4HR6C

Crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
264
structure length
264
Chain Sequence
NECIVETRTTRISGRDALCVDVAGALTSDGSRLILYPCGQQVNQKWTFHSDGTVRSLGKCLATNNSKFGNLVVIYDCSKLAAEDISWDVSVGGTIMNPNYEDLALTSNKATRSTNLTMEVNTYSASQGWRVGNYVQPIIGSIVGLDDMCLEATDGNTNMWLEECVPNKREQSWALYSDGTIRVDDNRELCVTASSSTYDNWKVITILNCDGSNNQRWVFLADGSISTPGNQRLAMDVARSDVDLKKIILHRPHGDLNQQWVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The sequence and structure of snake gourd (Trichosanthes anguina) seed lectin, a three-chain nontoxic homologue of type II RIPs
doi rcsb
molecule keywords LECTIN
molecule tags Sugar binding protein
total genus 76
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2012-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4hr6C01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4hr6C02
3HBWA 1S0GA 3FJBA 4GP3A 2K4AB 1HWNB 3EF2A 3IM5A 4JP0A 3UJ4A 4IZEA 1W3FA 3N7JA 2K8RA 4DEPA 3O5WB 1DZCA 4I4RA 2XOAA 5GAQA 4XFTA 3H6RB 3O3QA 1BARA 2NP0A 3A22A 3AKIA 3N0KA 1YTOA 4D0ZA 4G9NA 4I2SA 5E24E 3RMXA 3P53A 3BAHA 1JT7A 1S0LA 4I4PA 4J2SA 4Z8SB 3AH4A 1V6WA 1T4QA 2D7RA 1V6VA 3B9UA 4LO0C 3IM6A 1JTCA 4LO7C 4HA2A 4LO3A 3O49A 3V0BA 1W3AA 4ZBVB 2RSTA 5D62A 3K1XA 4EEEB 3HN1A 1G9AA 1BFGA 4ENDA 4OEEA 2RG9B 3CU1B 9ILBA 4G9MA 3H6QA 1FMZA 2GO2A 3FJCA 2AAIB 3BA7A 2VXRA 4J23B 1K5VA 2E4MC 3UD9A 4XFSA 2X2SA 3RSJA 3CA0A 2BEAA 3VUOA 31BIA 3PG0A 3FJAA 5FZYA 2Q3NB 4OWKA 1G9CA 4I8MA 2DRYA 1RZOB 3Q7YA 2L5XA 2KLLA 3CA6A 1AXMA 5FZUA 1JLXA 4ZFWB 4P0KA 5EC5A 1TWMA 3FGMA 4JQ0A 1JT5A 2LIQA 2D1ZA 4G6JA 3HOMA 4Q9GA 4IY8A 1EPWA 1ISVA 4Q9PA 1AVUA 1R8OA 2VUAA 3P6IA 5F8WA 2E4MA 2Y9XE 1Z0HA 3O4AA 4II0A 4JKXB 1ISWA 1BLAA 4QD2C 3ILAA 4A7YA 3QYDA 3LLPA 1V6XA 5BP5A 3FJEA 1TFMB 3E8LC 1YYNA 3PUBA 4DCKC 2QN4A 1DFCA 2FGFA 3S8JA 1ISZA 4XKIA 2BEBA 4IQPA 1IJTA 4FVVA 2ZR1B 3P6JA 4LO8B 3PMEA 4GAFA 1WBCA 2VSEA 3Q7WA 1SR4A 4AN7B 4X3AA 5F8SA 3BAUA 1WD3A 4TLPA 3V0BB 3VSZA 2Y9FA 5BQUC 1HWPB 3O4CA 1TWEA 4GP0A 5BVPI 4OEFA 1BLDA 1W3GA 4I4OA 3UD7A 2ERMA 4HR6C 5F90A 8I1BA 3UDAA 2VU9A 1S0CA 3R4UA 2ET2A 4JKQA 1FQ9A 4D0TA 4QKRA 1BFFA 3A07A 3VEQA 1MC9A 3ZXGA 1IILA 1IOBA 2VSAA 3FUQA 2Z48A 3OGFA 3LTQA 3ZC9A 4LO1A 1HCDA 1R8NA 2D7IA 4L4HA 1HWMB 1FV3A 5DSSB 3UD8A 1JT4A 3FJIA 1BFBA 3TC2A 4X38A 2D23A 4I1EA 1SZ6B 2I1BA 3A21A 1XYFA 3H6SE 3A23A 2F8XC 2MC2A 4ZGRB 3OJMA 3I2AA 3WINC 3ZC8A 3I29B 4QKSA 4EKXB 2GZBA 1S0EA 3O44A 1NZKA 4OW4A 1NUNA 4EFRA 2WRYA 1JQZA 3KMVA 3FJFA 1J0SA 1FN0A 4ZFUB 3RTJB 2D22A 4G1RA 2KI6B 2RQ9A 3D7WB 1P63A 1XZZA 3I2XA 4G6MA 1IRPA 1FGAA 3AJ5A 3BTAA 1JY0A 2P23A 4IZXA 2WBCA 3PHZA 3RTIB 1I1BA 4GOYA 4R6UB 4LO2C 1YXWA 1M16A 3CA1A 5HPZA 3VT0A 1V6UA 4I4SA 4IY9A 3VT2A 1DIWA 3N7KA 4LO0A 1XG6A 4IONA 1YBIA 3OBTA 2ZQNA 2VXTI 2F2FC 1DZDA 4I3NA 3BAGA 3WMVA 2HWMA 3V0AB 4QALA 3S8KA 3FJ9A 3NBDA 4I0YA 4X37A 2X2TA 2FO1A 1QQLA 2FDBM 3FUOA 3OGGA 5D63A 2P39A 1T9FA 5BXRA 4GAIA 3NBCA 5BXTA 1I1EA 1K5UA 3BA5A 4EB2B 1AVAC 1G9BA 4I96A 4HJJA 2D24A 4DENA 3BRDA 1BFCA 3WA1A 3CQAA 4ISRA 2J3PA 1FMMS 4F83A 4PC4A 2YUGA 4A7KA 5JLVA 3ZX7A 4X39A 2AXMA 1S0BA 3V79C 1G9DA 2IWTB 3MPPG 2LIEA 1WD4A 1ONKB 3FJ8A 2Z49A 2KKIA 3F62B 3IIRA 4H9WA 2NVHA 3O4BA 1DQGA 2MLLB 3H6RA 3NBEA 3BADA 2NTDA 3BX1C 1BA7A 3RMYA 1DLLA 1Z2VA 3WMUA 3W9TA 3FJJA 1JLYA 1WBAA 2NZ9A 5FNWA 4USOA 1KNMA 5D61A 3IAGC 3BAVA 2KH2A 4OUJA 3CRGA 5BQUA 1Q03A 2BFHA 5EHAA 1AFCA 3VSFA 3CA3A 3AZVA 3Q7XA 1EV2A 1PWAA 3AJ6A 2NM1A 4QBVA 3F1RA 3FJHA 3HSMA 1QQKA 2IHOA 2D20A 4P0LA 1G82A 1ILR1 3N7LA 4KEJA 4QBCA 2AFGA 3AH1A 41BIA 1PC8B 3VT1A 1Q1UA 4Q91A 4H04A 4L4IA 4KC3A 1F31A 3HALA 1ITBA 3CAHA 1AVXB 4ZKTB 2MIBA 4F34A 4I4QA 4QO3A 1FWVA 4J2XA 1DJSB 4KBBA 3BB2A 4I4VA 4QC4A 2DREA 3WINA 5FNXA 2HW9A 4D8HA 4ZLBB 4LO3C 3CA4A 4JAWA 3CRHA 1GGPB 2FFUA 5BOWA 1HWOB 2KI4A 4KEKA 4IYBA 1BASA 4ZA3B 2AQZA 3O4DA 4JPZA 2M49A 2NYYA 4I6IA 3NBNA 5FZZA 21BIA 4WBCA 1A8DA 2Q9XA 1TIEA 1M2TB 3POKA 1DQOA 4IHZA 