4HR1A

Structure of pav1-137, a protein from the virus pav1 that infects pyrococcus abyssi.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
118
structure length
118
Chain Sequence
FNGAQTVIQKISWLRTAIAFLKGYMETTGATKKELEQVEKLKERVDEIATAVNWDVYAQYARGDFNLLSDDEYKEIQKALLVLEDIKEQIIVEMLRVGLAQGQMGTLKISDYLDSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of PAV1-137: a protein from the virus PAV1 that infects Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi virus 1
molecule tags Unknown function
total genus 46
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.410 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hr1A00
4HR1B 4HR1A
chains in the Genus database with same CATH superfamily
3ABHA 2C08A 4BNEA 4EZOA 2JNKA 4EZVA 4UDXX 1R33A 2YLAA 2FYVA 4AZCB 3BVVA 3DX1A 3QNIA 4G6QA 3EJRA 1TQWA 3LMFA 3FD9A 4JL9A 3HAJA 4IWQA 3D52A 3SYVA 2PY6A 1QWUA 1OA1A 3ER9B 3BVUA 4H8SA 2Z0NA 4IM3A 2WINM 3BUDA 2X3WA 3T47A 3EJPA 1QX1A 3A98A 1GN9A 4R5JA 2ELBA 2RAKA 3D4YA 4AKVA 1W9MA 3SOGA 4AZ5A 5E84A 4JWCA 1O7DC 3B53X 5TKYA 4I1QA 1HTYA 5C5BB 2X5CA 3QWEA 2X3VA 2WYIA 4R5KA 4EZZA 1TQSA 2N3KA 4IWOA 3DDGA 2RAIA 3ERCC 2ALWA 1MJGA 3OWGA 1E1DA 1SU6A 3DX0A 1LQ7A 3CVRA 3VEBA 2F7OA 4B9QA 3RV0A 2RAJA 2EFKA 1JQKA 5FIGA 3D2FA 3DX2A 3O3OB 1HWWA 3OHXM 4JNFA 2V0OA 4IM0A 4JWDA 4EZXA 4FZSA 4UDYX 4H6IA 1X04A 4EZWA 1R34A 4EZYA 4DCNC 2OZNB 2RT6A 3UITA 4R5IA 4AZHA 2GF4A 1I4TA 3O3NB 1E9VA 1GNTA 2FICA 2YL5A 3PLTA 1PS3A 3HAHA 3QA8A 4DYLA 4AVMA 3EJSA 4IW0A 3T48A 1R5EA 1Y2OA 3CZSA 1GNLA 2JNSA 4E3CA 4WPEA 1SU8A 3LLLA 3QE6A 3L3OM 3F7WA 1I49A 2OBMA 4JN4A 4PO2A 1TQTA 3C7NA 2QFFA 4AZCA 3DX4A 2Q12A 4EZRA 4KIKB 5KBPA 3CAZA 3KAWA 3I01A 3B51X 3HAIA 3QNJA 1TQUA 1ZWWA 4JWIA 4R5GA 3D2EA 3B52X 2OW6A 2GA9D 2D1LA 1E2UA 4FZOA 1OA0A 3BVTA 2YL9A 3EJUA 4NPHA 4D8JA 4H6HA 1X03A 4EZQA 1UPXA 1YWMA 4AZBA 2YI8A 1U00A 3BUBA 2Z0OA 5C5BA 1OAOA 1DKZA 4JWEA 3BLBA 2F7QA 4AZGA 2Z8YA 4JNEA 4EZPA 3LVTA 2YLLA 2EX3B 1I4DA 2WYHA 4HR1B 3Q0KA 2YIAA 1I4LA 2F7RA 1O7DB 4EZSA 2F18A 3DPPA 2QXLA 1WDZA 2YL6A 2MI7A 2OO2A 3CV5A 