4HR1A

Structure of pav1-137, a protein from the virus pav1 that infects pyrococcus abyssi.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
118
structure length
118
Chain Sequence
FNGAQTVIQKISWLRTAIAFLKGYMETTGATKKELEQVEKLKERVDEIATAVNWDVYAQYARGDFNLLSDDEYKEIQKALLVLEDIKEQIIVEMLRVGLAQGQMGTLKISDYLDSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of PAV1-137: a protein from the virus PAV1 that infects Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi virus 1
molecule tags Unknown function
total genus 46
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.410 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hr1A00
4HR1A 4HR1B
chains in the Genus database with same CATH superfamily
1OA1A 1GN9A 1TQVA 2YI9A 4NSWA 1HTYA 2YL8A 3D2EA 4H6IA 3D51A 4D8JA 3LVTA 2Z0VA 4NPHA 3T4AG 3I01A 2WYHA 4AZCB 2PMRA 4FM3A 4AZ6A 3Q84A 4F00A 2Z8YA 3VEAA 2MI7A 1UPXA 4H6HA 4EZNA 4R5LA 3D2FA 3M3WA 1R5EA 2Q12A 3BVXA 4EZUA 4WPCA 1I49A 3QNJA 2Q13A 3T46A 3QNIA 2V0OA 3QWEA 3BLBA 2X3WA 3O3MB 2ND0A 4IM0A 3DX2A 3ZEDA 1OA0A 4AZ7A 4JNEA 3D4YA 3O3NB 1I4DA 3CZNA 1TQSA 4R5JA 3DX4A 1E9VA 3OHXM 1W9MA 3RV1A 4AKVA 1E1DA 3RPMA 3VKHA 4AZGA 3D52A 4M0MA 4JWEA 3DYTA 3HAJA 4JNFA 4EZZA 4AZIA 4E81A 3I2WA 5TKYA 2LXYA 3EJRA 3KAWA 2PY6A 1HXKA 2OBMA 2YLAA 4ATMA 3OWGA 4EZRA 3DX3A 2LM0A 2EFKA 4WPEA 3ER8C 2YI8A 2RAJA 4I1QA 4HYBA 4JWDA 1SU6A 4AZBA 3T48A 2YIAA 2F1BA 4UDXX 3CV5A 4EZSA 4EZOA 1GNTA 2GAFD 1GNLA 4DYLA 3HAHA 4G6QA 2GF4A 3O3OB 4HR1B 3Q0KA 3DX1A 3DDGA 3KDRA 2NCZA 2X3VA 1QWNA 2YL6A 3LMFA 4FZSA 2EFLA 1MJGA 3SYVA 3EJPA 1TQWA 2O0I1 4IWOA 3PLTA 3BVWA 2QFFA 1Y2OA 3D4ZA 3DX0A 4AZ5A 3BVTA 2WYIA 2ND1A 1R33A 3BUQA 4IWPA 2F1AA 3OK8A 2OBLA 2EX3B 1URUA 4EZPA 1QX1A 4EZWA 2OW7A 4IW0A 3UITA 2F7RA 2F7PA 2ELBA 3RV0A 3G9GA 4R5GA 4R5IA 1SUFA 2N3KA 2FYVA 3CAZA 2GA9D 3I04A 5FLEX 1X03A 3DPQA 2JNSA 1PS3A 3CKDA 3BVUA 3B53X 4KIKA 3DPPA 1LQ7A 3QE6A 1O7DC 4FZPA 3EJUA 3C7NA 4EZTA 2YIBA 3EJTA 3CVRA 2F7OA 3BUDA 3EJSA 2KHOA 1I4LA 2YL5A 1JQKA 4EZXA 3VEBA 4JWIA 2X5CA 4EZQA 5C5BB 3L3PA 1ZWWA 2YIVX 2RAIA 4IM2A 