4CJMA 3QR5A 4ZOTA 5BXPA 1RMLA 3FFZA 1CE7B 3CA5A 2DS0A 6I1BA 1Z4SA 1D0HA 4EFQA 4LO2A 3MALA 4P6AA 1OQLB 1ABRB 3R4SA 1FV2A 2D43A 4AN6A 3BRGC 1AF9A 1RY7A 1EVTA 2QYIB 1TOOA 2F2FA 1TTUA 1L2HA 4ISQA 1PZZA 2HZ9A 4J2YA 4J2KA 4ZFYB 5BP5C 1HCEA 3FJDA 1YF8B 3BAOA 1S0DA 3AH2A 1DFQA 4OWLA 3UJ0A 3VWCA 3OJVA 1PUUB 2R9KB 2FFVA 2Y9WC 3NJ5A 1SR4C 5G00A 5F8YA 1XHBA 4YOLA 3FJKA 4I4XA 3AKHA 4JRAA 4GOVA 1HIBA 5BXSA 5DVHA 3T8SA 3BAQA 2Y9GA 5JMCA 1TP0A 1FWUA 3JRRA 4OWJA 1IHKA 1UPSA 4Z9WB 1HKNA 3SNVA 4LO7B 2ESUA 1RG8A 3O4OA 3HMYA 2ZQOA 4I1BA 3WO4A 4KEIA 2VLCA 1IRAX 4I4UA 2K43A 3IM7A 4I37A 3AZWA 1PUMB 5EG6C 4LO1C 4A7ZA 1QXMA 3AKFA 5DZUA 5B2HA 2DRZA 4FGFA 1ISXA 1CVSA 1E0OA 3JUTA 3C9ZA 3WO2A 4EFPA 3N7MA 5I1BA 4I4YA 2D44A 2UUSA 4I7IA 3ZXDA 1Q04A 4P0JA 3CRIA 1AVWB 2HWAA 1ISYA 1N4KA 1JT3A 3WO3A 1S0FA 3OBRA 3OJ2A 4USPA 3BA4A 5DUYA 4OEGA 7I1BA 1VCLA 3AKGA 3V0AA 3BRFA 1MD6A 1II4A 1IT0A 4QD2B 4XFUA 1EYLA
chains in the Genus database with same CATH superfamily
3HBWA 1S0GA 3FJBA 4GP3A 2K4AB 1HWNB 3EF2A 3IM5A 4JP0A 3UJ4A 4IZEA 1W3FA 3N7JA 2K8RA 4DEPA 3O5WB 1DZCA 4I4RA 2XOAA 5GAQA 4XFTA 3H6RB 3O3QA 1BARA 2NP0A 3A22A 3AKIA 3N0KA 1YTOA 4D0ZA 4G9NA 4I2SA 5E24E 3RMXA 3P53A 3BAHA 1JT7A 1S0LA 4I4PA 4J2SA 4Z8SB 3AH4A 1V6WA 1T4QA 2D7RA 1V6VA 3B9UA 4LO0C 3IM6A 1JTCA 4LO7C 4HA2A 4LO3A 3O49A 3V0BA 1W3AA 4ZBVB 2RSTA 5D62A 3K1XA 4EEEB 3HN1A 1G9AA 1BFGA 4ENDA 4OEEA 2RG9B 3CU1B 9ILBA 4G9MA 3H6QA 1FMZA 2GO2A 3FJCA 2AAIB 3BA7A 2VXRA 4J23B 1K5VA 2E4MC 3UD9A 4XFSA 2X2SA 3RSJA 3CA0A 2BEAA 3VUOA 31BIA 3PG0A 3FJAA 5FZYA 2Q3NB 4OWKA 1G9CA 4I8MA 2DRYA 1RZOB 3Q7YA 2L5XA 2KLLA 3CA6A 1AXMA 5FZUA 1JLXA 4ZFWB 4P0KA 5EC5A 1TWMA 3FGMA 4JQ0A 1JT5A 2LIQA 2D1ZA 4G6JA 3HOMA 4Q9GA 4IY8A 1EPWA 1ISVA 4Q9PA 1AVUA 1R8OA 2VUAA 3P6IA 5F8WA 2E4MA 2Y9XE 1Z0HA 3O4AA 4II0A 4JKXB 1ISWA 1BLAA 4QD2C 3ILAA 4A7YA 4MZHA 3QYDA 3LLPA 1V6XA 5BP5A 3FJEA 1TFMB 3E8LC 1YYNA 3PUBA 4DCKC 2QN4A 1DFCA 2FGFA 3S8JA 1ISZA 4XKIA 2BEBA 4IQPA 1IJTA 4FVVA 2ZR1B 3P6JA 4LO8B 3PMEA 4GAFA 1WBCA 2NS2A 2VSEA 3Q7WA 1SR4A 4AN7B 4X3AA 5F8SA 3BAUA 1WD3A 4TLPA 3V0BB 3VSZA 2Y9FA 5BQUC 1HWPB 3O4CA 1TWEA 4GP0A 5BVPI 4OEFA 1BLDA 1W3GA 4I4OA 3UD7A 2ERMA 4HR6C 5F90A 8I1BA 3UDAA 2VU9A 1S0CA 3R4UA 4H75A 2ET2A 4JKQA 1FQ9A 4D0TA 4QKRA 1BFFA 3A07A 3VEQA 1MC9A 3ZXGA 1IILA 1IOBA 2VSAA 3FUQA 2Z48A 3OGFA 3LTQA 3ZC9A 4LO1A 1HCDA 1R8NA 2D7IA 4L4HA 1HWMB 1FV3A 5DSSB 3UD8A 1JT4A 3FJIA 1BFBA 3TC2A 4X38A 2D23A 4I1EA 1SZ6B 2I1BA 3A21A 1XYFA 3H6SE 3A23A 2F8XC 2MC2A 4ZGRB 3OJMA 3I2AA 3WINC 3ZC8A 3I29B 4QKSA 4EKXB 2GZBA 1S0EA 3O44A 1NZKA 4OW4A 4MZFB 1NUNA 4EFRA 2WRYA 1JQZA 3KMVA 3FJFA 1J0SA 1FN0A 4ZFUB 3RTJB 2D22A 4G1RA 2KI6B 4MZGB 2RQ9A 3D7WB 1P63A 1XZZA 3I2XA 4G6MA 1IRPA 1FGAA 3AJ5A 3BTAA 1JY0A 2P23A 4IZXA 2WBCA 3PHZA 3RTIB 1I1BA 4GOYA 4UY4A 4R6UB 4LO2C 1YXWA 1M16A 3CA1A 5HPZA 3VT0A 1V6UA 4I4SA 4IY9A 3VT2A 1DIWA 3N7KA 4LO0A 1XG6A 4IONA 1YBIA 3OBTA 2ZQNA 2VXTI 2F2FC 1DZDA 4I3NA 3BAGA 3WMVA 2HWMA 3V0AB 4QALA 3S8KA 3FJ9A 3NBDA 4I0YA 4X37A 2X2TA 2FO1A 1QQLA 2FDBM 3FUOA 3OGGA 5D63A 2P39A 1T9FA 5BXRA 4GAIA 3NBCA 5BXTA 1I1EA 1K5UA 3BA5A 4EB2B 1AVAC 1G9BA 4I96A 4HJJA 2D24A 4DENA 3BRDA 1BFCA 3WA1A 3CQAA 4ISRA 2J3PA 1FMMS 4F83A 4PC4A 2YUGA 4A7KA 5JLVA 3ZX7A 4X39A 2AXMA 1S0BA 3V79C 1G9DA 2IWTB 3MPPG 2LIEA 1WD4A 1ONKB 3FJ8A 2Z49A 2KKIA 3F62B 3IIRA 4H9WA 2NVHA 3O4BA 1DQGA 2MLLB 3H6RA 3NBEA 3BADA 2NTDA 3BX1C 1BA7A 3RMYA 1DLLA 1Z2VA 3WMUA 3W9TA 3FJJA 1JLYA 1WBAA 2NZ9A 5FNWA 4USOA 1KNMA 5D61A 3IAGC 3BAVA 2KH2A 4OUJA 3CRGA 5BQUA 1Q03A 2BFHA 5EHAA 1AFCA 3VSFA 3CA3A 3AZVA 3Q7XA 1EV2A 1PWAA 3AJ6A 2NM1A 4QBVA 3F1RA 3FJHA 3HSMA 1QQKA 2IHOA 2D20A 4P0LA 1G82A 1ILR1 3N7LA 4KEJA 4QBCA 2AFGA 3AH1A 41BIA 1PC8B 3VT1A 1Q1UA 4Q91A 4H04A 4L4IA 4KC3A 1F31A 3HALA 1ITBA 3CAHA 1AVXB 4ZKTB 2MIBA 4F34A 4I4QA 4QO3A 1FWVA 4J2XA 1DJSB 4KBBA 3BB2A 4I4VA 4QC4A 2DREA 3WINA 5FNXA 2HW9A 4D8HA 4ZLBB 4LO3C 3CA4A 4JAWA 