4HR1B

Structure of pav1-137, a protein from the virus pav1 that infects pyrococcus abyssi.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
119
structure length
119
Chain Sequence
AFNGAQTVIQKISWLRTAIAFLKGYMETTGATKKELEQVEKLKERVDEIATAVNWDVYAQYARGDFNLLSDDEYKEIQKALLVLEDIKEQIIVEMLRVGLAQGQMGTLKISDYLDSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of PAV1-137: a protein from the virus PAV1 that infects Pyrococcus abyssi
pubmed doi rcsb
source organism Pyrococcus abyssi virus 1
molecule tags Unknown function
total genus 45
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.410 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hr1B00
4HR1B 4HR1A
chains in the Genus database with same CATH superfamily
2ALWA 4IM0A 4DYLA 4FM3A 3QNIA 2GAFD 2FICA 3HAHA 3OHXM 3D2FA 2YLLA 3L3OM 3GI7A 1TQVA 1SUFA 2QFFA 3HAJA 4AKVA 4EZXA 2FYVA 4R5GA 1TQTA 3Q0KA 4UDYX 4HR1B 1ZYLA 1GN9A 2Z0VA 4UDXX 3T47A 4EZVA 1DKXA 2OO2A 3KAVA 3M3WA 2WYIA 3EJRA 4FZSA 2D1LA 4JLCA 4HYBA 4BNEA 5FLEX 3B51X 3QA8A 2ND0A 3B52X 2ZXQA 4F00A 3DPOA 3VEBA 4M0MA 3VKHA 4FZOA 1HXKA 3ACOA 4AVMA 4E3CA 3SYVA 1O7DC 4G6QA 3DX2A 2YL8A 3QE6A 2EX3B 3O3OB 3I01A 4EZWA 3DPPA 3D2EA 2X3WA 1X04A 3CKDA 3I04A 2YLAA 1TQWA 3BUQA 2C08A 4EZNA 3EJQA 4E81A 2Z0OA 1DKZA 2WINM 4EZOA 4IM2A 2Q12A 4AZ5A 4H8SA 1HTYA 2OW6A 3LMFA 1R34A 3DX1A 1QWUA 2RAKA 3D51A 2LXYA 3G9GA 3T48A 4D8JA 4I1QA 4ATMA 3QNJA 4AZBA 3LVTA 3BUDA 3ABHA 3DX0A 4AZGA 3ERCC 1I49A 3C7NA 2QKWA 3RV1A 3EJSA 4IWPA 4JWCA 3D4YA 2KHOA 4JN4A 1O7DB 4JWIA 2ND1A 4JWEA 4AZ7A 3DDFA 5KBPA 4F01A 3D50A 1UPXA 4JL9A 3LLLA 3PLTA 3DDGA 4IWOA 4R5KA 2YI8A 1GNLA 4B9QA 2MI7A 4EZRA 2PY6A 2RAIA 3OK8A 4R5IA 1OAOA 1QX1A 3SOGA 2GF4A 2YKTA 5FIGA 2YIBA 2OBMA 3CZSA 2YL9A 2V0OA 2F7RA 4NPHA 3VEAA 3OWGA 3BUBA 2OBLA 3CAZA 2Z0NA 3KAWA 4WPEA 4IWQA 3FD9A 1HWWA 3BUPA 2YL5A 2WYHA 4IM3A 4H6IA 4R5LA 3D4ZA 3BVTA 4FZPA 2D4CA 2RT6A 3DPQA 1Y2OA 4EZPA 5E84A 1OA1A 2YIAA 1X03A 1E2UA 2X3VA 2RAJA 4EZUA 1URUA 1SU6A 4DCNC 2F1BA 3F7WA 2Q13A 3HAIA 4HY9A 1E9VA 2QXLA 1SU8A 5C5BA 4EZZA 3ER8C 3DX4A 3EJUA 3T4AG 