4AVMA 4R5KA 4HR1A 2F7QA 4AZCA 3BUIA 2F18A 4BNEA 1R34A 3BVVA 2JNKA 4JN4A 5KBPA 4DCNC 1SU8A 2D1LA 3LLLA 4IM3A 3FD9A 3DDFA 2ZXQA 4JWCA 1I4TA 3CZSA 1TQTA 3L3OM 1DKZA 3KAVA 4F01A 4UDYX 2Z0OA 5FIGA 1SU7A 2Z0NA 2ALWA 3B52X 3F7WA 4JLCA 3A98A 1OAOA 4IWQA 3ACOA 4JL9A 1WDZA 1QWUA 3BUPA 3QA8A 2YKTA 2EWFA 2WINM 3T47A 2FICA 3T49A 4AZHA 2QXLA 4FZOA 2QKWA 3GI7A 5E84A 1DKXA 2OW6A 4PO2A 3DPOA 3ABHA 3ERCC 4H8SA 3I39X 1U00A 1E2UA 3BUBA 2YLLA 2YL9A 2RAKA 3D50A 2X3XA 3B51X 4E3CA 3ER9B 4KIKB 3SOGA 2C08A 1TQUA 4EZVA 3HAIA 2D4CA 1X04A 1O7DB 4EZYA 1YWMA 3EJQA 4NQIA 2OZNB 5C5BA 1ZYLA 1HWWA 2OO2A 1DKYA 4B9QA 2RT6A 4HY9A
chains in the Genus database with same CATH topology
1OA1A 4EZWA 1GN9A 3KAWA 2PY6A 2YI9A 3L3OM 4IW0A 2OBMA 1DKZA 3D2EA 3UITA 4H6IA 4D8JA 3OWGA 3KAVA 4F01A 4EZRA 2LM0A 3RV0A 4UDYX 3ER8C 2YI8A 4R5GA 1SU7A 4NPHA 4R5IA 5FIGA 4HYBA 4JWDA 3B52X 3F7WA 1SU6A 3T4AG 4JLCA 1SUFA 3A98A 1OAOA 3I01A 4IWQA 2N3KA 2YIAA 3T48A 2GA9D 3I04A 5FLEX 4JL9A 4FM3A 3DPQA 4UDXX 2JNSA 3QA8A 4F00A 4EZSA 3B53X 2Z8YA 2EWFA 3DPPA 4KIKA 4EZOA 3VEAA 1GNTA 1UPXA 2GAFD 1GNLA 2WINM 4H6HA 3T47A 4EZNA 3C7NA 3T49A 2QXLA 4R5LA 3D2FA 4G6QA 4EZTA 2YIBA 3GI7A 5E84A 1DKXA 3O3OB 4EZUA 4PO2A 3DPOA 3QNJA 4HR1B 3ERCC 3T46A 3KDRA 2NCZA 2KHOA 3LMFA 1JQKA 4EZXA 3O3MB 2ND0A 4IM0A 3I39X 1U00A 1E2UA 3VEBA 4JWIA 2X5CA 1MJGA 3ZEDA 4IWOA 1OA0A 4EZQA 4JNEA 3O3NB 2YIVX 2QFFA 4R5JA 4IM2A 3B51X 4E3CA 3ER9B 2ND1A 4R5KA 4KIKB 3OHXM 1E9VA 1W9MA 4HR1A 3RV1A 4EZVA 4IWPA 1E1DA 3VKHA 4EZYA 2OBLA 4M0MA 4JN4A 4JWEA 1SU8A 1ZYLA 2EX3B 4JNFA 4EZZA 4IM3A 4E81A 3FD9A 5TKYA 1DKYA 4B9QA 2RT6A 4EZPA 4JWCA 4HY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR1 A;  4HR1 B; 
#chains in the Genus database with same CATH topology
 1OA1 A;  1GN9 A;  1TQV A;  2YI9 A;  4NSW A;  1HTY A;  2YL8 A;  3D2E A;  4H6I A;  3D51 A;  4D8J A;  3LVT A;  2Z0V A;  4NPH A;  3T4A G;  3I01 A;  2WYH A;  4AZC B;  2PMR A;  4FM3 A;  4AZ6 A;  3Q84 A;  4F00 A;  2Z8Y A;  3VEA A;  2MI7 A;  1UPX A;  4H6H A;  4EZN A;  4R5L A;  3D2F A;  3M3W A;  1R5E A;  2Q12 