3CRHA 1GGPB 2FFUA 5BOWA 1HWOB 2KI4A 4KEKA 4IYBA 1BASA 4ZA3B 2AQZA 3O4DA 4JPZA 2M49A 2NYYA 4I6IA 3NBNA 5FZZA 21BIA 4WBCA 1A8DA 2Q9XA 1TIEA 1M2TB 3POKA 1DQOA 4IHZA 4CJMA 3QR5A 4ZOTA 5BXPA 1RMLA 3FFZA 1CE7B 3CA5A 2DS0A 6I1BA 1Z4SA 1D0HA 4EFQA 4LO2A 3MALA 4P6AA 1OQLB 1ABRB 3R4SA 1FV2A 2D43A 4AN6A 3BRGC 1AF9A 1RY7A 1EVTA 2QYIB 1TOOA 2F2FA 1TTUA 1L2HA 4ISQA 1PZZA 2HZ9A 4J2YA 4J2KA 4ZFYB 5BP5C 1HCEA 3FJDA 1YF8B 3BAOA 1S0DA 3AH2A 1DFQA 4OWLA 3UJ0A 3VWCA 3OJVA 1PUUB 2R9KB 2FFVA 2Y9WC 3NJ5A 1SR4C 5G00A 5F8YA 1XHBA 4YOLA 3FJKA 4I4XA 3AKHA 4JRAA 4GOVA 1HIBA 5BXSA 5DVHA 3T8SA 3BAQA 2Y9GA 5JMCA 1TP0A 1FWUA 3JRRA 4OWJA 1IHKA 1UPSA 4Z9WB 1HKNA 3SNVA 4LO7B 2ESUA 1RG8A 3O4OA 3HMYA 2ZQOA 4I1BA 3WO4A 4KEIA 2VLCA 1IRAX 4I4UA 2K43A 3IM7A 4I37A 3AZWA 1PUMB 5EG6C 4LO1C 4A7ZA 1QXMA 3AKFA 5DZUA 5B2HA 2DRZA 4FGFA 1ISXA 1CVSA 1E0OA 3JUTA 3C9ZA 3WO2A 4EFPA 3N7MA 5I1BA 4I4YA 2D44A 2UUSA 4I7IA 3ZXDA 1Q04A 4P0JA 3CRIA 1AVWB 2HWAA 1ISYA 1N4KA 1JT3A 3WO3A 1S0FA 3OBRA 3OJ2A 4USPA 3BA4A 5DUYA 4OEGA 7I1BA 1VCLA 3AKGA 3V0AA 3BRFA 1MD6A 1II4A 1IT0A 4QD2B 4XFUA 1EYLA
chains in the Genus database with same CATH topology
3HBWA 1S0GA 3FJBA 4GP3A 2K4AB 1HWNB 3EF2A 3IM5A 4JP0A 3UJ4A 4IZEA 1W3FA 3N7JA 2K8RA 4DEPA 3O5WB 1DZCA 4I4RA 2XOAA 5GAQA 4XFTA 3H6RB 3O3QA 1BARA 2NP0A 3A22A 3AKIA 3N0KA 1YTOA 4D0ZA 4G9NA 4I2SA 5E24E 3RMXA 3P53A 3BAHA 1JT7A 1S0LA 4I4PA 4J2SA 4Z8SB 3AH4A 1V6WA 1T4QA 2D7RA 1V6VA 3B9UA 4LO0C 3IM6A 1JTCA 4LO7C 4HA2A 4LO3A 3O49A 3V0BA 1W3AA 4ZBVB 2RSTA 5D62A 3K1XA 4EEEB 3HN1A 1G9AA 1BFGA 4ENDA 4OEEA 2RG9B 3CU1B 9ILBA 4G9MA 3H6QA 1FMZA 2GO2A 3FJCA 2AAIB 3BA7A 2VXRA 4J23B 1K5VA 2E4MC 3UD9A 4XFSA 2X2SA 3RSJA 3CA0A 2BEAA 3VUOA 31BIA 3PG0A 3FJAA 5FZYA 2Q3NB 4OWKA 1G9CA 4I8MA 2DRYA 1RZOB 3Q7YA 2L5XA 2KLLA 3CA6A 1AXMA 5FZUA 1JLXA 4ZFWB 4P0KA 5EC5A 1TWMA 3FGMA 4JQ0A 1JT5A 2LIQA 2D1ZA 4G6JA 3HOMA 4Q9GA 4IY8A 1EPWA 1ISVA 4Q9PA 1AVUA 1R8OA 2VUAA 3P6IA 5F8WA 2E4MA 2Y9XE 1Z0HA 3O4AA 4II0A 4JKXB 1ISWA 1BLAA 4QD2C 3ILAA 4A7YA 4MZHA 3QYDA 3LLPA 1V6XA 5BP5A 3FJEA 1TFMB 3E8LC 1YYNA 3PUBA 4DCKC 2QN4A 1DFCA 2FGFA 3S8JA 1ISZA 4XKIA 2BEBA 4IQPA 1IJTA 4FVVA 2ZR1B 3P6JA 4LO8B 3PMEA 4GAFA 1WBCA 2NS2A 2VSEA 3Q7WA 1SR4A 4AN7B 4X3AA 5F8SA 3BAUA 1WD3A 4TLPA 3V0BB 3VSZA 2Y9FA 5BQUC 1HWPB 3O4CA 1TWEA 4GP0A 5BVPI 4OEFA 1BLDA 1W3GA 4I4OA 3UD7A 2ERMA 4HR6C 5F90A 8I1BA 3UDAA 2VU9A 1S0CA 3R4UA 4H75A 2ET2A 4JKQA 1FQ9A 4D0TA 4QKRA 1BFFA 3A07A 3VEQA 1MC9A 3ZXGA 1IILA 1IOBA 2VSAA 3FUQA 2Z48A 3OGFA 3LTQA 3ZC9A 4LO1A 1HCDA 1R8NA 2D7IA 4L4HA 1HWMB 1FV3A 5DSSB 3UD8A 1JT4A 3FJIA 1BFBA 3TC2A 4X38A 2D23A 4I1EA 1SZ6B 2I1BA 3A21A 1XYFA 3H6SE 3A23A 2F8XC 2MC2A 4ZGRB 3OJMA 3I2AA 3WINC 3ZC8A 3I29B 4QKSA 4EKXB 2GZBA 1S0EA 3O44A 1NZKA 4OW4A 4MZFB 1NUNA 4EFRA 2WRYA 1JQZA 3KMVA 3FJFA 1J0SA 1FN0A 4ZFUB 3RTJB 2D22A 4G1RA 2KI6B 4MZGB 2RQ9A 3D7WB 1P63A 1XZZA 3I2XA 4G6MA 1IRPA 1FGAA 3AJ5A 3BTAA 1JY0A 2P23A 4IZXA 2WBCA 3PHZA 3RTIB 1I1BA 4GOYA 4UY4A 4R6UB 4LO2C 1YXWA 1M16A 3CA1A 5HPZA 3VT0A 1V6UA 4I4SA 4IY9A 3VT2A 1DIWA 3N7KA 4LO0A 1XG6A 4IONA 1YBIA 3OBTA 2ZQNA 2VXTI 2F2FC 1DZDA 4I3NA 3BAGA 3WMVA 2HWMA 3V0AB 4QALA 3S8KA 3FJ9A 3NBDA 4I0YA 4X37A 2X2TA 2FO1A 1QQLA 2FDBM 3FUOA 3OGGA 5D63A 2P39A 1T9FA 5BXRA 4GAIA 3NBCA 5BXTA 1I1EA 1K5UA 3BA5A 4EB2B 1AVAC 1G9BA 4I96A 4HJJA 2D24A 4DENA 3BRDA 1BFCA 3WA1A 3CQAA 4ISRA 2J3PA 1FMMS 4F83A 4PC4A 2YUGA 4A7KA 5JLVA 3ZX7A 4X39A 2AXMA 1S0BA 3V79C 1G9DA 2IWTB 3MPPG 2LIEA 1WD4A 1ONKB 3FJ8A 2Z49A 2KKIA 3F62B 3IIRA 4H9WA 2NVHA 3O4BA 1DQGA 2MLLB 3H6RA 3NBEA 3BADA 2NTDA 3BX1C 1BA7A 3RMYA 1DLLA 1Z2VA 3WMUA 3W9TA 3FJJA 1JLYA 1WBAA 2NZ9A 5FNWA 4USOA 1KNMA 5D61A 3IAGC 3BAVA 2KH2A 4OUJA 3CRGA 5BQUA 1Q03A 2BFHA 5EHAA 1AFCA 3VSFA 3CA3A 3AZVA 3Q7XA 1EV2A 1PWAA 3AJ6A 2NM1A 4QBVA 3F1RA 3FJHA 3HSMA 1QQKA 2IHOA 2D20A 4P0LA 1G82A 1ILR1 3N7LA 4KEJA 4QBCA 2AFGA 3AH1A 41BIA 1PC8B 3VT1A 1Q1UA 4Q91A 4H04A 4L4IA 