4KIKA 1JQKA 3QWEA 1PS3A 1YWMA 4IW0A 4EZQA 3UITA 3Q84A 4EZTA 2Z8YA 3RV0A 1SU7A 1QWNA 3RPMA 1WDZA 2O0I1 3BVWA 3BVVA 3ZEDA 4AZIA 2F7QA 2LM0A 2F18A 3BLBA 2N3KA 3B53X 4AZ6A 3CZNA 3CVRA 2EWFA 1I4TA 3DYTA 2JNKA 3BUIA 3O3MB 2F7PA 2X5CA 3DX3A 1MJGA 5C5BB 2F1AA 4AZCA 1LQ7A 1TQUA 2YIVX 1R5EA 4KIKB 4JNFA 3I39X 3EJPA 2X3XA 2EFKA 4PO2A 3A98A 3KDRA 2OW7A 2YI9A 4NQIA 1W9MA 2ELBA 4EZYA 4JNEA 1GNTA 4JWDA 1DKYA 1R33A 4WPCA 2OZNB 2EFLA 1I4DA 4EZSA 1U00A 1I4LA 4R5JA 1ZWWA 1E1DA 4H6HA 3T49A 4HR1A 3ER9B 3I2WA 3L3PA 2F7OA 3BVXA 4NSWA 2YL6A 4AZCB 2PMRA 3BVUA 2GA9D 4AZHA 3O3NB 3T46A 1TQSA 2NCZA 1OA0A 3CV5A 2JNSA 3EJTA 3D52A 5TKYA
chains in the Genus database with same CATH topology
1SU7A 4IWOA 4R5KA 4IM0A 4FM3A 2YI8A 1GNLA 4B9QA 2GAFD 3ZEDA 4EZNA 4EZRA 3OHXM 4E81A 3D2FA 1DKZA 2PY6A 2LM0A 2WINM 4EZOA 4R5IA 4IM2A 3L3OM 1OAOA 3GI7A 1SUFA 2QFFA 2N3KA 3B53X 4EZXA 5FIGA 2YIBA 2OBMA 4R5GA 2EWFA 4NPHA 3VEAA 3LMFA 3OWGA 2OBLA 3O3MB 4UDYX 2X5CA 4HR1B 1MJGA 3KAWA 1ZYLA 1GN9A 4UDXX 3T47A 4EZVA 1DKXA 4IWQA 2YIVX 3FD9A 4KIKB 3T48A 4D8JA 3KAVA 4IM3A 4JNFA 3I39X 4H6IA 3QNJA 4JLCA 4R5LA 4HYBA 5FLEX 4PO2A 3B51X 2RT6A 3A98A 3DPQA 3QA8A 4EZPA 2ND0A 3B52X 3KDRA 2YI9A 4F00A 1W9MA 3DPOA 4EZYA 5E84A 4JNEA 3VEBA 1GNTA 3ERCC 4JWDA 1DKYA 1OA1A 4M0MA 2YIAA 3C7NA 1E2UA 3VKHA 4EZSA 1U00A 3RV1A 4EZUA 4R5JA 4IWPA 4JWCA 4JN4A 2KHOA 4E3CA 1SU6A 1E1DA 4H6HA 3T49A 3F7WA 4G6QA 4JWIA 4HY9A 2ND1A 4HR1A 3ER9B 1E9VA 2QXLA 1SU8A 4JWEA 4EZZA 3ER8C 4F01A 3T4AG 4KIKA 1JQKA 4IW0A 4EZQA 2EX3B 1UPXA 3O3OB 3I01A 2GA9D 4JL9A 3UITA 4EZWA 3O3NB 3DPPA 3T46A 2NCZA 1OA0A 3D2EA 4EZTA 2JNSA 2Z8YA 3I04A 5TKYA 3RV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR1 B;  4HR1 A; 
#chains in the Genus database with same CATH topology
 2ALW A;  4IM0 A;  4DYL A;  4FM3 A;  3QNI A;  2GAF D;  2FIC A;  3HAH A;  3OHX M;  3D2F A;  2YLL A;  3L3O M;  3GI7 A;  1TQV A;  1SUF A;  2QFF A;  3HAJ A;  4AKV A;  4EZX A;  2FYV A;  4R5G A;  1TQT A;  3Q0K A;  4UDY X;  4HR1 B;  1ZYL A;  1GN9 A;  2Z0V A;  4UDX X;  3T47 A;  4EZV A;  1DKX A;  2OO2 A;  