A;  3BVX A;  4EZU A;  4WPC A;  1I49 A;  3QNJ A;  2Q13 A;  3T46 A;  3QNI A;  2V0O A;  3QWE A;  3BLB A;  2X3W A;  3O3M B;  2ND0 A;  4IM0 A;  3DX2 A;  3ZED A;  1OA0 A;  4AZ7 A;  4JNE A;  3D4Y A;  3O3N B;  1I4D A;  3CZN A;  1TQS A;  4R5J A;  3DX4 A;  1E9V A;  3OHX M;  1W9M A;  3RV1 A;  4AKV A;  1E1D A;  3RPM A;  3VKH A;  4AZG A;  3D52 A;  4M0M A;  4JWE A;  3DYT A;  3HAJ A;  4JNF A;  4EZZ A;  4AZI A;  4E81 A;  3I2W A;  5TKY A;  2LXY A;  3EJR A;  3KAW A;  2PY6 A;  1HXK A;  2OBM A;  2YLA A;  4ATM A;  3OWG A;  4EZR A;  3DX3 A;  2LM0 A;  2EFK A;  4WPE A;  3ER8 C;  2YI8 A;  2RAJ A;  4I1Q A;  4HYB A;  4JWD A;  1SU6 A;  4AZB A;  3T48 A;  2YIA A;  2F1B A;  4UDX X;  3CV5 A;  4EZS A;  4EZO A;  1GNT A;  2GAF D;  1GNL A;  4DYL A;  3HAH A;  4G6Q A;  2GF4 A;  3O3O B;  4HR1 B;  3Q0K A;  3DX1 A;  3DDG A;  3KDR A;  2NCZ A;  2X3V A;  1QWN A;  2YL6 A;  3LMF A;  4FZS A;  2EFL A;  1MJG A;  3SYV A;  3EJP A;  1TQW A;  2O0I 1;  4IWO A;  3PLT A;  3BVW A;  2QFF A;  1Y2O A;  3D4Z A;  3DX0 A;  4AZ5 A;  3BVT A;  2WYI A;  2ND1 A;  1R33 A;  3BUQ A;  4IWP A;  2F1A A;  3OK8 A;  2OBL A;  2EX3 B;  1URU A;  4EZP A;  1QX1 A;  4EZW A;  2OW7 A;  4IW0 A;  3UIT A;  2F7R A;  2F7P A;  2ELB A;  3RV0 A;  3G9G A;  4R5G A;  4R5I A;  1SUF A;  2N3K A;  2FYV A;  3CAZ A;  2GA9 D;  3I04 A;  5FLE X;  1X03 A;  3DPQ A;  2JNS A;  1PS3 A;  3CKD A;  3BVU A;  3B53 X;  4KIK A;  3DPP A;  1LQ7 A;  3QE6 A;  1O7D C;  4FZP A;  3EJU A;  3C7N A;  4EZT A;  2YIB A;  3EJT A;  3CVR A;  2F7O A;  3BUD A;  3EJS A;  2KHO A;  1I4L A;  2YL5 A;  1JQK A;  4EZX A;  3VEB A;  4JWI A;  2X5C A;  4EZQ A;  5C5B B;  3L3P A;  1ZWW A;  2YIV X;  2RAI A;  4IM2 A;  4AVM A;  4R5K A;  4HR1 A;  2F7Q A;  4AZC A;  3BUI A;  2F18 A;  4BNE A;  1R34 A;  3BVV A;  2JNK A;  4JN4 A;  5KBP A;  4DCN C;  1SU8 A;  2D1L A;  3LLL A;  4IM3 A;  3FD9 A;  3DDF A;  2ZXQ A;  4JWC A;  1I4T A;  3CZS A;  1TQT A;  3L3O M;  1DKZ A;  3KAV A;  4F01 A;  4UDY X;  2Z0O A;  5FIG A;  1SU7 A;  2Z0N A;  2ALW A;  3B52 X;  3F7W A;  4JLC A;  3A98 A;  1OAO A;  4IWQ A;  3ACO