4KC3A 1F31A 3HALA 1ITBA 3CAHA 1AVXB 4ZKTB 2MIBA 4F34A 4I4QA 4QO3A 1FWVA 4J2XA 1DJSB 4KBBA 3BB2A 4I4VA 4QC4A 2DREA 3WINA 5FNXA 2HW9A 4D8HA 4ZLBB 4LO3C 3CA4A 4JAWA 3CRHA 1GGPB 2FFUA 5BOWA 1HWOB 2KI4A 4KEKA 4IYBA 1BASA 4ZA3B 2AQZA 3O4DA 4JPZA 2M49A 2NYYA 4I6IA 3NBNA 5FZZA 21BIA 4WBCA 1A8DA 2Q9XA 1TIEA 1M2TB 3POKA 1DQOA 4IHZA 4CJMA 3QR5A 4ZOTA 5BXPA 1RMLA 3FFZA 1CE7B 3CA5A 2DS0A 6I1BA 1Z4SA 1D0HA 4EFQA 4LO2A 3MALA 4P6AA 1OQLB 1ABRB 3R4SA 1FV2A 2D43A 4AN6A 3BRGC 1AF9A 1RY7A 1EVTA 2QYIB 1TOOA 2F2FA 1TTUA 1L2HA 4ISQA 1PZZA 2HZ9A 4J2YA 4J2KA 4ZFYB 5BP5C 1HCEA 3FJDA 1YF8B 3BAOA 1S0DA 3AH2A 1DFQA 4OWLA 3UJ0A 3VWCA 3OJVA 1PUUB 2R9KB 2FFVA 2Y9WC 3NJ5A 1SR4C 5G00A 5F8YA 1XHBA 4YOLA 3FJKA 4I4XA 3AKHA 4JRAA 4GOVA 1HIBA 5BXSA 5DVHA 3T8SA 3BAQA 2Y9GA 5JMCA 1TP0A 1FWUA 3JRRA 4OWJA 1IHKA 1UPSA 4Z9WB 1HKNA 3SNVA 4LO7B 2ESUA 1RG8A 3O4OA 3HMYA 2ZQOA 4I1BA 3WO4A 4KEIA 2VLCA 1IRAX 4I4UA 2K43A 3IM7A 4I37A 3AZWA 1PUMB 5EG6C 4LO1C 4A7ZA 1QXMA 3AKFA 5DZUA 5B2HA 2DRZA 4FGFA 1ISXA 1CVSA 1E0OA 3JUTA 3C9ZA 3WO2A 4EFPA 3N7MA 5I1BA 4I4YA 2D44A 2UUSA 4I7IA 3ZXDA 1Q04A 4P0JA 3CRIA 1AVWB 2HWAA 1ISYA 1N4KA 1JT3A 3WO3A 1S0FA 3OBRA 3OJ2A 4USPA 3BA4A 5DUYA 4OEGA 7I1BA 1VCLA 3AKGA 3V0AA 3BRFA 1MD6A 1II4A 1IT0A 4QD2B 4XFUA 1EYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HBW A;  1S0G A;  3FJB A;  4GP3 A;  2K4A B;  1HWN B;  3EF2 A;  3IM5 A;  4JP0 A;  3UJ4 A;  4IZE A;  1W3F A;  3N7J A;  2K8R A;  4DEP A;  3O5W B;  1DZC A;  4I4R A;  2XOA A;  5GAQ A;  4XFT A;  3H6R B;  3O3Q A;  1BAR A;  2NP0 A;  3A22 A;  3AKI A;  3N0K A;  1YTO A;  4D0Z A;  4G9N A;  4I2S A;  5E24 E;  3RMX A;  3P53 A;  3BAH A;  1JT7 A;  1S0L A;  4I4P A;  4J2S A;  4Z8S B;  3AH4 A;  1V6W A;  1T4Q A;  2D7R A;  1V6V A;  3B9U A;  4LO0 C;  3IM6 A;  1JTC A;  4LO7 C;  4HA2 A;  4LO3 A;  3O49 A;  3V0B A;  1W3A A;  4ZBV B;  2RST A;  5D62 A;  3K1X A;  4EEE B;  3HN1 A;  1G9A A;  1BFG A;  4END A;  4OEE A;  2RG9 B;  3CU1 B;  9ILB A;  4G9M A;  3H6Q A;  1FMZ A;  2GO2 A;  3FJC A;  2AAI B;  3BA7 A;  2VXR A;  4J23 B;  1K5V A;  2E4M C;  3UD9 A;  4XFS A;  2X2S A;  3RSJ A;  3CA0 A;  2BEA A;  3VUO A;  31BI A;  3PG0 A;  3FJA A;  5FZY A;  2Q3N B;  4OWK A;  1G9C A;  4I8M A;  2DRY A;  1RZO B;  3Q7Y A;  2L5X A;  2KLL A;  3CA6 A;  1AXM A;  5FZU A;  1JLX A;  4ZFW B;  4P0K A;  5EC5 A;  1TWM A;  3FGM A;  4JQ0 A;  1JT5 A;  2LIQ A;  2D1Z A;  4G6J A;  3HOM A;  4Q9G A;  4IY8 A;  1EPW A;  1ISV A;  4Q9P A;  1AVU A;  1R8O A;  2VUA A;  3P6I A;  5F8W A;  2E4M A;  2Y9X E;  1Z0H A;  3O4A A;  4II0 A;  4JKX B;  1ISW A;  1BLA A;  4QD2 C;  3ILA A;  4A7Y A;  3QYD A;  3LLP A;  1V6X A;  5BP5 A;  3FJE A;  1TFM B;  3E8L C;  1YYN A;  3PUB A;  4DCK C;  2QN4 A;  1DFC A;  2FGF A;  3S8J A;  1ISZ A;  4XKI A;  2BEB A;  4IQP A;  1IJT A;  4FVV A;  2ZR1 B;  3P6J A;  4LO8 B;  3PME A;  4GAF A;  1WBC A;  2VSE A;  3Q7W A;  1SR4 A;  4AN7 B;  4X3A A;  5F8S A;  3BAU A;  1WD3 A;  4TLP A;  3V0B B;  3VSZ A;  2Y9F A;  5BQU C;  1HWP B;  3O4C A;  1TWE A;  4GP0 A;  5BVP I;  4OEF A;  1BLD A;  1W3G A;  4I4O A;  3UD7 A;  2ERM A;  4HR6 C;  5F90 A;  8I1B A;  3UDA A;  2VU9 A;  1S0C A;  3R4U A;  2ET2 A;  4JKQ A;  1FQ9 A;  4D0T A;  4QKR A;  1BFF A;  3A07 A;  3VEQ A;  1MC9 A;  3ZXG A;  1IIL A;  1IOB A;  2VSA A;  3FUQ A;  2Z48 A;  3OGF A;  3LTQ A;  3ZC9 A;  4LO1 A;  1HCD A;  1R8N A;  2D7I A;  4L4H A;  1HWM B;  1FV3 A;  5DSS B;  3UD8 A;  1JT4 A;  3FJI A;  1BFB A;  3TC2 A;  4X38 A;  2D23 A;  4I1E A;  1SZ6 B;  2I1B A;  3A21 A;  1XYF A;  3H6S E;  3A23 A;  2F8X C;  2MC2 A;  4ZGR B;  3OJM A;  3I2A A;  3WIN C;  3ZC8 A;  3I29 B;  4QKS A;  4EKX B;  2GZB A;  1S0E A;  3O44 A;  1NZK A;  4OW4 A;  1NUN A;  4EFR A;  2WRY A;  1JQZ A;  3KMV A;  3FJF A;  1J0S A;  1FN0 A;  4ZFU B;  3RTJ B;  2D22 A;  4G1R A;  2KI6 B;  2RQ9 A;  3D7W B;  1P63 A;  1XZZ A;  3I2X A;  4G6M A;  1IRP A;  1FGA A;  3AJ5 A;  3BTA A;  