3KAV A;  3M3W A;  2WYI A;  3EJR A;  4FZS A;  2D1L A;  4JLC A;  4HYB A;  4BNE A;  5FLE X;  3B51 X;  3QA8 A;  2ND0 A;  3B52 X;  2ZXQ A;  4F00 A;  3DPO A;  3VEB A;  4M0M A;  3VKH A;  4FZO A;  1HXK A;  3ACO A;  4AVM A;  4E3C A;  3SYV A;  1O7D C;  4G6Q A;  3DX2 A;  2YL8 A;  3QE6 A;  2EX3 B;  3O3O B;  3I01 A;  4EZW A;  3DPP A;  3D2E A;  2X3W A;  1X04 A;  3CKD A;  3I04 A;  2YLA A;  1TQW A;  3BUQ A;  2C08 A;  4EZN A;  3EJQ A;  4E81 A;  2Z0O A;  1DKZ A;  2WIN M;  4EZO A;  4IM2 A;  2Q12 A;  4AZ5 A;  4H8S A;  1HTY A;  2OW6 A;  3LMF A;  1R34 A;  3DX1 A;  1QWU A;  2RAK A;  3D51 A;  2LXY A;  3G9G A;  3T48 A;  4D8J A;  4I1Q A;  4ATM A;  3QNJ A;  4AZB A;  3LVT A;  3BUD A;  3ABH A;  3DX0 A;  4AZG A;  3ERC C;  1I49 A;  3C7N A;  2QKW A;  3RV1 A;  3EJS A;  4IWP A;  4JWC A;  3D4Y A;  2KHO A;  4JN4 A;  1O7D B;  4JWI A;  2ND1 A;  4JWE A;  4AZ7 A;  3DDF A;  5KBP A;  4F01 A;  3D50 A;  1UPX A;  4JL9 A;  3LLL A;  3PLT A;  3DDG A;  4IWO A;  4R5K A;  2YI8 A;  1GNL A;  4B9Q A;  2MI7 A;  4EZR A;  2PY6 A;  2RAI A;  3OK8 A;  4R5I A;  1OAO A;  1QX1 A;  3SOG A;  2GF4 A;  2YKT A;  5FIG A;  2YIB A;  2OBM A;  3CZS A;  2YL9 A;  2V0O A;  2F7R A;  4NPH A;  3VEA A;  3OWG A;  3BUB A;  2OBL A;  3CAZ A;  2Z0N A;  3KAW A;  4WPE A;  4IWQ A;  3FD9 A;  1HWW A;  3BUP A;  2YL5 A;  2WYH A;  4IM3 A;  4H6I A;  4R5L A;  3D4Z A;  3BVT A;  4FZP A;  2D4C A;  2RT6 A;  3DPQ A;  1Y2O A;  4EZP A;  5E84 A;  1OA1 A;  2YIA A;  1X03 A;  1E2U A;  2X3V A;  2RAJ A;  4EZU A;  1URU A;  1SU6 A;  4DCN C;  2F1B A;  3F7W A;  2Q13 A;  3HAI A;  4HY9 A;  1E9V A;  2QXL A;  1SU8 A;  5C5B A;  4EZZ A;  3ER8 C;  3DX4 A;  3EJU A;  3T4A G;  4KIK A;  1JQK A;  3QWE A;  1PS3 A;  1YWM A;  4IW0 A;  4EZQ A;  3UIT A;  3Q84 A;  4EZT A;  2Z8Y A;  3RV0 A;  1SU7 A;  1QWN A;  3RPM A;  1WDZ A;  2O0I 1;  3BVW A;  3BVV A;  3ZED A;  4AZI A;  2F7Q A;  2LM0 A;  2F18 A;  3BLB A;  2N3K A;  3B53 X;  4AZ6 A;  3CZN A;  3CVR A;  2EWF A;  1I4T A;  3DYT A;  2JNK A;  3BUI A;  3O3M B;  2F7P A;  2X5C A;  3DX3 A;  1MJG A;  5C5B B;  2F1A A;  4AZC A;  1LQ7 