4M0MA 3ACOA 3KAVA 3DPQA 3BVXA 3OK8A 1SUFA 3T46A 4AZ6A 2D4CA 2EFLA 3RPMA 4FZPA 2LM0A 4E81A 4F01A 4AZ7A 4EZNA 1DKYA 3D50A 3BUPA 4HY9A 3RV1A 4EZTA 1TQVA 3BVWA 1QWNA 2OBLA 2O0I1 3BUIA 2YIBA 1HXKA 1SU7A 3DDFA 3DPOA 3L3PA 3VEAA 3BUQA 4NSWA 3ER8C 3D4ZA 2LXYA 2Z0VA 2PMRA 3G9GA 2YIVX 1ZYLA 3DYTA 4R5LA 3KDRA 2F1AA 4FM3A 4KIKA 3Q84A 3I04A 4IWPA 3CKDA 3EJTA 2F7PA 2NCZA 2QKWA 3I39X 3ZEDA 2F1BA 2YL8A 2X3XA 3EJQA 3D51A 3CZNA 3O3MB 2EWFA 2YKTA 4HYBA 3VKHA 1URUA 3GI7A 2KHOA 3T4AG 2ND1A 2GAFD 4EZUA 3T49A 2YI9A 2OW7A 2ZXQA 3M3WA 4F00A 2Q13A 4NQIA 5FLEX 2ND0A 1DKXA 4WPCA 4JLCA 4IM2A 3DX3A 4HR1A 4AZIA 4ATMA 3I2WA
chains in the Genus database with same CATH topology
4NPHA 1JQKA 4D8JA 4EZOA 4EZVA 2YIBA 4H6HA 5FIGA 3D2FA 1SU7A 3O3OB 4EZQA 4UDXX 3OHXM 4JNFA 3DPOA 4IM0A 1UPXA 3VEAA 2YI8A 3ER8C 1U00A 4JWDA 4EZXA 4UDYX 2YIVX 1ZYLA 4H6IA 4G6QA 4R5LA 3LMFA 3KDRA 4EZWA 1OAOA 3FD9A 4JL9A 1DKZA 4IWQA 4JWEA 4EZYA 4FM3A 2PY6A 4KIKA 2RT6A 1OA1A 3UITA 3ER9B 3I04A 4R5IA 4IM3A 2WINM 2Z8YA 3O3NB 1E9VA 4JNEA 4IWPA 1GNTA 4EZPA 3T47A 2EX3B 3QA8A 4HR1B 2YIAA 4IW0A 3T48A 2NCZA 3A98A 4EZSA 3I39X 3ZEDA 1GNLA 1GN9A 2JNSA 3DPPA 2QXLA 4R5JA 1W9MA 4E3CA 3O3MB 5E84A 1SU8A 2EWFA 3B53X 4JWCA 5TKYA 4M0MA 3KAVA 4HYBA 3L3OM 3F7WA 2OBMA 3VKHA 4JN4A 4PO2A 3DPQA 2X5CA 1SUFA 3C7NA 3T46A 2QFFA 4EZRA 3GI7A 2KHOA 3T4AG 2ND1A 2GAFD 4EZUA 4KIKB 3KAWA 4R5KA 3T49A 2LM0A 3I01A 3B51X 4E81A 4EZZA 2N3KA 2YI9A 4IWOA 3QNJA 4F01A 4EZNA 4F00A 1DKYA 4JWIA 4HY9A 4R5GA 3ERCC 3D2EA 5FLEX 3RV1A 1MJGA 3OWGA 1E1DA 3B52X 2ND0A 1DKXA 1SU6A 4JLCA 4IM2A 2GA9D 3VEBA 4EZTA 4B9QA 4HR1A 1E2UA 3RV0A 2OBLA 1OA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR1 B;  4HR1 A; 
#chains in the Genus database with same CATH topology
 3ABH A;  2C08 A;  4BNE A;  4EZO A;  2JNK A;  4EZV A;  4UDX X;  1R33 A;  2YLA A;  2FYV A;  4AZC B;  3BVV A;  3DX1 A;  3QNI A;  4G6Q A;  3EJR A;  1TQW A;  3LMF A;  3FD9 A;  4JL9 A;  3HAJ A;  4IWQ A;  3D52 A;  3SYV A;  2PY6 A;  1QWU A;  1OA1 A;  3ER9 B;  3BVU A;  4H8S A;  2Z0N A;  4IM3 A;  2WIN M;  3BUD