1JY0 A;  2P23 A;  4IZX A;  2WBC A;  3PHZ A;  3RTI B;  1I1B A;  4GOY A;  4R6U B;  4LO2 C;  1YXW A;  1M16 A;  3CA1 A;  5HPZ A;  3VT0 A;  1V6U A;  4I4S A;  4IY9 A;  3VT2 A;  1DIW A;  3N7K A;  4LO0 A;  1XG6 A;  4ION A;  1YBI A;  3OBT A;  2ZQN A;  2VXT I;  2F2F C;  1DZD A;  4I3N A;  3BAG A;  3WMV A;  2HWM A;  3V0A B;  4QAL A;  3S8K A;  3FJ9 A;  3NBD A;  4I0Y A;  4X37 A;  2X2T A;  2FO1 A;  1QQL A;  2FDB M;  3FUO A;  3OGG A;  5D63 A;  2P39 A;  1T9F A;  5BXR A;  4GAI A;  3NBC A;  5BXT A;  1I1E A;  1K5U A;  3BA5 A;  4EB2 B;  1AVA C;  1G9B A;  4I96 A;  4HJJ A;  2D24 A;  4DEN A;  3BRD A;  1BFC A;  3WA1 A;  3CQA A;  4ISR A;  2J3P A;  1FMM S;  4F83 A;  4PC4 A;  2YUG A;  4A7K A;  5JLV A;  3ZX7 A;  4X39 A;  2AXM A;  1S0B A;  3V79 C;  1G9D A;  2IWT B;  3MPP G;  2LIE A;  1WD4 A;  1ONK B;  3FJ8 A;  2Z49 A;  2KKI A;  3F62 B;  3IIR A;  4H9W A;  2NVH A;  3O4B A;  1DQG A;  2MLL B;  3H6R A;  3NBE A;  3BAD A;  2NTD A;  3BX1 C;  1BA7 A;  3RMY A;  1DLL A;  1Z2V A;  3WMU A;  3W9T A;  3FJJ A;  1JLY A;  1WBA A;  2NZ9 A;  5FNW A;  4USO A;  1KNM A;  5D61 A;  3IAG C;  3BAV A;  2KH2 A;  4OUJ A;  3CRG A;  5BQU A;  1Q03 A;  2BFH A;  5EHA A;  1AFC A;  3VSF A;  3CA3 A;  3AZV A;  3Q7X A;  1EV2 A;  1PWA A;  3AJ6 A;  2NM1 A;  4QBV A;  3F1R A;  3FJH A;  3HSM A;  1QQK A;  2IHO A;  2D20 A;  4P0L A;  1G82 A;  1ILR 1;  3N7L A;  4KEJ A;  4QBC A;  2AFG A;  3AH1 A;  41BI A;  1PC8 B;  3VT1 A;  1Q1U A;  4Q91 A;  4H04 A;  4L4I A;  4KC3 A;  1F31 A;  3HAL A;  1ITB A;  3CAH A;  1AVX B;  4ZKT B;  2MIB A;  4F34 A;  4I4Q A;  4QO3 A;  1FWV A;  4J2X A;  1DJS B;  4KBB A;  3BB2 A;  4I4V A;  4QC4 A;  2DRE A;  3WIN A;  5FNX A;  2HW9 A;  4D8H A;  4ZLB B;  4LO3 C;  3CA4 A;  4JAW A;  3CRH A;  1GGP B;  2FFU A;  5BOW A;  1HWO B;  2KI4 A;  4KEK A;  4IYB A;  1BAS A;  4ZA3 B;  2AQZ A;  3O4D A;  4JPZ A;  2M49 A;  2NYY A;  4I6I A;  3NBN A;  5FZZ A;  21BI A;  4WBC A;  1A8D A;  2Q9X A;  1TIE A;  1M2T B;  3POK A;  1DQO A;  4IHZ A;  4CJM A;  3QR5 A;  4ZOT A;  5BXP A;  1RML A;  3FFZ A;  1CE7 B;  3CA5 A;  2DS0 A;  6I1B A;  1Z4S A;  1D0H A;  4EFQ A;  4LO2 A;  3MAL A;  4P6A A;  1OQL B;  1ABR B;  3R4S A;  1FV2 A;  2D43 A;  4AN6 A;  3BRG C;  1AF9 A;  1RY7 A;  1EVT A;  2QYI B;  1TOO A;  2F2F A;  1TTU A;  1L2H A;  4ISQ A;  1PZZ A;  2HZ9 A;  4J2Y A;  4J2K A;  4ZFY B;  5BP5 C;  1HCE A;  3FJD A;  1YF8 B;  3BAO A;  1S0D A;  3AH2 A;  1DFQ A;  4OWL A;  3UJ0 A;  3VWC A;  3OJV A;  1PUU B;  2R9K B;  2FFV A;  2Y9W C;  3NJ5 A;  1SR4 C;  5G00 A;  5F8Y A;  1XHB A;  4YOL A;  3FJK A;  4I4X A;  3AKH A;  4JRA A;  4GOV A;  1HIB A;  5BXS A;  5DVH A;  3T8S A;  3BAQ A;  2Y9G A;  5JMC A;  1TP0 A;  1FWU A;  3JRR A;  4OWJ A;  1IHK A;  1UPS A;  4Z9W B;  1HKN A;  3SNV A;  4LO7 B;  2ESU A;  1RG8 A;  3O4O A;  3HMY A;  2ZQO A;  4I1B A;  3WO4 A;  4KEI A;  2VLC A;  1IRA X;  4I4U A;  2K43 A;  3IM7 A;  4I37 A;  3AZW A;  1PUM B;  5EG6 C;  4LO1 C;  4A7Z A;  1QXM A;  3AKF A;  5DZU A;  5B2H A;  2DRZ A;  4FGF A;  1ISX A;  1CVS A;  1E0O A;  3JUT A;  3C9Z A;  3WO2 A;  4EFP A;  3N7M A;  5I1B A;  4I4Y A;  2D44 A;  2UUS A;  4I7I A;  3ZXD A;  1Q04 A;  4P0J A;  3CRI A;  1AVW B;  2HWA A;  1ISY A;  1N4K A;  1JT3 A;  3WO3 A;  1S0F A;  3OBR A;  3OJ2 A;  4USP A;  3BA4 A;  5DUY A;  4OEG A;  7I1B A;  1VCL A;  3AKG A;  3V0A A;  3BRF A;  1MD6 A;  1II4 A;  1IT0 A;  4QD2 B;  4XFU A;  1EYL A; 
#chains in the Genus database with same CATH topology