A;  1TQU A;  2YIV X;  1R5E A;  4KIK B;  4JNF A;  3I39 X;  3EJP A;  2X3X A;  2EFK A;  4PO2 A;  3A98 A;  3KDR A;  2OW7 A;  2YI9 A;  4NQI A;  1W9M A;  2ELB A;  4EZY A;  4JNE A;  1GNT A;  4JWD A;  1DKY A;  1R33 A;  4WPC A;  2OZN B;  2EFL A;  1I4D A;  4EZS A;  1U00 A;  1I4L A;  4R5J A;  1ZWW A;  1E1D A;  4H6H A;  3T49 A;  4HR1 A;  3ER9 B;  3I2W A;  3L3P A;  2F7O A;  3BVX A;  4NSW A;  2YL6 A;  4AZC B;  2PMR A;  3BVU A;  2GA9 D;  4AZH A;  3O3N B;  3T46 A;  1TQS A;  2NCZ A;  1OA0 A;  3CV5 A;  2JNS A;  3EJT A;  3D52 A;  5TKY A; 
#chains in the Genus database with same CATH homology
 1SU7 A;  4IWO A;  4R5K A;  4IM0 A;  4FM3 A;  2YI8 A;  1GNL A;  4B9Q A;  2GAF D;  3ZED A;  4EZN A;  4EZR A;  3OHX M;  4E81 A;  3D2F A;  1DKZ A;  2PY6 A;  2LM0 A;  2WIN M;  4EZO A;  4R5I A;  4IM2 A;  3L3O M;  1OAO A;  3GI7 A;  1SUF A;  2QFF A;  2N3K A;  3B53 X;  4EZX A;  5FIG A;  2YIB A;  2OBM A;  4R5G A;  2EWF A;  4NPH A;  3VEA A;  3LMF A;  3OWG A;  2OBL A;  3O3M B;  4UDY X;  2X5C A;  4HR1 B;  1MJG A;  3KAW A;  1ZYL A;  1GN9 A;  4UDX X;  3T47 A;  4EZV A;  1DKX A;  4IWQ A;  2YIV X;  3FD9 A;  4KIK B;  3T48 A;  4D8J A;  3KAV A;  4IM3 A;  4JNF A;  3I39 X;  4H6I A;  3QNJ A;  4JLC A;  4R5L A;  4HYB A;  5FLE X;  4PO2 A;  3B51 X;  2RT6 A;  3A98 A;  3DPQ A;  3QA8 A;  4EZP A;  2ND0 A;  3B52 X;  3KDR A;  2YI9 A;  4F00 A;  1W9M A;  3DPO A;  4EZY A;  5E84 A;  4JNE A;  3VEB A;  1GNT A;  3ERC C;  4JWD A;  1DKY A;  1OA1 A;  4M0M A;  2YIA A;  3C7N A;  1E2U A;  3VKH A;  4EZS A;  1U00 A;  3RV1 A;  4EZU A;  4R5J A;  4IWP A;  4JWC A;  4JN4 A;  2KHO A;  4E3C A;  1SU6 A;  1E1D A;  4H6H A;  3T49 A;  3F7W A;  4G6Q A;  4JWI A;  4HY9 A;  2ND1 A;  4HR1 A;  3ER9 B;  1E9V A;  2QXL A;  1SU8 A;  4JWE A;  4EZZ A;  3ER8 C;  4F01 A;  3T4A G;  4KIK A;  1JQK A;  4IW0 A;  4EZQ A;  2EX3 B;  1UPX A;  3O3O B;  3I01 A;  2GA9 D;  4JL9 A;  3UIT A;  4EZW A;  3O3N B;  3DPP A;  3T46 A;  2NCZ A;  1OA0 A;  3D2E A;  4EZT A;  2JNS A;  2Z8Y A;  3I04 A;  5TKY A;  3RV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...