4LEXL 3GSOA 3DGCR 1F4YH 3WDHA 3U46A 4XMPL 1T2XA 1G9NH 3REVB 4ERSH 5I30H 2FHFA 4CMHB 4GRWB 1J1XL 2CKBL 2H1PH 1KGCD 5JTWA 4DW2L 1LO5A 3CH1B 4RGOH 2M8XA 3QUZD 5TF0A 3PABB 3QULA 1A7RH 3HAEA 4LNRB 3GSUB 1SEBB 4TPRH 3VFVB 2R69H 1J1PH 3AXLA 1J8HA 1U3ZA 4N0YL 3OAYH 1PY9A 3CIQA 5BZWA 2BY2A 3K1KC 5C8JB 4ODVL 1CR9L 4PJXF 3VE0A 4BQCA 1YNLL 4MVBD 3QJHA 1FPTH 2Y07L 2Z35A 2NX5E 2GJ6D 1RZKH 2OXGA 4EBQL 1KFAL 3DYMA 3GSQA 4NNXB 1CT8B 1AGDB 2V6HA 2VSDA 1TVDA 4HUWA 4IRZH 4HLJA 1WIUA 1MHPL 3UYOD 4ONGH 2H2PC 3IXAA 2A83A 4G8IB 1ZHKB 4R4FH 1A47A 5SWSB 3KYMA 5JDSB 4IOIB 5CZKA 5LXGL 1LE9B 3EOTL 3B2UC 2FYYB 5GS3A 3ZLQC 4L8SB 1JNNH 1KB5H 1EA9C 4G9FD 4HC1L 5BOZG 3LMJH 1NBYA 3O9WA 4QTHA 2VR4A 3L5WA 3OAZK 3MRIA 4X7CC 1IZJA 2Z31C 4TNWF 4U49A 4C56A 5CEYB 1YPZB 3FB5A 1EJOL 4FQLL 4BQBA 4JZJB 1WV7T 5CUSH 4U1MB 4HWBL 1KJ2B 3PHQB 3LSOA 2WMPA 4I3SL 2AK4A 2X4PA 3DETC 5GGSB 2MPAH 2F58L 4NJ9L 5ADOH 4PGBB 2A6DA 2ZKHL 3RWHA 3HLAB 1GIGL 4BFBD 5INDA 4TVPD 3DRTB 2Z92A 4UBDD 4RISL 1RJYA 4EDXB 4HX1B 4OZFG 1FNEA 3P0YL 4DQOL 1XGRB 1H3XA 5AD0A 4WV1C 2HKFH 3OR7B 4TRPH 5ACZA 2FZ3A 1RFDL 4B7LA 1M7IB 1T20A 3NFSH 1UZ6E 5DMIH 4BSVB 2D31A 4PLOB 1RK1A 1CCZA 1I9EA 3EIFA 1LP9F 5BV7B 5JW5A 4OGYH 1AP2B 3DUUB 3MRFB 3TFKD 3MYZA 4JDZB 2D9QB 3A6CH 4HIEA 3MLYL 5EC2A 1S5IL 3BKJL 3CVHB 3RVTC 3B9KC 1N59A 3GSVB 4GFTB 1HSBA 3O6KH 4P57B 2YN5A 5BS0D 1S7XB 3BH9A 4KRPC 1MAJA 5GSRA 2EYSB 5IP4A 3SDXA 3ROLA 1F42A 2R23B 2QADB 5HHOA 2QSCL 3DXAB 4G42B 3O3AA 3WLWC 2ARJQ 2VDNH 1T21A 4BQ8A 1F8TL 3WLBA 5AG8A 2AABL 2GI7A 4AY0A 2NNAA 5C07D 4DGYL 3MCLH 4U7KA 4FG6C 3VXSB 3G9VA 3L3JA 1EGJL 4OCLC 5EO1A 2A77L 2H26A 3RZCB 5D2NB 1F90L 4LVNB 5F9JA 3VDBA 4XVJL 1QPPA 3HMWL 1MCJA 2ZZUT 3C2AL 3VH8A 3GDBA 2OZ4L 1EVTC 1C16A 1DLHB 1I9RL 1S9XB 3FN9A 1I1AD 5HY9B 3FONA 1X5ZA 5BO1L 2F8XC 4B0MM 3PP4H 4ZTOL 1JHKH 3OXSB 5CSZA 4GQ9H 4H5SA 4TUJB 3QDAA 1IGYA 4X6DA 1BF2A 4L4JA 4NDMA 3ZYOA 2O5XH 2IAMC 1CLOL 4X7FC 2DKMA 4PLJD 1CDUA 4P4KB 1MHEA 1FG9C 5CKGA 3RRQA 1JF1A 2QQNL 4QOKD 5BS0A 1IC7L 3BPCB 1CFQB 1KLGB 5SV3A 3VFUB 3CSYB 3NH7H 5DRWB 3WFDH 3WS3A 1CU4H 1Q0YH 1JV5B 5FFLA 4LARL 3B9EA 5FYJE 3C6LD 1OWWA 1N4XH 3A6OA 2DAVA 1EFXA 4GRMB 2BNQA 5J13B 1NANH 4XXCC 2QQKL 5F3BA 2Z31A 4DCQB 3NGBB 3T8XA 3WLWD 4OZGF 2PW1B 5ERWA 4I0PC 2Q8AL 1TPXC 1HQ4A 4JFDB 3SKJL 5DRXA 3FN3A 4JPWL 4RFEB 5ETUB 5TE4L 5EU5B 3RTQC 3QPXL 4GLRH 3S5LG 3UTTE 1QRKA 3ZKXB 1HEZA 4MAUL 3KAAA 3KPOA 3I84A 4L8BB 4RCAA 2R0LH 1YMMD 3SDYL 4MZ2A 4B7IA 4P2RB 2BVPA 1T2QL 4JFHE 2DTMH 3C5JB 4P5KB 3E2HB 4WV1A 5IVNA 3I6KA 2D7PA 5EZLB 2JJTC 4JRXA 4D9LL 3VFSA 3PXJA 4PLKC 2OI9C 4LHQB 1JGLL 2D7TL 5D1QB 4QRUB 2K1MA 3FOMA 3LZFL 5K93A 4MLIA 1S5HB 5IHZA 1I8IA 1QO3A 4IM8A 4LCYA 1TCRA 3LKSA 6CGTA 4QOKA 4OQTH 5JORB 1R3HB 4U6HA 3QNZB 5F7MC 3B9KA 1S3KH 4EI5B 4XRCB 1BGXL 3OBAA 5FHBH 1JF5A 1FL6A 1U95A 1Z5LB 1ACZA 3R4DA 3FAXA 1UCBL 1KYOJ 1UXWA 4YZFF 2A2QT 1CZ8H 3WNLA 2XZQL 4NKQB 5IEKA 2G2RB 3GK8L 1FFNA 1RMFL 3QUXB 4NN6C 1MPAH 4HIIB 1LILA 1JWMA 2BVQB 3NCMA 3OWEA 4NO5A 3QRFM 4PBVC 4OIIL 5HYJA 2P48B 5ESVB 5FIEA 3MV9A 1FZOB 3MODL 4EN3B 4FABL 4CADB 1DQJA 3O41B 3NA4A 2Y6SC