 3HBW A;  1S0G A;  3FJB A;  4GP3 A;  2K4A B;  1HWN B;  3EF2 A;  3IM5 A;  4JP0 A;  3UJ4 A;  4IZE A;  1W3F A;  3N7J A;  2K8R A;  4DEP A;  3O5W B;  1DZC A;  4I4R A;  2XOA A;  5GAQ A;  4XFT A;  3H6R B;  3O3Q A;  1BAR A;  2NP0 A;  3A22 A;  3AKI A;  3N0K A;  1YTO A;  4D0Z A;  4G9N A;  4I2S A;  5E24 E;  3RMX A;  3P53 A;  3BAH A;  1JT7 A;  1S0L A;  4I4P A;  4J2S A;  4Z8S B;  3AH4 A;  1V6W A;  1T4Q A;  2D7R A;  1V6V A;  3B9U A;  4LO0 C;  3IM6 A;  1JTC A;  4LO7 C;  4HA2 A;  4LO3 A;  3O49 A;  3V0B A;  1W3A A;  4ZBV B;  2RST A;  5D62 A;  3K1X A;  4EEE B;  3HN1 A;  1G9A A;  1BFG A;  4END A;  4OEE A;  2RG9 B;  3CU1 B;  9ILB A;  4G9M A;  3H6Q A;  1FMZ A;  2GO2 A;  3FJC A;  2AAI B;  3BA7 A;  2VXR A;  4J23 B;  1K5V A;  2E4M C;  3UD9 A;  4XFS A;  2X2S A;  3RSJ A;  3CA0 A;  2BEA A;  3VUO A;  31BI A;  3PG0 A;  3FJA A;  5FZY A;  2Q3N B;  4OWK A;  1G9C A;  4I8M A;  2DRY A;  1RZO B;  3Q7Y A;  2L5X A;  2KLL A;  3CA6 A;  1AXM A;  5FZU A;  1JLX A;  4ZFW B;  4P0K A;  5EC5 A;  1TWM A;  3FGM A;  4JQ0 A;  1JT5 A;  2LIQ A;  2D1Z A;  4G6J A;  3HOM A;  4Q9G A;  4IY8 A;  1EPW A;  1ISV A;  4Q9P A;  1AVU A;  1R8O A;  2VUA A;  3P6I A;  5F8W A;  2E4M A;  2Y9X E;  1Z0H A;  3O4A A;  4II0 A;  4JKX B;  1ISW A;  1BLA A;  4QD2 C;  3ILA A;  4A7Y A;  4MZH A;  3QYD A;  3LLP A;  1V6X A;  5BP5 A;  3FJE A;  1TFM B;  3E8L C;  1YYN A;  3PUB A;  4DCK C;  2QN4 A;  1DFC A;  2FGF A;  3S8J A;  1ISZ A;  4XKI A;  2BEB A;  4IQP A;  1IJT A;  4FVV A;  2ZR1 B;  3P6J A;  4LO8 B;  3PME A;  4GAF A;  1WBC A;  2NS2 A;  2VSE A;  3Q7W A;  1SR4 A;  4AN7 B;  4X3A A;  5F8S A;  3BAU A;  1WD3 A;  4TLP A;  3V0B B;  3VSZ A;  2Y9F A;  5BQU C;  1HWP B;  3O4C A;  1TWE A;  4GP0 A;  5BVP I;  4OEF A;  1BLD A;  1W3G A;  4I4O A;  3UD7 A;  2ERM A;  4HR6 C;  5F90 A;  8I1B A;  3UDA A;  2VU9 A;  1S0C A;  3R4U A;  4H75 A;  2ET2 A;  4JKQ A;  1FQ9 A;  4D0T A;  4QKR A;  1BFF A;  3A07 A;  3VEQ A;  1MC9 A;  3ZXG A;  1IIL A;  1IOB A;  2VSA A;  3FUQ A;  2Z48 A;  3OGF A;  3LTQ A;  3ZC9 A;  4LO1 A;  1HCD A;  1R8N A;  2D7I A;  4L4H A;  1HWM B;  1FV3 A;  5DSS B;  3UD8 A;  1JT4 A;  3FJI A;  1BFB A;  3TC2 A;  4X38 A;  2D23 A;  4I1E A;  1SZ6 B;  2I1B A;  3A21 A;  1XYF A;  3H6S E;  3A23 A;  2F8X C;  2MC2 A;  4ZGR B;  3OJM A;  3I2A A;  3WIN C;  3ZC8 A;  3I29 B;  4QKS A;  4EKX B;  2GZB A;  1S0E A;  3O44 A;  1NZK A;  4OW4 A;  4MZF B;  1NUN A;  4EFR A;  2WRY A;  1JQZ A;  3KMV A;  3FJF A;  1J0S A;  1FN0 A;  4ZFU B;  3RTJ B;  2D22 A;  4G1R A;  2KI6 B;  4MZG B;  2RQ9 A;  3D7W B;  1P63 A;  1XZZ A;  3I2X A;  4G6M A;  1IRP A;  1FGA A;  3AJ5 A;  3BTA A;  1JY0 A;  2P23 A;  4IZX A;  2WBC A;  3PHZ A;  3RTI B;  1I1B A;  4GOY A;  4UY4 A;  4R6U B;  4LO2 C;  1YXW A;  1M16 A;  3CA1 A;  5HPZ A;  3VT0 A;  1V6U A;  4I4S A;  4IY9 A;  3VT2 A;  1DIW A;  3N7K A;  4LO0 A;  1XG6 A;  4ION A;  1YBI A;  3OBT A;  2ZQN A;  2VXT I;  2F2F C;  1DZD A;  4I3N A;  3BAG A;  3WMV A;  2HWM A;  3V0A B;  4QAL A;  3S8K A;  3FJ9 A;  3NBD A;  4I0Y A;  4X37 A;  2X2T A;  2FO1 A;  1QQL A;  2FDB M;  3FUO A;  3OGG A;  5D63 A;  2P39 A;  1T9F A;  5BXR A;  4GAI A;  3NBC A;  5BXT A;  1I1E A;  1K5U A;  3BA5 A;  4EB2 B;  1AVA C;  1G9B A;  4I96 A;  4HJJ A;  2D24 A;  4DEN A;  3BRD A;  1BFC A;  3WA1 A;  3CQA A;  4ISR A;  2J3P A;  1FMM S;  4F83 A;  4PC4 A;  2YUG A;  4A7K A;  5JLV A;  3ZX7 A;  4X39 A;  2AXM A;  1S0B A;  3V79 C;  1G9D A;  2IWT B;  3MPP G;  2LIE A;  1WD4 A;  1ONK B;  3FJ8 A;  2Z49 A;  2KKI A;  3F62 B;  3IIR A;  4H9W A;  2NVH A;  3O4B A;  1DQG A;  2MLL B;  3H6R A;  3NBE A;  3BAD A;  2NTD A;  3BX1 C;  1BA7 A;  3RMY A;  1DLL A;  1Z2V A;  3WMU A;  3W9T A;  3FJJ A;  1JLY A;  1WBA A;  2NZ9 A;  5FNW A;  4USO A;  1KNM A;  5D61 A;  3IAG C;  3BAV A;  2KH2 A;  4OUJ A;  3CRG A;  5BQU A;  1Q03 A;  2BFH A;  5EHA A;  1AFC A;  3VSF A;  3CA3 A;  3AZV A;  3Q7X A;  1EV2 A;  1PWA A;  3AJ6 A;  2NM1 A;  4QBV A;  3F1R A;  3FJH A;  3HSM A;  1QQK A;  2IHO A;  2D20 A;  4P0L A;  1G82 A;  1ILR 1;  3N7L A;  4KEJ A;  4QBC A;  2AFG A;  3AH1 A;  41BI A;  1PC8 B;  3VT1 A;  1Q1U A;  4Q91 A;  4H04 A;  4L4I A;  4KC3 A;  1F31 A;  3HAL A;  1ITB A;  3CAH A;  1AVX B;  4ZKT B;  2MIB A;  4F34 A;  4I4Q A;  4QO3 A;  1FWV A;  4J2X A;  1DJS B;  4KBB A;  3BB2 A;  4I4V A;  4QC4 A;  2DRE A;  3WIN A;  5FNX A;  2HW9 A;  4D8H A;  4ZLB B;  4LO3 C;  3CA4 