A;  2X3W A;  3T47 A;  3EJP A;  1QX1 A;  3A98 A;  1GN9 A;  4R5J A;  2ELB A;  2RAK A;  3D4Y A;  4AKV A;  1W9M A;  3SOG A;  4AZ5 A;  5E84 A;  4JWC A;  1O7D C;  3B53 X;  5TKY A;  4I1Q A;  1HTY A;  5C5B B;  2X5C A;  3QWE A;  2X3V A;  2WYI A;  4R5K A;  4EZZ A;  1TQS A;  2N3K A;  4IWO A;  3DDG A;  2RAI A;  3ERC C;  2ALW A;  1MJG A;  3OWG A;  1E1D A;  1SU6 A;  3DX0 A;  1LQ7 A;  3CVR A;  3VEB A;  2F7O A;  4B9Q A;  3RV0 A;  2RAJ A;  2EFK A;  1JQK A;  5FIG A;  3D2F A;  3DX2 A;  3O3O B;  1HWW A;  3OHX M;  4JNF A;  2V0O A;  4IM0 A;  4JWD A;  4EZX A;  4FZS A;  4UDY X;  4H6I A;  1X04 A;  4EZW A;  1R34 A;  4EZY A;  4DCN C;  2OZN B;  2RT6 A;  3UIT A;  4R5I A;  4AZH A;  2GF4 A;  1I4T A;  3O3N B;  1E9V A;  1GNT A;  2FIC A;  2YL5 A;  3PLT A;  1PS3 A;  3HAH A;  3QA8 A;  4DYL A;  4AVM A;  3EJS A;  4IW0 A;  3T48 A;  1R5E A;  1Y2O A;  3CZS A;  1GNL A;  2JNS A;  4E3C A;  4WPE A;  1SU8 A;  3LLL A;  3QE6 A;  3L3O M;  3F7W A;  1I49 A;  2OBM A;  4JN4 A;  4PO2 A;  1TQT A;  3C7N A;  2QFF A;  4AZC A;  3DX4 A;  2Q12 A;  4EZR A;  4KIK B;  5KBP A;  3CAZ A;  3KAW A;  3I01 A;  3B51 X;  3HAI A;  3QNJ A;  1TQU A;  1ZWW A;  4JWI A;  4R5G A;  3D2E A;  3B52 X;  2OW6 A;  2GA9 D;  2D1L A;  1E2U A;  4FZO A;  1OA0 A;  3BVT A;  2YL9 A;  3EJU A;  4NPH A;  4D8J A;  4H6H A;  1X03 A;  4EZQ A;  1UPX A;  1YWM A;  4AZB A;  2YI8 A;  1U00 A;  3BUB A;  2Z0O A;  5C5B A;  1OAO A;  1DKZ A;  4JWE A;  3BLB A;  2F7Q A;  4AZG A;  2Z8Y A;  4JNE A;  4EZP A;  3LVT A;  2YLL A;  2EX3 B;  1I4D A;  2WYH A;  4HR1 B;  3Q0K A;  2YIA A;  1I4L A;  2F7R A;  1O7D B;  4EZS A;  2F18 A;  3DPP A;  2QXL A;  1WDZ A;  2YL6 A;  2MI7 A;  2OO2 A;  3CV5 A;  4M0M A;  3ACO A;  3KAV A;  3DPQ A;  3BVX A;  3OK8 A;  1SUF A;  3T46 A;  4AZ6 A;  2D4C A;  2EFL A;  3RPM A;  4FZP A;  2LM0 A;  4E81 A;  4F01 A;  4AZ7 A;  4EZN A;  1DKY A;  3D50 A;  3BUP A;  4HY9 A;  3RV1 A;  4EZT A;  1TQV A;  3BVW A;  1QWN A;  2OBL A;  2O0I 1;  3BUI A;  2YIB A;  1HXK A;  1SU7 A;  3DDF A;  3DPO A;  3L3P A;  3VEA A;  3BUQ A;  4NSW A;  3ER8 C;  3D4Z A;  2LXY