A;  4JL9 A;  1WDZ A;  1QWU A;  3BUP A;  3QA8 A;  2YKT A;  2EWF A;  2WIN M;  3T47 A;  2FIC A;  3T49 A;  4AZH A;  2QXL A;  4FZO A;  2QKW A;  3GI7 A;  5E84 A;  1DKX A;  2OW6 A;  4PO2 A;  3DPO A;  3ABH A;  3ERC C;  4H8S A;  3I39 X;  1U00 A;  1E2U A;  3BUB A;  2YLL A;  2YL9 A;  2RAK A;  3D50 A;  2X3X A;  3B51 X;  4E3C A;  3ER9 B;  4KIK B;  3SOG A;  2C08 A;  1TQU A;  4EZV A;  3HAI A;  2D4C A;  1X04 A;  1O7D B;  4EZY A;  1YWM A;  3EJQ A;  4NQI A;  2OZN B;  5C5B A;  1ZYL A;  1HWW A;  2OO2 A;  1DKY A;  4B9Q A;  2RT6 A;  4HY9 A; 
#chains in the Genus database with same CATH homology
 1OA1 A;  4EZW A;  1GN9 A;  3KAW A;  2PY6 A;  2YI9 A;  3L3O M;  4IW0 A;  2OBM A;  1DKZ A;  3D2E A;  3UIT A;  4H6I A;  4D8J A;  3OWG A;  3KAV A;  4F01 A;  4EZR A;  2LM0 A;  3RV0 A;  4UDY X;  3ER8 C;  2YI8 A;  4R5G A;  1SU7 A;  4NPH A;  4R5I A;  5FIG A;  4HYB A;  4JWD A;  3B52 X;  3F7W A;  1SU6 A;  3T4A G;  4JLC A;  1SUF A;  3A98 A;  1OAO A;  3I01 A;  4IWQ A;  2N3K A;  2YIA A;  3T48 A;  2GA9 D;  3I04 A;  5FLE X;  4JL9 A;  4FM3 A;  3DPQ A;  4UDX X;  2JNS A;  3QA8 A;  4F00 A;  4EZS A;  3B53 X;  2Z8Y A;  2EWF A;  3DPP A;  4KIK A;  4EZO A;  3VEA A;  1GNT A;  1UPX A;  2GAF D;  1GNL A;  2WIN M;  4H6H A;  3T47 A;  4EZN A;  3C7N A;  3T49 A;  2QXL A;  4R5L A;  3D2F A;  4G6Q A;  4EZT A;  2YIB A;  3GI7 A;  5E84 A;  1DKX A;  3O3O B;  4EZU A;  4PO2 A;  3DPO A;  3QNJ A;  4HR1 B;  3ERC C;  3T46 A;  3KDR A;  2NCZ A;  2KHO A;  3LMF A;  1JQK A;  4EZX A;  3O3M B;  2ND0 A;  4IM0 A;  3I39 X;  1U00 A;  1E2U A;  3VEB A;  4JWI A;  2X5C A;  1MJG A;  3ZED A;  4IWO A;  1OA0 A;  4EZQ A;  4JNE A;  3O3N B;  2YIV X;  2QFF A;  4R5J A;  4IM2 A;  3B51 X;  4E3C A;  3ER9 B;  2ND1 A;  4R5K A;  4KIK B;  3OHX M;  1E9V A;  1W9M A;  4HR1 A;  3RV1 A;  4EZV A;  4IWP A;  1E1D A;  3VKH A;  4EZY A;  2OBL A;  4M0M A;  4JN4 A;  4JWE A;  1SU8 A;  1ZYL A;  2EX3 B;  4JNF A;  4EZZ A;  4IM3 A;  4E81 A;  3FD9 A;  5TKY A;  1DKY A;  4B9Q A;  2RT6 A;  4EZP A;  4JWC A;  4HY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...