A;  4JAW A;  3CRH A;  1GGP B;  2FFU A;  5BOW A;  1HWO B;  2KI4 A;  4KEK A;  4IYB A;  1BAS A;  4ZA3 B;  2AQZ A;  3O4D A;  4JPZ A;  2M49 A;  2NYY A;  4I6I A;  3NBN A;  5FZZ A;  21BI A;  4WBC A;  1A8D A;  2Q9X A;  1TIE A;  1M2T B;  3POK A;  1DQO A;  4IHZ A;  4CJM A;  3QR5 A;  4ZOT A;  5BXP A;  1RML A;  3FFZ A;  1CE7 B;  3CA5 A;  2DS0 A;  6I1B A;  1Z4S A;  1D0H A;  4EFQ A;  4LO2 A;  3MAL A;  4P6A A;  1OQL B;  1ABR B;  3R4S A;  1FV2 A;  2D43 A;  4AN6 A;  3BRG C;  1AF9 A;  1RY7 A;  1EVT A;  2QYI B;  1TOO A;  2F2F A;  1TTU A;  1L2H A;  4ISQ A;  1PZZ A;  2HZ9 A;  4J2Y A;  4J2K A;  4ZFY B;  5BP5 C;  1HCE A;  3FJD A;  1YF8 B;  3BAO A;  1S0D A;  3AH2 A;  1DFQ A;  4OWL A;  3UJ0 A;  3VWC A;  3OJV A;  1PUU B;  2R9K B;  2FFV A;  2Y9W C;  3NJ5 A;  1SR4 C;  5G00 A;  5F8Y A;  1XHB A;  4YOL A;  3FJK A;  4I4X A;  3AKH A;  4JRA A;  4GOV A;  1HIB A;  5BXS A;  5DVH A;  3T8S A;  3BAQ A;  2Y9G A;  5JMC A;  1TP0 A;  1FWU A;  3JRR A;  4OWJ A;  1IHK A;  1UPS A;  4Z9W B;  1HKN A;  3SNV A;  4LO7 B;  2ESU A;  1RG8 A;  3O4O A;  3HMY A;  2ZQO A;  4I1B A;  3WO4 A;  4KEI A;  2VLC A;  1IRA X;  4I4U A;  2K43 A;  3IM7 A;  4I37 A;  3AZW A;  1PUM B;  5EG6 C;  4LO1 C;  4A7Z A;  1QXM A;  3AKF A;  5DZU A;  5B2H A;  2DRZ A;  4FGF A;  1ISX A;  1CVS A;  1E0O A;  3JUT A;  3C9Z A;  3WO2 A;  4EFP A;  3N7M A;  5I1B A;  4I4Y A;  2D44 A;  2UUS A;  4I7I A;  3ZXD A;  1Q04 A;  4P0J A;  3CRI A;  1AVW B;  2HWA A;  1ISY A;  1N4K A;  1JT3 A;  3WO3 A;  1S0F A;  3OBR A;  3OJ2 A;  4USP A;  3BA4 A;  5DUY A;  4OEG A;  7I1B A;  1VCL A;  3AKG A;  3V0A A;  3BRF A;  1MD6 A;  1II4 A;  1IT0 A;  4QD2 B;  4XFU A;  1EYL A; 
#chains in the Genus database with same CATH homology
 3HBW A;  1S0G A;  3FJB A;  4GP3 A;  2K4A B;  1HWN B;  3EF2 A;  3IM5 A;  4JP0 A;  3UJ4 A;  4IZE A;  1W3F A;  3N7J A;  2K8R A;  4DEP A;  3O5W B;  1DZC A;  4I4R A;  2XOA A;  5GAQ A;  4XFT A;  3H6R B;  3O3Q A;  1BAR A;  2NP0 A;  3A22 A;  3AKI A;  3N0K A;  1YTO A;  4D0Z A;  4G9N A;  4I2S A;  5E24 E;  3RMX A;  3P53 A;  3BAH A;  1JT7 A;  1S0L A;  4I4P A;  4J2S A;  4Z8S B;  3AH4 A;  1V6W A;  1T4Q A;  2D7R A;  1V6V A;  3B9U A;  4LO0 C;  3IM6 A;  1JTC A;  4LO7 C;  4HA2 A;  4LO3 A;  3O49 A;  3V0B A;  1W3A A;  4ZBV B;  2RST A;  5D62 A;  3K1X A;  4EEE B;  3HN1 A;  1G9A A;  1BFG A;  4END A;  4OEE A;  2RG9 B;  3CU1 B;  9ILB A;  4G9M A;  3H6Q A;  1FMZ A;  2GO2 A;  3FJC A;  2AAI B;  3BA7 A;  2VXR A;  4J23 B;  1K5V A;  2E4M C;  3UD9 A;  4XFS A;  2X2S A;  3RSJ A;  3CA0 A;  2BEA A;  3VUO A;  31BI A;  3PG0 A;  3FJA A;  5FZY A;  2Q3N B;  4OWK A;  1G9C A;  4I8M A;  2DRY A;  1RZO B;  3Q7Y A;  2L5X A;  2KLL A;  3CA6 A;  1AXM A;  5FZU A;  1JLX A;  4ZFW B;  4P0K A;  5EC5 A;  1TWM A;  3FGM A;  4JQ0 A;  1JT5 A;  2LIQ A;  2D1Z A;  4G6J A;  3HOM A;  4Q9G A;  4IY8 A;  1EPW A;  1ISV A;  4Q9P A;  1AVU A;  1R8O A;  2VUA A;  3P6I A;  5F8W A;  2E4M A;  2Y9X E;  1Z0H A;  3O4A A;  4II0 A;  4JKX B;  1ISW A;  1BLA A;  4QD2 C;  3ILA A;  4A7Y A;  4MZH A;  3QYD A;  3LLP A;  1V6X A;  5BP5 A;  3FJE A;  1TFM B;  3E8L C;  1YYN A;  3PUB A;  4DCK C;  2QN4 A;  1DFC A;  2FGF A;  3S8J A;  1ISZ A;  4XKI A;  2BEB A;  4IQP A;  1IJT A;  4FVV A;  2ZR1 B;  3P6J A;  4LO8 B;  3PME A;  4GAF A;  1WBC A;  2NS2 A;  2VSE A;  3Q7W A;  1SR4 A;  4AN7 B;  4X3A A;  5F8S A;  3BAU A;  1WD3 A;  4TLP A;  3V0B B;  3VSZ A;  2Y9F A;  5BQU C;  1HWP B;  3O4C A;  1TWE A;  4GP0 A;  5BVP I;  4OEF A;  1BLD A;  1W3G A;  4I4O A;  3UD7 A;  2ERM A;  4HR6 C;  5F90 A;  8I1B A;  3UDA A;  2VU9 A;  1S0C A;  3R4U A;  4H75 A;  2ET2 A;  4JKQ A;  1FQ9 A;  4D0T A;  4QKR A;  1BFF A;  3A07 A;  3VEQ A;  1MC9 A;  3ZXG A;  1IIL A;  1IOB A;  2VSA A;  3FUQ A;  2Z48 A;  3OGF A;  3LTQ A;  3ZC9 A;  4LO1 A;  1HCD A;  1R8N A;  2D7I A;  4L4H A;  1HWM B;  1FV3 A;  5DSS B;  3UD8 A;  1JT4 A;  3FJI A;  1BFB A;  3TC2 A;  4X38 A;  2D23 A;  