A;  2Z0V A;  2PMR A;  3G9G A;  2YIV X;  1ZYL A;  3DYT A;  4R5L A;  3KDR A;  2F1A A;  4FM3 A;  4KIK A;  3Q84 A;  3I04 A;  4IWP A;  3CKD A;  3EJT A;  2F7P A;  2NCZ A;  2QKW A;  3I39 X;  3ZED A;  2F1B A;  2YL8 A;  2X3X A;  3EJQ A;  3D51 A;  3CZN A;  3O3M B;  2EWF A;  2YKT A;  4HYB A;  3VKH A;  1URU A;  3GI7 A;  2KHO A;  3T4A G;  2ND1 A;  2GAF D;  4EZU A;  3T49 A;  2YI9 A;  2OW7 A;  2ZXQ A;  3M3W A;  4F00 A;  2Q13 A;  4NQI A;  5FLE X;  2ND0 A;  1DKX A;  4WPC A;  4JLC A;  4IM2 A;  3DX3 A;  4HR1 A;  4AZI A;  4ATM A;  3I2W A; 
#chains in the Genus database with same CATH homology
 4NPH A;  1JQK A;  4D8J A;  4EZO A;  4EZV A;  2YIB A;  4H6H A;  5FIG A;  3D2F A;  1SU7 A;  3O3O B;  4EZQ A;  4UDX X;  3OHX M;  4JNF A;  3DPO A;  4IM0 A;  1UPX A;  3VEA A;  2YI8 A;  3ER8 C;  1U00 A;  4JWD A;  4EZX A;  4UDY X;  2YIV X;  1ZYL A;  4H6I A;  4G6Q A;  4R5L A;  3LMF A;  3KDR A;  4EZW A;  1OAO A;  3FD9 A;  4JL9 A;  1DKZ A;  4IWQ A;  4JWE A;  4EZY A;  4FM3 A;  2PY6 A;  4KIK A;  2RT6 A;  1OA1 A;  3UIT A;  3ER9 B;  3I04 A;  4R5I A;  4IM3 A;  2WIN M;  2Z8Y A;  3O3N B;  1E9V A;  4JNE A;  4IWP A;  1GNT A;  4EZP A;  3T47 A;  2EX3 B;  3QA8 A;  4HR1 B;  2YIA A;  4IW0 A;  3T48 A;  2NCZ A;  3A98 A;  4EZS A;  3I39 X;  3ZED A;  1GNL A;  1GN9 A;  2JNS A;  3DPP A;  2QXL A;  4R5J A;  1W9M A;  4E3C A;  3O3M B;  5E84 A;  1SU8 A;  2EWF A;  3B53 X;  4JWC A;  5TKY A;  4M0M A;  3KAV A;  4HYB A;  3L3O M;  3F7W A;  2OBM A;  3VKH A;  4JN4 A;  4PO2 A;  3DPQ A;  2X5C A;  1SUF A;  3C7N A;  3T46 A;  2QFF A;  4EZR A;  3GI7 A;  2KHO A;  3T4A G;  2ND1 A;  2GAF D;  4EZU A;  4KIK B;  3KAW A;  4R5K A;  3T49 A;  2LM0 A;  3I01 A;  3B51 X;  4E81 A;  4EZZ A;  2N3K A;  2YI9 A;  4IWO A;  3QNJ A;  4F01 A;  4EZN A;  4F00 A;  1DKY A;  4JWI A;  4HY9 A;  4R5G A;  3ERC C;  3D2E A;  5FLE X;  3RV1 A;  1MJG A;  3OWG A;  1E1D A;  3B52 X;  2ND0 A;  1DKX A;  1SU6 A;  4JLC A;  4IM2 A;  2GA9 D;  3VEB A;  4EZT A;  4B9Q A;  4HR1 A;  1E2U A;  3RV0 A;  2OBL A;  1OA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...