4I1E A;  1SZ6 B;  2I1B A;  3A21 A;  1XYF A;  3H6S E;  3A23 A;  2F8X C;  2MC2 A;  4ZGR B;  3OJM A;  3I2A A;  3WIN C;  3ZC8 A;  3I29 B;  4QKS A;  4EKX B;  2GZB A;  1S0E A;  3O44 A;  1NZK A;  4OW4 A;  4MZF B;  1NUN A;  4EFR A;  2WRY A;  1JQZ A;  3KMV A;  3FJF A;  1J0S A;  1FN0 A;  4ZFU B;  3RTJ B;  2D22 A;  4G1R A;  2KI6 B;  4MZG B;  2RQ9 A;  3D7W B;  1P63 A;  1XZZ A;  3I2X A;  4G6M A;  1IRP A;  1FGA A;  3AJ5 A;  3BTA A;  1JY0 A;  2P23 A;  4IZX A;  2WBC A;  3PHZ A;  3RTI B;  1I1B A;  4GOY A;  4UY4 A;  4R6U B;  4LO2 C;  1YXW A;  1M16 A;  3CA1 A;  5HPZ A;  3VT0 A;  1V6U A;  4I4S A;  4IY9 A;  3VT2 A;  1DIW A;  3N7K A;  4LO0 A;  1XG6 A;  4ION A;  1YBI A;  3OBT A;  2ZQN A;  2VXT I;  2F2F C;  1DZD A;  4I3N A;  3BAG A;  3WMV A;  2HWM A;  3V0A B;  4QAL A;  3S8K A;  3FJ9 A;  3NBD A;  4I0Y A;  4X37 A;  2X2T A;  2FO1 A;  1QQL A;  2FDB M;  3FUO A;  3OGG A;  5D63 A;  2P39 A;  1T9F A;  5BXR A;  4GAI A;  3NBC A;  5BXT A;  1I1E A;  1K5U A;  3BA5 A;  4EB2 B;  1AVA C;  1G9B A;  4I96 A;  4HJJ A;  2D24 A;  4DEN A;  3BRD A;  1BFC A;  3WA1 A;  3CQA A;  4ISR A;  2J3P A;  1FMM S;  4F83 A;  4PC4 A;  2YUG A;  4A7K A;  5JLV A;  3ZX7 A;  4X39 A;  2AXM A;  1S0B A;  3V79 C;  1G9D A;  2IWT B;  3MPP G;  2LIE A;  1WD4 A;  1ONK B;  3FJ8 A;  2Z49 A;  2KKI A;  3F62 B;  3IIR A;  4H9W A;  2NVH A;  3O4B A;  1DQG A;  2MLL B;  3H6R A;  3NBE A;  3BAD A;  2NTD A;  3BX1 C;  1BA7 A;  3RMY A;  1DLL A;  1Z2V A;  3WMU A;  3W9T A;  3FJJ A;  1JLY A;  1WBA A;  2NZ9 A;  5FNW A;  4USO A;  1KNM A;  5D61 A;  3IAG C;  3BAV A;  2KH2 A;  4OUJ A;  3CRG A;  5BQU A;  1Q03 A;  2BFH A;  5EHA A;  1AFC A;  3VSF A;  3CA3 A;  3AZV A;  3Q7X A;  1EV2 A;  1PWA A;  3AJ6 A;  2NM1 A;  4QBV A;  3F1R A;  3FJH A;  3HSM A;  1QQK A;  2IHO A;  2D20 A;  4P0L A;  1G82 A;  1ILR 1;  3N7L A;  4KEJ A;  4QBC A;  2AFG A;  3AH1 A;  41BI A;  1PC8 B;  3VT1 A;  1Q1U A;  4Q91 A;  4H04 A;  4L4I A;  4KC3 A;  1F31 A;  3HAL A;  1ITB A;  3CAH A;  1AVX B;  4ZKT B;  2MIB A;  4F34 A;  4I4Q A;  4QO3 A;  1FWV A;  4J2X A;  1DJS B;  4KBB A;  3BB2 A;  4I4V A;  4QC4 A;  2DRE A;  3WIN A;  5FNX A;  2HW9 A;  4D8H A;  4ZLB B;  4LO3 C;  3CA4 A;  4JAW A;  3CRH A;  1GGP B;  2FFU A;  5BOW A;  1HWO B;  2KI4 A;  4KEK A;  4IYB A;  1BAS A;  4ZA3 B;  2AQZ A;  3O4D A;  4JPZ A;  2M49 A;  2NYY A;  4I6I A;  3NBN A;  5FZZ A;  21BI A;  4WBC A;  1A8D A;  2Q9X A;  1TIE A;  1M2T B;  3POK A;  1DQO A;  4IHZ A;  4CJM A;  3QR5 A;  4ZOT A;  5BXP A;  1RML A;  3FFZ A;  1CE7 B;  3CA5 A;  2DS0 A;  6I1B A;  1Z4S A;  1D0H A;  4EFQ A;  4LO2 A;  3MAL A;  4P6A A;  1OQL B;  1ABR B;  3R4S A;  1FV2 A;  2D43 A;  4AN6 A;  3BRG C;  1AF9 A;  1RY7 A;  1EVT A;  2QYI B;  1TOO A;  2F2F A;  1TTU A;  1L2H A;  4ISQ A;  1PZZ A;  2HZ9 A;  4J2Y A;  4J2K A;  4ZFY B;  5BP5 C;  1HCE A;  3FJD A;  1YF8 B;  3BAO A;  1S0D A;  3AH2 A;  1DFQ A;  4OWL A;  3UJ0 A;  3VWC A;  3OJV A;  1PUU B;  2R9K B;  2FFV A;  2Y9W C;  3NJ5 A;  1SR4 C;  5G00 A;  5F8Y A;  1XHB A;  4YOL A;  3FJK A;  4I4X A;  3AKH A;  4JRA A;  4GOV A;  1HIB A;  5BXS A;  5DVH A;  3T8S A;  3BAQ A;  2Y9G A;  5JMC A;  1TP0 A;  1FWU A;  3JRR A;  4OWJ A;  1IHK A;  1UPS A;  4Z9W B;  1HKN A;  3SNV A;  4LO7 B;  2ESU A;  1RG8 A;  3O4O A;  3HMY A;  2ZQO A;  4I1B A;  3WO4 A;  4KEI A;  2VLC A;  1IRA X;  4I4U A;  2K43 A;  3IM7 A;  4I37 A;  3AZW A;  1PUM B;  5EG6 C;  4LO1 C;  4A7Z A;  1QXM A;  3AKF A;  5DZU A;  5B2H A;  2DRZ A;  4FGF A;  1ISX A;  1CVS A;  1E0O A;  3JUT A;  3C9Z A;  3WO2 A;  4EFP A;  3N7M A;  5I1B A;  4I4Y A;  2D44 A;  2UUS A;  4I7I A;  3ZXD A;  1Q04 A;  4P0J A;  3CRI A;  1AVW B;  2HWA A;  1ISY A;  1N4K A;  1JT3 A;  3WO3 A;  1S0F A;  3OBR A;  3OJ2 A;  4USP A;  3BA4 A;  5DUY A;  4OEG A;  7I1B A;  1VCL A;  3AKG A;  3V0A A;  3BRF A;  1MD6 A;  1II4 A;  1IT0 A;  4QD2 B;  4XFU A;  1EYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...